2N05A

Solution structure of the non-phosphorylated n-terminal region of human cysteine string protein (csp)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 5
publication title Phosphorylation of Cysteine String Protein Triggers a Major Conformational Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2n05A00
1WJZA 2QWRB 4J80A 4IT5A 1BQ0A 3APOA 2CTQA 2DN9A 3UO2A 2KQXA 2QWOB 4RWUA 2CTWA 1IURA 2Y4UA 2DMXA 2LO1A 1GH6A 2GUZB 4J7ZA 3UCSC 2CUGA 2Y4TA 1FAFA 2OCHA 1BQZA 2GUZA 2LGWA 2QWPB 2QSAA 3UO3A 3BVOA 2N04A 2EJ7A 2M6YA 3AG7A 2YUAA 1HDJA 1N4CA 2QWQB 1NZ6A 3APQA 2CTRA 1XBLA 2QWNB 1FPOA 2CTPA 2YS8A 2PF4E 2L6LA 2N05A
chains in the Genus database with same CATH superfamily
4JTDB 4DV3O 5KX5B 3SYQA 2DMXA 1E79G 2Q68A 1CXZB 1V9PA 2FYUH 3U11A 3T4ZA 1RSOB 4PI2A 4TUYB 5KAFZ 1AR1B 1BHBA 4DR4B 4NB5A 3RT3C 1N32B 4X1KB 2FMLA 1Q6IA 1E1QG 3L73H 2EZOA 4Q6GA 4IT5A 1R3IC 4DV6O 4LFBO 2IJIA 4DV1B 2GTSA 4LBEC 2X6BA 1XHXA 1CEZA 4JYBA 4YIOA 4UCVA 2UXDB 2Q67A 4DK0A 4UCOA 3JD2A 1Q5OA 1QLEB 3LDCA 1XBLA 3CPWU 1N36O 2Q7GA 2ITDC 3LNNA 1GK9A 3IC7A 5JVDB 4X62B 4FMTA 3K79A 1B6QA 4DR3B 4HAMA 2LO1A 3IGAC 4J7JA 1FAFA 5KX5A 3A8TA 4W4KA 2JEUA 1EN6A 1RSOA 4TUYA 1HNZO 3P30A 2XOKG 2Q7HA 4X1KA 5H2FZ 4PV1B 2EIJB 1DLBA 3CCRV 4AQYB 1IURA 1QBZA 2NN4A 4UVBA 3LSQA 2YIBA 2QA4V 2Z0AA 5A9GA 5BR8O 3JAKA 4IYHA 1MNGA 4O4IB 5GTIZ 3ZHVA 1XQ8A 4LWSB 4JPRA 1KP2A 4IIJB 4X1IB 1WB8A 3TGUH 5L3BA 2HJFC 3OTOB 5JVDA 4QE7A 1I0HA 1WPBA 2RDCA 1JX9A 2RQ6A 3OEHG 2ZM6B 4JI5O 5LGUA 1G6UA 2EULA 4HZ3A 4AI8A 1NTZH 1M57B 3SJCC 2ZNIA 5JJJB 1QNMA 1JVMA 3QO5A 3ML0A 3K5NA 4B3TB 2WAMA 3D3IA 2P5OA 3WU2Z 4XBFA 3DXRB 5IYZB 2LGQA 3BA9A 4NR1A 1Q3EA 1BL8A 2DWEC 2EINC 4O4IA 2UXBO 3W7WA 4LWSA 4IIJA 1K9MW 4BR6A 3B8NA 4X1IA 4GKJB 5L3FA 3C90A 2ADQB 3H01A 3OMIB 4GUNA 2K1EA 2QEXV 3EXAA 2ZR2A 4CH5A 1I5YA 2X6CA 1VQNV 5LHIA 1SESA 2PF4E 4NXNO 1AI6A 4LF5B 1KBHA 2JEXA 3JD0A 2KG7B 4O4LB 3H1KH 1Y74B 3K04A 4DV5B 1THZA 1YTFD 2OWOA 4JI3B 2BTQB 3ASNB 3SJQC 3DXRA 4WFGA 5IYZA 1R6TA 1VF5B 3W7UA 2F66C 3A0HZ 2YDEA 5CA1B 1XI1A 3N2KB 3GWOA 1GMGA 4B08A 1KKCA 4CC5A 1AROP 4YHHO 2Y0IA 2Q7EA 1L0LH 2ZDIA 5LMUO 3LSSA 2DYRC 4QNHB 1TGOA 3SYAA 3G6BA 3APQA 1SF9A 5KAIZ 4DR7B 4PJ0Z 3E86A 5IT9N 1O9HA 1EZVH 3MHSC 2R9AA 1SETA 2JS5A 2VQFB 1BMFG 4X64B 3VQXA 3ETQA 2DYSC 3ABKC 3CXCU 4J7ZA 2KG7A 4O4LA 4WFBV 4JI6B 3JD4A 1Y74A 1SZXA 4GLXA 4J10A 2HP8A 2BTQA 1U97A 3CXHF 3ETEA 4MW3A 4P9PA 1N34O 2ODMA 4LF7B 1VQ8V 4IHJB 4X8AA 3M99B 1WP8A 1HNXO 5CA1A 1FYJA 1NR1A 1R3LC 1XL6A 4MVOA 3L71H 5LA6B 4FK5C 2QWPB 1EM1A 1FFXB 4RUFA 3OR7C 4OGQB 4GX1A 3S3WA 1Q6HA 2EIMB 4KFMA 1YJ9V 1XOUA 3JSNA 4CC6A 4RAIA 4JI8O 1BSMA 1ZSPA 1GRJA 2AHYA 3K9SA 4I9QA 2LW7A 2QSAA 5EIBD 5LHHA 1DTOA 3UKMA 3STZC 4YJ3A 4LH7A 3CRRA 2ZQMA 4L87A 1B04A 4DR2O 1Q43A 1XL4A 3B77A 1R6KA 1DF4A 4IHJA 5JJEB 1ZLZA 2Z5UA 4O4JB 5LA6A 2OIGA 1F51A 1RP3B 5L3DA 2HJDA 3IFXA 2YSUB 1FFXA 1US6A 2QE7G 3ZMTA 1L8DA 2NLJC 4D6TH 1OCCC 3AG3B 4BW5A 3T2MA 1AB3A 4U7OA 2Q6AA 3MD0A 4JI7O 2UUAO 1FJGB 5CBGA 4I7ZB 5JCOA 2PI5A 1N0NA 4KHPB 3AK1A 1OCZC 2RMKB 2ITCC 1IX9A 3LUTB 3AK2A 4CBCA 3U10A 3CCSV 3HKDB 5LGNA 1EZJA 3T1YB 4J9YB 2XNDG 5FPRA 4ZBMA 1ZWIC 2BOCC 2Q0OC 3ZX6A 4JV5B 2L35A 3OT7A 4DXWA 3RYHA 4O4JA 4GKKO 3MAQA 3BVOA 5IWAB 1VQ4V 4LH6A 3I55V 1QLNA 4G27B 2IU0A 3FD9A 4RQEA 3VQYA 2ZE6A 2JS3A 4DV7O 1KUQA 1SRYA 1FXKB 3D3QA 4J9ZB 1S5JA 5LXTB 1PL4A 1XILA 4I4TB 2XUMA 4L8JA 4P9OA 1S5HC 2XAGA 4Z1MG 5L3GA 4AHCA 1QVGU 4U7NA 2HVKC 2HVJC 4DUZB 2HG5C 3HKDA 2P67A 3U0ZA 4LFAO 2MK3A 1JCHA 3ETGA 5KHHA 1AVMA 2IM9A 2R72A 4GT1A 3QNEA 4MVSA 3O65A 4ZHQA 1VQ6V 4YY3O 1HR0O 1XDCA 5B1NA 1NTMH 3RW0A 1G8MA 5EBLC 3B4SA 1Q6UA 3VQVA 4CH6A 4NXMB 3JAMN 1DGSA 1FS0G 2Y48A 3R65A 1GAXA 1KP3A 2XTAA 3BHPA 2DW4A 2ZXWC 1BT8A 4I9WA 1FXKA 2CE4A 2HHHO 1VQLV 2PI4A 5DM6V 3X2QC 1P84F 3KCYA 3ASOC 5LXTA 3SYPA 3UT5B 2V4DA 4JZ2A 3CMAV 4I4TA 4FIPC 2EINB 1B06A 1Y67A 1FPOA 2W6IG 1H2NA 1S77D 1OV9A 3OEEG 3ZHTA 4TSFG 