2N1GA

Structure of c-terminal domain of human polymerase rev1 in complex with pold3 rir-motif
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
b'NLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Interaction between the Rev1 C-Terminal Domain and the PolD3 Subunit of Pol zeta Suggests a Mechanism of Polymerase Exchange upon Rev1/Pol zeta-Dependent Translesion Synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 94
sequence length 94
ec nomenclature ec 2.7.7.-:
pdb deposition date 2015-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n1gA00
4GK0E 4EXTA 2LSGA 2N1GA 2LSJA 2LSKA 2LSIA 4BA9A 2LSYA 3VU7H 4GK5E 4FJOA
chains in the Genus database with same CATH superfamily
2CBIA 1MIWA 2VQFT 1O3XA 3PUZF 3I1AA 5FY1A 4P0BA 3RIFA 2XQ6A 3P4SA 4IL4A 4IDQA 5FY0A 4P09A 4M1PA 4AIUA 2EHOC 2VVSA 3CQCB 4I50E 2PG8A 2D9DA 4HGAA 1FJGT 3OVUA 3DTOA 3ZT6A 4A5XA 3PUYF 4IHJE 4JI2T 5H6RB 4BJNA 4ILCA 5L2LA 4XAXB 4ERRA 2LE8A 5FXXA 4JEUB 3KBUA 4H9NC 2UXBT 4QH1A 4N78D 2QVAA 3SS1A 2V7KA 3E08A 3RKOA 3LBXB 4OHFA 3AECA 1FMWA 2M67A 4GYSA 3RIAA 4DV5T 3AA6B 4JI6T 4O2AE 2KT9A 4U74A 3HA4A 4O2BE 1UCUA 3OPCA 1WR6A 3NKZA 4CQIA 1FMVA 2IUBA 1N32T 2A9UA 5DQWA 1NWMX 5AQTB 2A3DA 3HL6A 2E9XD 1YQ4A 4U72A 4I55E 4IREA 4HWDA 5LHHB 5IUXA 2LJLA 1J5ET 2A72A 3ZSTA 4L0RA 3AXJA 5AQKB 2BG9B 5FXZA 4IE4A 3M65A 2FJDA 3ETVA 5EK4A 5JDFA 4ILAA 4NUUA 4AQYT 3GWHA 3CVRA 5HXRA 5HWYA 4L9IA 3FZKB 4DMVA 2LHNA 3N9LA 4AKLA 3AB3B 4I0UA 3RI5A 2I0MA 5LXTE 2D0UA 3ETUA 2BBHA 2VB6A 3CMLA 2JMKA 4HFDA 4U31A 5L3GB 3PE0A 5HWXA 5DJQC 4DR1T 4HFVA 2X0YA 1KK7A 2CBJA 5TAOA 2CHNA 1NAFA 2QYWA 3PJAA 5AQRB 3FZHB 5L3DB 3AA1B 4TN7B 5AQIB 3M3ZB 3TLUA 1MIYA 5C3JA 5KX5E 3GMIA 3AE6A 2B1EA 3IBPA 2XAHB 2HN1A 3ZCIA 3RGLA 3I9WA 3P4QA 3C64A 4ASKA 2CLYB 2AE9A 3P50A 4CN1A 1BR2A 2WAUA 1T7SA 2LHRA 3RHWA 1US7B 3TKLB 5C2TA 5HEUA 4HFEA 2CWYA 5LP6E 2K3WA 2NTYA 2LSGA 3QB5K 3F31A 4EEDA 4A97A 3AEEA 3B13A 5AQLB 2OV9A 2V1DB 3N5LA 2J62A 5HXHA 5L47A 5HXSA 2WP9A 2W2UA 2V7JA 3O4XE 3MACA 4BJMA 4AI6A 1YW0A 4WZXA 1HNXT 2NR4A 2OLTA 5LA6E 3LSVA 3MJXA 2JQQA 4B3ST 1WYCA 4Z91A 4DR4T 3IHRA 3UUBA 2XSAA 2VL0A 3PUGA 4A56A 5LCYA 4TV8E 1OEDE 2KMFA 2X67A 3AEGA 5AQPB 3A8YC 3RYCE 2VQET 5AQSB 4AQFC 4F6RC 5ETWA 2XTLA 3CX6B 2XAQB 4UELA 5HEJA 3UU8A 2CEAA 2V7LA 3LFMA 4NPPA 1MMNA 2E5LT 4AKHA 2V5DA 5L4EA 4HKAA 3P7IA 4K0KT 3QC9A 4Q25A 2WBLA 2W61A 4U2ZA 5LGNB 4PNIA 2K24A 4YHHT 2XQYA 4ZHQE 4NUVA 3BQKA 4DV2T 1SUMB 2EHOD 1MMGA 3AEDA 2VK9A 3L3PA 4EZ4A 2I59A 3CWZB 5FY7A 4GKKT 1T8BA 4HTEA 3RQUA 1G8XA 3AXJB 3BQLA 4G63A 4ZXLA 5J2UE 3SWHA 2LSJA 1DU2A 4X1YE 4H63H 4LFBT 4AKGA 3TLTA 2Y6XA 3I9YA 3RRWA 3SRZA 4IIJE 5JR9C 4QH5A 5LGUB 4YTPA 3PUXF 2JQHA 2J1DG 5HCMA 2LM2A 3AAAB 2A2FX 5FL1A 1WFDA 4DVDA 1XMQT 4TWFA 1NEKA 5J1GA 2BKNA 5H6QB 3IF8B 