2N1GA

Structure of c-terminal domain of human polymerase rev1 in complex with pold3 rir-motif
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
NLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Interaction between the Rev1 C-Terminal Domain and the PolD3 Subunit of Pol zeta Suggests a Mechanism of Polymerase Exchange upon Rev1/Pol zeta-Dependent Translesion Synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 94
sequence length 94
ec nomenclature ec 2.7.7.-:
pdb deposition date 2015-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n1gA00
2LSYA 2LSJA 2N1GA 3VU7H 4BA9A 2LSGA 4GK5E 4EXTA 2LSIA 4FJOA 4GK0E 2LSKA
chains in the Genus database with same CATH superfamily
5F5WA 4IE4A 4O2BE 3TKLB 2CM0A 2V6YA 2VWAA 5J1GA 3UU4A 3CKDA 2CWOA 3I0OA 1XDOA 2JQHA 3ONJA 4JI2T 3N9NA 5HCJA 4YTNA 2CWYA 5LG4A 2E5LT 1OEDB 5JDFA 4ZI3C 2ODUA 3CX8B 3Q5WA 2CA5A 1S35A 4HTEA 2Y8DA 4TZ4C 2XTLA 3LBXB 5EK2A 2K5BB 3AXJB 2Y48B 4WBNE 2V5CA 4B3MT 4HWIB 3FZMB 5JR9C 3EABA 2K9AA 2IIUA 4OYKA 2L8KA 2LHRA 1WR6A 5FXVA 5AQFB 1E7PA 2CLYB 1WYCA 3K8PC 1IJ5A 4NIQA 3HKDE 3NRYA 4ZS2A 3HKCE 1X79A 2WMNA 4U31A 2ODVA 1HNZT 3I9WA 4CXYA 2FJAA 2Q9QC 2X9YA 4IE6A 1XNQT 2W61A 4EAHA 4YSZA 5FP3A 1T8BA 3KBUA 4NUVA 4YHJA 5CA1E 2IUBA 4X62T 3RKGA 2XQ6A 3G06A 3QB5K 3OTOT 3CVRA 4GK5E 4HN9A 2CHNA 1CUNA 2VL8A 1FEWA 4PFPA 4PNIA 1UUSA 3M3ZB 3J7Yq 4AIUA 1DU2A 1OEDA 4QX7B 3LG7A 1I6ZA 3LBXA 5DJQC 1KNRA 2PJQA 3DTOA 4AQYT 1MNDA 2WS3A 4XAXB 4ZI7E 3AXJA 2A2FX 3AA7B 5LNKA 4UVBB 3RYHE 1JNZA 2DHRA 5KDMC 1BR0A 4LF9T 4JLEA 2BVMA 4A56A 3QNUA 4PJLA 2CEAA 2YEVC 3RF1A 4J2CA 4UXNB 5LMUT 4DBRA 4DV2T 4KMCA 4UIGA 1T7SA 2JIWA 4JI3T 3AE3A 3CPZA 4ADZA 3AAAB 3P4WA 1L0VA 3IF8B 1HCIA 4JI5T 3CQCB 2X9HA 2X9XA 3P4RA 3AE5A 3ETUA 2CHOA 4EV6A 1D0XA 2V6XA 5HEGA 5L3CB 3ONXA 5HCMA 4XBFB 3ZMTB 1XZYA 1J5ET 4DR6T 1Z0PA 4HFCA 3FXEB 2QVAA 3ZJ2A 3SRZA 4I4TE 1KNPA 4DVDA 4DR3T 3AECA 5LB7B 5DQWA 4IDQA 5L2LA 3H3MA 3ZMUB 2C0SA 3MZKB 4P1NA 3F57A 4U7YA 2FJDA 2BDEA 2CPTA 2ZLYA 2HPJA 3UTKA 5CB4E 4X1YE 2BBJA 1W0BA 4DV6T 1BR1A 2WDRA 2IC6A 2WU2A 2LKHA 3ZSSA 1QLBA 1J1JA 3GA8A 3VRAA 5L3FB 4QH4A 4DR2T 1HTJF 3PTRB 3TLWA 1YKEB 2CXLA 4IE7A 2UUCT 4JI0T 1WRDA 4O4HE 4ZI2D 2XUEA 1SA0E 1MNEA 4WBOA 3FBLA 4HWFA 4LFBT 3PV0F 2HHHT 2Z6EA 5HXSA 2K24A 5FXZA 1KEYA 4CN1A 2IDOB 3SFEA 3N9LA 2WAUA 3L3PA 2L3LA 1NEKA 4DIDB 5LYJE 5AQVB 1E2AA 4AXPA 4CI2B 2QA7A 5FKYA 1SHZC 3CK6A 1MIVA 3H3AA 1HR0T 2UXBT 4UF0B 5LGTB 2E5VA 1OEDE 1HS7A 2XQYA 4IL4A 2XAFB 3M65A 4BJMA 2W62A 4YLHA 4O4IE 2YU2A 2MBGA 4HFHA 2N9DA 1XNRT 3D0TA 2W2UA 2L9QA 4X1IE 4UV9B 5ABGA 4JI6T 4DMWA 4X20E 5JQGE 3JC6C 2B76A 4LF7T 2BZBA 5LP6E 2F4VT 3HKEE 2WU5A 4F6RC 4CN6A 4HFDA 2BG9E 2JQKA 1KNZA 4A5XA 4K0UA 3L8RA 3NRXA 2N1GA 4IT4A 1FMWA 4GYSA 4L9IA 1WCRA 2E9XB 4ZS3A 4GYRA 3MJXA 5C2TA 3LSVA 2XAGB 4AKIA 4IGUA 5HWXA 1YW0A 2ZM0A 2VVSA 5EZYE 2J1DG 3RPUA 4AQFC 1WLXA 3O1IA 2LM2A 3SWHA 1IBKT 4H9QC 4PJNA 1HFAA 2LE8A 4C91A 3Q9DA 1ZOYA 4NPPA 4UF0A 4HWDA 3A5XA 4PAGA 5AQHB 4P09A 3Q5DA 3P50A 4E7SA 4YT0A 5J2TE 4QXCB 2MTQA 1B7TA 3VKHA 1BR2A 2EHOC 2WWUA 4O2AE 3J9X1 2WB5A 5KX5E 3RIAA 4GKJT 2XPKA 1HF8A 5HXEA 2IMLA 4Z90A 2CCQA 4PW8A 3K3NA 5KXJA 5AQRB 5LJMA 2W00A 3VR8A 2PBIA 5TAOA 2CXFA 1D1BA 2NW8A 5F8PA 2V7JA 1IBLT 1M62A 2LOSA 4KP3C 1UX4A 4ILBA 1Y01A 4YJ2E 3ZC1A 3AA6B 3N9QA 2D9DA 3C4WA 3KDSE 4HFBA 3RRCA 5AQGB 1FJGT 2VKJA 2VL0A 4BAYB 5L3EB 3RI5A 3UUBA 2W4XA 2RP4A 1U5PA 2JMKA 1W09A 1E1HB 2MPKA 2W0GA 2G0UA 4LF6T 4ZXLA 3RKOA 2BVLA 4YSXA 5ABFB 3RRWA 2WDVA 3N9PA 3UU5A 2UUBT 1VOMA 5JH7E 2I0MA 2X9WA 3SS1A 3ONLC 5IHYA 4AKRB 1VCSA 4NXNT 4UV8B 5HEUA 1VRBA 4H9SE 4TN7B 2IW5B 2A3DA 4PFOA 4YJ3E 4JV5T 4G2AA 1UURA 2JJ9A 1HNWT 2VASA 4JEHB 5FYMA 1ZHCA 3T1YT 1S94A 4OYJA 4QXHB 3AAEB 3R6NA 5DABA 4AISA 2H7OA 1R8IA 4I43B 4Q25A 3RGLA 1G73A 2WBLA 3ZT5A 5HEJA 4ZI3D 1D1CA 2IHR1 2XZEA 2PFVA 4DR1T 3F31A 2BKNA 3AVSA 2MOZA 2LRKA 1YD8G 5L47A 4OX9T 3AA0B 4WW0A 2XAQB 3P8CD 5C3JA 4ASKA 2CBJA 3AEDA 2D2SA 2BG9B 4B3TT 1KFYA 2DCFA 3AE6A 5IYZE 1LKXA 4EB6E 2NP9A 4JI1T 4QWNB 1D0ZA 5A1LA 4UEMA 2A72A 5ABFA 5LCYA 2NTXA 3P4PA 2ACZA 2VK9A 2Q9QD 5JRCB 4MLKA 4NXMT 4DO0A 1MMNA 3ZT7A 4ZHQE 3HI2A 3ZKRA 4MFRA 2M67A 2XASB 3RC8A 3AE8A 2WDQA 4H63V 4DMVA 3FZHB 4B3ST 2XSAA 2UXXB 4ISTA 5HEHA 1IJ6A 5LG3A 2V26A 4QKNA 4EEBA 2BBHA 4U3CA 4I50E 4DNDA 3PUYF 