3DC6A 5LP6C 2GDSA 5LYJB 1DK1A 4DR4O 1URFA 1N32O 4NKGB 1HNWO 4ZOLB 1H2KA 4WFFA 1QHTA 2EJRA 4DV1O 4BIOA 3APOA 2B9ZA 4R7CA 1MMMA 2P6JA 4UCUA 3E35A 3FX7A 5H5NA 3K0DA 4CS4A 2UXDO 3RYIB 4MSWC 2UUBB 3CP1A 3H1HH 2D3OW 5LHGA 4FVMA 3HKCB 3QG5A 2LQTA 5H6RA 1VQ9V 3D36C 4F6RB 2XAFA 4A5UB 4X62O 1VP7A 1Q8IA 3L74H 2X7RB 2N05A 4QGPA 4DR3O 2IU3A 4GX0A 5B1BC 2ZD9A 4QE9A 3SJBC 4RWUA 4PDMA 1H8HG 2EX3A 2K9PA 3CC2V 1ZX3A 3K58A 1XMOB 4UCRA 2XAHA 5LBQA 3R66A 5LYJA 3WB1A 2DYRB 3M8AA 4ZOLA 5LL6Y 5EIBC 4PDRA 1EFRG 2WLKA 4AQYO 1N0JA 2WLIA 3CYOA 1K73W 2UXCB 2F95B 2QR4A 3FYEB 1HWYA 2CTWA 5JJNB 2KKWA 3ABKB 2Y0PA 3RYIA 2BSKB 1K7DA 1NT2B 4O2BA 5CB4B 4FLUA 3JSLA 3T1HB 1R1BA 3HKCA 1NZ6A 4H13B 4RUEA 2KSDA 2QWNB 4B3SB 4F6RA 1Y4MA 1I5XA 4JI0B 3JCUZ 3ZJZA 3I5DA 4KL1A 1S76D 2ZM6O 2YXYA 2ATKC 4FLZA 3B09A 4GX2A 4AILC 1M56C 4CZZA 2OT5A 1BE3H 5LOVB 4CS2A 4DRXA 4JI1B 4O4HB 3JAKB 4UCSA 4I5SA 1QR8A 1K5QA 3UQ8A 1PD3A 4B7KA 3ZMSA 4EKWA 2WLJA 1YVWA 3J81N 3ABLC 2IH1C 3JAWB 3LSUA 2DQ3A 4DR1B 1ORQC 5K1PA 3ZHUA 1ZL8B 3OFNG 2BSKA 4RO2A 1K97A 5CB4A 4NTXA 4F6EA 4GKJO 1KYOF 5EBWC 3WB0A 2FL4A 4FFBB 4ZIBA 3K59A 4FLTA 1BGYH 1Y66A 3AG1C 2QM7A 1NI8A 5BMVB 3RN4A 1A32A 2YIDA 1AJNA 4BW9A 1SQPH 1WNSA 3AG4C 3CRCA 1QU7A 4H33A 3H9VA 4KP4A 3ZRVA 3H1IH 4ZI7B 5LOVA 5IE9A 3RYCB 1NS1A 4O4HA 4JASA 2X0LA 1Z5VA 2B5UA 3FB8C 4LF5O 3ZHRA 3E8FA 1RM1B 1NH2D 1FD9A 2QTSA 1OCCB 1PL0A 5KA5A 4DV5O 1SA0B 2YXLA 2HLDG 2ZT9B 5JQGB 3SDLA 1Q81W 4JI3O 1UFIA 2WLMA 3JAWA 2EJ7A 1OCZB 5IY5C 1ZL8A 5CMUA 2AZ0A 1KKDA 3SPGA 1I7FA 1AP5A 2HEPA 5BY1A 1H2GA 2E5LB 1VQPV 1MA1A 3OMAB 1NJIW 1NKDA 4FFBA 4MVZA 5BMVA 1V55C 1LR1A 3KKYA 4DR7O 5AG2A 3RFRA 4NVPA 4LCUC 3E8GA 4ZI7A 1D2DA 3RYCA 3SYCA 2ZE8A 4UB8Z 2RN9A 2VQFO 1V54B 4X64O 1M93A 1WB7A 4MTXA 4DR5B 2ZIOA 2YI9A 1VQ7V 4HNAB 5CA3A 4JI6O 2OIEA 2CK3G 1SA0A 4OX9O 2QKAA 2AXTZ 2WSSG 5JQGA 3WFVA 1G4YB 1IVSA 5IYBO 3CCMV 1N4CA 5IJ0B 1I94O 4GCZA 3ZBHA 3TXQA 1R6NA 1FFTB 3ZRWA 2KQXA 4G2KA 1IDSA 3IJ4A 4X9QA 1IBMB 5EZYA 4NTWA 4JI2B 5HFMA 1NQTA 5KHGA 5K1XA 1GM8A 1YTFB 5BR8B 2Q73A 5TISZ 1DF5A 5FNVB 1F4NA 1SQBH 1RPRA 4FZ0A 5CN0A 3TJTA 3FFQA 1L0NH 1Y6XA 1YJNV 3AK3A 1Q86W 1VF7A 2FB5A 4WFAV 4LR3A 4HNAA 1AP6A 2ZXWB 4LF9O 1IXBA 2GSMB 1AR5A 4UVCA 3OD4A 1EBOA 2ZCEA 3X2QB 4FM2A 2OCCC 3CHXA 3EFFK 4LNUB 5IJ0A 1ENVA 3AG2C 1IBKB 4FLXA 1NVPD 5KUKA 4JI4B 2F4VB 1AI4A 1R3KC 1W59A 2AW9A 2JJ2G 4LFCB 2OCHA 4CH3A 1UPGA 2N04A 1RFYA 1XNRB 4ICGA 4YJ3B 3SGIA 1GN4A 2CTPA 1VF6C 4MS2A 5FNVA 3L70H 3CRQA 2VQEB 2D2CB 1FJGO 5A2QN 1OCOC 4KHPO 3CJHB 1JA8A 1J5EB 3O9OA 1VQKV 1W2BU 1XNQB 2IJKA 4DR6B 4O2AB 4J11A 3QTCA 2EILB 1OHHG 3T1YO 3JATB 4LNUA 3QVNA 1PM9A 3PJSK 3ABUA 3DTUB 2OTLV 1YZBA 2Y4UA 3OGIB 1TAEA 2WLNA 4EB6A 3E2EA 2FKXA 2ADPA 4PA4A 1P7BA 3ZHSA 5B1AC 4FLVA 3G4SV 3CCQV 3SYOA 1YIJV 1SS3A 2X6AA 4UXNA 4DW1A 3K5LA 2XT9A 2F43G 4TOIA 3KG2A 4JYYA 1VQ5V 3A0RA 3RYHB 5EBMC 3CJHA 3JYCA 4F4LA 3TK1A 4KXRA 4WBNB 4UV9A 2E75B 4DUZO 1PKXA 4O2AA 4ZKIA 1O9GA 3HKEB 4DV4O 3JATA 1Y76B 3D36A 2P4VA 2NR5A 3BA8A 3E8HA 2CTQA 1R73A 4JYAB 5J2UB 3FB6C 4K8ZA 5KHKA 3P3NA 3RBZA 1M90W 4WFHA 1M56B 3BAAA 2AHZA 1VMGA 1OCRC 2ETNA 3FB5C 4FLYA 1QQCA 3ZN1A 4LF8B 2CTRA 3CEIA 4TV8B 3N2GB 2R9RB 4TQFA 3ZCCA 2AZ2A 2QWOB 1X4TA 1FXVA 2A3QA 1OJHA 3ABLB 2QM8A 4ZHQB 4K35A 2R9IA 2Y69C 1H2MA 3K06A 1KU9A 4DUYB 1COWG 1W0JG 1PNMA 1M57C 1MZEA 4X65B 4WBNA 2HR3A 2Q5ZA 4DO2A 3HKEA 4G28B 1Y76A 1AJPA 3C3SA 3BEHA 1B3QA 4LF4O 3AG1B 5J2UA 2E74B 2UU9B 3AG4B 2XHBA 1LUVA 1IZ3A 3G67A 1TUBB 1ZAUA 2LW1A 4J7KA 4TV8A 3K5MA 3N2GA 4B3MB 1GM7A 4J80A 5E79Z 2RCVA 5J2TB 1SQVH 1MSDA 1QVFU 5B3SC 1GN3A 1WAZA 2YXHA 2CDYA 1GN2A 2A79B 3CRMA 4QIWF 2GBOA 4BIUA 4BIZA 1BQZA 3KCXA 2DQ0A 2DWDC 3S3XA 2M6YA 1MOFA 2ZINA 2NNUA 1YSCA 4I55B 5IY5B 3J80N 1WN7A 2UUCB 3FB7C 3AEIA 1W0KG 2Q4PA 1VEWA 1E1RG 3OUFA 1XMOO 5C93A 3NR7A 1AI7A 3ZS8C 1K34A 2IBZH 1V55B 3THOA 2F23A 1XMQB 2A0LA 3E83A 2UXCO 1TUBA 1PP9H 1SC5B 3KZIZ 3CC4V 3OGCC 4X1YB 5EK0A 3UO2A 2FTKA 1MZFA 