4LF6T 3ZSSA 1J1JA 2UXNB 2M6BA 2SPCA 1Z8UA 3A5XA 4X65T 4GOUA 4ZI7E 4JI0T 5M4YA 4CI2B 4ISTA 1G73A 4J2CA 2ODVA 3Q2MA 2J47A 3KVBA 5BMVE 2CM0A 1OEDC 4DR3T 4GYRA 2LRKA 4NIQA 5AQFB 4KP3C 5LHIB 3RIUC 2K5BB 2Z6EA 5KDMC 1JNRA 3N9OA 4V1Av 5GONE 3EI0A 4YJ3E 2B76A 2X66A 2NW9A 1GQEA 3RYIE 3JCFA 4PK6A 4JI1T 3Q5DA 1HFAA 2VURA 2ZM0A 2L9QA 5FYMA 5JDQA 1SE7A 1HG2A 3EDVA 3FBLA 4DV6T 4JYAT 3OTOT 4DUZT 4ANJA 2X0HA 2MYSA 3KFWX 2DL1A 2WZHA 3RKGA 4WBNE 5FXWA 3R6NA 4DBQA 5JRCA 1D0YA 2XUEA 3UULA 1MNDA 1U5PA 2V5CA 3TLVA 4Z8XA 3H37A 3K3QC 5FL0A 2F4VT 3ZMZB 3RC3A 1ZV4X 4JLEA 4FI5A 5JH7E 2W63A 2Y8DA 5AQQB 3LDQB 3VKGA 2V8SV 2ACXA 2IMLA 3ZEFB 2V6YA 2Q9QA 1KF6A 4BAYB 2MPKA 3NRYA 2BKPA 3RH3A 5LHGB 3C4ZA 2HN2A 1M62A 4X5TA 1EZ3A 3ZCJA 3LJCA 2MAWA 1UX5A 2V7IA 3PU3A 5LMUT 2UUCT 2YINA 4DV1T 4IDZA 4QWNB 5LYJE 2HPJA 2DNXA 4UV8B 4TUYE 3LG7A 1BR4A 1KNPA 2C0SA 3UU6A 3ZN0B 5JDHA 3PUQA 3C50A 3AE5A 3CQGB 3MK7C 2QA7A 2BG9E 4LF9T 3VKHA 3QOFA 4JEHB 3H3AA 2CRBA 4EXTA 1T98A 2IAKA 4ISSA 3MA9A 4O4JE 4IDOA 3EVYA 4X62T 1BR0A 5HEHA 3OKQA 4ZS2A 4BA9A 3IEEA 3EAMA 3AE3A 3HKDE 4HWHA 2UUBT 2WZIA 3PUAA 4GKJT 2WB5A 2CXDA 5FNVE 5BR8T 5ABHA 4K0UA 4U7YA 3ZC1A 4H9QC 2P9BA 1BR1A 1XWMA 4PJLA 4PFOA 5ABFA 4OYJA 3SFEA 5LMNT 2NW7A 5LJNA 1HG5A 4PJMA 2X68A 2XSBA 4AQGA 3ONXA 4NXNT 2RP4A 4AKRB 4JI8T 2FJBA 1CUNA 4B3TT 2DI4A 4QH4A 2BZBA 3ZPOA 4QKNA 2YDSA 1V9DA 4FJOA 2IC9A 5LBQB 5CGMA 4DV0T 2V6XA 3AE8A 1I6ZA 3KV6A 5E0OA 4GK0E 2X9WA 3AAIA 4UR9A 1ZEEA 3IA3A 4E7ZA 2NW8A 4DV3T 3KINB 4JI3T 5AQMB 3ZLIA 4TNVA 3ANWA 3RYHE 2XQ4A 4HWIB 3B5MA 5AQNB 1X79A 2WCAA 1IJ6A 4KMCA 5EK2A 1Y64B 4DR6T 3WAKA 4O4IE 2IIUA 2YKSA 3I0OA 2E2AA 4EYYR 5FVLA 4X1IE 1HS7A 5FXVA 3FXEB 2WU2A 4CXWA 3PUVF 3FZFB 3EDUA 3ONLC 3UFEA 3AAEB 2UXCT 5JRCB 2JIWA 4DV7T 4IL9A 3VRAA 1UK5A 1HNZT 2CE7A 1KNRA 2NTXA 3CK6A 1AJ3A 2BG9C 5AQUB 1UURA 2W66A 2W00A 3CPZA 4DIDB 1XMOT 5AQHB 4HWFA 5J0ZA 2YDRA 1W9RA 2V6YB 2YOEA 3T1YT 3JC6D 2Q9QB 2XQ7A 2FJEA 4QXBB 4MALA 4EEBA 2XQ9A 3O1JA 3L39A 4COFA 4LF8T 2VKDA 3DP7A 3Q5EA 3QNUA 4U3CA 2K9AA 5LG3A 3KBTA 3UUXB 2ES0A 3UTKA 2H89A 2ZM2A 2DHRA 1D0XA 4IDNA 2NOXA 3ZMSB 2BVMA 4MHCA 2XM1A 3V5UA 2E8IA 4ZZBA 3P4RA 1XNQT 5FVKA 2XAFB 1W0BA 2XM2A 3UU4A 4YFSA 4IE5A 3J7Yq 2CLYC 1LKXA 4IE7A 4CI3B 1N34T 5FP3A 2BBJA 2WM9A 3BK9A 4KI0F 2D2SA 3WAJA 1T72A 1U4QA 5AQVB 3D0TA 3B57A 4GIWA 5ABFB 2Q9QC 4UF0B 3K3OA 4AISA 3HI2A 3PUWF 2XASB 4B6XA 2HHHT 3RF1A 2AXDS 3CKDA 2H88A 2X51A 5CFBA 2ZM6T 2WQYA 2QGSA 3N9QA 2IHR1 2BKOA 4KUMB 3JAEA 3P8CD 3CQXC 1XNRT 4PJJA 2XQ3A 5JDGA 4DR2T 3ZYKA 3PV0F 1SA0E 2KZ7B 2KINB 3C4XA 4U33A 3CX8B 4HFIA 4YT0A 3ZMTB 3C51A 3MXZA 4MFRA 4EGWA 1SHZC 2BS3A 4ZS3A 2X9HA 2E5VA 3O9XA 3O1HA 4QXHB 3FBZA 4TWDA 5L3EB 5HXEA 3ANWB 1IBKT 5A1LA 3HKEE 2PBIA 2WWVA 1Z0PA 1VCSA 5HCJA 3GA8A 2V26A 3DJBA 3QB5A 4EOZB 2W62A 2NWBA 