2X51A 2XY8B 3CX7B 3OJAA 2YDQA 1J5WA 5C8YE 3UFEA 4U2YA 2XSBA 3IBPA 1UCUA 5JR9B 4PJJA 1OXZA 2K48A 4OHFA 3F2EA 4KBMB 1YKHB 4DBQA 3P7IA 2XQ8A 2LEHA 5HWYA 2X0YA 5H6QB 5HXCA 3FBZA 2BG9A 1HG5A 3RIUA 4H9NC 1SUMB 3MK7C 3EDUA 4ERRA 2Q9QB 2XQ7A 4M1PA 4HFIA 2KNDA 3VU7H 3LK3B 5M4YA 3KV9A 3AEGA 4EXTA 2FUPA 2CRBA 2ZM6T 4FI5A 5FXWA 2VVNA 2V7KA 3EVYA 3UUMA 5JRCA 1XMOT 3RLFF 1X9BA 2MYSA 2M6IA 2NOXA 3OBVE 5F3JA 3C64A 4OK0A 1MIYA 3QK6A 4JI7T 4B6XA 1WR0A 3PUZF 3PU3A 4HFVA 3BQKA 4DR5T 2LSJA 5BR8T 4IIJE 3C51A 3Q5EA 4IDZA 3KV6A 1ZV4X 4IREA 2CBIA 4HWCA 3AEAA 4U33A 2AE9A 5JDLA 3CIRA 1OWAA 4Z91A 2OA5A 2DWGA 4IDOA 5JR9A 5JDGA 3IA3A 5JDHA 3BK9A 2DL1A 2NW9A 2PG8A 4EYUA 3LJCA 3ZN0B 2QRXA 3VRBA 2WWVA 2WP9A 3DJBA 2VURA 1HX8A 3SFDA 4CN4A 2X67A 3PU8A 3P4SA 5H6RB 3ZCJA 3TLVA 5ETWA 3NVOA 5LMNT 1XWMA 4JYAT 3X1DA 2Q9QA 3WI3A 3PE0A 4TWDA 3KV5A 1ZKEA 3N5LA 2J62A 2VB6A 4EEDA 4N78D 5JDMA 4YFSA 5EK3A 4WYVA 4HWHA 2ES0A 3E0ZA 4HE8A 4L0RA 2NR4A 5JTGA 1HNXT 1MIWA 3JADA 2HPLA 5FMNA 5AQJB 5AQLB 4ILUA 4ZOLE 2KWIB 3C4XA 3C50A 4DV5T 5HXRA 3O4XE 3JAEA 4H9PC 1D0YA 2FBWA 1HG2A 2X0LB 3L09A 3NZPA 3AE2A 4COFA 4KX6A 2V8SV 1XMQT 2JQ9A 2H89A 1T98A 2C5KT 3OKQA 1NAFA 3CMLA 3K1SA 2W67A 3VHLA 3ZMVB 3R84B 4DUYT 2XM1A 1I94T 4TV9E 4BA9A 5AFUL 3KBTA 1XDPA 3N2GE 3JC6D 4QX8B 4NUUA 1W9RA 4P0AA 3NBXX 3LK42 3E08A 5AQTB 4X65T 4DV4T 5AQNB 2V7IA 4UVAB 3UQ7A 3KINB 3QB5A 2SPCA 1LVKA 2X0HA 4X1KE 5CJ5A 3CQXC 4G63A 4KHPT 1YQ3A 5IWAT 1UGOA 3QC9A 2W63A 1AJ3A 4AKLA 3KFWX 3RH3A 5CA0E 3ESLA 2HH7A 3EUHA 3GN5B 5FXXA 2K3WA 1JNRA 1MMAA 3KVAA 5HYAA 1OEDC 3V5UA 5HEOA 2XQAA 2EHOD 3VKGA 1U4QA 1ZP0A 1YXRA 3U78A 4DR4T 2LJLA 4CXXA 2YK0A 3PJAJ 3RYFE 3ZCIA 2XAJB 3TLUA 3A8YC 5AQMB 2QGSA 4CZZB 4IDNA 4DV0T 3UQ4A 4MBQA 3OVUA 4JBWF 5L4HA 4I55E 2CLYC 4BJNA 2BS4A 2VQFT 4YY3T 2ZM2A 3ZYKA 3K3QC 1W0AA 4KI0F 4LMLA 4OFZA 1NENA 5LBQB 2CE7A 4EYYR 4C90A 4XZCA 2WM9A 5BMVE 3LFMA 2J4GA 2AXDS 4LF5T 4QH1A 2WQYA 4HGAA 3AEEA 2KSRA 2KWHA 4CXWA 2V5DA 3IHRA 4X5TA 3MXZA 5JDQA 4KHZF 4AI6A 3PUSA 3PUWF 5KMGP 1N34T 2EHOB 3GN5A 2GK9A 4IDPA 3ZT6A 4U72A 2X66A 4IE5A 4QHOA 2XHEB 2DLRA 5FY7A 1V9DA 4ZZCA 3PUVF 5GONE 2N2NA 2X68A 2DNXA 4ISSA 3AB3B 4YXDA 5AQIB 1IAPA 2LLYA 2ZM8A 2VKOA 3UULA 1UK5A 3KVBA 2I59A 4F8HA 3NZQA 3AEFA 4YTMA 3S4UA 5LOVE 3I0QA 5AQSB 1VCTA 2H7VC 2VKDA 3N2OA 5AQOB 2FJBA 4TX5A 3CWZB 3SOLA 4PK6A 2BS3A 2LRLA 4CI1B 2KINB 3E22E 5LXTE 2KZ7B 1FIOA 1FMVA 3RC3A 2V1DB 5LHHB 5CGMA 3RQUA 2B1EA 2RA1A 4AQFA 2YINA 2KLQA 2C5IT 2YN6A 5LGNB 2NTYA 4E7ZA 2DWKA 2XQ5A 3UFGA 1UX5A 4V1Av 4JI8T 1G8XA 3O1HA 3V5SA 3I9YA 2MAWA 2CMRA 4IL9A 2EHOA 3P4QA 5AQKB 4X64T 3N2KE 5FY1A 4UELA 2YKSA 3GMIA 3AEBA 2NWBA 5FNVE 3PUXF 4TNVA 2VKHA 3QOFA 1WFDA 5FVKA 4YSYA 5JVDE 4ILCA 1ZEEA 4EZHA 4U74A 3BQLA 1N33T 5DQVA 5JREA 2XQ4A 5L4EA 5FY0A 5J0ZA 3ZMZB 2JRKA 5AQPB 2YDRA 2E8IA 4ZZBA 1US7B 4L5GA 1O3XA 3MACA 2KMFA 2LOPA 1H7CA 1M7KA 5CFBA 2LT3A 3FZLB 3FZFB 2I6HA 4P0BA 3QUJA 3RQWA 1D1AA 3AE9A 3I1AA 3RYCE 3KV4A 4U7IA 3FZKB 3T1HT 2WMOA 3O1JA 4WNKA 3EAMA 2XJ7A 4HEAA 2E2AA 3ZMSB 4EZ4A 2V7MA 2UXDT 4H9RC 2JMHA 2WCAA 3EDVA 3OPCA 1GQEA 3AE4A 4CI3B 3W15B 4DV1T 3CQGB 3EHZA 3TLTA 4GK0E 2LSYA 2OV9A 2LHNA 2XAHB 3PUQA 2JPFA 4TUYE 4LMKA 3HKBE 4H9OC 2J47A 3AE7A 2UXNB 3WAKA 2BKOA 3CX6B 1QSDA 2WSSV 3PJAA 4H63H 4HFEA 1WYBA 3T8OA 4ZI2C 3VR9A 3OYXA 4JUYA 5JDNA 1LVFA 4X66T 2LSGA 1EZ3A 3A7MA 3LDQB 2WY2A 4I0UA 3N9MA 4HKAA 3Q5XA 2UUAT 3H37A 4DR7T 4FJOA 3UT5E 2LSKA 4LFCT 1MMGA 5ABHA 1SE7A 2D0TA 5L3DB 2UU9T 4WZXA 4MHCA 3B57A 3LK2B 3MKDA 4TWHA 3K3OA 3ZYMA 3ZYLA 2E9XC 4AKGA 3RYIE 1Z8UA 3FXDB 3WAJA 3O9XA 3TLSA 2IAKA 3ZJ1A 4YTPA 5FL0A 5IUXA 3MA9A 4GKKT 2QYWA 3HR0A 3UU3A 5AQQB 3EI0A 2D0UA 5AQUB 2E9XD 3AAIA 5LBMA 4PK5A 1T72A 2V7LA 1IBMT 3ZLIA 1YQ4A 2XQ9A 2NW7A 2LKGA 2LM9A 2XQ3A 4EIWA 1QUUA 4GIWA 5LJNA 5E0OA 3AVRA 4EGWA 1BR4A 1LRZA 2YU1A 1HX1B 5FVLA 4IE0A 3Q2MA 2YOEA 2C5JA 3DP7A 2VQET 4IHJE 5L3BB 3ZSTA 4DV7T 4TWFA 3IEEA 1NWMX 3AE1A 3B13A 3ZPOA 3RIFA 5FL1A 2W66A 4KUMB 4AQGA 4DUZT 3C98B 3PDYA 4O8SA 4LF4T 3PURA 3ETVA 2WZHA 2R6GF 3ABVA 3UU6A 3NWIA 3N9OA 3ANWB 4A97A 5LHIB 3UU8A 2HN2A 3ZEFB 3C4ZA 4MALA 3RHWA 2OLTA 5ABEA 2DI4A 2BS2A 4EOZB 3BQIA 2UXCT 5LHGB 1KK7A 2ACXA 2Y6XA 3ZN1B 4ANJA 3UUXB 4UR9A 4LFAT 2V6YB 3NKZA 4TV8E 2HN1A 2PTFA 3U3IA 5LGUB 4QXBB 3JCFA 1N36T 2A9UA 4ILAA 3ZC0A 3L39A 4UVCB 4DV3T 4JI4T 2WZIA 2H88A 4PJMA 5HXHA 3FB2A 2RPAA 2FJEA 3PUAA 5LA6E 2IC9A 4TNWA 5L3GB 2JQQA 4YHHT 2XM2A 2CXDA 1MMDA 1N32T 3HL6A 4A98A 4Z8XA 3UUNA 1KF6A 4QH5A 4LF8T 2YDSA 3PUGA 4U2ZA 2H3RA 3B5MA 4AKHA 1Y64B 1IZNB 3HA4A 4ZEYA 3GWHA 2KXPB 2LSIA 4O4LE 2BG9C 1CHUA 4GOUA 3JAFA 4CQIA 5J2UE 3RIUC 2KT9A 2E9XA 4JEUB 2BKPA 3FHNA 3RX6A 5HAXA 4K0KT 2M6BA 2ZMAA 5EK4A 2D5UA 4B3RT 3OYZA 3ANWA 5ADXL 4PK4A 3AA1B 2P9BA 4O4JE 4LMJA
