2N05A

Solution structure of the non-phosphorylated n-terminal region of human cysteine string protein (csp)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'MRSPGMADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 5
publication title Phosphorylation of Cysteine String Protein Triggers a Major Conformational Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2n05A00
2L6LA 2PF4E 2CUGA 1FAFA 2CTQA 2EJ7A 2QWOB 3BVOA 1WJZA 2GUZA 2OCHA 2N05A 2YS8A 4J7ZA 3APQA 2DMXA 3APOA 2LGWA 2QWNB 2Y4UA 2Y4TA 2N04A 1GH6A 1NZ6A 2CTWA 2QWPB 2GUZB 2DN9A 2M6YA 3UO3A 2QWRB 1IURA 1HDJA 1FPOA 2LO1A 3AG7A 4IT5A 2YUAA 2CTPA 2KQXA 4RWUA 2QWQB 1BQZA 2CTRA 1XBLA 3UCSC 3UO2A 2QSAA 1BQ0A 1N4CA 4J80A
chains in the Genus database with same CATH superfamily
2JK5C 2EULA 2HEPA 3RYHB 1W0JG 4JYYA 3ABUA 2HLDG 4UFZA 1QR8A 3AG2B 3LSSA 2KQXA 3FB7C 1OCCB 3L75H 2NNUA 2KG7B 1RM1B 4MTFA 3ZMZA 2N74A 3BFRA 1NH2D 4FK5C 4CH6A 2UU9B 1G6UA 1PD3A 1L1FA 3ASOC 2ATKC 1NTZH 2DMXA 5KUMA 4LF7O 5LXTB 2DWEC 3W7XA 2UXCB 1SS3A 4B3MO 3ZRVA 3RVZA 1PM9A 4U3JA 1G8MA 3T4ZA 4DV1B 5D5QA 1H8HG 3WB1A 4X88A 2L35A 2EJRA 3TXSA 1RPOA 2OCHA 1Q90D 4DV2B 4XDJA 3JD2A 4X1KA 5LP6C 1NZ6A 1VMGA 1YF2A 3G4SV 3E89A 5IWAO 3OUFA 3TETA 3RT3C 1H2SB 3H1IH 2PF4E 1GN4A 3ZHVA 5CA3A 3K57A 4DV6O 3RGBA 2PY5A 4O4HA 3AEIA 1XNRO 4MSWC 2QM4A 3ZHQA 4DRXB 1VQ7V 3TGUH 1QHTA 1T5EA 1H2MA 1MNGA 4MW3A 2QJ1A 4QPKA 3OM3B 3TXQA 4ZOLA 4AILC 1WPBA 5KUKA 1HP8A 2YI8A 2XAJA 2E5LB 2FMLA 3ZHSA 3TCUA 3EFFK 1NR1A 4WBNA 3HR0A 3FYEB 3HPLC 1MG1A 5KHGA 1FFTB 3ML0A 1KKCA 1WA8A 4R6ZA 2UXXA 3E22B 4LF8B 2UU9O 4J10A 1A32A 4ZI7A 3G6BA 2C2AA 2DW4A 2JEUA 2CGNA 4LCUC 1V54C 4I9WA 4DR7B 1FXVA 5EK0A 3U11A 4YJ3B 1S3JA 5J2UA 4DV1O 1NQTA 1JCHA 3CX5F 4NTWA 3AK1A 4QE9A 3CCMV 3ICXA 4X1YB 3TJTA 4DV2O 1AI6A 5L3DA 2P4VA 2Q0OC 1I5XA 5EBLC 1PP9H 3E8BA 3E35A 4MVMA 3AK2A 2WLHA 2R72A 3KCYA 5LHIA 2RCVA 4RWUA 1F4MA 4PD4F 1KB9F 4KL1A 2XT9A 5EIBD 3FD9A 3HKDA 3IGAC 1V55B 1I08A 3MHHC 2ZT9B 4UVBA 2CGOA 4RO2A 5LGNA 2E5LO 5KA6A 4CS4A 3HKCB 1R3KC 4X66B 3X2QB 2ZR2A 1JA8A 4MVOA 2VQFB 1ZAUA 2UUAO 1FAFA 1XHZA 3D36A 2NR5A 4X8AA 1MSWD 5GONB 2XASA 4MVSA 4LF8O 3CEIA 4E4EA 5IJ9A 3QO7A 4TV8B 3I55V 2AHZA 2CK3G 5EBWC 4I50B 5D5PA 3OTFA 4KP4A 4PELA 4DR7O 4DR4B 2JJ1G 3IC9A 2KSDA 3CJHB 4EFBA 2BTQA 2QWOB 1KU9A 1AJNA 3DC6A 4K8XA 2ZCEA 1FD9A 1HNWB 1M1KW 2IJJA 2Q69A 1N36B 4LFAB 4UV9A 1DF5A 1GTOA 2XAFA 2IU3A 3VQWA 4LBEC 1AP5A 1SQFA 4AI8A 3RYIB 1HWYA 3MHSC 4I0XB 3K9AA 4LNUB 2QGNA 2DQ0A 3UT5B 3JAWB 4O4JB 4PA4A 3P30A 1FJGB 2GTSA 1JVMA 2AGAA 2HHHB 3T1YB 4BR6A 1RFYA 3P3PA 3W7UA 1M9NA 4JYAB 1IVSA 2IH3C 1K8AW 4UCUA 2BCCH 3A2FA 2CUGA 2GHYA 2A06H 5EBMC 4G27B 5CN0A 4O2BB 1R73A 1W2BU 3I5DA 1F23A 1DF4A 1WPXA 1OHHG 2YEVB 4X66O 4X64B 5IYDO 1U97A 3STZC 4LH6A 1EFRG 4H0LB 2VQFO 5JVDA 3ETEA 3AG7A 3LSUA 2WLLB 4YIOA 2R9IA 3MDSA 3H1JH 2QSAA 1BHAA 5IYZB 1FXKB 4I4TA 1UFIA 1NS1A 4NTXA 2FB5A 3RYCB 4TUYA 4HAMA 4DR4O 2GSMB 3SJBC 3VBBA 5A9GA 3BA9A 1BL8A 1US6A 3H1KH 1B3QA 4DW1A 4DV3B 1VF6C 3K08A 3RYHA 4UVCA 3VQYA 1HNWO 1EN6A 2AZ0A 1G1XB 1K5SA 1N36O 4LFAO 1M4UA 5L3BA 5CB4B 1G4YB 3APQA 2KKWA 1GRJA 2ZKOA 1GH6A 2EIMC 2GUZB 3KZIZ 4GCZA 4O4LB 3G67A 5H6RA 2LP7A 1VQLV 4DV7B 4UV8A 5IYBO 3G6EV 4ABMA 1FJGO 3ASOB 2HHHO 1YJNV 2DE0X 3H1HH 3T1YO 4MTGA 4CH5A 2P06A 3ZMSA 1JPXA 4P9PA 4JYAO 4PA9A 5GTIZ 3SYAA 1IX9A 4H44B 3LDCA 4OXSA 4LWSA 1ZLZA 3L9DA 3QVNA 2ZIOA 1YIJV 3QTCA 4X64O 2EILC 3R66A 3NXSA 3N27A 3ZHRA 3WU2Z 3ZMTA 2IH1C 4JI8B 2HKOA 2G38A 5LP6B 1J95A 2VRZA 2CTWA 1Q5OA 4PHZA 2LW7A 1R6KA 1WP7A 2QWRB 2Q9LA 2X6AA 1GN6A 3QO5A 1XEQA 4UCOA 3UQ8A 1JJOA 2CTQA 3E8HA 1E79G 2PYLA 4K0KB 1L8DA 2F23A 4DV3O 2XAHA 2MK3A 1K3EA 4CC5A 4RUFA 1IDSA 3K5NA 4MVUA 2YS8A 5FNVB 3CP1A 5KMGB 1GN3A 5IY5C 1P7BA 3JASB 4Z2WA 1YVWA 3E8GA 2ZDIC 1GKFA 2BE3A 2JEXA 5KHHA 3DC5A 4FIPC 1KC8W 4B08A 1OCRC 4I5SA 4JGSA 4DK0A 2QE7G 5CBFA 1DGSA 1Q6IA 3RN4A 1NR7A 3T4DA 2BOCC 2XUMA 4DV7O 5CMUA 1WP8A 1XNQB 1AJPA 5KX5A 