2HPLA 5JDNA 5F8PA 3N2KE 4TV9E 4B3MT 1IJ5A 4GK5E 3N9MA 2JPFA 2JQKA 2CXLA 5LGTB 2BDEA 3AEAA 3ZKRA 2N2NA 1WRDA 2DWKA 3V5SA 3SOLA 2K48A 2PTFA 2NP9A 2WS3A 4ZOLE 4DMWA 4I4TE 4AKIA 1ZHCA 3JC6C 2LKHA 3W15B 2JJ9A 4UVBB 5LBMA 3UU5A 2ZM8A 3SFDA 1YD8G 5DABA 4HFHA 4IE0A 3S4UA 3T8OA 3RPUA 3OJAA 4TX5A 5IWAT 4EB6E 1KNZA 4ZI2C 5CJ5A 4DV4T 4OYKA 4AQFA 4C90A 3F2EA 2YN6A 3ONJA 4CN6A 3VU7H 3PU8A 2JRKA 4YSZA 2DLRA 4PJNA 1I94T 3C98B 2G0UA 2ZMAA 4H63V 4UVCB 1QSDA 2XY8B 5CA1E 3AE4A 1S94A 2DCFA 2XAJB 4JBWF 3G06A 5AQOB 5JDLA 3F57A 2XQAA 3PTRB 4TNWA 1QLBA 1UX4A 3ESLA 3LK3B 3MZKB 4X20E 1IZNB 4EV6A 4ZEYA 4CI1B 2E9XA 2VKOA 2IDOB 2I6HA 4DUYT 4YXDA 2XQ5A 3PDYA 2LEHA 3UQ7A 2C5JA 1E7PA 2BS2A 4X66T 2XAGB 4L5GA 1CHUA 1L0VA 1W0AA 1LVKA 4JUYA 4IT4A 4OX9T 3RC8A 3TLWA 3RRCA 2D5UA 1R8IA 2IC6A 4LMLA 4TWHA 2LM9A 4U2YA 2MTQA 3NWIA 4PW8A 4HFBA 2VL8A 3EABA 2WDQA 1E2AA 4X64T 4TZ4C 2MBGA 4DR5T 4DR7T 1QUUA 3U3IA 3C4WA 1VCTA 5JTGA 5FMNA 2W0GA 3O1IA 4IE6A 5JR9A 2MOZA 2OA5A 2CPTA 2LT3A 5ABGA 4G2AA 3UU3A 2H3RA 2VVNA 3ZC0A 3FZLB 1WLXA 2KLQA 2C5IT 5KXJA 3NRXA 3ZT7A 3AEFA 3PURA 3ABVA 4DNDA 1D0ZA 4UF0A 2H7VC 2LRLA 1Y01A 4WW0A 2XZEA 4JV5T 3K8PC 2Q9QD 4PFPA 3AE7A 4JI4T 3RLFF 3J9X1 3L8RA 4YHJA 3HR0A 3HKCE 1OEDA 3EHZA 2KNDA 1WR0A 3CIRA 2LKGA 5LJMA 1ZP0A 3UUNA 3RIUA 1MMAA 1YKHB 3I0QA 5IHYA 3T1HT 2UUAT 3ZJ2A 3Q5WA 1YXRA 3RQWA 2W67A 2CWOA 3NZPA 3KVAA 4YY3T 1HX8A 3OYZA 3LK2B 2N1GA 3A7MA 4ADZA 4F8HA 5EK3A 2FUPA 1B7TA 4XZCA 3E0ZA 4YSXA 4P0AA 1N36T 5DQVA 3KV4A 4KBMB 1S35A 1M7KA 3VR9A 2CA5A 5KMGP 2YU2A 5LB7B 3UT5E 2KSRA 1XZYA 1UGOA 4H9SE 4KX6A 4LF4T 4KHZF 4HFCA 3QUJA 3AA7B 3VHLA 5AQJB 1MIVA 4CXXA 1KEYA 4YJ2E 2VASA 2H7OA 5JQGE 4ZI3C 1MNEA 4DBRA 2UU9T 5HAXA 4O4HE 2L3LA 3WI3A 5F5WA 1KFYA 4WYVA 4Z90A 5ADXL 4LMJA 2LOPA 2D0TA 3BQIA 2ODUA 2V7MA 2YEVC 1D1AA 4YTNA 4EIWA 2RPAA 2XPKA 2EHOA 1OXZA 1UUSA 5CA0E 2E9XB 3L09A 2Y48B 3UQ4A 2W4XA 2YDQA 4ZI2D 2UXDT 2C5KT 2PJQA 3KDSE 4A98A 5LNKA 4E7SA 5JVDE 2XJ7A 3Q5XA 4H9RC 4I43B 4B3RT 3RYFE 1VOMA 4H9PC 3ZYLA 3GN5A 3UFGA 5L3CB 2BS4A 5ABEA 3PJAJ 2LSYA 4X1KE 1HTJF 5HEOA 3KV9A 2VKJA 2X9YA 3OBVE 2BVLA 5HEGA 4PK5A 5JR9B 1HR0T 2WDVA 1H7CA 1IBMT 5LOVE 1JNZA 3AE1A 2LOSA 5J2TE 3ZN1B 2WY2A 4IDPA 4ZZCA 1W09A 2N9DA 4YTMA 1N33T 2YU1A 4ILUA 4QX7B 5CB4E 4O8SA 3N9PA 1D1CA 2WMOA 2HH7A 3N9NA 2JMHA 5C8YE 1HF8A 1HCIA 4QXCB 3FZMB 1HNWT 2XQ8A 4DO0A 3AEBA 1MMDA 4EAHA 4LF5T 2E9XC 3K3NA 3K1SA 4LFCT 5L4HA 2ZLYA 3TLSA 3EUHA 1OEDB 3RX6A 3H3MA 2UXXB 4HEAA 2CMRA 4QX8B 3FHNA 5L3BB 5AQGB 2LSKA 4PAGA 2CCQA 2CXFA 3LBXA 3R84B 1YQ3A 4CN4A 4JI7T 3UUMA 3ZYMA 4CXYA 2RA1A 4LF7T 5L3FB 4AXPA 2QRXA 2IW5B 3FXDB 1IAPA 4OFZA 3N2GE 4WBOA 1J5WA 3LK42 2R6GF 4UIGA 4LFAT 1LRZA 4U7IA 3NVOA 1VRBA 1NENA 2GK9A 2CHOA 3P4PA 4PK4A 2WDRA 2VKHA 2KWHA 3ZMVB 5HXCA 4ILBA 3Q9DA 4HE8A 3AVRA 3JADA 1OWAA 