chains in the Genus database with same CATH topology
2E9XB 1ZEEA 4EZHA 4U74A 4ZS3A 4GYRA 4IE4A 3DJBA 4O2BE 3MJXA 3TKLB 2CM0A 3BQLA 2XAGB 4AKIA 2VWAA 5DQVA 1HX8A 2X67A 5J1GA 3PU8A 4IGUA 5JREA 3CKDA 5HWXA 1YW0A 5H6RB 2ZM0A 2CWOA 3I0OA 5FY0A 3ZCJA 3ZMZB 5ETWA 3N9NA 5EZYE 2JRKA 2J1DG 2E8IA 3RPUA 2Q9QA 3WI3A 3PE0A 1WLXA 2CWYA 3O1IA 4AQFC 5LG4A 3KV5A 1ZKEA 3SWHA 3N5LA 4H9QC 4PJNA 1US7B 1HFAA 2LE8A 4C91A 3Q9DA 2VB6A 5JDFA 4ZI3C 4L5GA 1O3XA 2ODUA 3CX8B 3MACA 3Q5WA 4UF0A 2CA5A 4N78D 5JDMA 1S35A 4HTEA 2Y8DA 3A5XA 4PAGA 4TZ4C 4P09A 4YFSA 2XTLA 5EK3A 3LBXB 2KMFA 5EK2A 2ES0A 2LOPA 4E7SA 2K5BB 5J2TE 3E0ZA 4QXCB 1H7CA 2MTQA 4HE8A 1B7TA 4L0RA 2LT3A 3VKHA 1BR2A 2Y48B 4WBNE 2EHOC 4P0BA 1MIWA 2WWUA 4O2AE 3QUJA 3J9X1 5KX5E 5JR9C 2K9AA 1D1AA 1HF8A 5HXEA 4OYKA 3I1AA 3RYCE 2CCQA 2L8KA 3KV4A 2LHRA 4PW8A 3K3NA 1WR6A 2HPLA 5FMNA 5LJMA 2WMOA 2W00A 3O1JA 5FXVA 2PBIA 2CLYB 5TAOA 4WNKA 2CXFA 1WYCA 1D1BA 2NW8A 5F8PA 3K8PC 4ILUA 4ZOLE 2KWIB 2V7JA 3C4XA 1IJ5A 3C50A 4HEAA 3HKDE 3NRYA 4ZS2A 3HKCE 3ZMSB 1X79A 2LOSA 2WMNA 4KP3C 2ODVA 1UX4A 4EZ4A 5HXRA 3O4XE 2V7MA 4H9RC 3I9WA 2JMHA 4H9PC 3EDVA 4CXYA 1D0YA 2Q9QC 1HG2A 2X9YA 4IE6A 4YJ2E 2W61A 2X0LB 4EAHA 3ZC1A 3AA6B 3N9QA 5FP3A 3C4WA 3KDSE 3L09A 3NZPA 3RRCA 2VKJA 4CI3B 3KBUA 3W15B 3CQGB 4NUVA 4YHJA 4GK0E 2LSYA 4BAYB 5L3EB 5CA1E 2LHNA 1T98A 2RP4A 1U5PA 2JMKA 2XAHB 2C5KT 3OKQA 1NAFA 3CMLA 3PUQA 2JPFA 4TUYE 3VHLA 1E1HB 2W0GA 2G0UA 3ZMVB 3HKBE 4H9OC 2UXNB 3R84B 3WAKA 3CVRA 4GK5E 4HN9A 1CUNA 2VL8A 1FEWA 3CX6B 3RKOA 2BVLA 1QSDA 2WSSV 4H63H 4TV9E 1WYBA 4PNIA 4PFPA 4BA9A 5AFUL 3KBTA 3J7Yq 3T8OA 4ZI2C 3N2GE 3JC6D 4QX8B 3OYXA 4JUYA 5JDNA 1LVFA 2LSGA 1EZ3A 4NUUA 3RRWA 3N9PA 1VOMA 5JH7E 4P0AA 2X9WA 3N9MA 4HKAA 3Q5XA 3NBXX 3SS1A 3LK42 4QX7B 5IHYA 3H37A 3LG7A 3E08A 4FJOA 2LSKA 3LBXA 3UT5E 4AKRB 5DJQC 4UV8B 2PJQA 1VRBA 4H9SE 3DTOA 4TN7B 1MNDA 4XAXB 2V7IA 2IW5B 4ZI7E 4UVAB 2A2FX 2A3DA 3KINB 4PFOA 3AA7B 4YJ3E 5LNKA 2SPCA 1LVKA 4X1KE 1MMGA 4G2AA 2JJ9A 4UVBB 3CQXC 2VASA 3RYHE 4G63A 4JEHB 5FYMA 1ZHCA 2DHRA 5KDMC 1S94A 4OYJA 1BR0A 2D0TA 5L3DB 4MHCA 4QXHB 4JLEA 2BVMA 3B57A 4A56A 4PJLA 2CEAA 3AAEB 3LK2B 3MKDA 2YEVC 3QC9A 4J2CA 3R6NA 5DABA 2W63A 4UXNB 1AJ3A 3K3OA 3ZYMA 3ZYLA 2H7OA 4AKLA 3KFWX 2E9XC 3RH3A 5CA0E 4DBRA 4AKGA 3RYIE 4KMCA 4UIGA 4I43B 3FXDB 3ESLA 1G73A 2WBLA 3WAJA 3O9XA 2HH7A 2IAKA 3EUHA 3ZJ1A 4ZI3D 1D1CA 3GN5B 3CPZA 2PFVA 4ADZA 3F31A 3AAAB 5FXXA 3MA9A 3IF8B 3AVSA 2MOZA 1HCIA 3CQCB 2X9HA 1YD8G 2X9XA 3HR0A 1MMAA 2D0UA 3KVAA 5HYAA 3AA0B 3V5UA 3ETUA 2E9XD 3AAIA 4WW0A 2XAQB 5LBMA 4PK5A 1D0XA 2EHOD 3P8CD 3VKGA 5L3CB 3ONXA 1U4QA 4ASKA 4XBFB 2V7LA 3ZMTB 3U78A 2LJLA 3ZLIA 2D2SA 2NW7A 4CXXA 2LM9A 1Z0PA 2YK0A 3RYFE 2DCFA 3FXEB 3ZCIA 3ZJ2A 3SRZA 2XAJB 5IYZE 1LKXA 2QGSA 4I4TE 2NP9A 4CZZB 4EB6E 4DVDA 4EIWA 1QUUA 4MBQA 4GIWA 5LJNA 5DQWA 5E0OA 5L2LA 3ZMUB 2C0SA 3AVRA 3MZKB 4QWNB 1BR4A 1D0ZA 5A1LA 4I55E 4UEMA 3F57A 1LRZA 2A72A 2YU1A 2CLYC 2BDEA 5LCYA 2NTXA 4BJNA 2ZLYA 2VK9A 2ZM2A 2HPJA 2Q9QD 4IE0A 5CB4E 3UTKA 3ZYKA 3Q2MA 4MLKA 5JVDE 5JRCB 3K3QC 4DO0A 4X1YE 1MMNA 4ZHQE 2C5JA 3DP7A 1BR1A 3HI2A 4IHJE 4OFZA 5LBQB 5L3BB 2CE7A 4EYYR 4C90A 4XZCA 2WM9A 2IC6A 4MFRA 5BMVE 3LFMA 3IEEA 2M67A 1NWMX 2XASB 3RC8A 3GA8A 4H63V 4DMVA 5L3FB 3B13A 4HGAA 1HTJF 3PTRB 3ZPOA 1YKEB 4KUMB 2CXLA 2UXXB 4ISTA 1IJ6A 4IE7A 4CXWA 2KWHA 4AQGA 3IHRA 3MXZA 2V26A 4QKNA 3C98B 3PDYA 4O8SA 4I50E 4DNDA 2X51A 3CX7B 3PURA 3OJAA 5JDQA 1WRDA 4O4HE 5C8YE 3ETVA 4AI6A 4ZI2D 2XUEA 1SA0E 3PUSA 5KMGP 3UFEA 1MNEA 2EHOB 3IBPA 4WBOA 3GN5A 2GK9A 3FBLA 3N9OA 3ANWB 1UCUA 5JR9B 5LHIB 2Z6EA 5HXSA 2K24A 3ZEFB 4PJJA 1OXZA 4U72A 5FXZA 2X66A 3C4ZA 4MALA 2K48A 4IE5A 4QHOA 4OHFA 2DI4A 4EOZB 2XHEB 3F2EA 4KBMB 3BQIA 1YKHB 2DLRA 5FY7A 4DBQA 5LHGB 1V9DA 1KK7A 2ACXA 3P7IA 2Y6XA 3N9LA 3ZN1B 2WAUA 5GONE 3L3PA 2LEHA 5HWYA 2L3LA 2N2NA 2X68A 3UUXB 4ANJA 2DNXA 5H6QB 4ISSA 3AB3B 5HXCA 5LYJE 