2WLIA 5B3SC 4X1IB 2JJ2G 2QDOA 1Z2GA 2XAQA 2RDCA 4CS2A 4LFCB 1V54B 4EKWA 2V7QG 4CC6A 3MD0A 4AHCA 5LYJA 3W7WA 4TV9B 3CXHF 3A0BZ 3D3QA 4I7ZB 2DJVA 4TQDA 2W6JG 3C3TA 4GX1A 4J9ZB 4JI8O 2MW2B 3UO2A 4J80A 3AK3A 3N2KA 4LC1A 3BPZA 3OEEG 3KCXA 4PA7A 5JJJB 3GB7C 3OAAG 1IBLO 1EN5A 1X4TA 2GDSA 1VP7A 3A8TA 3JD1A 4WFBV 1WN7A 4IGGA 1M93A 1PL0A 1VIBA 4K0KO 3CHXA 4PA3A 3L70H 4IYIA 2UUBB 4F6RB 1JJ2U 1QU7A 4FM1A 4DR1B 3SJAC 2HVJC 4HYOA 3RBZA 2K1EA 3SGIA 4QE7A 1YHQV 4IL6Z 3S3XA 3DXRA 1LUWA 4TV8A 1URFA 1TUBB 4HNAB 2BOBC 1XNQO 4I50A 1QLNA 3JATB 2Y69C 4YJ2A 4LH7A 1O9GA 1QLEC 4DK1A 4LFCO 2K9PA 3ZRXA 5KHIA 4DR2B 5JQGA 4X9QA 4JF3A 2NN4A 1CPYA 2BSKB 5B66Z 4JI0B 4TSFG 4EB6A 2GBOA 4PDVA 5H9CA 3ZHUA 5J2TA 1R3LC 2ZE8A 5DECA 2M6YA 3UM7A 3CCUV 3AG4C 4I0XA 1XBLA 1DK1A 3M99B 4LNUA 2A0LA 1YTFD 3B8NA 1KP2A 3JAWA 1YXBA 3EXAA 3FAVA 3RW0A 1N8RW 1Q8IA 1Y74A 2EX3A 2EIKC 4ZIBA 1KUQA 4J41A 3EVKA 3OEHG 4PJ0Z 1AJQA 2DQ3A 2JS5A 2ILMA 4B3TB 3N2GA 2V1DA 2UUBO 4BIZA 2RNBA 5EC2C 3PN1A 2XTAA 1SESA 4DR1O 5H6QA 1DTOA 4UCSA 2F93B 3BAAA 4FLWA 2CDYA 1SERA 1VQKV 3CC2V 4P2ZA 3LDEA 2QTSA 1TA8A 4IHJA 1LUVA 2A9HA 3K58A 3F7YC 3ETGA 3DGEA 4X62B 1JR9A 3B77A 3HKEA 1PNMA 2QKAA 3FB5C 3WB0A 2Q68A 2XNDG 1R3JC 2HR3A 4L87A 4JPRA 1K33A 4GZRB 4DR2O 4R8CA 4K3AA 1RSOB 1TVKA 4CBCA 4U3FH 3T2MA 1S77D 3D36C 2N04A 1RPRA 2VQEB 3CRAA 2JS3A 3CXCU 1R3IC 4JI0O 2H94A 2Q0AA 1IZ3A 2E75B 2RMKB 5CB4A 1K34A 2HJFC 2P5OA 1D2DA 3ZN0A 2AXTZ 3G71V 1YI2V 4YHHB 3SJCC 2UXCO 2EIMB 5EZYA 5C8YA 1FFXB 4GUNA 3VQVA 2YDEA 4JAVA 1SZTA 4RQEA 4KXRA 1AB3A 5DM6V 1F51A 1J5EB 1HNZB 3LUTB 3J81N 1UJWB 1BMFG 1VQ6V 3QO8A 4B3TO 5LOVA 4O2AB 2Q7EA 1AR1B 1H2GA 1L0LH 1PV0A 1SQVH 5F2VO 5CBHA 5KHJA 1JFFA 1TAEA 4JI2B 5CA1A 2B1IA 4Z1MG 5KHKA 1IBMB 3OR7C 2EILB 1NKDA 4J7KA 3H1LH 1B04A 3JAKA 4X62O 3FX7A 4B3RB 3J80N 4PDLA 3W7SA 3DSQA 3HKBB 3FFQA 2RN9A 5BMVB 1NTMH 1HR0B 1MABG 4MS2A 5FNVA 5KMGA 5HFLA 3H9VA 3ZRWA 4DV0B 2VQEO 5BY1A 3JARB 4PDMA 2OWOA 4I55A 2JGDB 5IY5B 1XQ8A 3M7MX 1Y76B 2F4VB 3ZJZA 3CCVV 1O9HA 1QR9A 4JZGA 1BE3H 4JI5B 1I7FA 1V9PA 5LGUA 1ZL8A 2ZIMA 2ZINA 4U7NA 2WAMA 2P22C 3WFVA 4LFBB 1PNLA 1E1QG 4YHHO 1OCRB 1OJHA 5JJEB 5KLVH 1LNQA 2F95B 1UPGA 1JQ0A 2WLKA 4LR3A 1WJZA 2CH7B 2O57A 4FFBA 3STLC 4X1IA 1H2LA 1VQMV 3PJSK 2Y4UA 2EBOA 1J5EO 5B3SB 2Y0IA 1HNZO 3KG2A 1AROP 1FPOA 2DOSA 3BABA 4Q20A 1WB7A 1KMIZ 3Q4HA 2A3QA 3BEHA 4GLXA 3K79A 5FLXN 3SYQA 1AI7A 2XHBA 4DV4B 1D5AA 4G2KA 3K5MA 4JI2O 3CRMA 3NR7A 4K8ZA 5L3EA 4DUYB 2QA4V 1RP3B 4OPHA 2H8PC 1EZJA 5EIBC 1PPJH 4IT5A 1SQPH 1EBOA 1VF5B 3ABMC 5H2FZ 3JALB 2P7TC 4B3RO 2YC0A 4WFAV 3ABTA 3A0HZ 4U3JB 1PKXA 2LFSA 1P4RA 1HR0O 2XAGA 4D6TH 2OT5A 1XI1A 4PV1B 4DV0O 1Y6XA 4X1KB 4A5UB 2YXLA 1BSMA 5LA6B 3OT7A 2F4VO 4ICGA 1K4CC 5IJ0A 4D7SA 1N32B 2X6BA 2LW1A 4JI5O 4RAIA 3S3WA 4FPPA 5B1AC 4LF4B 4I9QA 1SQXH 4JTCB 3ABKC 4LFBO 1VQOV 1GM9A 3SJQC 5K1PA 3TK1A 4HNAA 5B1BC 1K73W 4JTDB 3ASNC 3JATA 5FL7G 3RYFB 3K59A 1SRYA 1MZFA 2HFEC 1QCEA 2P90A 4BAYA 2Y69B 2IW5A 3GWKC 5JCOA 1QLEB 3OFNG 3BCCH 4WBNB 2HG5C 2KG7A 3P32A 4OGQB 3CC4V 4DV4O 3FYIB 3OMNB 5LGTA 2W0XA 4ZI7B 3RFRA 5EYPB 4DUYO 2QM7A 3CRQA 1YZBA 5LXTA 2ZNIA 4JASA 3SDLA 4EEQA 3G80A 4WFGA 2LO1A 2OTJV 3AG4B 5GTHZ 2DYRC 4H13B 1MMMA 5J2UB 3SYOA 3ZBHA 4FLXA 4B7EA 3QNEA 2D2CB 1QBZA 2EIKB 5JH7B 3CB2A 3T1HB 1N0NA 2EZPA 4GX2A 3B2EE 3B8MA 1EZVH 2Q6AA 4FJCC 5C93A 2LQTA 4OPAA 1N32O 1NU1H 3ZCCA 4XDLA 1DLBA 2NLJC 3UKMA 2QEXV 4LF4O 3OTOB 4PI2A 4DO2A 4DRXA 4MVRA 4P30A 3ZMUA 4XDKA 1KKDA 1VQ4V 3JD0A 3ZX6A 2N05A 3CMEV 5LMNB 3SPGA 3F5WC 1M90W 1BGYH 4JTAB 3VQXA 1BCCH 5FPRA 1K5QA 3CRRA 3JAMN 1AVMA 3E2EA 4H37A 1N34B 1F4NA 2JIZG 2Q73A 3E22A 2R9RB 4ZHQB 4IIJB 2ZD9A 5IJ9B 1IURA 1WNSA 1XREA 3H01A 4JV5B 1GN2A 2PUSA 4TWKA 2E76B 2DYSC 2HP8A 2E74B 3C3SA 4YJ3A 2YICA 4MTXA 5LBQA 4FLVA 1D5NA 4R50A 2BTQB 3SPCA 4B7KA 3CPWU 1QNMA 2B1GA 2QR4A 4X1YA 1YJ9V 4J9YB 4FMTA 3WG7C 1EN4A 2UXNA 1OV9A 5FPOA 2ZE5A 3CCSV 1AR4A 4MTOA 1K9MW 3O9OA 3T1HO 1SA0B 2Z0AA 3LNMB 2DWDC 1XUQA 1SQGA 2FYUH 4X65B 1K7DA 1XMQB 5IT9N 2YXYA 2AHYA 1B6QA 2B9ZA 2Y4TA 1BHBA 3OTOO 2PI4A 4UCRA 1NJIW 1VARA 1Z5VA 3L73H 3THOA 2IJHA 2D3OW 5LMNO 2RJZA 4CH3A 1L0NH 2X7RB 2ZQMA 2Z3YA 4BW5A 3T1CA 1NT2B 1M5IA 5H5NA 2OYQA 3HKCA 4JYCA 2OCCC 5E1AC 1ZSPA 5KA5A 1N34O 3JARA 4QNHB 4BIUA 3AG1C 5GONA 4X89A 2OIGA 1M56C 4XBFA 3U0ZA 4NR1A 4O4IB 3CSXA 4TOIA 5EC1C 4UCTA 4JV5O 4I4TB 3ZN1A 4JI6B 2QWNB 3CJHA 2HVKC 2FKXA 2IJKA 4TUYB 2QWPB 4CS3A 2B5UA 4BWAA 1BQZA 3M8AA 4UUJC 3OUSA 4DR6B 2X0LA 1AI4A 2Z5UA 3CCLV 2Y0PA 3OW2U 2ZE7A 2ZNJA 1XL6A 4UCVA 1OCOC 3B4SA 1S76D 3P3NA 4D7TA 1K92A 3BA8A 5IYCO 1GK9A 3RYIA 4WF9V 2M7WA 4F4LA 4X65O 1BT8A 1XMQO 2HJDA 3ABLC 3CCEV 3UT5A 4O4JA 3BVOA 1Y67A 3SYCA 4GYCB 3K0GA 3SR2C 3SPHA 3RVYA 4NB5A 4DR5B 3JALA 1K97A 5GW7A 1W59A 3CE2A 2IM9A 3ABMB 4JI7B 3OGCC 4O2BA 4WFFA 1GMGA 3MAQA 1TGOA 4NYKA 4LWSB 3ZS8C 2YEVA 2EJ7A 3IFXA 4CH4A 2ZR3A 3LSQA 1QVFU 5B1OA 1GAXA 2UXDB 1ZWIC 2WLLA 1Q82W 4DR3B 4KUMA 5LA6A 2PI5A 5IYZA 1FXKA 4NKGB 1KYOF 1WAZA 3CWBH 3ETQA 3RYCA 5CA0B 2EIJC 2QKSA 1NVPB 4JI1B 2IJIA 4JI6O 1VQ5V 1N33B 1PL4A 4G28B 4H33A 1R6TA 4KFMA 5JJNB 5B1AB 4UVAA 1KBHA 2Q8VA 3E83A 3QF7A 1P7GA 4DUZB 3ABKB 1Y4MA 1VF7A 3RYFA 4DR6O 4YIPA 2DN9A 1VQNV 5B1BB 1FS0G 3E8FA 3QG5A 3CCJV 1I94B 4QIWF 4DV5B 3ASNB 1SC5B 1AR5A 4WFEA 2ZE6A 2X6CA 5JWPA 3LNNA 1HW7A 2ITCC 2F66C 4PA6A 2GUZA 5KAIZ 2GV9A 3WB2A 3CS5A 5TISZ 1FKAO 2UUAB 2GTAA 4O4LA 1EM1A 5ITZB 3CCQV 1Q6UA 2ZXWC 5EYPA 2AZ2A 1OCZC 2F1MA 4FM0A 4X20B 5KX5B 2WLIB 4DR5O 1MA1A 1OZ0A 1P84F 1JX9A 4Q6GA 4JAUA 1Q7YW 1S5LZ 4JI7O 3IJ4A 4RUEA 3JCZA 4MVQA 1VEWA 2E3CA 3IAYA 4LF5B 2Q4PA 1ZUQA 1GM7A 1U96A 1CEZA 2DYRB 2WLJA 3K03A 3UCSC 5LYJB 2UXDO 5JH7A 3A0RA 1THZA 5LMUB 4DR3O 1TUEB 3K0DA 4E2LA 5LP6A 4HBNA 3F7VC 4LF6B 4UB6Z 3N2KB 1B06A 1LR1A 3E86A 3CRCA 1M57C 1KP3A 5BXZA 4JI1O 1KECA 4QPJA 1N33O 2ADPA 4FVMA 1XMOB 3LDDA 2ITDC 3R65A 4DUZO 4TQFA 2OIEA 3SPIA 3JASA 3L74H 1Y66A 5AG2A 2UXBB 5LHGA 3OE7G 2YIBD 1I94O 4DV5O 2Q67A 2QM8A 3O65A 2EINC 4Z1VA 2WA4A 4FFKA 1YDXA 1HDJA 2JGUA 2LJ2A 1XHXA 5IE9A 3AG3C 1S72V 3OR6C 2YI9A 4AQYB 4ZHQA 1Q86W 4IIJA 1FYJA 3DXRB 1NVPD 2IBZH 4QJFB 3APOA 2VWKA 1VQ9V 3JSNA 4W4LA 3AG2C 4GKKB 4YJ2B 4FLTA 2Q7GA 2WA3A 5JCOC 2DYSB 4FLYA 2CTRA 3ZHTA 3CD6V 1OCCC 4YXWG 1RM1C 1IXBA 4N21A 5JQGB 4NXMB 4LF5O 2Y48A 4TV9A 2LGQA 1YEWA 1GO3F 2PTMA 1HNXB 2LGWA 1S5HC 1BZKA 2P6JA 3WG7B 1I5YA 5LMUO 4EB6B 4DYLA 1IBMO 2F43G 1SA0A 3JCUZ 4HZ3A 3U10A 2WWWA 3IC7A 4DW0A 4LF6O 5LL6Y 5J2TB 5K1XA 3B40A 3OMIB 2RQ6A 1NBMG 2YSUB 1WLEA 5BZBA 1YCIA 1AILA 4JI3B 1XMOO 4OX9B 3CC7V 1KQSU 3FAVB 1E1RG 1S5JA 1AI5A 3D8CA 1IXMA 3KKYA 1Y74B 1S0VA 1NI8A 4FLUA 3UO3A 4KHPB 3FB6C 2JRIA 1VQ8V 1SZXA 4MW8A 1ROPA 2UXBO 2JDIG 4F6RA 1Q43A 4GX0A 1I0HA 5E79Z 1KD1W 3N2GB 4NXNB 4JZ2A 5DN6G 4P9OA 1X59A 4N23A 1F7YA 4J7ZA 4C7UA 5B5EZ 3CYOA 1ORQC 2A79B 1R1BA 2OCCB 4AQYO 4PI0A 1TUBA 4O4HB 4O4IA 1NTKH 1ZTEA 2CTPA 3AG1B 4IHJB 1YJWV 1M56B 1Q6HA 1N4CA 1MSDA 2JVDA 5A2QN 3L72H 4ZOLB 3OGIB 1K4DC 2CE4A 4WFHA 1P49A 3HKEB 4GKKO 4IYHA 4J42A 1ENVA 3GVMA 2YIAA 3K5LA 4WCEV 1IBKB 2BSKA 4NTYA 1TVKB 4NXMO 2YUAA 1Q81W 4UXNA 1JMKC 2ARHA 1FXHA 1WA8B 1HNXO 2L6LA 1VQPV 1N0JA 1XILA 4YY3B 1OCOB 1YSCA 3F5TA 4FZ1A 1MOFA 3BY6A 1PNKA 3C90A 1Q3EA 4LP8A 4JI4B 4EFEA 2PYJA 2QWQB 5EZYB 3FKSG 3ABLB 4JI3O 5C8YB 4GKJB 4OX9O 2Q7HA 2H3OA 1H8EG 1SKVA 4RQFA 2WLNA 1JOYA 5BR8B 2R70A 4DXWA 4ZKIA 4KHPO 2FTKA 4QGPA 2YIBA 2PGGA 2XOKG 5LOVB 4NXNO 3JD3A 3I56V 2ETNA 4GX5A 4CZZA 2LFRA 2PZSA 3CCRV 1JFFB 1ZX3A 1R6NA 5CA1B 1V55C 2CAZC 5L3FA 3L71H 3K06A 4L8JA 4K35A 4JYBA 5CA0A 3HKDB 1CP9A 1SETA 1COWG 3K9SA 1IBLB 3BRCA 3D3IA 2WSSG 3JAKB 4TT3G 2BTOA 4MVZA 4B3SB 1XL4A 5CBGA 4FZ0A 2EIJB 3EHBB 5LHHA 4U7OA 3X2QC 1RSOA 2ADQB 3CMAV 1IBKO 5L3CA 1VF6A 5HFMA 3ZRWB 1W0KG 2QTOA 2R9AA 4JAAA 2Q5ZA 1H2NA 3B09A 4I55B 4LF9B 2ODMA 2VWJA 2A7WA 1NH2B 2ZM6B 4YY3O 2VS0A 3JD4A 5KAFZ 3FB8C 4W4KA 1XOUA 2UUCB 3VOUA 4BIOA 5ITZA 1ZL8B 2P67A 3SYPA 1FFXA 4JI4O 2AW9A 3SPJA 