5J2TA 4QPKA 4DV0B 3K03A 1M5IA 3T1HO 2N74A 4JAUA 2MW2B 3ZEDA 2R70A 1HW7A 2BTOA 4RQFA 3JASB 4B3SO 3ABMC 4JI0O 3BRCA 3K08A 1K4CC 1LUWA 4I55A 2WLIB 4PDLA 1PNKA 3CSXA 2DOSA 4GZRB 3A0BZ 4PA7A 1CP9A 4JI1O 4JF3A 1M4UA 2YC0A 4O2BB 1IBLB 5B66Z 1H38A 3JD1A 3CCVV 5DEDA 1WP7A 2F1MA 2WLHA 5DECA 1YDXA 1BHAA 3L72H 4DR1O 2GV9A 2QKCA 4X1YA 5BXZA 1GH6A 3WB2A 1YF2A 3H1JH 4DV2B 4DRXB 1S5LZ 4PDVA 1J95A 3BY6A 2F93B 3OR6C 5H6QA 3M7MX 1JJ2U 4X66B 1M1KW 2WA3A 3D8CA 5B1OA 3K57A 3JASA 4B3RB 2OCCB 1AJQA 3RWRD 2QWRB 2QKSA 2BE3A 5JCOC 4B7EA 1N33B 1QR9A 3A2FA 2DYSB 5IDJA 3ZHQA 3HPLC 5GTHZ 1L1FA 3ZMVA 2HHHB 1JFFB 2JRIA 1HP8A 3CE2A 3LNMB 4XDLA 4EFEA 3OTOO 3OUSA 3B8MA 4Z1VA 2EZPA 4TQDA 3E22B 1OCOB 1TVKA 2PYJA 5IYCO 2EIKC 4FZ1A 3HB3B 1F23A 2P4KA 3FAVB 2P06A 5KLVH 1HDJA 2V1DA 1HNWB 1EN5A 3TCUA 2JGDB 2QTOA 3AG3C 2E5LO 2YIBD 4R8CA 1K4DC 4B3TO 1WPXA 1M9NA 1JJOA 4WF9V 1XHZA 1NU1H 3K5OA 1ROPA 3OE7G 4UB6Z 4GYCB 3JCZA 4H37A 1GTOA 3UO3A 1BZKA 1YI2V 5L3CA 5B1AB 3K9AA 5JWPA 3FKSG 3WG7C 2P22C 4MVMA 1JFFA 4DR5O 5JH7A 4JAAA 4DW0A 4OPAA 2E3CA 4UFZA 4D7SA 3DC5A 1VF6A 5LMNB 3HR0A 2GUZB 1F4MA 2P90A 4LF6B 4K0KB 2VWJA 2JGUA 4YXWG 3E22A 2IJJA 4E2LA 2P7TC 3OAAG 1ZUQA 2QWQB 2W0XA 3FAVA 4WCEV 2LFSA 2JGDA 3MDSA 1NH2B 1NBMG 4DV3B 1FXKC 1IBMO 1S0VA 4JI2O 5CBFA 2OTJV 2IJHA 3J7AU 4PI0A 1YCIA 3EVKA 1OCRB 3RGBA 2JK5C 5F2VO 2YI8A 4X88A 1PNLA 1Q90D 1KQSU 3GWKC 4Q20A 3ZRWB 5EC2C 5ITZB 5FLXN 5H9CA 3QO8A 2Z3YA 1KMIZ 1T5EA 3E8BA 4DV6B 4LFBB 5EZYB 2JJ1G 3VOUA 3IC9A 2GUZA 1Q82W 2ZNJA 2Y69B 2Q9LA 4LP8A 1IBKO 2HFEC 4ABMA 4JI4O 2YIAA 2XASA 2F4VO 3H1LH 1N36B 2QM4A 3JALB 1SZTA 4LFCO 5EC1C 2QGNA 2C2AA 1K33A 1XNRO 1BS3A 1U96A 5KHJA 4FM1A 4UUJC 2DE0X 4LF7O 2PYLA 2VQEO 1HNZB 4MTGA 1WLEA 4U3FH 5GONB 1J5EO 5ITZA 3BFRA 5B3SB 3FYIB 3CD6V 5KMGB 1XNQO 3EHBB 2PGGA 4GX5A 4DR6O 2HKOA 1Z2GA 2VRZA 3E89A 2JDIG 4UVAA 3ETDA 2YS8A 4JAVA 4K8XA 1XEQA 5CA0B 4TV9B 2XAQA 4YIPA 2CAZC 1VQMV 4OXSA 3JALA 4TWKA 1H2SB 5EYPB 1KECA 2UXXA 1JPXA 4FFKA 1TUEB 3SPIA 2W6JG 4BAYA 2YUAA 3F7VC 4H44B 4JI5B 3ASOB 4CS3A 4C7UA 4YJ2B 3CB2A 4MVUA 4MT8A 1KD1W 4QPJA 5GONA 2O57A 4EB6B 1NVPB 4EFBA 4X89A 1SQXH 1D5AA 2CUGA 3MHHC 2PTMA 5KMGA 2H94A 5KHIA 5LP6B 4JYCA 1SKVA 5D5QA 1MABG 5FL7G 4PELA 3RVYA 3ABMB 2A7WA 5D5PA 1K3EA 3JARB 4TT3G 3ZRXA 4JYAO 2UXBB 1P49A 2ZIMA 5KA6A 4IL6Z 5CA0A 4TV9A 2PY5A 2CGOA 1AI5A 3CCEV 3NXSA 3F5TA 5EYPA 4HYOA 3CC7V 1VQOV 2ZE5A 3SR2C 4LF8O 3N27A 2AGAA 4OX9B 2CGNA 3VBBA 3OMNB 4I50B 3QF7A 2QDOA 4MTFA 1I94B 3CRAA 2YEVB 1VIBA 2IW5A 3ZMUA 3SPHA 4YJ2A 4DYLA 3N2KA 5KUMA 3BCCH 4NXNB 5B1BB 1GN6A 4JV5O 1X59A 3I56V 4DUYO 3G6EV 5IWAO 2WA4A 4X65O 5LP6A 2LJ2A 1QLEC 5CBHA 3UM7A 4UCTA 4P2ZA 2M7WA 3JARA 4QJFB 2VWKA 2KB1A 2UU9O 2WWWA 1YXBA 4OPHA 2JVDA 4YHHB 1NTKH 4LF9B 1GKFA 1MSWD 3GVMA 1OZ0A 4KUMA 5LMUB 4B3MO 3ICXA 2EIJC 4I50A 1NR7A 5C8YB 2YEVA 3JD3A 3STLC 3CCLV 1P7GA 2WLLB 1RPOA 2RNBA 4P30A 2A9HA 1XREA 1JOYA 3F5WC 2LP7A 2LGWA 2EIKB 2UUCO 2CH7B 3CCUV 1R3JC 1RM1C 3CCJV 4NXMO 1FXHA 1Z5WA 2ZR3A 3C3TA 1N34B 4XDKA 1SQGA 1HNXB 3RVZA 5IJ9B 3VQWA 2QJ1A 3Q4HB 5B5EZ 3QO7A 1XMQO 2H3OA 4U3JB 4MVRA 5L3EA 1H2LA 4JGSA 2PZSA 1GM9A 4J42A 3WG7B 5LGTA 2BCCH 1UJWB 3CWBH 3G80A 4J41A 4PD4F 4R6ZA 4DV0O 5C8YA 5IYDO 3RYFB 5E1AC 2Q0AA 2WLLA 3T4DA 1P4RA 3OM3B 4JI8B 2E76B 2VS0A 3AG7A 1YEWA 3HKBB 4MW8A 3G71V 2V7QG 2CH7A 1QCEA 1SERA 2EBOA 1V54C 1WA8B 2OYQA 3SPJA 1YJWV 4MVQA 3L75H 4DR2B 1GO3F 3ZRSA 3CMEV 1IBLO 3TETA 3LDEA 2UUBO 1Q7YW 3P3PA 2ZDIC 4BWAA 2RJZA 3PN1A 3B40A 5IJ9A 3L9DA 3Q4HA 2PUSA 1XUQA 4U3JA 3ZN0A 2A06H 3SJAC 3IAYA 3GB7C 1WJZA 1BQ0A 4DV4B 1JR9A 4IGGA 2DN9A 1K92A 4DV2O 5BZBA 4PA6A 3UCSC 2Y4TA 3CS5A 4X66O 3RYFA 4JI7B 2UUAB 2IH3C 3ASNC 1MG1A 4B3RO 1TA8A 2ILMA 3F7YC 3W7XA 1F7YA 3OTFA 4HBNA 5HFLA 2GHYA 3HKBA 2ARHA 2XAJA 3DSQA 1N33O 3ABTA 2ZKOA 1WA8A 1AILA 1PV0A 1YITV 1I08A 5DN6G 2GTAA 4X20B 1SQFA 1BCCH 4NTYA 3B2EE 5FPOA 3ZIAG 4CH4A 4PA3A 4GKKB 4PA9A 2L6LA 4E4EA 1YHQV 2JIZG 1IXMA 1H8EG 1JQ0A 1CPYA 4EEQA 2G38A 4PHZA 4DV7B 4I0XB 4WFEA 4LF4B 3BABA 4R50A 1SQQH 4N23A 5GW7A 2H8PC 2LFRA 3DGEA 2BOBC 1KB9F 1D5NA 4JZGA 2WPDG 2ZE7A 1G1XB 2B1GA 4N21A 2Q8VA 4W4LA 3T1CA 3K0GA 2DJVA 1FKAO 3CX5F 4FPPA 1JMKC 1TVKB 3TXSA 4DK1A 1S72V 4LFAB 4IYIA 4UV8A 1VARA 1AR4A 3SPCA 2EILC 3P32A 1ZTEA 1EN4A 4NYKA 4D7TA 4X20A 2W0FC 3K3WA 4YY3B 2YICA 1HR0B 3UT5A 4MTOA 4JTAB 4LC1A 3W7TA 2EIMC 4XDJA 3OW2U 3AG2B 4FJCC 3ZMZA 5LMNO 1KC8W 4LF6O 1K5SA 1LNQA 4H0LB 4K0KO 4FM0A 2UXNA 1N8RW 2B1IA 4Z2WA 1S3JA 4I0XA 4JTCB 5J9PC 2Q69A 3LDDA 4FLWA 1K8AW 3BPZA 3W7SA 4ASUG 1PPJH 4K3AA 5JH7B