3FBZA 1IAPA 1HG5A 4TV8E 2ZM8A 4AXPA 4CI2B 2VKOA 3UULA 3KVBA 3U3IA 4H9NC 5LGUB 3MK7C 4QXBB 3EDUA 4ERRA 2I59A 2Q9QB 2QA7A 3NZQA 4M1PA 2KNDA 1SHZC 3S4UA 5LOVE 3VU7H 3I0QA 3ZC0A 3LK3B 4UVCB 5M4YA 1MIVA 3H3AA 3KV9A 4PJMA 4UF0B 5HXHA 3FB2A 2H7VC 2VKDA 4EXTA 5LGTB 3N2OA 4FI5A 5FXWA 1HS7A 4TX5A 3CWZB 3SOLA 4PK6A 2XQYA 2V7KA 2XAFB 3EVYA 3PUAA 3UUMA 5LA6E 5JRCA 3M65A 2IC9A 4BJMA 2W62A 2MYSA 4YLHA 4CI1B 4O4IE 2YU2A 5L3GB 2JQQA 2MBGA 2KINB 3E22E 5LXTE 2CXDA 2NOXA 2KZ7B 1MMDA 1FIOA 3OBVE 5F3JA 3C64A 4OK0A 2N9DA 1FMVA 3RC3A 1MIYA 2V1DB 5LHHB 3HL6A 2B1EA 2RA1A 3QK6A 4Z8XA 3UUNA 3D0TA 4B6XA 3PUGA 4AQFA 2L9QA 2YINA 2KLQA 2H3RA 3PU3A 4AKHA 4HFVA 4X1IE 1Y64B 2C5IT 3BQKA 1IZNB 4UV9B 2LSJA 5LGNB 3HA4A 4IIJE 2NTYA 3GWHA 2KXPB 2LSIA 4E7ZA 4O4LE 3C51A 4IDZA 4DMWA 2DWKA 3KV6A 4X20E 5JQGE 1ZV4X 1UX5A 3JC6C 4GOUA 4V1Av 4CQIA 5J2UE 1G8XA 3O1HA 3V5SA 3I9YA 2KT9A 2E9XA 4JEUB 2CMRA 5JDLA 3FHNA 3RX6A 1OWAA 5HAXA 2BZBA 2OA5A 5LP6E 2EHOA 2DWGA 2ZMAA 5EK4A 2D5UA 3HKEE 3N2KE 4F6RC 3OYZA 3ANWA 5JR9A 5FY1A 5ADXL 4UELA 5JDGA 3GMIA 4PK4A 5JDHA 1KNZA 2NWBA 3BK9A 5FNVE 3AA1B 2P9BA 2NW9A 2PG8A 2VKHA 4O4JE 4EYUA 3LJCA 4K0UA 3NRXA 2N1GA 3ZN0B 1FMWA 4GYSA 4L9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSY A;  2LSJ A;  2N1G A;  3VU7 H;  4BA9 A;  2LSG A;  4GK5 E;  4EXT A;  2LSI A;  4FJO A;  4GK0 E;  2LSK A; 
#chains in the Genus database with same CATH topology
 5F5W A;  4IE4 A;  4O2B E;  3TKL B;  2CM0 A;  2V6Y A;  2VWA A;  5J1G A;  3UU4 A;  3CKD A;  2CWO A;  3I0O A;  1XDO A;  2JQH A;  3ONJ A;  4JI2 T;  3N9N A;  5HCJ A;  4YTN A;  2CWY A;  5LG4 A;  2E5L T;  1OED B;  5JDF A;  4ZI3 C;  2ODU A;  3CX8 B;  3Q5W A;  2CA5 A;  1S35 A;  4HTE A;  2Y8D A;  4TZ4 C;  2XTL A;  3LBX B;  5EK2 A;  2K5B B;  3AXJ B;  2Y48 B;  4WBN E;  2V5C A;  4B3M T;  4HWI B;  3FZM B;  5JR9 C;  3EAB A;  2K9A A;  2IIU A;  4OYK A;  2L8K A;  2LHR A;  1WR6 A;  5FXV A;  5AQF B;  1E7P A;  2CLY B;  1WYC A;  3K8P C;  1IJ5 A;  4NIQ A;  3HKD E;  3NRY A;  4ZS2 A;  3HKC E;  1X79 A;  2WMN A;  4U31 A;  2ODV A;  1HNZ T;  3I9W A;  4CXY A;  2FJA A;  2Q9Q C;  2X9Y A;  4IE6 A;  1XNQ T;  2W61 A;  4EAH A;  4YSZ A;  5FP3 A;  1T8B A;  3KBU A;  4NUV A;  4YHJ A;  5CA1 E;  2IUB A;  4X62 T;  3RKG A;  2XQ6 A;  3G06 A;  3QB5 K;  3OTO T;  3CVR A;  4GK5 E;  4HN9 A;  2CHN A;  1CUN A;  2VL8 A;  1FEW A;  4PFP A;  4PNI A;  1UUS A;  3M3Z B;  3J7Y q;  4AIU A;  1DU2 A;  1OED A;  4QX7 B;  3LG7 A;  1I6Z A;  3LBX A;  5DJQ C;  1KNR A;  2PJQ A;  3DTO A;  4AQY T;  1MND A;  2WS3 A;  4XAX B;  4ZI7 E;  3AXJ A;  2A2F X;  3AA7 B;  5LNK A;  4UVB B;  3RYH E;  1JNZ A;  2DHR A;  5KDM C;  1BR0 A;  4LF9 T;  4JLE A;  2BVM A;  4A56 A;  3QNU A;  4PJL A;  2CEA A;  2YEV C;  3RF1 A;  4J2C A;  4UXN B;  5LMU T;  4DBR A;  4DV2 T;  4KMC A;  4UIG A;  1T7S A;  2JIW A;  4JI3 T;  3AE3 A;  3CPZ A;  4ADZ A;  3AAA B;  3P4W A;  1L0V A;  3IF8 B;  1HCI A;  4JI5 T;  3CQC B;  2X9H A;  2X9X A;  3P4R A;  3AE5 A;  3ETU A;  2CHO A;  4EV6 A;  1D0X A;  2V6X A;  5HEG A;  5L3C B;  3ONX A;  5HCM A;  4XBF B;  3ZMT B;  1XZY A;  1J5E T;  4DR6 T;  1Z0P A;  4HFC A;  3FXE B;  2QVA A;  3ZJ2 A;  3SRZ A;  4I4T E;  1KNP A;  4DVD A;  4DR3 T;  3AEC A;  5LB7 B;  5DQW A;  4IDQ A;  5L2L A;  3H3M A;  3ZMU B;  2C0S A;  3MZK B;  4P1N A;  3F57 A;  4U7Y A;  2FJD A;  2BDE A;  2CPT A;  2ZLY A;  2HPJ A;  3UTK A;  5CB4 E;  4X1Y E;  2BBJ A;  1W0B A;  4DV6 T;  1BR1 A;  2WDR A;  2IC6 A;  2WU2 A;  2LKH A;  3ZSS A;  1QLB A;  1J1J A;  3GA8 A;  3VRA A;  5L3F B;  4QH4 A;  4DR2 T;  1HTJ F;  3PTR B;  3TLW A;  1YKE B;  2CXL A;  4IE7 A;  2UUC T;  4JI0 T;  1WRD A;  4O4H E;  4ZI2 D;  2XUE A;  1SA0 E;  1MNE A;  4WBO A;  3FBL A;  4HWF A;  4LFB T;  3PV0 F;  2HHH T;  2Z6E A;  5HXS A;  2K24 A;  5FXZ A;  1KEY A;  4CN1 A;  2IDO B;  3SFE A;  3N9L A;  2WAU A;  3L3P A;  2L3L A;  1NEK A;  4DID B;  5LYJ E;  5AQV B;  1E2A A;  4AXP A;  4CI2 B;  2QA7 A;  5FKY A;  1SHZ C;  3CK6 A;  1MIV A;  3H3A A;  1HR0 T;  2UXB T;  4UF0 B;  5LGT B;  2E5V A;  1OED E;  1HS7 A;  2XQY A;  4IL4 A;  2XAF B;  3M65 A;  4BJM A;  2W62 A;  4YLH A;  4O4I E;  2YU2 A;  2MBG A;  4HFH A;  2N9D A;  1XNR T;  3D0T A;  2W2U A;  2L9Q A;  4X1I E;  4UV9 B;  5ABG A;  4JI6 T;  4DMW A;  4X20 E;  5JQG E;  3JC6 C;  2B76 A;  4LF7 T;  2BZB A;  5LP6 