4R7CA 3K3WA 4F6EA 2IU0A 1WB8A 4GKJO 4X20A 4FM2A 5L3GA 1MZEA 1YTFB 4FFBB 2ZXWB 1AP6A 5BR8O 1OCZB 1SQBH 2WLMA 3JYCA 5IDJA 2W6IG 3BHPA 3J7AU 4O2AA 2WPDG 1SQQH 4NVPA 3ZMVA 3Q4HB 3OD4A 1H38A 2YXHA 4GT1A 3DTUB 1SF9A 2FL4A 2V4DA 1BQ0A 2QKCA 3ZEDA 4LF7B 3RWRD 3JSLA 5J9PC 4B3MB 3HKBA 3GWOA 4UB8Z 4ASUG 4B3SO 1XDCA 1GM8A 1QVGU 2KB1A 1M57B 3HB3B 5BMVA 1H2KA 3ETDA 3K5OA 4PDRA 4J11A 3K04A 4MT8A 2EZOA 5DEDA 2P4KA 2OTLV 1CXZB 1BS3A 2JGDA 4J7JA 5JVDB 4FLZA 1FXKC 1Y76A 2ZDIA 5IWAB 3OMAB 2W0FC 4LF9O 5B1NA 2ZM6O 4ZBMA 3ZRSA 2EINB 5IJ0B 2YIDA 4DV6B 2UUCO 3ZIAG 4BW9A 1YITV 1XNRB 1QQCA 3W7TA 3AG3B 1Z5WA 2CH7A
chains in the Genus database with same CATH topology
2L6LA 2PF4E 2CUGA 1FAFA 2CTQA 2EJ7A 2QWOB 3BVOA 1WJZA 2GUZA 2OCHA 2N05A 2YS8A 4J7ZA 3APQA 2DMXA 3APOA 2LGWA 2QWNB 2Y4UA 2Y4TA 2N04A 1GH6A 1NZ6A 2CTWA 2QWPB 2GUZB 2DN9A 2M6YA 3UO3A 2QWRB 1IURA 1HDJA 1FPOA 2LO1A 3AG7A 4IT5A 2YUAA 2CTPA 2KQXA 4RWUA 2QWQB 1BQZA 2CTRA 1XBLA 3UCSC 3UO2A 2QSAA 1BQ0A 1N4CA 4J80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6L A;  2PF4 E;  2CUG A;  1FAF A;  2CTQ A;  2EJ7 A;  2QWO B;  3BVO A;  1WJZ A;  2GUZ A;  2OCH A;  2N05 A;  2YS8 A;  4J7Z A;  3APQ A;  2DMX A;  3APO A;  2LGW A;  2QWN B;  2Y4U A;  2Y4T A;  2N04 A;  1GH6 A;  1NZ6 A;  2CTW A;  2QWP B;  2GUZ B;  2DN9 A;  2M6Y A;  3UO3 A;  2QWR B;  1IUR A;  1HDJ A;  1FPO A;  2LO1 A;  3AG7 A;  4IT5 A;  2YUA A;  2CTP A;  2KQX A;  4RWU A;  2QWQ B;  1BQZ A;  2CTR A;  1XBL A;  3UCS C;  3UO2 A;  2QSA A;  1BQ0 A;  1N4C A;  4J80 A; 
#chains in the Genus database with same CATH topology
 2JK5 C;  2EUL A;  2HEP A;  3RYH B;  1W0J G;  4JYY A;  3ABU A;  2HLD G;  4UFZ A;  1QR8 A;  3AG2 B;  3LSS A;  2KQX A;  3FB7 C;  1OCC B;  3L75 H;  2NNU A;  2KG7 B;  1RM1 B;  4MTF A;  3ZMZ A;  2N74 A;  3BFR A;  1NH2 D;  4FK5 C;  4CH6 A;  2UU9 B;  1G6U A;  1PD3 A;  1L1F A;  3ASO C;  2ATK C;  1NTZ H;  2DMX A;  5KUM A;  4LF7 O;  5LXT B;  2DWE C;  3W7X A;  2UXC B;  1SS3 A;  4B3M O;  3ZRV A;  3RVZ A;  1PM9 A;  4U3J A;  1G8M A;  3T4Z A;  4DV1 B;  5D5Q A;  1H8H G;  3WB1 A;  4X88 A;  2L35 A;  2EJR A;  3TXS A;  1RPO A;  2OCH A;  1Q90 D;  4DV2 B;  4XDJ A;  3JD2 A;  4X1K A;  5LP6 C;  1NZ6 A;  1VMG A;  1YF2 A;  3G4S V;  3E89 A;  5IWA O;  3OUF A;  3TET A;  3RT3 C;  1H2S B;  3H1I H;  2PF4 E;  1GN4 A;  3ZHV A;  5CA3 A;  3K57 A;  4DV6 O;  3RGB A;  2PY5 A;  4O4H A;  3AEI A;  1XNR O;  4MSW C;  2QM4 A;  3ZHQ A;  4DRX B;  1VQ7 V;  3TGU H;  1QHT A;  1T5E A;  1H2M A;  1MNG A;  4MW3 A;  2QJ1 A;  4QPK A;  3OM3 B;  3TXQ A;  4ZOL A;  4AIL C;  1WPB A;  5KUK A;  1HP8 A;  2YI8 A;  2XAJ A;  2E5L B;  2FML A;  3ZHS A;  3TCU A;  3EFF K;  1NR1 A;  4WBN A;  3HR0 A;  3FYE B;  3HPL C;  1MG1 A;  5KHG A;  1FFT B;  3ML0 A;  1KKC A;  1WA8 A;  4R6Z A;  2UXX A;  3E22 B;  4LF8 B;  2UU9 O;  4J10 A;  1A32 A;  4ZI7 A;  3G6B A;  2C2A A;  2DW4 A;  2JEU A;  2CGN A;  4LCU C;  1V54 C;  4I9W A;  4DR7 B;  1FXV A;  5EK0 A;  3U11 A;  4YJ3 B;  1S3J A;  5J2U A;  4DV1 O;  1NQT A;  1JCH A;  3CX5 F;  4NTW A;  3AK1 A;  4QE9 A;  3CCM V;  3ICX A;  4X1Y B;  3TJT A;  4DV2 O;  1AI6 A;  5L3D A;  2P4V A;  2Q0O C;  1I5X A;  5EBL C;  1PP9 H;  3E8B A;  3E35 A;  4MVM A;  3AK2 A;  2WLH A;  2R72 A;  3KCY A;  5LHI A;  2RCV A;  4RWU A;  1F4M A;  4PD4 F;  1KB9 F;  4KL1 A;  2XT9 A;  5EIB D;  3FD9 A;  3HKD A;  3IGA C;  1V55 B;  1I08 A;  3MHH C;  2ZT9 B;  4UVB A;  2CGO A;  4RO2 A;  5LGN A;  2E5L O;  5KA6 A;  4CS4 A;  3HKC B;  1R3K C;  4X66 B;  3X2Q B;  2ZR2 A;  1JA8 A;  4MVO A;  2VQF B;  1ZAU A;  2UUA O;  1FAF A;  1XHZ A;  3D36 A;  2NR5 A;  4X8A A;  1MSW D;  5GON B;  2XAS A;  4MVS A;  4LF8 O;  3CEI A;  4E4E A;  5IJ9 A;  3QO7 A;  4TV8 B;  3I55 V;  2AHZ A;  2CK3 G;  5EBW C;  4I50 B;  5D5P A;  3OTF A;  4KP4 A;  4PEL A;  4DR7 O;  4DR4 B;  2JJ1 G;  3IC9 A;  2KSD A;  3CJH B;  4EFB A;  2BTQ A;  2QWO B;  1KU9 A;  1AJN A;  3DC6 A;  4K8X A;  2ZCE A;  1FD9 A;  1HNW