3AA0B 3QK6A 3JAFA 4IGUA 3VRBA 1IBLT 2J4GA 5LG4A 2JQ9A 2LSIA 2BG9A 4UEMA 3P4WA 2DWGA 3ZT5A 4KHPT 2L8KA 1X9BA 1FEWA 4O4LE 1FIOA 4NXMT 3VR8A 2FJAA 2VWAA 3PUSA 2KXPB 3NZQA 1HX1B 4CZZB 3NBXX 2WU5A 2WMNA 4JI5T 5HYAA 1ZOYA 4XBFB 2EHOB 3HKBE 3MKDA 4WNKA 4C91A 4MBQA 5JREA 2X9XA 4EZHA 4YLHA 3OYXA 4HWCA 4HN9A 1XDOA 2X0LB 1LVFA 2YK0A 5FKYA 4LMKA 4OK0A 2WWUA 4ZI3D 3ZJ1A 4MLKA 1ZKEA 3AE9A 5EZYE 3ZMUB 4UXNB 3GN5B 5IYZE 1XDPA 2PFVA 2WSSV 4H9OC 3U78A 2ACZA 4UV9B 3KV5A 4YSYA 5AFUL 2LLYA 3N2OA 5JDMA 3AVSA 1E1HB 2KWIB 4QHOA 1WYBA 2M6IA 2XHEB 3X1DA 2FBWA 4UVAB 4EYUA 3E22E 4P1NA 3AE2A 1WCRA 3FB2A 1D1BA 1YKEB 3CX7B 5F3JA
chains in the Genus database with same CATH topology
2UXNB 3V5UA 1B7TA 4XZCA 2E8IA 3E0ZA 2SPCA 4P0AA 1MIWA 5DQVA 3KV4A 1O3XA 2XAFB 3A5XA 3I1AA 4GOUA 4KBMB 4ZI7E 1S35A 5FY1A 5M4YA 2CA5A 4YFSA 5KMGP 4CI2B 2YU2A 4ISTA 4IE5A 3J7Yq 4P0BA 2CLYC 1G73A 4J2CA 1LKXA 3UT5E 2ODVA 3Q2MA 3KVBA 5FY0A 4P09A 4M1PA 5BMVE 2EHOC 4IE7A 4H9SE 4CI3B 2CM0A 3CQCB 4I50E 2PG8A 4HGAA 5FP3A 4GYRA 3DTOA 2WM9A 4IHJE 3QUJA 4KP3C 3AA7B 3VHLA 5LHIB 5H6RB 4BJNA 5L2LA 3BK9A 4XAXB 4ERRA 2LE8A 1MIVA 2D2SA 3WAJA 1U4QA 4CXXA 3D0TA 2K5BB 2Z6EA 3B57A 5KDMC 5FXXA 4YJ2E 4JEUB 3KBUA 4H9NC 3N9OA 4V1Av 5GONE 2VASA 2H7OA 5JQGE 4ZI3C 4GIWA 2Q9QC 1MNEA 4N78D 3K3OA 4UF0B 4YJ3E 4DBRA 3HI2A 3SS1A 2X66A 2V7KA 2NW9A 3E08A 5HAXA 3RYIE 4O4HE 3RKOA 2L3LA 3LBXB 3WI3A 2XASB 4OHFA 4PK6A 1FMWA 2M67A 4GYSA 1HFAA 3AA6B 4B6XA 4O2AE 2KT9A 4U74A 2ZM0A 2L9QA 3CKDA 3HA4A 5FYMA 5JDQA 1HG2A 3EDVA 4O2BE 3FBLA 1UCUA 2X51A 2QGSA 3N9QA 5ADXL 1WR6A 2LOPA 2D0TA 4CQIA 3BQIA 1FMVA 2ODUA 4KUMB 4ANJA 2V7MA 3P8CD 2YEVC 5DQWA 1NWMX 3CQXC 1D1AA 4PJJA 2MYSA 3KFWX 2A3DA 5JDGA 4WBNE 3HL6A 3ZYKA 4EIWA 2E9XD 5FXWA 1SA0E 3R6NA 4DBQA 5JRCA 2KZ7B 2EHOA 1D0YA 1OXZA 4U72A 2KINB 2E9XB 2XUEA 5CA0E 3L09A 2Y48B 4I55E 3UULA 3C4XA 1MNDA 3CX8B 1U5PA 3ZMTB 3C51A 3MXZA 5LHHB 4Z8XA 4MFRA 2LJLA 3H37A 4ZI2D 1SHZC 3K3QC 2C5KT 2PJQA 3KDSE 3ZMZB 3RC3A 2A72A 5LNKA 1ZV4X 4JLEA 4FI5A 5JH7E 4L0RA 4E7SA 4ZS3A 5JVDE 2W63A 2Y8DA 2X9HA 3Q5XA 4H9RC 3O1HA 3O9XA 4QXHB 3FBZA 3VKGA 2ACXA 4I43B 5FXZA 3RYFE 3ZEFB 5L3EB 1VOMA 4IE4A 4H9PC 3ZYLA 2Q9QA 5HXEA 3ANWB 3GN5A 3M65A 5L3CB 4BAYB 3ETVA 5A1LA 3NRYA 3HKEE 5EK4A 3RH3A 5JDFA 5LHGB 4X1KE 2LSYA 2PBIA 3C4ZA 1HTJF 4NUUA 1EZ3A 3GWHA 3ZCJA 3LJCA 3CVRA 1UX5A 5HXRA 3KV9A 4L9IA 1Z0PA 5HWYA 4DMVA 2LHNA 3N9LA 3GA8A 2V7IA 3AB3B 2VKJA 3PU3A 2V26A 4AKLA 2X9YA 3DJBA 3OBVE 5LXTE 2YINA 2D0UA 2BVLA 3ETUA 4IDZA 4QWNB 2VB6A 5LYJE 4PK5A 4EOZB 5JR9B 2W62A 2HPJA 2NWBA 3CMLA 2DNXA 2HPLA 2JMKA 5JDNA 4UV8B 3PE0A 5HWXA 5L3GB 5DJQC 1H7CA 4TUYE 5F8PA 3N2KE 4HFVA 5LOVE 4TV9E 3LG7A 1BR4A 2LOSA 4F6RC 1KK7A 5J2TE 1IJ5A 3ZN1B 2C0SA 2N9DA 3ZN0B 5TAOA 5JDHA 1NAFA 3PUQA 4GK5E 3C50A 2YU1A 3N9MA 2JPFA 4ILUA 