E;  2F4V T;  3HKE E;  2WU5 A;  4F6R C;  4CN6 A;  4HFD A;  2BG9 E;  2JQK A;  1KNZ A;  4A5X A;  4K0U A;  3L8R A;  3NRX A;  2N1G A;  4IT4 A;  1FMW A;  4GYS A;  4L9I A;  1WCR A;  2E9X B;  4ZS3 A;  4GYR A;  3MJX A;  5C2T A;  3LSV A;  2XAG B;  4AKI A;  4IGU A;  5HWX A;  1YW0 A;  2ZM0 A;  2VVS A;  5EZY E;  2J1D G;  3RPU A;  4AQF C;  1WLX A;  3O1I A;  2LM2 A;  3SWH A;  1IBK T;  4H9Q C;  4PJN A;  1HFA A;  2LE8 A;  4C91 A;  3Q9D A;  1ZOY A;  4NPP A;  4UF0 A;  4HWD A;  3A5X A;  4PAG A;  5AQH B;  4P09 A;  3Q5D A;  3P50 A;  4E7S A;  4YT0 A;  5J2T E;  4QXC B;  2MTQ A;  1B7T A;  3VKH A;  1BR2 A;  2EHO C;  2WWU A;  4O2A E;  3J9X 1;  2WB5 A;  5KX5 E;  3RIA A;  4GKJ T;  2XPK A;  1HF8 A;  5HXE A;  2IML A;  4Z90 A;  2CCQ A;  4PW8 A;  3K3N A;  5KXJ A;  5AQR B;  5LJM A;  2W00 A;  3VR8 A;  2PBI A;  5TAO A;  2CXF A;  1D1B A;  2NW8 A;  5F8P A;  2V7J A;  1IBL T;  1M62 A;  2LOS A;  4KP3 C;  1UX4 A;  4ILB A;  1Y01 A;  4YJ2 E;  3ZC1 A;  3AA6 B;  3N9Q A;  2D9D A;  3C4W A;  3KDS E;  4HFB A;  3RRC A;  5AQG B;  1FJG T;  2VKJ A;  2VL0 A;  4BAY B;  5L3E B;  3RI5 A;  3UUB A;  2W4X A;  2RP4 A;  1U5P A;  2JMK A;  1W09 A;  1E1H B;  2MPK A;  2W0G A;  2G0U A;  4LF6 T;  4ZXL A;  3RKO A;  2BVL A;  4YSX A;  5ABF B;  3RRW A;  2WDV A;  3N9P A;  3UU5 A;  2UUB T;  1VOM A;  5JH7 E;  2I0M A;  2X9W A;  3SS1 A;  3ONL C;  5IHY A;  4AKR B;  1VCS A;  4NXN T;  4UV8 B;  5HEU A;  1VRB A;  4H9S E;  4TN7 B;  2IW5 B;  2A3D A;  4PFO A;  4YJ3 E;  4JV5 T;  4G2A A;  1UUR A;  2JJ9 A;  1HNW T;  2VAS A;  4JEH B;  5FYM A;  1ZHC A;  3T1Y T;  1S94 A;  4OYJ A;  4QXH B;  3AAE B;  3R6N A;  5DAB A;  4AIS A;  2H7O A;  1R8I A;  4I43 B;  4Q25 A;  3RGL A;  1G73 A;  2WBL A;  3ZT5 A;  5HEJ A;  4ZI3 D;  1D1C A;  2IHR 1;  2XZE A;  2PFV A;  4DR1 T;  3F31 A;  2BKN A;  3AVS A;  2MOZ A;  2LRK A;  1YD8 G;  5L47 A;  4OX9 T;  3AA0 B;  4WW0 A;  2XAQ B;  3P8C D;  5C3J A;  4ASK A;  2CBJ A;  3AED A;  2D2S A;  2BG9 B;  4B3T T;  1KFY A;  2DCF A;  3AE6 A;  5IYZ E;  1LKX A;  4EB6 E;  2NP9 A;  4JI1 T;  4QWN B;  1D0Z A;  5A1L A;  4UEM A;  2A72 A;  5ABF A;  5LCY A;  2NTX A;  3P4P A;  2ACZ A;  2VK9 A;  2Q9Q D;  5JRC B;  4MLK A;  4NXM T;  4DO0 A;  1MMN A;  3ZT7 A;  4ZHQ E;  3HI2 A;  3ZKR A;  4MFR A;  2M67 A;  2XAS B;  3RC8 A;  3AE8 A;  2WDQ A;  4H63 V;  4DMV A;  3FZH B;  4B3S T;  2XSA A;  2UXX B;  4IST A;  5HEH A;  1IJ6 A;  5LG3 A;  2V26 A;  4QKN A;  4EEB A;  2BBH A;  4U3C A;  4I50 E;  4DND A;  3PUY F;  2X51 A;  2XY8 B;  3CX7 B;  3OJA A;  2YDQ A;  1J5W A;  5C8Y E;  3UFE A;  4U2Y A;  2XSB A;  3IBP A;  1UCU A;  5JR9 B;  4PJJ A;  1OXZ A;  2K48 A;  4OHF A;  3F2E A;  4KBM B;  1YKH B;  4DBQ A;  3P7I A;  2XQ8 A;  2LEH A;  5HWY A;  2X0Y A;  5H6Q B;  5HXC A;  3FBZ A;  2BG9 A;  1HG5 A;  3RIU A;  4H9N C;  1SUM B;  3MK7 C;  3EDU A;  4ERR A;  2Q9Q B;  2XQ7 A;  4M1P A;  4HFI A;  2KND A;  3VU7 H;  3LK3 B;  5M4Y A;  3KV9 A;  3AEG A;  4EXT A;  2FUP A;  2CRB A;  2ZM6 T;  4FI5 A;  5FXW A;  2VVN A;  2V7K A;  3EVY A;  3UUM A;  5JRC A;  1XMO T;  3RLF F;  1X9B A;  2MYS A;  2M6I A;  2NOX A;  3OBV E;  5F3J A;  3C64 A;  4OK0 A;  1MIY A;  3QK6 A;  4JI7 T;  4B6X A;  1WR0 A;  3PUZ F;  3PU3 A;  4HFV A;  3BQK A;  4DR5 T;  2LSJ A;  5BR8 T;  4IIJ E;  3C51 A;  3Q5E A;  4IDZ A;  3KV6 A;  1ZV4 X;  4IRE A;  2CBI A;  4HWC A;  3AEA A;  4U33 A;  2AE9 A;  5JDL A;  3CIR A;  1OWA A;  4Z91 A;  2OA5 A;  2DWG A;  4IDO A;  5JR9 A;  5JDG A;  3IA3 A;  5JDH A;  3BK9 A;  2DL1 A;  2NW9 A;  2PG8 A;  4EYU A;  3LJC A;  3ZN0 B;  2QRX A;  3VRB A;  2WWV A;  2WP9 A;  3DJB A;  2VUR A;  1HX8 A;  3SFD A;  4CN4 A;  2X67 A;  3PU8 A;  3P4S A;  5H6R B;  3ZCJ A;  3TLV A;  5ETW A;  3NVO A;  5LMN T;  1XWM A;  4JYA T;  3X1D A;  2Q9Q A;  3WI3 A;  3PE0 A;  4TWD A;  3KV5 A;  1ZKE A;  3N5L A;  2J62 A;  2VB6 A;  4EED A;  4N78 D;  5JDM A;  4YFS A;  5EK3 A;  4WYV A;  4HWH A;  2ES0 A;  3E0Z A;  4HE8 A;  4L0R A;  2NR4 A;  5JTG A;  1HNX T;  1MIW A;  3JAD A;  2HPL A;  5FMN A;  5AQJ B;  5AQL B;  4ILU A;  4ZOL E;  2KWI B;  3C4X A;  3C50 A;  4DV5 T;  5HXR A;  3O4X E;  3JAE A;  4H9P C;  1D0Y A;  2FBW A;  1HG2 A;  2X0L B;  3L09 A;  3NZP A;  3AE2 A;  4COF A;  4KX6 A;  2V8S V;  1XMQ T;  2JQ9 A;  2H89 A;  1T98 A;  2C5K T;  3OKQ A;  1NAF A;  3CML A;  3K1S A;  2W67 A;  3VHL A;  3ZMV