B;  1M1K W;  2IJJ A;  2Q69 A;  1N36 B;  4LFA B;  4UV9 A;  1DF5 A;  1GTO A;  2XAF A;  2IU3 A;  3VQW A;  4LBE C;  1AP5 A;  1SQF A;  4AI8 A;  3RYI B;  1HWY A;  3MHS C;  4I0X B;  3K9A A;  4LNU B;  2QGN A;  2DQ0 A;  3UT5 B;  3JAW B;  4O4J B;  4PA4 A;  3P30 A;  1FJG B;  2GTS A;  1JVM A;  2AGA A;  2HHH B;  3T1Y B;  4BR6 A;  1RFY A;  3P3P A;  3W7U A;  1M9N A;  4JYA B;  1IVS A;  2IH3 C;  1K8A W;  4UCU A;  2BCC H;  3A2F A;  2CUG A;  2GHY A;  2A06 H;  5EBM C;  4G27 B;  5CN0 A;  4O2B B;  1R73 A;  1W2B U;  3I5D A;  1F23 A;  1DF4 A;  1WPX A;  1OHH G;  2YEV B;  4X66 O;  4X64 B;  5IYD O;  1U97 A;  3STZ C;  4LH6 A;  1EFR G;  4H0L B;  2VQF O;  5JVD A;  3ETE A;  3AG7 A;  3LSU A;  2WLL B;  4YIO A;  2R9I A;  3MDS A;  3H1J H;  2QSA A;  1BHA A;  5IYZ B;  1FXK B;  4I4T A;  1UFI A;  1NS1 A;  4NTX A;  2FB5 A;  3RYC B;  4TUY A;  4HAM A;  4DR4 O;  2GSM B;  3SJB C;  3VBB A;  5A9G A;  3BA9 A;  1BL8 A;  1US6 A;  3H1K H;  1B3Q A;  4DW1 A;  4DV3 B;  1VF6 C;  3K08 A;  3RYH A;  4UVC A;  3VQY A;  1HNW O;  1EN6 A;  2AZ0 A;  1G1X B;  1K5S A;  1N36 O;  4LFA O;  1M4U A;  5L3B A;  5CB4 B;  1G4Y B;  3APQ A;  2KKW A;  1GRJ A;  2ZKO A;  1GH6 A;  2EIM C;  2GUZ B;  3KZI Z;  4GCZ A;  4O4L B;  3G67 A;  5H6R A;  2LP7 A;  1VQL V;  4DV7 B;  4UV8 A;  5IYB O;  3G6E V;  4ABM A;  1FJG O;  3ASO B;  2HHH O;  1YJN V;  2DE0 X;  3H1H H;  3T1Y O;  4MTG A;  4CH5 A;  2P06 A;  3ZMS A;  1JPX A;  4P9P A;  4JYA O;  4PA9 A;  5GTI Z;  3SYA A;  1IX9 A;  4H44 B;  3LDC A;  4OXS A;  4LWS A;  1ZLZ A;  3L9D A;  3QVN A;  2ZIO A;  1YIJ V;  3QTC A;  4X64 O;  2EIL C;  3R66 A;  3NXS A;  3N27 A;  3ZHR A;  3WU2 Z;  3ZMT A;  2IH1 C;  4JI8 B;  2HKO A;  2G38 A;  5LP6 B;  1J95 A;  2VRZ A;  2CTW A;  1Q5O A;  4PHZ A;  2LW7 A;  1R6K A;  1WP7 A;  2QWR B;  2Q9L A;  2X6A A;  1GN6 A;  3QO5 A;  1XEQ A;  4UCO A;  3UQ8 A;  1JJO A;  2CTQ A;  3E8H A;  1E79 G;  2PYL A;  4K0K B;  1L8D A;  2F23 A;  4DV3 O;  2XAH A;  2MK3 A;  1K3E A;  4CC5 A;  4RUF A;  1IDS A;  3K5N A;  4MVU A;  2YS8 A;  5FNV B;  3CP1 A;  5KMG B;  1GN3 A;  5IY5 C;  1P7B A;  3JAS B;  4Z2W A;  1YVW A;  3E8G A;  2ZDI C;  1GKF A;  2BE3 A;  2JEX A;  5KHH A;  3DC5 A;  4FIP C;  1KC8 W;  4B08 A;  1OCR C;  4I5S A;  4JGS A;  4DK0 A;  2QE7 G;  5CBF A;  1DGS A;  1Q6I A;  3RN4 A;  1NR7 A;  3T4D A;  2BOC C;  2XUM A;  4DV7 O;  5CMU A;  1WP8 A;  1XNQ B;  1AJP A;  5KX5 A;  2WLI A;  5B3S C;  4X1I B;  2JJ2 G;  2QDO A;  1Z2G A;  2XAQ A;  2RDC A;  4CS2 A;  4LFC B;  1V54 B;  4EKW A;  2V7Q G;  4CC6 A;  3MD0 A;  4AHC A;  5LYJ A;  3W7W A;  4TV9 B;  3CXH F;  3A0B Z;  3D3Q A;  4I7Z B;  2DJV A;  4TQD A;  2W6J G;  3C3T A;  4GX1 A;  4J9Z B;  4JI8 O;  2MW2 B;  3UO2 A;  4J80 A;  3AK3 A;  3N2K A;  4LC1 A;  3BPZ A;  3OEE G;  3KCX A;  4PA7 A;  5JJJ B;  3GB7 C;  3OAA G;  1IBL O;  1EN5 A;  1X4T A;  2GDS A;  1VP7 A;  3A8T A;  3JD1 A;  4WFB V;  1WN7 A;  4IGG A;  1M93 A;  1PL0 A;  1VIB A;  4K0K O;  3CHX A;  4PA3 A;  3L70 H;  4IYI A;  2UUB B;  4F6R B;  1JJ2 U;  1QU7 A;  4FM1 A;  4DR1 B;  3SJA C;  2HVJ C;  4HYO A;  3RBZ A;  2K1E A;  3SGI A;  4QE7 A;  1YHQ V;  4IL6 Z;  3S3X A;  3DXR A;  1LUW A;  4TV8 A;  1URF A;  1TUB B;  4HNA B;  2BOB C;  1XNQ O;  4I50 A;  1QLN A;  3JAT B;  2Y69 C;  4YJ2 A;  4LH7 A;  1O9G A;  1QLE C;  4DK1 A;  4LFC O;  2K9P A;  3ZRX A;  5KHI A;  4DR2 B;  5JQG A;  4X9Q A;  4JF3 A;  2NN4 A;  1CPY A;  2BSK B;  5B66 Z;  4JI0 B;  4TSF G;  4EB6 A;  2GBO A;  4PDV A;  5H9C A;  3ZHU A;  5J2T A;  1R3L C;  2ZE8 A;  5DEC A;  2M6Y A;  3UM7 A;  3CCU V;  3AG4 C;  4I0X A;  1XBL A;  1DK1 A;  3M99 B;  4LNU A;  2A0L A;  1YTF D;  3B8N A;  1KP2 A;  3JAW A;  1YXB A;  3EXA A;  3FAV A;  3RW0 A;  1N8R W;  1Q8I A;  1Y74 A;  2EX3 A;  2EIK C;  4ZIB A;  1KUQ A;  4J41 A;  3EVK A;  3OEH G;  4PJ0 Z;  1AJQ A;  2DQ3 A;  2JS5 A;  2ILM A;  4B3T B;  3N2G A;  2V1D A;  2UUB O;  4BIZ A;  2RNB A;  5EC2 C;  3PN1 A;  2XTA A;  1SES A;  4DR1 O;  5H6Q A;  