chains in the Genus database with same CATH topology
1WJZA 2QWRB 4J80A 4IT5A 1BQ0A 3APOA 2CTQA 2DN9A 3UO2A 2KQXA 2QWOB 4RWUA 2CTWA 1IURA 2Y4UA 2DMXA 2LO1A 1GH6A 2GUZB 4J7ZA 3UCSC 2CUGA 2Y4TA 1FAFA 2OCHA 1BQZA 2GUZA 2LGWA 2QWPB 2QSAA 3UO3A 3BVOA 2N04A 2EJ7A 2M6YA 3AG7A 2YUAA 1HDJA 1N4CA 2QWQB 1NZ6A 3APQA 2CTRA 1XBLA 2QWNB 1FPOA 2CTPA 2YS8A 2PF4E 2L6LA 2N05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJZ A;  2QWR B;  4J80 A;  4IT5 A;  1BQ0 A;  3APO A;  2CTQ A;  2DN9 A;  3UO2 A;  2KQX A;  2QWO B;  4RWU A;  2CTW A;  1IUR A;  2Y4U A;  2DMX A;  2LO1 A;  1GH6 A;  2GUZ B;  4J7Z A;  3UCS C;  2CUG A;  2Y4T A;  1FAF A;  2OCH A;  1BQZ A;  2GUZ A;  2LGW A;  2QWP B;  2QSA A;  3UO3 A;  3BVO A;  2N04 A;  2EJ7 A;  2M6Y A;  3AG7 A;  2YUA A;  1HDJ A;  1N4C A;  2QWQ B;  1NZ6 A;  3APQ A;  2CTR A;  1XBL A;  2QWN B;  1FPO A;  2CTP A;  2YS8 A;  2PF4 E;  2L6L A;  2N05 A; 
#chains in the Genus database with same CATH topology
 4JTD B;  4DV3 O;  5KX5 B;  3SYQ A;  2DMX A;  1E79 G;  2Q68 A;  1CXZ B;  1V9P A;  2FYU H;  3U11 A;  3T4Z A;  1RSO B;  4PI2 A;  4TUY B;  5KAF Z;  1AR1 B;  1BHB A;  4DR4 B;  4NB5 A;  3RT3 C;  1N32 B;  4X1K B;  2FML A;  1Q6I A;  1E1Q G;  3L73 H;  2EZO A;  4Q6G A;  4IT5 A;  1R3I C;  4DV6 O;  4LFB O;  2IJI A;  4DV1 B;  2GTS A;  4LBE C;  2X6B A;  1XHX A;  1CEZ A;  4JYB A;  4YIO A;  4UCV A;  2UXD B;  2Q67 A;  4DK0 A;  4UCO A;  3JD2 A;  1Q5O A;  1QLE B;  3LDC A;  1XBL A;  3CPW U;  1N36 O;  2Q7G A;  2ITD C;  3LNN A;  1GK9 A;  3IC7 A;  5JVD B;  4X62 B;  4FMT A;  3K79 A;  1B6Q A;  4DR3 B;  4HAM A;  2LO1 A;  3IGA C;  4J7J A;  1FAF A;  5KX5 A;  3A8T A;  4W4K A;  2JEU A;  1EN6 A;  1RSO A;  4TUY A;  1HNZ O;  3P30 A;  2XOK G;  2Q7H A;  4X1K A;  5H2F Z;  4PV1 B;  2EIJ B;  1DLB A;  3CCR V;  4AQY B;  1IUR A;  1QBZ A;  2NN4 A;  4UVB A;  3LSQ A;  2YIB A;  2QA4 V;  2Z0A A;  5A9G A;  5BR8 O;  3JAK A;  4IYH A;  1MNG A;  4O4I B;  5GTI Z;  3ZHV A;  1XQ8 A;  4LWS B;  4JPR A;  1KP2 A;  4IIJ B;  4X1I B;  1WB8 A;  3TGU H;  5L3B A;  2HJF C;  3OTO B;  5JVD A;  4QE7 A;  1I0H A;  1WPB A;  2RDC A;  1JX9 A;  2RQ6 A;  3OEH G;  2ZM6 B;  4JI5 O;  5LGU A;  1G6U A;  2EUL A;  4HZ3 A;  4AI8 A;  1NTZ H;  1M57 B;  3SJC C;  2ZNI A;  5JJJ B;  1QNM A;  1JVM A;  3QO5 A;  3ML0 A;  3K5N A;  4B3T B;  2WAM A;  3D3I A;  2P5O A;  3WU2 Z;  4XBF A;  3DXR B;  5IYZ B;  2LGQ A;  3BA9 A;  4NR1 A;  1Q3E A;  1BL8 A;  2DWE C;  2EIN C;  4O4I A;  2UXB O;  3W7W A;  4LWS A;  4IIJ A;  1K9M W;  4BR6 A;  3B8N A;  4X1I A;  4GKJ B;  5L3F A;  3C90 A;  2ADQ B;  3H01 A;  3OMI B;  4GUN A;  2K1E A;  2QEX V;  3EXA A;  2ZR2 A;  4CH5 A;  1I5Y A;  2X6C A;  1VQN V;  5LHI A;  1SES A;  2PF4 E;  4NXN O;  1AI6 A;  4LF5 B;  1KBH A;  2JEX A;  3JD0 A;  2KG7 B;  4O4L B;  3H1K H;  1Y74 B;  3K04 A;  4DV5 B;  1THZ A;  1YTF D;  2OWO A;  4JI3 B;  2BTQ B;  3ASN B;  3SJQ C;  3DXR A;  4WFG A;  5IYZ A;  1R6T A;  1VF5 B;  3W7U A;  2F66 C;  3A0H Z;  2YDE A;  5CA1 B;  1XI1 A;  3N2K B;  3GWO A;  1GMG A;  4B08 A;  1KKC A;  4CC5 A;  1ARO P;  4YHH O;  2Y0I A;  2Q7E A;  1L0L H;  2ZDI A;  5LMU O;  3LSS A;  2DYR C;  4QNH B;  1TGO A;  3SYA A;  3G6B A;  3APQ A;  1SF9 A;  5KAI Z;  4DR7 B;  4PJ0 Z;  3E86 A;  5IT9 N;  1O9H A;  1EZV H;  3MHS C;  2R9A A;  1SET A;  2JS5 A;  2VQF B;  1BMF G;  4X64 B;  3VQX A;  3ETQ A;  2DYS C;  3ABK C;  3CXC U;  4J7Z A;  2KG7 A;  4O4L A;  4WFB V;  4JI6 B;  3JD4 A;  1Y74 A;  1SZX A;  4GLX A;  4J10 A;  2HP8 A;  2BTQ A;  1U97 A;  3CXH F;  3ETE A;  4MW3 A;  4P9P A;  1N34 O;  2ODM A;  4LF7 B;  1VQ8 V;  4IHJ B;  4X8A A;  3M99 B;  1WP8 A;  1HNX O;  5CA1 A;  1FYJ A;  1NR1 A;  1R3L C;  1XL6 A;  4MVO A;  3L71 H;  5LA6 B;  4FK5 C;  2QWP B;  1EM1 A;  1FFX B;  4RUF A;  3OR7 C;  4OGQ B;  4GX1 A;  3S3W A;  1Q6H A;  2EIM B;  4KFM A;  1YJ9 V;  1XOU A;  3JSN A;  4CC6 A;  4RAI A;  4JI8 O;  1BSM A;  1ZSP A;  1GRJ A;  2AHY A;  3K9S A;  4I9Q A;  2LW7 A;  2QSA A;  5EIB D;  5LHH A;  1DTO A;  3UKM A;  3STZ C;  4YJ3 A;  4LH7 A;  3CRR A;  2ZQM A;  4L87 A;  1B04 A;  4DR2 O;  1Q43 A;  1XL4 A;  3B77 A;  1R6K A;  1DF4 A;  4IHJ A;  5JJE B;  1ZLZ A;  2Z5U A;  4O4J B;  5LA6 A;  2OIG A;  1F51 A;  1RP3 B;  5L3D A;  2HJD A;  3IFX A;  2YSU B;  1FFX A;  1US6 A;  2QE7 G;  3ZMT A;  1L8D A;  2NLJ C;  4D6T H;  1OCC C;  3AG3 B;  4BW5 A;  3T2M A;  1AB3 A;  4U7O A;  2Q6A A;  3MD0 A;  4JI7 O;  2UUA O;  1FJG B;  5CBG A;  4I7Z B;  5JCO A;  2PI5 A;  1N0N A;  4KHP B;  3AK1 A;  1OCZ C;  2RMK B;  2ITC C;  1IX9 A;  3LUT B;  3AK2 A;  4CBC A;  3U10 A;  3CCS V;  3HKD B;  5LGN A;  1EZJ A;  3T1Y B;  4J9Y B;  2XND G;  5FPR A;  4ZBM A;  1ZWI C;  2BOC C;  2Q0O C;  3ZX6 A;  4JV5 B;  2L35 A;  3OT7 A;  4DXW A;  3RYH A;  4O4J A;  4GKK O;  3MAQ A;  3BVO A;  5IWA B;  1VQ4 V;  4LH6 A;  3I55 V;  1QLN A;  4G27 B;  2IU0 A;  3FD9 A;  4RQE A;  3VQY A;  2ZE6 A;  2JS3 A;  4DV7 O;  1KUQ A;  1SRY A;  1FXK B;  3D3Q A;  4J9Z B;  1S5J A;  5LXT B;  1PL4 A;  1XIL A;  4I4T B;  2XUM A;  4L8J A;  4P9O A;  1S5H C;  2XAG A;  4Z1M G;  5L3G A;  4AHC A;  1QVG U;  4U7N A;  2HVK C;  2HVJ C;  4DUZ B;  2HG5 C;  3HKD A;  2P67 A;  3U0Z A;  4LFA O;  2MK3 A;  1JCH A;  3ETG A;  5KHH A;  1AVM A;  2IM9 A;  2R72 A;  4GT1 A;  3QNE A;  4MVS A;  3O65 A;  4ZHQ A;  1VQ6 V;  4YY3 O;  1HR0 O;  1XDC A;  5B1N A;  1NTM H;  3RW0 A;  1G8M A;  5EBL C;  3B4S A;  1Q6U A;  3VQV A;  4CH6 A;  4NXM B;  3JAM N;  1DGS A;  1FS0 G;  2Y48 A;  3R65 A;  1GAX A;  1KP3 A;  2XTA A;  3BHP A;  2DW4 A;  2ZXW C;  1BT8 A;  4I9W A;  1FXK A;  2CE4 A;  2HHH O;  1VQL V;  2PI4 A;  5DM6 V;  3X2Q C;  1P84 F;  3KCY A;  3ASO C;  5LXT A;  3SYP A;  3UT5 B;  2V4D A;  4JZ2 A;  3CMA V;  4I4T A;  4FIP C;  2EIN B;  1B06 A;  1Y67 A;  1FPO A;  2W6I G;  1H2N A;  1S77 D;  1OV9 A;  3OEE G;  3ZHT A;  4TSF G;  3DC6 A;  5LP6 C;  2GDS A;  5LYJ B;  1DK1 A;  4DR4 O;  1URF A;  1N32 O;  4NKG B;  1HNW O;  4ZOL B;  1H2K A;  4WFF A;  1QHT A;  2EJR A;  4DV1 O;  4BIO A;  3APO A;  2B9Z A;  4R7C A;  1MMM A;  2P6J A;  4UCU A;  3E35 A;  3FX7 A;  5H5N A;  3K0D A;  4CS4 A;  2UXD O;  3RYI B;  4MSW C;  2UUB B;  3CP1 A;  3H1H H;  2D3O W;  5LHG A;  4FVM A;  3HKC B;  3QG5 A;  2LQT A;  5H6R A;  1VQ9 V;  3D36 C;  4F6R B;  2XAF A;  4A5U B;  4X62 O;  1VP7 A;  1Q8I A;  3L74 H;  2X7R B;  2N05 A;  4QGP A;  4DR3 O;  2IU3 A;  4GX0 A;  5B1B C;  2ZD9 A;  4QE9 A;  3SJB C;  4RWU A;  4PDM A;  1H8H G;  2EX3 A;  2K9P A;  3CC2 V;  1ZX3 A;  3K58 A;  1XMO B;  4UCR A;  2XAH A;  5LBQ A;  3R66 A;  5LYJ A;  3WB1 A;  2DYR B;  3M8A A;  4ZOL A;  5LL6 Y;  5EIB C;  4PDR A;  1EFR G;  2WLK A;  4AQY O;  1N0J A;  2WLI A;  3CYO A;  1K73 W;  2UXC B;  2F95 B;  2QR4 A;  3FYE B;  1HWY A;  2CTW A;  5JJN B;  2KKW A;  3ABK B;  2Y0P A;  3RYI A;  2BSK B;  1K7D A;  1NT2 B;  4O2B A;  5CB4 B;  4FLU A;  3JSL A;  3T1H B;  1R1B A;  3HKC A;  1NZ6 A;  4H13 B;  4RUE A;  2KSD A;  2QWN B;  4B3S B;  4F6R A;  1Y4M A;  1I5X A;  4JI0 B;  3JCU Z;  3ZJZ A;  3I5D A;  4KL1 A;  1S76 D;  2ZM6 O;  2YXY A;  2ATK C;  4FLZ A;  3B09 A;  4GX2 A;  4AIL C;  1M56 C;  4CZZ A;  2OT5 A;  1BE3 H;  5LOV B;  4CS2 A;  4DRX A;  4JI1 B;  4O4H B;  3JAK B;  4UCS A;  4I5S A;  1QR8 A;  1K5Q A;  3UQ8 A;  1PD3 A;  4B7K A;  3ZMS A;  4EKW A;  2WLJ A;  1YVW A;  3J81 N;  3ABL C;  2IH1 C;  3JAW