B;  3R84 B;  4DUY T;  2XM1 A;  1I94 T;  4TV9 E;  4BA9 A;  5AFU L;  3KBT A;  1XDP A;  3N2G E;  3JC6 D;  4QX8 B;  4NUU A;  1W9R A;  4P0A A;  3NBX X;  3LK4 2;  3E08 A;  5AQT B;  4X65 T;  4DV4 T;  5AQN B;  2V7I A;  4UVA B;  3UQ7 A;  3KIN B;  3QB5 A;  2SPC A;  1LVK A;  2X0H A;  4X1K E;  5CJ5 A;  3CQX C;  4G63 A;  4KHP T;  1YQ3 A;  5IWA T;  1UGO A;  3QC9 A;  2W63 A;  1AJ3 A;  4AKL A;  3KFW X;  3RH3 A;  5CA0 E;  3ESL A;  2HH7 A;  3EUH A;  3GN5 B;  5FXX A;  2K3W A;  1JNR A;  1MMA A;  3KVA A;  5HYA A;  1OED C;  3V5U A;  5HEO A;  2XQA A;  2EHO D;  3VKG A;  1U4Q A;  1ZP0 A;  1YXR A;  3U78 A;  4DR4 T;  2LJL A;  4CXX A;  2YK0 A;  3PJA J;  3RYF E;  3ZCI A;  2XAJ B;  3TLU A;  3A8Y C;  5AQM B;  2QGS A;  4CZZ B;  4IDN A;  4DV0 T;  3UQ4 A;  4MBQ A;  3OVU A;  4JBW F;  5L4H A;  4I55 E;  2CLY C;  4BJN A;  2BS4 A;  2VQF T;  4YY3 T;  2ZM2 A;  3ZYK A;  3K3Q C;  1W0A A;  4KI0 F;  4LML A;  4OFZ A;  1NEN A;  5LBQ B;  2CE7 A;  4EYY R;  4C90 A;  4XZC A;  2WM9 A;  5BMV E;  3LFM A;  2J4G A;  2AXD S;  4LF5 T;  4QH1 A;  2WQY A;  4HGA A;  3AEE A;  2KSR A;  2KWH A;  4CXW A;  2V5D A;  3IHR A;  4X5T A;  3MXZ A;  5JDQ A;  4KHZ F;  4AI6 A;  3PUS A;  3PUW F;  5KMG P;  1N34 T;  2EHO B;  3GN5 A;  2GK9 A;  4IDP A;  3ZT6 A;  4U72 A;  2X66 A;  4IE5 A;  4QHO A;  2XHE B;  2DLR A;  5FY7 A;  1V9D A;  4ZZC A;  3PUV F;  5GON E;  2N2N A;  2X68 A;  2DNX A;  4ISS A;  3AB3 B;  4YXD A;  5AQI B;  1IAP A;  2LLY A;  2ZM8 A;  2VKO A;  3UUL A;  1UK5 A;  3KVB A;  2I59 A;  4F8H A;  3NZQ A;  3AEF A;  4YTM A;  3S4U A;  5LOV E;  3I0Q A;  5AQS B;  1VCT A;  2H7V C;  2VKD A;  3N2O A;  5AQO B;  2FJB A;  4TX5 A;  3CWZ B;  3SOL A;  4PK6 A;  2BS3 A;  2LRL A;  4CI1 B;  2KIN B;  3E22 E;  5LXT E;  2KZ7 B;  1FIO A;  1FMV A;  3RC3 A;  2V1D B;  5LHH B;  5CGM A;  3RQU A;  2B1E A;  2RA1 A;  4AQF A;  2YIN A;  2KLQ A;  2C5I T;  2YN6 A;  5LGN B;  2NTY A;  4E7Z A;  2DWK A;  2XQ5 A;  3UFG A;  1UX5 A;  4V1A v;  4JI8 T;  1G8X A;  3O1H A;  3V5S A;  3I9Y A;  2MAW A;  2CMR A;  4IL9 A;  2EHO A;  3P4Q A;  5AQK B;  4X64 T;  3N2K E;  5FY1 A;  4UEL A;  2YKS A;  3GMI A;  3AEB A;  2NWB A;  5FNV E;  3PUX F;  4TNV A;  2VKH A;  3QOF A;  1WFD A;  5FVK A;  4YSY A;  5JVD E;  4ILC A;  1ZEE A;  4EZH A;  4U74 A;  3BQL A;  1N33 T;  5DQV A;  5JRE A;  2XQ4 A;  5L4E A;  5FY0 A;  5J0Z A;  3ZMZ B;  2JRK A;  5AQP B;  2YDR A;  2E8I A;  4ZZB A;  1US7 B;  4L5G A;  1O3X A;  3MAC A;  2KMF A;  2LOP A;  1H7C A;  1M7K A;  5CFB A;  2LT3 A;  3FZL B;  3FZF B;  2I6H A;  4P0B A;  3QUJ A;  3RQW A;  1D1A A;  3AE9 A;  3I1A A;  3RYC E;  3KV4 A;  4U7I A;  3FZK B;  3T1H T;  2WMO A;  3O1J A;  4WNK A;  3EAM A;  2XJ7 A;  4HEA A;  2E2A A;  3ZMS B;  4EZ4 A;  2V7M A;  2UXD T;  4H9R C;  2JMH A;  2WCA A;  3EDV A;  3OPC A;  1GQE A;  3AE4 A;  4CI3 B;  3W15 B;  4DV1 T;  3CQG B;  3EHZ A;  3TLT A;  4GK0 E;  2LSY A;  2OV9 A;  2LHN A;  2XAH B;  3PUQ A;  2JPF A;  4TUY E;  4LMK A;  3HKB E;  4H9O C;  2J47 A;  3AE7 A;  2UXN B;  3WAK A;  2BKO A;  3CX6 B;  1QSD A;  2WSS V;  3PJA A;  4H63 H;  4HFE A;  1WYB A;  3T8O A;  4ZI2 C;  3VR9 A;  3OYX A;  4JUY A;  5JDN A;  1LVF A;  4X66 T;  2LSG A;  1EZ3 A;  3A7M A;  3LDQ B;  2WY2 A;  4I0U A;  3N9M A;  4HKA A;  3Q5X A;  2UUA T;  3H37 A;  4DR7 T;  4FJO A;  3UT5 E;  2LSK A;  4LFC T;  1MMG A;  5ABH A;  1SE7 A;  2D0T A;  5L3D B;  2UU9 T;  4WZX A;  4MHC A;  3B57 A;  3LK2 B;  3MKD A;  4TWH A;  3K3O A;  3ZYM A;  3ZYL A;  2E9X C;  4AKG A;  3RYI E;  1Z8U A;  3FXD B;  3WAJ A;  3O9X A;  3TLS A;  2IAK A;  3ZJ1 A;  4YTP A;  5FL0 A;  5IUX A;  3MA9 A;  4GKK T;  2QYW A;  3HR0 A;  3UU3 A;  5AQQ B;  3EI0 A;  2D0U A;  5AQU B;  2E9X D;  3AAI A;  5LBM A;  4PK5 A;  1T72 A;  2V7L A;  1IBM T;  3ZLI A;  1YQ4 A;  2XQ9 A;  2NW7 A;  2LKG A;  2LM9 A;  2XQ3 A;  4EIW A;  1QUU A;  4GIW A;  5LJN A;  5E0O A;  3AVR A;  4EGW A;  1BR4 A;  1LRZ A;  2YU1 A;  1HX1 B;  5FVL A;  4IE0 A;  3Q2M A;  2YOE A;  2C5J A;  3DP7 A;  2VQE T;  4IHJ E;  5L3B B;  3ZST A;  4DV7 T;  4TWF A;  3IEE A;  1NWM X;  3AE1 A;  3B13 A;  3ZPO A;  3RIF A;  5FL1 A;  2W66 A;  4KUM B;  4AQG A;  4DUZ T;  3C98 B;  3PDY A;  4O8S A;  4LF4 T;  3PUR A;  3ETV A;  2WZH A;  2R6G F;  3ABV A;  3UU6 A;  3NWI A;  3N9O A;  3ANW B;  4A97 A;  5LHI B;  3UU8 A;  2HN2 A;  3ZEF B;  3C4Z A;  4MAL