1DTO A;  4UCS A;  2F93 B;  3BAA A;  4FLW A;  2CDY A;  1SER A;  1VQK V;  3CC2 V;  4P2Z A;  3LDE A;  2QTS A;  1TA8 A;  4IHJ A;  1LUV A;  2A9H A;  3K58 A;  3F7Y C;  3ETG A;  3DGE A;  4X62 B;  1JR9 A;  3B77 A;  3HKE A;  1PNM A;  2QKA A;  3FB5 C;  3WB0 A;  2Q68 A;  2XND G;  1R3J C;  2HR3 A;  4L87 A;  4JPR A;  1K33 A;  4GZR B;  4DR2 O;  4R8C A;  4K3A A;  1RSO B;  1TVK A;  4CBC A;  4U3F H;  3T2M A;  1S77 D;  3D36 C;  2N04 A;  1RPR A;  2VQE B;  3CRA A;  2JS3 A;  3CXC U;  1R3I C;  4JI0 O;  2H94 A;  2Q0A A;  1IZ3 A;  2E75 B;  2RMK B;  5CB4 A;  1K34 A;  2HJF C;  2P5O A;  1D2D A;  3ZN0 A;  2AXT Z;  3G71 V;  1YI2 V;  4YHH B;  3SJC C;  2UXC O;  2EIM B;  5EZY A;  5C8Y A;  1FFX B;  4GUN A;  3VQV A;  2YDE A;  4JAV A;  1SZT A;  4RQE A;  4KXR A;  1AB3 A;  5DM6 V;  1F51 A;  1J5E B;  1HNZ B;  3LUT B;  3J81 N;  1UJW B;  1BMF G;  1VQ6 V;  3QO8 A;  4B3T O;  5LOV A;  4O2A B;  2Q7E A;  1AR1 B;  1H2G A;  1L0L H;  1PV0 A;  1SQV H;  5F2V O;  5CBH A;  5KHJ A;  1JFF A;  1TAE A;  4JI2 B;  5CA1 A;  2B1I A;  4Z1M G;  5KHK A;  1IBM B;  3OR7 C;  2EIL B;  1NKD A;  4J7K A;  3H1L H;  1B04 A;  3JAK A;  4X62 O;  3FX7 A;  4B3R B;  3J80 N;  4PDL A;  3W7S A;  3DSQ A;  3HKB B;  3FFQ A;  2RN9 A;  5BMV B;  1NTM H;  1HR0 B;  1MAB G;  4MS2 A;  5FNV A;  5KMG A;  5HFL A;  3H9V A;  3ZRW A;  4DV0 B;  2VQE O;  5BY1 A;  3JAR B;  4PDM A;  2OWO A;  4I55 A;  2JGD B;  5IY5 B;  1XQ8 A;  3M7M X;  1Y76 B;  2F4V B;  3ZJZ A;  3CCV V;  1O9H A;  1QR9 A;  4JZG A;  1BE3 H;  4JI5 B;  1I7F A;  1V9P A;  5LGU A;  1ZL8 A;  2ZIM A;  2ZIN A;  4U7N A;  2WAM A;  2P22 C;  3WFV A;  4LFB B;  1PNL A;  1E1Q G;  4YHH O;  1OCR B;  1OJH A;  5JJE B;  5KLV H;  1LNQ A;  2F95 B;  1UPG A;  1JQ0 A;  2WLK A;  4LR3 A;  1WJZ A;  2CH7 B;  2O57 A;  4FFB A;  3STL C;  4X1I A;  1H2L A;  1VQM V;  3PJS K;  2Y4U A;  2EBO A;  1J5E O;  5B3S B;  2Y0I A;  1HNZ O;  3KG2 A;  1ARO P;  1FPO A;  2DOS A;  3BAB A;  4Q20 A;  1WB7 A;  1KMI Z;  3Q4H A;  2A3Q A;  3BEH A;  4GLX A;  3K79 A;  5FLX N;  3SYQ A;  1AI7 A;  2XHB A;  4DV4 B;  1D5A A;  4G2K A;  3K5M A;  4JI2 O;  3CRM A;  3NR7 A;  4K8Z A;  5L3E A;  4DUY B;  2QA4 V;  1RP3 B;  4OPH A;  2H8P C;  1EZJ A;  5EIB C;  1PPJ H;  4IT5 A;  1SQP H;  1EBO A;  1VF5 B;  3ABM C;  5H2F Z;  3JAL B;  2P7T C;  4B3R O;  2YC0 A;  4WFA V;  3ABT A;  3A0H Z;  4U3J B;  1PKX A;  2LFS A;  1P4R A;  1HR0 O;  2XAG A;  4D6T H;  2OT5 A;  1XI1 A;  4PV1 B;  4DV0 O;  1Y6X A;  4X1K B;  4A5U B;  2YXL A;  1BSM A;  5LA6 B;  3OT7 A;  2F4V O;  4ICG A;  1K4C C;  5IJ0 A;  4D7S A;  1N32 B;  2X6B A;  2LW1 A;  4JI5 O;  4RAI A;  3S3W A;  4FPP A;  5B1A C;  4LF4 B;  4I9Q A;  1SQX H;  4JTC B;  3ABK C;  4LFB O;  1VQO V;  1GM9 A;  3SJQ C;  5K1P A;  3TK1 A;  4HNA A;  5B1B C;  1K73 W;  4JTD B;  3ASN C;  3JAT A;  5FL7 G;  3RYF B;  3K59 A;  1SRY A;  1MZF A;  2HFE C;  1QCE A;  2P90 A;  4BAY A;  2Y69 B;  2IW5 A;  3GWK C;  5JCO A;  1QLE B;  3OFN G;  3BCC H;  4WBN B;  2HG5 C;  2KG7 A;  3P32 A;  4OGQ B;  3CC4 V;  4DV4 O;  3FYI B;  3OMN B;  5LGT A;  2W0X A;  4ZI7 B;  3RFR A;  5EYP B;  4DUY O;  2QM7 A;  3CRQ A;  1YZB A;  5LXT A;  2ZNI A;  4JAS A;  3SDL A;  4EEQ A;  3G80 A;  4WFG A;  2LO1 A;  2OTJ V;  3AG4 B;  5GTH Z;  2DYR C;  4H13 B;  1MMM A;  5J2U B;  3SYO A;  3ZBH A;  4FLX A;  4B7E A;  3QNE A;  2D2C B;  1QBZ A;  2EIK B;  5JH7 B;  3CB2 A;  3T1H B;  1N0N A;  2EZP A;  4GX2 A;  3B2E E;  3B8M A;  1EZV H;  2Q6A A;  4FJC C;  5C93 A;  2LQT A;  4OPA A;  1N32 O;  1NU1 H;  3ZCC A;  4XDL A;  1DLB A;  2NLJ C;  3UKM A;  2QEX V;  4LF4 O;  3OTO B;  4PI2 A;  4DO2 A;  4DRX A;  4MVR A;  4P30 A;  3ZMU A;  4XDK A;  1KKD A;  1VQ4 V;  3JD0 A;  3ZX6 A;  2N05 A;  3CME V;  5LMN B;  3SPG A;  3F5W C;  1M90 W;  1BGY H;  4JTA B;  3VQX A;  1BCC H;  5FPR A;  1K5Q A;  3CRR A;  3JAM N;  1AVM A;  3E2E A;  4H37 A;  1N34 B;  1F4N A;  2JIZ G;  2Q73 A;  3E22 A;  2R9R B;  4ZHQ B;  4IIJ B;  2ZD9 A;  5IJ9 B;  1IUR A;  