4QX7B 5CB4E 2CXLA 3CQGB 5LGTB 5L3DB 2BDEA 3MK7C 3AA1B 2QA7A 4O8SA 3VKHA 4TN7B 3N9PA 1D1CA 2N2NA 2WMOA 1MIYA 2HH7A 3H3AA 1WRDA 4JEHB 5KX5E 3GMIA 2DWKA 1T98A 3N9NA 2IAKA 4EXTA 4ISSA 2JMHA 5C8YE 1HF8A 3MA9A 3SOLA 3V5SA 2B1EA 2K48A 3IBPA 1HCIA 2XAHB 2NP9A 4ZOLE 4QXCB 4DMWA 4O4JE 3ZCIA 4I4TE 3EVYA 3I9WA 4AKIA 4DO0A 1ZHCA 3C64A 3JC6C 1BR0A 3W15B 1MMDA 3OKQA 2JJ9A 4ZS2A 4EAHA 4UVBB 4ASKA 5LBMA 3IEEA 4BA9A 2E9XC 3K3NA 2ZM8A 2CLYB 3HKDE 2ZLYA 1YD8G 5DABA 4IE0A 3S4UA 1BR2A 2WAUA 3T8OA 3RPUA 3OJAA 4TX5A 3EUHA 4EB6E 1KNZA 4ZI2C 3PUAA 3RX6A 2LHRA 3TKLB 1US7B 4OYKA 2CXDA 5FNVE 4AQFA 4C90A 4K0UA 3ZC1A 2UXXB 3F2EA 4H9QC 4HEAA 2P9BA 1BR1A 2CMRA 2CWYA 4PJLA 4PFOA 4QX8B 2NTYA 3FHNA 5LP6E 2LSGA 4OYJA 5L3BB 2LSKA 3VU7H 3F31A 4PAGA 2NW7A 2CCQA 3PU8A 3B13A 2JRKA 2CXFA 5LJNA 3LBXA 2V1DB 2DLRA 3R84B 1HG5A 4PJNA 3N5LA 4PJMA 5HXHA 3C98B 3UUMA 3ZYMA 2X68A 2G0UA 2RA1A 4CXYA 4AQGA 5L3FB 3ONXA 5HXSA 2ZMAA 4H63V 4AXPA 4UVCB 2IW5B 2RP4A 2V7JA 1QSDA 3FXDB 3O4XE 3MACA 4AKRB 5CA1E 4BJMA 1S94A 4AI6A 1YW0A 2DCFA 1IAPA 2XAJB 4OFZA 5LA6E 3N2GE 4WBOA 1CUNA 3LK42 3MJXA 5JDLA 2DI4A 3F57A 3PTRB 4UIGA 2BZBA 3ZPOA 2JQQA 4QKNA 1LRZA 1V9DA 1UX4A 3ESLA 3LK3B 2IC9A 3MZKB 4FJOA 5LBQB 4X20E 1WYCA 1IZNB 1VRBA 4CI1B 3IHRA 2E9XA 2VKOA 3PUGA 2GK9A 4A56A 5LCYA 4TV8E 4PK4A 2VKHA 3PDYA 2KMFA 2KWHA 3ZMVB 5HXCA 2LEHA 2C5JA 2X67A 3KV6A 3Q9DA 4HE8A 2XAGB 4L5GA 3AVRA 3RYCE 4AQFC 1OWAA 3AA0B 3QK6A 5E0OA 5ETWA 2XTLA 1LVKA 3CX6B 4GK0E 4IGUA 4JUYA 2XAQB 5LG4A 2X9WA 2LSIA 3RC8A 3AAIA 4UELA 1ZEEA 4UEMA 4E7ZA 3RRCA 2NW8A 2CEAA 2D5UA 2V7LA 2DWGA 3KINB 2IC6A 3LFMA 3ZLIA 2LM9A 1MMNA 2MTQA 3ANWA 4AKHA 4PW8A 2VL8A 3RYHE 4HKAA 2L8KA 1FEWA 3P7IA 1FIOA 4O4LE 1X79A 1IJ6A 4TZ4C 2MBGA 3QC9A 2VWAA 1QUUA 3U3IA 3C4WA 4KMCA 3PUSA 2WBLA 2W61A 2KXPB 5EK2A 5FMNA 1Y64B 3NZQA 2W0GA 3WAKA 5LGNB 4O4IE 3O1IA 4IE6A 5JR9A 2MOZA 4PNIA 3I0OA 3NBXX 4CZZB 2K24A 4EYYR 2OA5A 2XQYA 4ZHQE 4NUVA 2LT3A 4X1IE 1HS7A 2WMNA 3BQKA 4G2AA 5FXVA 3FXEB 4CXWA 2H3RA 5HYAA 3EDUA 2EHOD 3ZC0A 1MMGA 3UFEA 2VK9A 3AAEB 5JRCB 3L3PA 4XBFB 2EHOB 3HKBE 4EZ4A 3MKDA 2I59A 4WNKA 1WLXA 2KLQA 4C91A 3CWZB 4MBQA 5FY7A 5JREA 2C5IT 2CE7A 3NRXA 2NTXA 4HTEA 1AJ3A 2X9XA 3PURA 1G8XA 4EZHA 4YLHA 4DNDA 3OYXA 2W00A 1D0ZA 3BQLA 4HN9A 3CPZA 4UF0A 4G63A 2H7VC 2X0LB 1LVFA 2YK0A 4WW0A 4OK0A 2WWUA 4ZI3D 3K8PC 5J2UE 3ZJ1A 2Q9QD 4MLKA 1ZKEA 3SWHA 2LSJA 5EZYE 4PFPA 3ZMUB 3JC6D 4X1YE 2Q9QB 4UXNB 4H63H 3GN5B 5IYZE 2PFVA 2WSSV 4H9OC 4QXBB 3U78A 4AKGA 3J9X1 4UV9B 3KV5A 4MALA 2Y6XA 4YHJA 3I9YA 3HR0A 3RRWA 3SRZA 5AFUL 4IIJE 5JR9C 3HKCE 5LGUB 3O1JA 3N2OA 5JDMA 2KNDA 2VKDA 3AVSA 3DP7A 1E1HB 2K9AA 2KWIB 2J1DG 4QHOA 1WYBA 2XHEB 3KBTA 5LJMA 3UUXB 2ES0A 3UUNA 3UTKA 4UVAB 3AAAB 2A2FX 1MMAA 4DVDA 1YKHB 2ZM2A 3I0QA 5IHYA 4EYUA 3E22E 2DHRA 3ZJ2A 3Q5WA 5J1GA 1D0XA 3FB2A 2CWOA 1D1BA 5H6QB 3NZPA 3KVAA 2NOXA 3ZMSB 3IF8B 1HX8A 3OYZA 2BVMA 3LK2B 2N1GA 1YKEB 3CX7B 4ADZA 5EK3A 4MHCA 5F3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GK0 E;  4EXT A;  2LSG A;  2N1G A;  2LSJ A;  2LSK A;  2LSI A;  4BA9 A;  2LSY A;  3VU7 H;  4GK5 E;  4FJO A; 