B;  3LSU A;  2DQ3 A;  4DR1 B;  1ORQ C;  5K1P A;  3ZHU A;  1ZL8 B;  3OFN G;  2BSK A;  4RO2 A;  1K97 A;  5CB4 A;  4NTX A;  4F6E A;  4GKJ O;  1KYO F;  5EBW C;  3WB0 A;  2FL4 A;  4FFB B;  4ZIB A;  3K59 A;  4FLT A;  1BGY H;  1Y66 A;  3AG1 C;  2QM7 A;  1NI8 A;  5BMV B;  3RN4 A;  1A32 A;  2YID A;  1AJN A;  4BW9 A;  1SQP H;  1WNS A;  3AG4 C;  3CRC A;  1QU7 A;  4H33 A;  3H9V A;  4KP4 A;  3ZRV A;  3H1I H;  4ZI7 B;  5LOV A;  5IE9 A;  3RYC B;  1NS1 A;  4O4H A;  4JAS A;  2X0L A;  1Z5V A;  2B5U A;  3FB8 C;  4LF5 O;  3ZHR A;  3E8F A;  1RM1 B;  1NH2 D;  1FD9 A;  2QTS A;  1OCC B;  1PL0 A;  5KA5 A;  4DV5 O;  1SA0 B;  2YXL A;  2HLD G;  2ZT9 B;  5JQG B;  3SDL A;  1Q81 W;  4JI3 O;  1UFI A;  2WLM A;  3JAW A;  2EJ7 A;  1OCZ B;  5IY5 C;  1ZL8 A;  5CMU A;  2AZ0 A;  1KKD A;  3SPG A;  1I7F A;  1AP5 A;  2HEP A;  5BY1 A;  1H2G A;  2E5L B;  1VQP V;  1MA1 A;  3OMA B;  1NJI W;  1NKD A;  4FFB A;  4MVZ A;  5BMV A;  1V55 C;  1LR1 A;  3KKY A;  4DR7 O;  5AG2 A;  3RFR A;  4NVP A;  4LCU C;  3E8G A;  4ZI7 A;  1D2D A;  3RYC A;  3SYC A;  2ZE8 A;  4UB8 Z;  2RN9 A;  2VQF O;  1V54 B;  4X64 O;  1M93 A;  1WB7 A;  4MTX A;  4DR5 B;  2ZIO A;  2YI9 A;  1VQ7 V;  4HNA B;  5CA3 A;  4JI6 O;  2OIE A;  2CK3 G;  1SA0 A;  4OX9 O;  2QKA A;  2AXT Z;  2WSS G;  5JQG A;  3WFV A;  1G4Y B;  1IVS A;  5IYB O;  3CCM V;  1N4C A;  5IJ0 B;  1I94 O;  4GCZ A;  3ZBH A;  3TXQ A;  1R6N A;  1FFT B;  3ZRW A;  2KQX A;  4G2K A;  1IDS A;  3IJ4 A;  4X9Q A;  1IBM B;  5EZY A;  4NTW A;  4JI2 B;  5HFM A;  1NQT A;  5KHG A;  5K1X A;  1GM8 A;  1YTF B;  5BR8 B;  2Q73 A;  5TIS Z;  1DF5 A;  5FNV B;  1F4N A;  1SQB H;  1RPR A;  4FZ0 A;  5CN0 A;  3TJT A;  3FFQ A;  1L0N H;  1Y6X A;  1YJN V;  3AK3 A;  1Q86 W;  1VF7 A;  2FB5 A;  4WFA V;  4LR3 A;  4HNA A;  1AP6 A;  2ZXW B;  4LF9 O;  1IXB A;  2GSM B;  1AR5 A;  4UVC A;  3OD4 A;  1EBO A;  2ZCE A;  3X2Q B;  4FM2 A;  2OCC C;  3CHX A;  3EFF K;  4LNU B;  5IJ0 A;  1ENV A;  3AG2 C;  1IBK B;  4FLX A;  1NVP D;  5KUK A;  4JI4 B;  2F4V B;  1AI4 A;  1R3K C;  1W59 A;  2AW9 A;  2JJ2 G;  4LFC B;  2OCH A;  4CH3 A;  1UPG A;  2N04 A;  1RFY A;  1XNR B;  4ICG A;  4YJ3 B;  3SGI A;  1GN4 A;  2CTP A;  1VF6 C;  4MS2 A;  5FNV A;  3L70 H;  3CRQ A;  2VQE B;  2D2C B;  1FJG O;  5A2Q N;  1OCO C;  4KHP O;  3CJH B;  1JA8 A;  1J5E B;  3O9O A;  1VQK V;  1W2B U;  1XNQ B;  2IJK A;  4DR6 B;  4O2A B;  4J11 A;  3QTC A;  2EIL B;  1OHH G;  3T1Y O;  3JAT B;  4LNU A;  3QVN A;  1PM9 A;  3PJS K;  3ABU A;  3DTU B;  2OTL V;  1YZB A;  2Y4U A;  3OGI B;  1TAE A;  2WLN A;  4EB6 A;  3E2E A;  2FKX A;  2ADP A;  4PA4 A;  1P7B A;  3ZHS A;  5B1A C;  4FLV A;  3G4S V;  3CCQ V;  3SYO A;  1YIJ V;  1SS3 A;  2X6A A;  4UXN A;  4DW1 A;  3K5L A;  2XT9 A;  2F43 G;  4TOI A;  3KG2 A;  4JYY A;  1VQ5 V;  3A0R A;  3RYH B;  5EBM C;  3CJH A;  3JYC A;  4F4L A;  3TK1 A;  4KXR A;  4WBN B;  4UV9 A;  2E75 B;  4DUZ O;  1PKX A;  4O2A A;  4ZKI A;  1O9G A;  3HKE B;  4DV4 O;  3JAT A;  1Y76 B;  3D36 A;  2P4V A;  2NR5 A;  3BA8 A;  3E8H A;  2CTQ A;  1R73 A;  4JYA B;  5J2U B;  3FB6 C;  4K8Z A;  5KHK A;  3P3N A;  3RBZ A;  1M90 W;  4WFH A;  1M56 B;  3BAA A;  2AHZ A;  1VMG A;  1OCR C;  2ETN A;  3FB5 C;  4FLY A;  1QQC A;  3ZN1 A;  4LF8 B;  2CTR A;  3CEI A;  4TV8 B;  3N2G B;  2R9R B;  4TQF A;  3ZCC A;  2AZ2 A;  2QWO B;  1X4T A;  1FXV A;  2A3Q A;  1OJH A;  3ABL B;  2QM8 A;  4ZHQ B;  4K35 A;  2R9I A;  2Y69 C;  1H2M A;  3K06 A;  1KU9 A;  4DUY B;  1COW G;  1W0J G;  1PNM A;  1M57 C;  1MZE A;  4X65 B;  4WBN A;  2HR3 A;  2Q5Z A;  4DO2 A;  3HKE A;  4G28 B;  1Y76 A;  1AJP A;  3C3S A;  3BEH A;  1B3Q A;  4LF4 O;  3AG1 B;  5J2U A;  2E74 B;  2UU9 B;  3AG4 B;  2XHB A;  1LUV A;  1IZ3 A;  3G67 A;  1TUB B;  1ZAU A;  2LW1 A;  4J7K A;  4TV8 A;  3K5M A;  3N2G A;  4B3M B;  1GM7 A;  4J80 A;  5E79 Z;  2RCV A;  5J2T B;  1SQV H;  1MSD A;  1QVF U;  5B3S C;  1GN3 A;  1WAZ A;  2YXH A;  2CDY A;  1GN2 A;  2A79 B;  3CRM