1WNS A;  1XRE A;  3H01 A;  4JV5 B;  1GN2 A;  2PUS A;  4TWK A;  2E76 B;  2DYS C;  2HP8 A;  2E74 B;  3C3S A;  4YJ3 A;  2YIC A;  4MTX A;  5LBQ A;  4FLV A;  1D5N A;  4R50 A;  2BTQ B;  3SPC A;  4B7K A;  3CPW U;  1QNM A;  2B1G A;  2QR4 A;  4X1Y A;  1YJ9 V;  4J9Y B;  4FMT A;  3WG7 C;  1EN4 A;  2UXN A;  1OV9 A;  5FPO A;  2ZE5 A;  3CCS V;  1AR4 A;  4MTO A;  1K9M W;  3O9O A;  3T1H O;  1SA0 B;  2Z0A A;  3LNM B;  2DWD C;  1XUQ A;  1SQG A;  2FYU H;  4X65 B;  1K7D A;  1XMQ B;  5IT9 N;  2YXY A;  2AHY A;  1B6Q A;  2B9Z A;  2Y4T A;  1BHB A;  3OTO O;  2PI4 A;  4UCR A;  1NJI W;  1VAR A;  1Z5V A;  3L73 H;  3THO A;  2IJH A;  2D3O W;  5LMN O;  2RJZ A;  4CH3 A;  1L0N H;  2X7R B;  2ZQM A;  2Z3Y A;  4BW5 A;  3T1C A;  1NT2 B;  1M5I A;  5H5N A;  2OYQ A;  3HKC A;  4JYC A;  2OCC C;  5E1A C;  1ZSP A;  5KA5 A;  1N34 O;  3JAR A;  4QNH B;  4BIU A;  3AG1 C;  5GON A;  4X89 A;  2OIG A;  1M56 C;  4XBF A;  3U0Z A;  4NR1 A;  4O4I B;  3CSX A;  4TOI A;  5EC1 C;  4UCT A;  4JV5 O;  4I4T B;  3ZN1 A;  4JI6 B;  2QWN B;  3CJH A;  2HVK C;  2FKX A;  2IJK A;  4TUY B;  2QWP B;  4CS3 A;  2B5U A;  4BWA A;  1BQZ A;  3M8A A;  4UUJ C;  3OUS A;  4DR6 B;  2X0L A;  1AI4 A;  2Z5U A;  3CCL V;  2Y0P A;  3OW2 U;  2ZE7 A;  2ZNJ A;  1XL6 A;  4UCV A;  1OCO C;  3B4S A;  1S76 D;  3P3N A;  4D7T A;  1K92 A;  3BA8 A;  5IYC O;  1GK9 A;  3RYI A;  4WF9 V;  2M7W A;  4F4L A;  4X65 O;  1BT8 A;  1XMQ O;  2HJD A;  3ABL C;  3CCE V;  3UT5 A;  4O4J A;  3BVO A;  1Y67 A;  3SYC A;  4GYC B;  3K0G A;  3SR2 C;  3SPH A;  3RVY A;  4NB5 A;  4DR5 B;  3JAL A;  1K97 A;  5GW7 A;  1W59 A;  3CE2 A;  2IM9 A;  3ABM B;  4JI7 B;  3OGC C;  4O2B A;  4WFF A;  1GMG A;  3MAQ A;  1TGO A;  4NYK A;  4LWS B;  3ZS8 C;  2YEV A;  2EJ7 A;  3IFX A;  4CH4 A;  2ZR3 A;  3LSQ A;  1QVF U;  5B1O A;  1GAX A;  2UXD B;  1ZWI C;  2WLL A;  1Q82 W;  4DR3 B;  4KUM A;  5LA6 A;  2PI5 A;  5IYZ A;  1FXK A;  4NKG B;  1KYO F;  1WAZ A;  3CWB H;  3ETQ A;  3RYC A;  5CA0 B;  2EIJ C;  2QKS A;  1NVP B;  4JI1 B;  2IJI A;  4JI6 O;  1VQ5 V;  1N33 B;  1PL4 A;  4G28 B;  4H33 A;  1R6T A;  4KFM A;  5JJN B;  5B1A B;  4UVA A;  1KBH A;  2Q8V A;  3E83 A;  3QF7 A;  1P7G A;  4DUZ B;  3ABK B;  1Y4M A;  1VF7 A;  3RYF A;  4DR6 O;  4YIP A;  2DN9 A;  1VQN V;  5B1B B;  1FS0 G;  3E8F A;  3QG5 A;  3CCJ V;  1I94 B;  4QIW F;  4DV5 B;  3ASN B;  1SC5 B;  1AR5 A;  4WFE A;  2ZE6 A;  2X6C A;  5JWP A;  3LNN A;  1HW7 A;  2ITC C;  2F66 C;  4PA6 A;  2GUZ A;  5KAI Z;  2GV9 A;  3WB2 A;  3CS5 A;  5TIS Z;  1FKA O;  2UUA B;  2GTA A;  4O4L A;  1EM1 A;  5ITZ B;  3CCQ V;  1Q6U A;  2ZXW C;  5EYP A;  2AZ2 A;  1OCZ C;  2F1M A;  4FM0 A;  4X20 B;  5KX5 B;  2WLI B;  4DR5 O;  1MA1 A;  1OZ0 A;  1P84 F;  1JX9 A;  4Q6G A;  4JAU A;  1Q7Y W;  1S5L Z;  4JI7 O;  3IJ4 A;  4RUE A;  3JCZ A;  4MVQ A;  1VEW A;  2E3C A;  3IAY A;  4LF5 B;  2Q4P A;  1ZUQ A;  1GM7 A;  1U96 A;  1CEZ A;  2DYR B;  2WLJ A;  3K03 A;  3UCS C;  5LYJ B;  2UXD O;  5JH7 A;  3A0R A;  1THZ A;  5LMU B;  4DR3 O;  1TUE B;  3K0D A;  4E2L A;  5LP6 A;  4HBN A;  3F7V C;  4LF6 B;  4UB6 Z;  3N2K B;  1B06 A;  1LR1 A;  3E86 A;  3CRC A;  1M57 C;  1KP3 A;  5BXZ A;  4JI1 O;  1KEC A;  4QPJ A;  1N33 O;  2ADP A;  4FVM A;  1XMO B;  3LDD A;  2ITD C;  3R65 A;  4DUZ O;  4TQF A;  2OIE A;  3SPI A;  3JAS A;  3L74 H;  1Y66 A;  5AG2 A;  2UXB B;  5LHG A;  3OE7 G;  2YIB D;  1I94 O;  4DV5 O;  2Q67 A;  2QM8 A;  3O65 A;  2EIN C;  4Z1V A;  2WA4 A;  4FFK A;  1YDX A;  1HDJ A;  2JGU A;  2LJ2 A;  1XHX A;  5IE9 A;  3AG3 C;  1S72 V;  3OR6 C;  2YI9 A;  4AQY B;  4ZHQ A;  1Q86 W;  4IIJ A;  1FYJ A;  3DXR B;  1NVP D;  2IBZ H;  4QJF B;  3APO A;  2VWK A;  1VQ9 V;  3JSN A;  4W4L A;  3AG2 C;  4GKK B;  4YJ2 B;  4FLT A;  2Q7G A;  2WA3 A;  5JCO C;  2DYS B;  4FLY A;  2CTR A;  3ZHT A;  3CD6 V;  1OCC C;  4YXW G;  1RM1 C;  1IXB A;  4N21 A;  5JQG B;  4NXM B;  4LF5 O;  2Y48 A;  4TV9 A;  2LGQ A;  1YEW A;  1GO3 F;  2PTM A;  1HNX B;  2LGW A;  