A;  3RHW A;  2OLT A;  5ABE A;  2DI4 A;  2BS2 A;  4EOZ B;  3BQI A;  2UXC T;  5LHG B;  1KK7 A;  2ACX A;  2Y6X A;  3ZN1 B;  4ANJ A;  3UUX B;  4UR9 A;  4LFA T;  2V6Y B;  3NKZ A;  4TV8 E;  2HN1 A;  2PTF A;  3U3I A;  5LGU B;  4QXB B;  3JCF A;  1N36 T;  2A9U A;  4ILA A;  3ZC0 A;  3L39 A;  4UVC B;  4DV3 T;  4JI4 T;  2WZI A;  2H88 A;  4PJM A;  5HXH A;  3FB2 A;  2RPA A;  2FJE A;  3PUA A;  5LA6 E;  2IC9 A;  4TNW A;  5L3G B;  2JQQ A;  4YHH T;  2XM2 A;  2CXD A;  1MMD A;  1N32 T;  3HL6 A;  4A98 A;  4Z8X A;  3UUN A;  1KF6 A;  4QH5 A;  4LF8 T;  2YDS A;  3PUG A;  4U2Z A;  2H3R A;  3B5M A;  4AKH A;  1Y64 B;  1IZN B;  3HA4 A;  4ZEY A;  3GWH A;  2KXP B;  2LSI A;  4O4L E;  2BG9 C;  1CHU A;  4GOU A;  3JAF A;  4CQI A;  5J2U E;  3RIU C;  2KT9 A;  2E9X A;  4JEU B;  2BKP A;  3FHN A;  3RX6 A;  5HAX A;  4K0K T;  2M6B A;  2ZMA A;  5EK4 A;  2D5U A;  4B3R T;  3OYZ A;  3ANW A;  5ADX L;  4PK4 A;  3AA1 B;  2P9B A;  4O4J E;  4LMJ A; 
#chains in the Genus database with same CATH homology
 2E9X B;  1ZEE A;  4EZH A;  4U74 A;  4ZS3 A;  4GYR A;  4IE4 A;  3DJB A;  4O2B E;  3MJX A;  3TKL B;  2CM0 A;  3BQL A;  2XAG B;  4AKI A;  2VWA A;  5DQV A;  1HX8 A;  2X67 A;  5J1G A;  3PU8 A;  4IGU A;  5JRE A;  3CKD A;  5HWX A;  1YW0 A;  5H6R B;  2ZM0 A;  2CWO A;  3I0O A;  5FY0 A;  3ZCJ A;  3ZMZ B;  5ETW A;  3N9N A;  5EZY E;  2JRK A;  2J1D G;  2E8I A;  3RPU A;  2Q9Q A;  3WI3 A;  3PE0 A;  1WLX A;  2CWY A;  3O1I A;  4AQF C;  5LG4 A;  3KV5 A;  1ZKE A;  3SWH A;  3N5L A;  4H9Q C;  4PJN A;  1US7 B;  1HFA A;  2LE8 A;  4C91 A;  3Q9D A;  2VB6 A;  5JDF A;  4ZI3 C;  4L5G A;  1O3X A;  2ODU A;  3CX8 B;  3MAC A;  3Q5W A;  4UF0 A;  2CA5 A;  4N78 D;  5JDM A;  1S35 A;  4HTE A;  2Y8D A;  3A5X A;  4PAG A;  4TZ4 C;  4P09 A;  4YFS A;  2XTL A;  5EK3 A;  3LBX B;  2KMF A;  5EK2 A;  2ES0 A;  2LOP A;  4E7S A;  2K5B B;  5J2T E;  3E0Z A;  4QXC B;  1H7C A;  2MTQ A;  4HE8 A;  1B7T A;  4L0R A;  2LT3 A;  3VKH A;  1BR2 A;  2Y48 B;  4WBN E;  2EHO C;  4P0B A;  1MIW A;  2WWU A;  4O2A E;  3QUJ A;  3J9X 1;  5KX5 E;  5JR9 C;  2K9A A;  1D1A A;  1HF8 A;  5HXE A;  4OYK A;  3I1A A;  3RYC E;  2CCQ A;  2L8K A;  3KV4 A;  2LHR A;  4PW8 A;  3K3N A;  1WR6 A;  2HPL A;  5FMN A;  5LJM A;  2WMO A;  2W00 A;  3O1J A;  5FXV A;  2PBI A;  2CLY B;  5TAO A;  4WNK A;  2CXF A;  1WYC A;  1D1B A;  2NW8 A;  5F8P A;  3K8P C;  4ILU A;  4ZOL E;  2KWI B;  2V7J A;  3C4X A;  1IJ5 A;  3C50 A;  4HEA A;  3HKD E;  3NRY A;  4ZS2 A;  3HKC E;  3ZMS B;  1X79 A;  2LOS A;  2WMN A;  4KP3 C;  2ODV A;  1UX4 A;  4EZ4 A;  5HXR A;  3O4X E;  2V7M A;  4H9R C;  3I9W A;  2JMH A;  4H9P C;  3EDV A;  4CXY A;  1D0Y A;  2Q9Q C;  1HG2 A;  2X9Y A;  4IE6 A;  4YJ2 E;  2W61 A;  2X0L B;  4EAH A;  3ZC1 A;  3AA6 B;  3N9Q A;  5FP3 A;  3C4W A;  3KDS E;  3L09 A;  3NZP A;  3RRC A;  2VKJ A;  4CI3 B;  3KBU A;  3W15 B;  3CQG B;  4NUV A;  4YHJ A;  4GK0 E;  2LSY A;  4BAY B;  5L3E B;  5CA1 E;  2LHN A;  1T98 A;  2RP4 A;  1U5P A;  2JMK A;  2XAH B;  2C5K T;  3OKQ A;  1NAF A;  3CML A;  3PUQ A;  2JPF A;  4TUY E;  3VHL A;  1E1H B;  2W0G A;  2G0U A;  3ZMV B;  3HKB E;  4H9O C;  2UXN B;  3R84 B;  3WAK A;  3CVR A;  4GK5 E;  4HN9 A;  1CUN A;  2VL8 A;  1FEW A;  3CX6 B;  3RKO A;  2BVL A;  1QSD A;  2WSS V;  4H63 H;  4TV9 E;  1WYB A;  4PNI A;  4PFP A;  4BA9 A;  5AFU L;  3KBT A;  3J7Y q;  3T8O A;  4ZI2 C;  3N2G E;  3JC6 D;  4QX8 B;  3OYX A;  4JUY A;  5JDN A;  1LVF A;  2LSG A;  1EZ3 A;  4NUU A;  3RRW A;  3N9P A;  1VOM A;  5JH7 E;  4P0A A;  2X9W A;  3N9M A;  4HKA A;  3Q5X A;  3NBX X;  3SS1 A;  3LK4 2;  4QX7 B;  5IHY A;  3H37 A;  3LG7 A;  3E08 A;  4FJO A;  2LSK A;  3LBX A;  3UT5 E;  4AKR B;  5DJQ C;  4UV8 B;  2PJQ A;  1VRB A;  4H9S E;  3DTO A;  4TN7 B;  1MND A;  4XAX B;  2V7I A;  2IW5 B;  4ZI7 E;  4UVA B;  2A2F X;  2A3D A;  3KIN B;  4PFO A;  3AA7 B;  4YJ3 E;  5LNK A;  2SPC A;  1LVK A;  4X1K E;  1MMG A;  4G2A A;  2JJ9 A;  4UVB B;  3CQX C;  2VAS A;  3RYH E;  4G63 A;  4JEH B;  5FYM A;  1ZHC A;  2DHR A;  5KDM C;  1S94 A;  4OYJ A;  1BR0 A;  2D0T A;  5L3D B;  4MHC A;  4QXH B;  4JLE A;  2BVM A;  3B57 A;  4A56 A;  4PJL A;  2CEA A;  3AAE B;  3LK2 B;  3MKD A;  2YEV C;  3QC9 A;  4J2C A;  3R6N A;  5DAB A;  2W63 A;  4UXN B;  1AJ3 A;  3K3O A;  3ZYM A;  3ZYL A;  2H7O A;  4AKL A;  3KFW X;  2E9X