A;  4QIW F;  2GBO A;  4BIU A;  4BIZ A;  1BQZ A;  3KCX A;  2DQ0 A;  2DWD C;  3S3X A;  2M6Y A;  1MOF A;  2ZIN A;  2NNU A;  1YSC A;  4I55 B;  5IY5 B;  3J80 N;  1WN7 A;  2UUC B;  3FB7 C;  3AEI A;  1W0K G;  2Q4P A;  1VEW A;  1E1R G;  3OUF A;  1XMO O;  5C93 A;  3NR7 A;  1AI7 A;  3ZS8 C;  1K34 A;  2IBZ H;  1V55 B;  3THO A;  2F23 A;  1XMQ B;  2A0L A;  3E83 A;  2UXC O;  1TUB A;  1PP9 H;  1SC5 B;  3KZI Z;  3CC4 V;  3OGC C;  4X1Y B;  5EK0 A;  3UO2 A;  2FTK A;  1MZF A;  5J2T A;  4QPK A;  4DV0 B;  3K03 A;  1M5I A;  3T1H O;  2N74 A;  4JAU A;  2MW2 B;  3ZED A;  2R70 A;  1HW7 A;  2BTO A;  4RQF A;  3JAS B;  4B3S O;  3ABM C;  4JI0 O;  3BRC A;  3K08 A;  1K4C C;  1LUW A;  4I55 A;  2WLI B;  4PDL A;  1PNK A;  3CSX A;  2DOS A;  4GZR B;  3A0B Z;  4PA7 A;  1CP9 A;  4JI1 O;  4JF3 A;  1M4U A;  2YC0 A;  4O2B B;  1IBL B;  5B66 Z;  1H38 A;  3JD1 A;  3CCV V;  5DED A;  1WP7 A;  2F1M A;  2WLH A;  5DEC A;  1YDX A;  1BHA A;  3L72 H;  4DR1 O;  2GV9 A;  2QKC A;  4X1Y A;  5BXZ A;  1GH6 A;  3WB2 A;  1YF2 A;  3H1J H;  4DV2 B;  4DRX B;  1S5L Z;  4PDV A;  1J95 A;  3BY6 A;  2F93 B;  3OR6 C;  5H6Q A;  3M7M X;  1JJ2 U;  4X66 B;  1M1K W;  2WA3 A;  3D8C A;  5B1O A;  3K57 A;  3JAS A;  4B3R B;  2OCC B;  1AJQ A;  3RWR D;  2QWR B;  2QKS A;  2BE3 A;  5JCO C;  4B7E A;  1N33 B;  1QR9 A;  3A2F A;  2DYS B;  5IDJ A;  3ZHQ A;  3HPL C;  5GTH Z;  1L1F A;  3ZMV A;  2HHH B;  1JFF B;  2JRI A;  1HP8 A;  3CE2 A;  3LNM B;  4XDL A;  4EFE A;  3OTO O;  3OUS A;  3B8M A;  4Z1V A;  2EZP A;  4TQD A;  3E22 B;  1OCO B;  1TVK A;  2PYJ A;  5IYC O;  2EIK C;  4FZ1 A;  3HB3 B;  1F23 A;  2P4K A;  3FAV B;  2P06 A;  5KLV H;  1HDJ A;  2V1D A;  1HNW B;  1EN5 A;  3TCU A;  2JGD B;  2QTO A;  3AG3 C;  2E5L O;  2YIB D;  4R8C A;  1K4D C;  4B3T O;  1WPX A;  1M9N A;  1JJO A;  4WF9 V;  1XHZ A;  1NU1 H;  3K5O A;  1ROP A;  3OE7 G;  4UB6 Z;  4GYC B;  3JCZ A;  4H37 A;  1GTO A;  3UO3 A;  1BZK A;  1YI2 V;  5L3C A;  5B1A B;  3K9A A;  5JWP A;  3FKS G;  3WG7 C;  2P22 C;  4MVM A;  1JFF A;  4DR5 O;  5JH7 A;  4JAA A;  4DW0 A;  4OPA A;  2E3C A;  4UFZ A;  4D7S A;  3DC5 A;  1VF6 A;  5LMN B;  3HR0 A;  2GUZ B;  1F4M A;  2P90 A;  4LF6 B;  4K0K B;  2VWJ A;  2JGU A;  4YXW G;  3E22 A;  2IJJ A;  4E2L A;  2P7T C;  3OAA G;  1ZUQ A;  2QWQ B;  2W0X A;  3FAV A;  4WCE V;  2LFS A;  2JGD A;  3MDS A;  1NH2 B;  1NBM G;  4DV3 B;  1FXK C;  1IBM O;  1S0V A;  4JI2 O;  5CBF A;  2OTJ V;  2IJH A;  3J7A U;  4PI0 A;  1YCI A;  3EVK A;  1OCR B;  3RGB A;  2JK5 C;  5F2V O;  2YI8 A;  4X88 A;  1PNL A;  1Q90 D;  1KQS U;  3GWK C;  4Q20 A;  3ZRW B;  5EC2 C;  5ITZ B;  5FLX N;  5H9C A;  3QO8 A;  2Z3Y A;  1KMI Z;  1T5E A;  3E8B A;  4DV6 B;  4LFB B;  5EZY B;  2JJ1 G;  3VOU A;  3IC9 A;  2GUZ A;  1Q82 W;  2ZNJ A;  2Y69 B;  2Q9L A;  4LP8 A;  1IBK O;  2HFE C;  4ABM A;  4JI4 O;  2YIA A;  2XAS A;  2F4V O;  3H1L H;  1N36 B;  2QM4 A;  3JAL B;  1SZT A;  4LFC O;  5EC1 C;  2QGN A;  2C2A A;  1K33 A;  1XNR O;  1BS3 A;  1U96 A;  5KHJ A;  4FM1 A;  4UUJ C;  2DE0 X;  4LF7 O;  2PYL A;  2VQE O;  1HNZ B;  4MTG A;  1WLE A;  4U3F H;  5GON B;  1J5E O;  5ITZ A;  3BFR A;  5B3S B;  3FYI B;  3CD6 V;  5KMG B;  1XNQ O;  3EHB B;  2PGG A;  4GX5 A;  4DR6 O;  2HKO A;  1Z2G A;  2VRZ A;  3E89 A;  2JDI G;  4UVA A;  3ETD A;  2YS8 A;  4JAV A;  4K8X A;  1XEQ A;  5CA0 B;  4TV9 B;  2XAQ A;  4YIP A;  2CAZ C;  1VQM V;  4OXS A;  3JAL A;  4TWK A;  1H2S B;  5EYP B;  1KEC A;  2UXX A;  1JPX A;  4FFK A;  1TUE B;  3SPI A;  2W6J G;  4BAY A;  2YUA A;  3F7V C;  4H44 B;  4JI5 B;  3ASO B;  4CS3 A;  4C7U A;  4YJ2 B;  3CB2 A;  4MVU A;  4MT8 A;  1KD1 W;  4QPJ A;  5GON A;  2O57 A;  4EB6 B;  1NVP B;  4EFB A;  4X89 A;  1SQX H;  1D5A A;  2CUG A;  3MHH C;  2PTM A;  5KMG A;  2H94 A;  5KHI A;  5LP6 B;  4JYC A;  1SKV A;  5D5Q A;  1MAB G;  5FL7 G;  4PEL A;  3RVY A;  3ABM B;  2A7W A;  5D5P A;  1K3E A;  3JAR B;  4TT3 G;  3ZRX A;  4JYA O;  2UXB B;  1P49 A;  2ZIM