1S5H C;  1BZK A;  2P6J A;  3WG7 B;  1I5Y A;  5LMU O;  4EB6 B;  4DYL A;  1IBM O;  2F43 G;  1SA0 A;  3JCU Z;  4HZ3 A;  3U10 A;  2WWW A;  3IC7 A;  4DW0 A;  4LF6 O;  5LL6 Y;  5J2T B;  5K1X A;  3B40 A;  3OMI B;  2RQ6 A;  1NBM G;  2YSU B;  1WLE A;  5BZB A;  1YCI A;  1AIL A;  4JI3 B;  1XMO O;  4OX9 B;  3CC7 V;  1KQS U;  3FAV B;  1E1R G;  1S5J A;  1AI5 A;  3D8C A;  1IXM A;  3KKY A;  1Y74 B;  1S0V A;  1NI8 A;  4FLU A;  3UO3 A;  4KHP B;  3FB6 C;  2JRI A;  1VQ8 V;  1SZX A;  4MW8 A;  1ROP A;  2UXB O;  2JDI G;  4F6R A;  1Q43 A;  4GX0 A;  1I0H A;  5E79 Z;  1KD1 W;  3N2G B;  4NXN B;  4JZ2 A;  5DN6 G;  4P9O A;  1X59 A;  4N23 A;  1F7Y A;  4J7Z A;  4C7U A;  5B5E Z;  3CYO A;  1ORQ C;  2A79 B;  1R1B A;  2OCC B;  4AQY O;  4PI0 A;  1TUB A;  4O4H B;  4O4I A;  1NTK H;  1ZTE A;  2CTP A;  3AG1 B;  4IHJ B;  1YJW V;  1M56 B;  1Q6H A;  1N4C A;  1MSD A;  2JVD A;  5A2Q N;  3L72 H;  4ZOL B;  3OGI B;  1K4D C;  2CE4 A;  4WFH A;  1P49 A;  3HKE B;  4GKK O;  4IYH A;  4J42 A;  1ENV A;  3GVM A;  2YIA A;  3K5L A;  4WCE V;  1IBK B;  2BSK A;  4NTY A;  1TVK B;  4NXM O;  2YUA A;  1Q81 W;  4UXN A;  1JMK C;  2ARH A;  1FXH A;  1WA8 B;  1HNX O;  2L6L A;  1VQP V;  1N0J A;  1XIL A;  4YY3 B;  1OCO B;  1YSC A;  3F5T A;  4FZ1 A;  1MOF A;  3BY6 A;  1PNK A;  3C90 A;  1Q3E A;  4LP8 A;  4JI4 B;  4EFE A;  2PYJ A;  2QWQ B;  5EZY B;  3FKS G;  3ABL B;  4JI3 O;  5C8Y B;  4GKJ B;  4OX9 O;  2Q7H A;  2H3O A;  1H8E G;  1SKV A;  4RQF A;  2WLN A;  1JOY A;  5BR8 B;  2R70 A;  4DXW A;  4ZKI A;  4KHP O;  2FTK A;  4QGP A;  2YIB A;  2PGG A;  2XOK G;  5LOV B;  4NXN O;  3JD3 A;  3I56 V;  2ETN A;  4GX5 A;  4CZZ A;  2LFR A;  2PZS A;  3CCR V;  1JFF B;  1ZX3 A;  1R6N A;  5CA1 B;  1V55 C;  2CAZ C;  5L3F A;  3L71 H;  3K06 A;  4L8J A;  4K35 A;  4JYB A;  5CA0 A;  3HKD B;  1CP9 A;  1SET A;  1COW G;  3K9S A;  1IBL B;  3BRC A;  3D3I A;  2WSS G;  3JAK B;  4TT3 G;  2BTO A;  4MVZ A;  4B3S B;  1XL4 A;  5CBG A;  4FZ0 A;  2EIJ B;  3EHB B;  5LHH A;  4U7O A;  3X2Q C;  1RSO A;  2ADQ B;  3CMA V;  1IBK O;  5L3C A;  1VF6 A;  5HFM A;  3ZRW B;  1W0K G;  2QTO A;  2R9A A;  4JAA A;  2Q5Z A;  1H2N A;  3B09 A;  4I55 B;  4LF9 B;  2ODM A;  2VWJ A;  2A7W A;  1NH2 B;  2ZM6 B;  4YY3 O;  2VS0 A;  3JD4 A;  5KAF Z;  3FB8 C;  4W4K A;  1XOU A;  2UUC B;  3VOU A;  4BIO A;  5ITZ A;  1ZL8 B;  2P67 A;  3SYP A;  1FFX A;  4JI4 O;  2AW9 A;  3SPJ A;  4R7C A;  3K3W A;  4F6E A;  2IU0 A;  1WB8 A;  4GKJ O;  4X20 A;  4FM2 A;  5L3G A;  1MZE A;  1YTF B;  4FFB B;  2ZXW B;  1AP6 A;  5BR8 O;  1OCZ B;  1SQB H;  2WLM A;  3JYC A;  5IDJ A;  2W6I G;  3BHP A;  3J7A U;  4O2A A;  2WPD G;  1SQQ H;  4NVP A;  3ZMV A;  3Q4H B;  3OD4 A;  1H38 A;  2YXH A;  4GT1 A;  3DTU B;  1SF9 A;  2FL4 A;  2V4D A;  1BQ0 A;  2QKC A;  3ZED A;  4LF7 B;  3RWR D;  3JSL A;  5J9P C;  4B3M B;  3HKB A;  3GWO A;  4UB8 Z;  4ASU G;  4B3S O;  1XDC A;  1GM8 A;  1QVG U;  2KB1 A;  1M57 B;  3HB3 B;  5BMV A;  1H2K A;  3ETD A;  3K5O A;  4PDR A;  4J11 A;  3K04 A;  4MT8 A;  2EZO A;  5DED A;  2P4K A;  2OTL V;  1CXZ B;  1BS3 A;  2JGD A;  4J7J A;  5JVD B;  4FLZ A;  1FXK C;  1Y76 A;  2ZDI A;  5IWA B;  3OMA B;  2W0F C;  4LF9 O;  5B1N A;  2ZM6 O;  4ZBM A;  3ZRS A;  2EIN B;  5IJ0 B;  2YID A;  4DV6 B;  2UUC O;  3ZIA G;  4BW9 A;  1YIT V;  1XNR B;  1QQC A;  3W7T A;  3AG3 B;  1Z5W A;  2CH7 A; 
#chains in the Genus database with same CATH homology
 2L6L A;  2PF4 E;  2CUG A;  1FAF A;  2CTQ A;  2EJ7 A;  2QWO B;  3BVO A;  1WJZ A;  2GUZ A;  2OCH A;  2N05 A;  2YS8 A;  4J7Z A;  3APQ A;  2DMX A;  3APO A;  2LGW A;  2QWN B;  2Y4U A;  2Y4T A;  2N04 A;  1GH6 A;  1NZ6 A;  2CTW A;  2QWP B;  2GUZ B;  2DN9 A;  2M6Y A;  3UO3 A;  2QWR B;  1IUR A;  1HDJ A;  1FPO A;  2LO1 A;  3AG7 A;  4IT5 A;  2YUA A;  2CTP A;  2KQX A;  4RWU A;  2QWQ B;  1BQZ A;  2CTR A;  1XBL A;  3UCS C;  3UO2 A;  2QSA A;  1BQ0 A;  1N4C A;  4J80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...