C;  3RH3 A;  5CA0 E;  4DBR A;  4AKG A;  3RYI E;  4KMC A;  4UIG A;  4I43 B;  3FXD B;  3ESL A;  1G73 A;  2WBL A;  3WAJ A;  3O9X A;  2HH7 A;  2IAK A;  3EUH A;  3ZJ1 A;  4ZI3 D;  1D1C A;  3GN5 B;  3CPZ A;  2PFV A;  4ADZ A;  3F31 A;  3AAA B;  5FXX A;  3MA9 A;  3IF8 B;  3AVS A;  2MOZ A;  1HCI A;  3CQC B;  2X9H A;  1YD8 G;  2X9X A;  3HR0 A;  1MMA A;  2D0U A;  3KVA A;  5HYA A;  3AA0 B;  3V5U A;  3ETU A;  2E9X D;  3AAI A;  4WW0 A;  2XAQ B;  5LBM A;  4PK5 A;  1D0X A;  2EHO D;  3P8C D;  3VKG A;  5L3C B;  3ONX A;  1U4Q A;  4ASK A;  4XBF B;  2V7L A;  3ZMT B;  3U78 A;  2LJL A;  3ZLI A;  2D2S A;  2NW7 A;  4CXX A;  2LM9 A;  1Z0P A;  2YK0 A;  3RYF E;  2DCF A;  3FXE B;  3ZCI A;  3ZJ2 A;  3SRZ A;  2XAJ B;  5IYZ E;  1LKX A;  2QGS A;  4I4T E;  2NP9 A;  4CZZ B;  4EB6 E;  4DVD A;  4EIW A;  1QUU A;  4MBQ A;  4GIW A;  5LJN A;  5DQW A;  5E0O A;  5L2L A;  3ZMU B;  2C0S A;  3AVR A;  3MZK B;  4QWN B;  1BR4 A;  1D0Z A;  5A1L A;  4I55 E;  4UEM A;  3F57 A;  1LRZ A;  2A72 A;  2YU1 A;  2CLY C;  2BDE A;  5LCY A;  2NTX A;  4BJN A;  2ZLY A;  2VK9 A;  2ZM2 A;  2HPJ A;  2Q9Q D;  4IE0 A;  5CB4 E;  3UTK A;  3ZYK A;  3Q2M A;  4MLK A;  5JVD E;  5JRC B;  3K3Q C;  4DO0 A;  4X1Y E;  1MMN A;  4ZHQ E;  2C5J A;  3DP7 A;  1BR1 A;  3HI2 A;  4IHJ E;  4OFZ A;  5LBQ B;  5L3B B;  2CE7 A;  4EYY R;  4C90 A;  4XZC A;  2WM9 A;  2IC6 A;  4MFR A;  5BMV E;  3LFM A;  3IEE A;  2M67 A;  1NWM X;  2XAS B;  3RC8 A;  3GA8 A;  4H63 V;  4DMV A;  5L3F B;  3B13 A;  4HGA A;  1HTJ F;  3PTR B;  3ZPO A;  1YKE B;  4KUM B;  2CXL A;  2UXX B;  4IST A;  1IJ6 A;  4IE7 A;  4CXW A;  2KWH A;  4AQG A;  3IHR A;  3MXZ A;  2V26 A;  4QKN A;  3C98 B;  3PDY A;  4O8S A;  4I50 E;  4DND A;  2X51 A;  3CX7 B;  3PUR A;  3OJA A;  5JDQ A;  1WRD A;  4O4H E;  5C8Y E;  3ETV A;  4AI6 A;  4ZI2 D;  2XUE A;  1SA0 E;  3PUS A;  5KMG P;  3UFE A;  1MNE A;  2EHO B;  3IBP A;  4WBO A;  3GN5 A;  2GK9 A;  3FBL A;  3N9O A;  3ANW B;  1UCU A;  5JR9 B;  5LHI B;  2Z6E A;  5HXS A;  2K24 A;  3ZEF B;  4PJJ A;  1OXZ A;  4U72 A;  5FXZ A;  2X66 A;  3C4Z A;  4MAL A;  2K48 A;  4IE5 A;  4QHO A;  4OHF A;  2DI4 A;  4EOZ B;  2XHE B;  3F2E A;  4KBM B;  3BQI A;  1YKH B;  2DLR A;  5FY7 A;  4DBQ A;  5LHG B;  1V9D A;  1KK7 A;  2ACX A;  3P7I A;  2Y6X A;  3N9L A;  3ZN1 B;  2WAU A;  5GON E;  3L3P A;  2LEH A;  5HWY A;  2L3L A;  2N2N A;  2X68 A;  3UUX B;  4ANJ A;  2DNX A;  5H6Q B;  4ISS A;  3AB3 B;  5HXC A;  5LYJ E;  3FBZ A;  1IAP A;  1HG5 A;  4TV8 E;  2ZM8 A;  4AXP A;  4CI2 B;  2VKO A;  3UUL A;  3KVB A;  3U3I A;  4H9N C;  5LGU B;  3MK7 C;  4QXB B;  3EDU A;  4ERR A;  2I59 A;  2Q9Q B;  2QA7 A;  3NZQ A;  4M1P A;  2KND A;  1SHZ C;  3S4U A;  5LOV E;  3VU7 H;  3I0Q A;  3ZC0 A;  3LK3 B;  4UVC B;  5M4Y A;  1MIV A;  3H3A A;  3KV9 A;  4PJM A;  4UF0 B;  5HXH A;  3FB2 A;  2H7V C;  2VKD A;  4EXT A;  5LGT B;  3N2O A;  4FI5 A;  5FXW A;  1HS7 A;  4TX5 A;  3CWZ B;  3SOL A;  4PK6 A;  2XQY A;  2V7K A;  2XAF B;  3EVY A;  3PUA A;  3UUM A;  5LA6 E;  5JRC A;  3M65 A;  2IC9 A;  4BJM A;  2W62 A;  2MYS A;  4YLH A;  4CI1 B;  4O4I E;  2YU2 A;  5L3G B;  2JQQ A;  2MBG A;  2KIN B;  3E22 E;  5LXT E;  2CXD A;  2NOX A;  2KZ7 B;  1MMD A;  1FIO A;  3OBV E;  5F3J A;  3C64 A;  4OK0 A;  2N9D A;  1FMV A;  3RC3 A;  1MIY A;  2V1D B;  5LHH B;  3HL6 A;  2B1E A;  2RA1 A;  3QK6 A;  4Z8X A;  3UUN A;  3D0T A;  4B6X A;  3PUG A;  4AQF A;  2L9Q A;  2YIN A;  2KLQ A;  2H3R A;  3PU3 A;  4AKH A;  4HFV A;  4X1I E;  1Y64 B;  2C5I T;  3BQK A;  1IZN B;  4UV9 B;  2LSJ A;  5LGN B;  3HA4 A;  4IIJ E;  2NTY A;  3GWH A;  2KXP B;  2LSI A;  4E7Z A;  4O4L E;  3C51 A;  4IDZ A;  4DMW A;  2DWK A;  3KV6 A;  4X20 E;  5JQG E;  1ZV4 X;  1UX5 A;  3JC6 C;  4GOU A;  4V1A v;  4CQI A;  5J2U E;  1G8X A;  3O1H A;  3V5S A;  3I9Y A;  2KT9 A;  2E9X A;  4JEU B;  2CMR A;  5JDL A;  3FHN A;  3RX6 A;  1OWA A;  5HAX A;  2BZB A;  2OA5 A;  5LP6 E;  2EHO A;  2DWG A;  2ZMA A;  5EK4 A;  2D5U A;  3HKE E;  3N2K E;  4F6R C;  3OYZ A;  3ANW A;  5JR9 A;  5FY1 A;  5ADX L;  4UEL A;  5JDG A;  3GMI A;  4PK4 A;  5JDH A;  1KNZ A;  2NWB A;  3BK9 A;  5FNV E;  3AA1 B;  2P9B A;  2NW9 A;  2PG8 A;  2VKH A;  4O4J E;  4EYU A;  3LJC A;  4K0U A;  3NRX A;  2N1G A;  3ZN0 B;  1FMW A;  4GYS A;  4L9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...