A;  5KA6 A;  4IL6 Z;  5CA0 A;  4TV9 A;  2PY5 A;  2CGO A;  1AI5 A;  3CCE V;  3NXS A;  3F5T A;  5EYP A;  4HYO A;  3CC7 V;  1VQO V;  2ZE5 A;  3SR2 C;  4LF8 O;  3N27 A;  2AGA A;  4OX9 B;  2CGN A;  3VBB A;  3OMN B;  4I50 B;  3QF7 A;  2QDO A;  4MTF A;  1I94 B;  3CRA A;  2YEV B;  1VIB A;  2IW5 A;  3ZMU A;  3SPH A;  4YJ2 A;  4DYL A;  3N2K A;  5KUM A;  3BCC H;  4NXN B;  5B1B B;  1GN6 A;  4JV5 O;  1X59 A;  3I56 V;  4DUY O;  3G6E V;  5IWA O;  2WA4 A;  4X65 O;  5LP6 A;  2LJ2 A;  1QLE C;  5CBH A;  3UM7 A;  4UCT A;  4P2Z A;  2M7W A;  3JAR A;  4QJF B;  2VWK A;  2KB1 A;  2UU9 O;  2WWW A;  1YXB A;  4OPH A;  2JVD A;  4YHH B;  1NTK H;  4LF9 B;  1GKF A;  1MSW D;  3GVM A;  1OZ0 A;  4KUM A;  5LMU B;  4B3M O;  3ICX A;  2EIJ C;  4I50 A;  1NR7 A;  5C8Y B;  2YEV A;  3JD3 A;  3STL C;  3CCL V;  1P7G A;  2WLL B;  1RPO A;  2RNB A;  4P30 A;  2A9H A;  1XRE A;  1JOY A;  3F5W C;  2LP7 A;  2LGW A;  2EIK B;  2UUC O;  2CH7 B;  3CCU V;  1R3J C;  1RM1 C;  3CCJ V;  4NXM O;  1FXH A;  1Z5W A;  2ZR3 A;  3C3T A;  1N34 B;  4XDK A;  1SQG A;  1HNX B;  3RVZ A;  5IJ9 B;  3VQW A;  2QJ1 A;  3Q4H B;  5B5E Z;  3QO7 A;  1XMQ O;  2H3O A;  4U3J B;  4MVR A;  5L3E A;  1H2L A;  4JGS A;  2PZS A;  1GM9 A;  4J42 A;  3WG7 B;  5LGT A;  2BCC H;  1UJW B;  3CWB H;  3G80 A;  4J41 A;  4PD4 F;  4R6Z A;  4DV0 O;  5C8Y A;  5IYD O;  3RYF B;  5E1A C;  2Q0A A;  2WLL A;  3T4D A;  1P4R A;  3OM3 B;  4JI8 B;  2E76 B;  2VS0 A;  3AG7 A;  1YEW A;  3HKB B;  4MW8 A;  3G71 V;  2V7Q G;  2CH7 A;  1QCE A;  1SER A;  2EBO A;  1V54 C;  1WA8 B;  2OYQ A;  3SPJ A;  1YJW V;  4MVQ A;  3L75 H;  4DR2 B;  1GO3 F;  3ZRS A;  3CME V;  1IBL O;  3TET A;  3LDE A;  2UUB O;  1Q7Y W;  3P3P A;  2ZDI C;  4BWA A;  2RJZ A;  3PN1 A;  3B40 A;  5IJ9 A;  3L9D A;  3Q4H A;  2PUS A;  1XUQ A;  4U3J A;  3ZN0 A;  2A06 H;  3SJA C;  3IAY A;  3GB7 C;  1WJZ A;  1BQ0 A;  4DV4 B;  1JR9 A;  4IGG A;  2DN9 A;  1K92 A;  4DV2 O;  5BZB A;  4PA6 A;  3UCS C;  2Y4T A;  3CS5 A;  4X66 O;  3RYF A;  4JI7 B;  2UUA B;  2IH3 C;  3ASN C;  1MG1 A;  4B3R O;  1TA8 A;  2ILM A;  3F7Y C;  3W7X A;  1F7Y A;  3OTF A;  4HBN A;  5HFL A;  2GHY A;  3HKB A;  2ARH A;  2XAJ A;  3DSQ A;  1N33 O;  3ABT A;  2ZKO A;  1WA8 A;  1AIL A;  1PV0 A;  1YIT V;  1I08 A;  5DN6 G;  2GTA A;  4X20 B;  1SQF A;  1BCC H;  4NTY A;  3B2E E;  5FPO A;  3ZIA G;  4CH4 A;  4PA3 A;  4GKK B;  4PA9 A;  2L6L A;  4E4E A;  1YHQ V;  2JIZ G;  1IXM A;  1H8E G;  1JQ0 A;  1CPY A;  4EEQ A;  2G38 A;  4PHZ A;  4DV7 B;  4I0X B;  4WFE A;  4LF4 B;  3BAB A;  4R50 A;  1SQQ H;  4N23 A;  5GW7 A;  2H8P C;  2LFR A;  3DGE A;  2BOB C;  1KB9 F;  1D5N A;  4JZG A;  2WPD G;  2ZE7 A;  1G1X B;  2B1G A;  4N21 A;  2Q8V A;  4W4L A;  3T1C A;  3K0G A;  2DJV A;  1FKA O;  3CX5 F;  4FPP A;  1JMK C;  1TVK B;  3TXS A;  4DK1 A;  1S72 V;  4LFA B;  4IYI A;  4UV8 A;  1VAR A;  1AR4 A;  3SPC A;  2EIL C;  3P32 A;  1ZTE A;  1EN4 A;  4NYK A;  4D7T A;  4X20 A;  2W0F C;  3K3W A;  4YY3 B;  2YIC A;  1HR0 B;  3UT5 A;  4MTO A;  4JTA B;  4LC1 A;  3W7T A;  2EIM C;  4XDJ A;  3OW2 U;  3AG2 B;  4FJC C;  3ZMZ A;  5LMN O;  1KC8 W;  4LF6 O;  1K5S A;  1LNQ A;  4H0L B;  4K0K O;  4FM0 A;  2UXN A;  1N8R W;  2B1I A;  4Z2W A;  1S3J A;  4I0X A;  4JTC B;  5J9P C;  2Q69 A;  3LDD A;  4FLW A;  1K8A W;  3BPZ A;  3W7S A;  4ASU G;  1PPJ H;  4K3A A;  5JH7 B; 
#chains in the Genus database with same CATH homology
 1WJZ A;  2QWR B;  4J80 A;  4IT5 A;  1BQ0 A;  3APO A;  2CTQ A;  2DN9 A;  3UO2 A;  2KQX A;  2QWO B;  4RWU A;  2CTW A;  1IUR A;  2Y4U A;  2DMX A;  2LO1 A;  1GH6 A;  2GUZ B;  4J7Z A;  3UCS C;  2CUG A;  2Y4T A;  1FAF A;  2OCH A;  1BQZ A;  2GUZ A;  2LGW A;  2QWP B;  2QSA A;  3UO3 A;  3BVO A;  2N04 A;  2EJ7 A;  2M6Y A;  3AG7 A;  2YUA A;  1HDJ A;  1N4C A;  2QWQ B;  1NZ6 A;  3APQ A;  2CTR A;  1XBL A;  2QWN B;  1FPO A;  2CTP A;  2YS8 A;  2PF4 E;  2L6L A;  2N05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...