#chains in the Genus database with same CATH topology
 2CBI A;  1MIW A;  2VQF T;  1O3X A;  3PUZ F;  3I1A A;  5FY1 A;  4P0B A;  3RIF A;  2XQ6 A;  3P4S A;  4IL4 A;  4IDQ A;  5FY0 A;  4P09 A;  4M1P A;  4AIU A;  2EHO C;  2VVS A;  3CQC B;  4I50 E;  2PG8 A;  2D9D A;  4HGA A;  1FJG T;  3OVU A;  3DTO A;  3ZT6 A;  4A5X A;  3PUY F;  4IHJ E;  4JI2 T;  5H6R B;  4BJN A;  4ILC A;  5L2L A;  4XAX B;  4ERR A;  2LE8 A;  5FXX A;  4JEU B;  3KBU A;  4H9N C;  2UXB T;  4QH1 A;  4N78 D;  2QVA A;  3SS1 A;  2V7K A;  3E08 A;  3RKO A;  3LBX B;  4OHF A;  3AEC A;  1FMW A;  2M67 A;  4GYS A;  3RIA A;  4DV5 T;  3AA6 B;  4JI6 T;  4O2A E;  2KT9 A;  4U74 A;  3HA4 A;  4O2B E;  1UCU A;  3OPC A;  1WR6 A;  3NKZ A;  4CQI A;  1FMV A;  2IUB A;  1N32 T;  2A9U A;  5DQW A;  1NWM X;  5AQT B;  2A3D A;  3HL6 A;  2E9X D;  1YQ4 A;  4U72 A;  4I55 E;  4IRE A;  4HWD A;  5LHH B;  5IUX A;  2LJL A;  1J5E T;  2A72 A;  3ZST A;  4L0R A;  3AXJ A;  5AQK B;  2BG9 B;  5FXZ A;  4IE4 A;  3M65 A;  2FJD A;  3ETV A;  5EK4 A;  5JDF A;  4ILA A;  4NUU A;  4AQY T;  3GWH A;  3CVR A;  5HXR A;  5HWY A;  4L9I A;  3FZK B;  4DMV A;  2LHN A;  3N9L A;  4AKL A;  3AB3 B;  4I0U A;  3RI5 A;  2I0M A;  5LXT E;  2D0U A;  3ETU A;  2BBH A;  2VB6 A;  3CML A;  2JMK A;  4HFD A;  4U31 A;  5L3G B;  3PE0 A;  5HWX A;  5DJQ C;  4DR1 T;  4HFV A;  2X0Y A;  1KK7 A;  2CBJ A;  5TAO A;  2CHN A;  1NAF A;  2QYW A;  3PJA A;  5AQR B;  3FZH B;  5L3D B;  3AA1 B;  4TN7 B;  5AQI B;  3M3Z B;  3TLU A;  1MIY A;  5C3J A;  5KX5 E;  3GMI A;  3AE6 A;  2B1E A;  3IBP A;  2XAH B;  2HN1 A;  3ZCI A;  3RGL A;  3I9W A;  3P4Q A;  3C64 A;  4ASK A;  2CLY B;  2AE9 A;  3P50 A;  4CN1 A;  1BR2 A;  2WAU A;  1T7S A;  2LHR A;  3RHW A;  1US7 B;  3TKL B;  5C2T A;  5HEU A;  4HFE A;  2CWY A;  5LP6 E;  2K3W A;  2NTY A;  2LSG A;  3QB5 K;  3F31 A;  4EED A;  4A97 A;  3AEE A;  3B13 A;  5AQL B;  2OV9 A;  2V1D B;  3N5L A;  2J62 A;  5HXH A;  5L47 A;  5HXS A;  2WP9 A;  2W2U A;  2V7J A;  3O4X E;  3MAC A;  4BJM A;  4AI6 A;  1YW0 A;  4WZX A;  1HNX T;  2NR4 A;  2OLT A;  5LA6 E;  3LSV A;  3MJX A;  2JQQ A;  4B3S T;  1WYC A;  4Z91 A;  4DR4 T;  3IHR A;  3UUB A;  2XSA A;  2VL0 A;  3PUG A;  4A56 A;  5LCY A;  4TV8 E;  1OED E;  2KMF A;  2X67 A;  3AEG A;  5AQP B;  3A8Y C;  3RYC E;  2VQE T;  5AQS B;  4AQF C;  4F6R C;  5ETW A;  2XTL A;  3CX6 B;  2XAQ B;  4UEL A;  5HEJ A;  3UU8 A;  2CEA A;  2V7L A;  3LFM A;  4NPP A;  1MMN A;  2E5L T;  4AKH A;  2V5D A;  5L4E A;  4HKA A;  3P7I A;  4K0K T;  3QC9 A;  4Q25 A;  2WBL A;  2W61 A;  4U2Z A;  5LGN B;  4PNI A;  2K24 A;  4YHH T;  2XQY A;  4ZHQ E;  4NUV A;  3BQK A;  4DV2 T;  1SUM B;  2EHO D;  1MMG A;  3AED A;  2VK9 A;  3L3P A;  4EZ4 A;  2I59 A;  3CWZ B;  5FY7 A;  4GKK T;  1T8B A;  4HTE A;  3RQU A;  1G8X A;  3AXJ B;  3BQL A;  4G63 A;  4ZXL A;  5J2U E;  3SWH A;  2LSJ A;  1DU2 A;  4X1Y E;  4H63 H;  4LFB T;  4AKG A;  3TLT A;  2Y6X A;  3I9Y A;  3RRW A;  3SRZ A;  4IIJ E;  5JR9 C;  4QH5 A;  5LGU B;  4YTP A;  3PUX F;  2JQH A;  2J1D G;  5HCM A;  2LM2 A;  3AAA B;  2A2F X;  5FL1 A;  1WFD A;  4DVD A;  1XMQ T;  4TWF A;  1NEK A;  5J1G A;  2BKN A;  5H6Q B;  3IF8 B;  4LF6 T;  3ZSS A;  1J1J A;  2UXN B;  2M6B A;  2SPC A;  1Z8U A;  3A5X A;  4X65 T;  4GOU A;  4ZI7 E;  4JI0 T;  5M4Y A;  4CI2 B;  4IST A;  1G73 A;  4J2C A;  2ODV A;  3Q2M A;  2J47 A;  3KVB A;  5BMV E;  2CM0 A;  1OED C;  4DR3 T;  4GYR A;  2LRK A;  4NIQ A;  5AQF B;  4KP3 C;  5LHI B;  3RIU C;  2K5B B;  2Z6E A;  5KDM C;  1JNR A;  3N9O A;  4V1A v;  5GON E;  3EI0 A;  4YJ3 E;  2B76 A;  2X66 A;  2NW9 A;  1GQE A;  3RYI E;  3JCF A;  4PK6 A;  4JI1 T;  3Q5D A;  1HFA A;  2VUR A;  2ZM0 A;  2L9Q A;  5FYM A;  5JDQ A;  1SE7 A;  1HG2 A;  3EDV A;  3FBL A;  4DV6 T;  4JYA T;  3OTO T;  4DUZ T;  4ANJ A;  2X0H A;  2MYS A;  3KFW X;  2DL1 A;  2WZH A;  3RKG A;  4WBN E;  5FXW A;  3R6N A;  4DBQ A;  5JRC A;  1D0Y A;  2XUE A;  3UUL A;  1MND A;  1U5P A;  2V5C A;  3TLV A;  4Z8X A;  3H37 A;  3K3Q C;  5FL0 A;  2F4V T;  3ZMZ B;  3RC3 A;  1ZV4 X;  4JLE A;  4FI5 A;  5JH7 E;  2W63 A;  2Y8D A;  5AQQ B;  3LDQ B;  3VKG A;  2V8S V;  2ACX A;  2IML A;  3ZEF B;  2V6Y A;  2Q9Q A;  1KF6 A;  4BAY B;  2MPK A;  3NRY A;  2BKP A;  3RH3 A;  5LHG B;  3C4Z A;  2HN2 A;  1M62 A;  4X5T A;  1EZ3 A;  3ZCJ A;  3LJC A;  2MAW A;  1UX5 A;  2V7I A;  3PU3 A;  5LMU T;  2UUC T;  2YIN A;  4DV1 T;  4IDZ A;  4QWN B;  5LYJ E;  2HPJ A;  2DNX A;  4UV8 B;  4TUY E;  3LG7 A;  1BR4 A;  1KNP A;  2C0S A;  3UU6 A;  3ZN0 B;  5JDH A;  3PUQ A;  3C50 A;  3AE5 A;  3CQG B;  3MK7 C;  2QA7 A;  2BG9 E;  4LF9 T;  3VKH A;  3QOF A;  4JEH B;  3H3A A;  2CRB A;  4EXT A;  1T98 A;  2IAK A;  4ISS A;  3MA9 A;  4O4J E;  4IDO A;  3EVY A;  4X62 T;  1BR0 A;  5HEH A;  3OKQ A;  4ZS2 A;  4BA9 A;  3IEE A;  3EAM A;  3AE3 A;  3HKD E;  4HWH A;  2UUB T;  2WZI A;  3PUA A;  4GKJ T;  2WB5 A;  2CXD A;  5FNV E;  5BR8 T;  5ABH A;  4K0U A;  4U7Y A;  3ZC1 A;  4H9Q C;  2P9B A;  1BR1 A;  1XWM A;  4PJL A;  4PFO A;  5ABF A;  4OYJ A;  3SFE A;  5LMN T;  2NW7 A;  5LJN A;  1HG5 A;  4PJM A;  2X68 A;  2XSB A;  4AQG A;  3ONX A;  4NXN T;  2RP4 A;  4AKR B;  4JI8 T;  2FJB A;  1CUN A;  4B3T T;  2DI4 A;  4QH4 A;  2BZB A;  3ZPO A;  4QKN A;  2YDS A;  1V9D A;  4FJO A;  2IC9 A;  5LBQ B;  5CGM A;  4DV0 T;  2V6X A;  3AE8 A;  1I6Z A;  3KV6 A;  5E0O A;  4GK0 E;  2X9W A;  3AAI A;  4UR9 A;  1ZEE A;  3IA3 A;  4E7Z A;  2NW8 A;  4DV3 T;  3KIN B;  4JI3 T;  5AQM B;  3ZLI A;  4TNV A;  3ANW A;  3RYH E;  2XQ4 A;  4HWI B;  3B5M A;  5AQN B;  1X79 A;  2WCA A;  1IJ6 A;  4KMC A;  5EK2 A;  1Y64 B;  4DR6 T;  3WAK A;  4O4I E;  2IIU A;  2YKS A;  3I0O A;  2E2A A;  4EYY R;  5FVL A;  4X1I E;  1HS7 A;  5FXV A;  3FXE B;  2WU2 A;  4CXW A;  3PUV F;  3FZF B;  3EDU A;  3ONL C;  3UFE A;  3AAE B;  2UXC T;  5JRC B;  2JIW A;  4DV7 T;  4IL9 A;  3VRA A;  1UK5 A;  1HNZ T;  2CE7 A;  1KNR A;  2NTX A;  3CK6 A;  1AJ3 A;  2BG9 C;  5AQU B;  1UUR A;  2W66 A;  2W00 A;  3CPZ A;  4DID B;  1XMO T;  5AQH B;  4HWF A;  5J0Z A;  2YDR A;  1W9R A;  2V6Y B;  2YOE A;  3T1Y T;  3JC6 D;  2Q9Q B;  2XQ7 A;  2FJE A;  4QXB B;  4MAL A;  4EEB A;  2XQ9 A;  3O1J A;  3L39 A;  4COF A;  4LF8 T;  2VKD A;  3DP7 A;  3Q5E A;  3QNU A;  4U3C A;  2K9A A;  5LG3 A;  3KBT A;  3UUX B;  2ES0 A;  3UTK A;  2H89 A;  2ZM2 A;  2DHR A;  1D0X A;  4IDN A;  2NOX A;  3ZMS B;  2BVM A;  4MHC A;  2XM1 A;  3V5U A;  2E8I A;  4ZZB A;  3P4R A;  1XNQ T;  5FVK A;  2XAF B;  1W0B A;  2XM2 A;  3UU4 A;  4YFS A;  4IE5 A;  3J7Y q;  2CLY C;  1LKX A;  4IE7 A;  4CI3 B;  1N34 T;  5FP3 A;  2BBJ A;  2WM9 A;  3BK9 A;  4KI0 F;  2D2S A;  3WAJ A;  1T72 A;  1U4Q A;  5AQV B;  3D0T A;  3B57 A;  4GIW A;  5ABF B;  2Q9Q C;  4UF0 B;  3K3O A;  4AIS A;  3HI2 A;  3PUW F;  2XAS B;  4B6X A;  2HHH T;  3RF1 A;  2AXD S;  3CKD A;  2H88 A;  2X51 A;  5CFB A;  2ZM6 T;  2WQY A;  2QGS A;  3N9Q A;  2IHR 1;  2BKO A;  4KUM B;  3JAE A;  3P8C D;  3CQX C;  1XNR T;  4PJJ A;  2XQ3 A;  5JDG A;  4DR2 T;  3ZYK A;  3PV0 F;  1SA0 E;  2KZ7 B;  2KIN B;  3C4X A;  4U33 A;  3CX8 B;  4HFI A;  4YT0 A;  3ZMT B;  3C51 A;  3MXZ A;  4MFR A;  4EGW A;  1SHZ C;  2BS3 A;  4ZS3 A;  2X9H A;  2E5V A;  3O9X A;  3O1H A;  4QXH B;  3FBZ A;  4TWD A;  5L3E B;  5HXE A;  3ANW B;  1IBK T;  5A1L A;  3HKE E;  2PBI A;  2WWV A;  1Z0P A;  1VCS A;  5HCJ A;  3GA8 A;  2V26 A;  3DJB A;  3QB5 A;  4EOZ B;  2W62 A;  2NWB A;  2HPL A;  5JDN A;  5F8P A;  3N2K E;  4TV9 E;  4B3M T;  1IJ5 A;  4GK5 E;  3N9M A;  2JPF A;  2JQK A;  2CXL A;  5LGT B;  2BDE A;  3AEA A;  3ZKR A;  2N2N A;  1WRD A;  2DWK A;  3V5S A;  3SOL A;  2K48 A;  2PTF A;  2NP9 A;  2WS3 A;  4ZOL E;  4DMW A;  4I4T E;  4AKI A;  1ZHC A;  3JC6 C;  2LKH A;  3W15 B;  2JJ9 A;  4UVB B;  5LBM A;  3UU5 A;  2ZM8 A;  3SFD A;  1YD8 G;  5DAB A;  4HFH A;  4IE0 A;  3S4U A;  3T8O A;  3RPU A;  3OJA A;  4TX5 A;  5IWA T;  4EB6 E;  1KNZ A;  4ZI2 C;  5CJ5 A;  4DV4 T;  4OYK A;  4AQF A;  4C90 A;  3F2E A;  2YN6 A;  3ONJ A;  4CN6 A;  3VU7 H;  3PU8 A;  2JRK A;  4YSZ A;  2DLR A;  4PJN A;  1I94 T;  3C98 B;  2G0U A;  2ZMA A;  4H63 V;  4UVC B;  1QSD A;  2XY8 B;  5CA1 E;  3AE4 A;  1S94 A;  2DCF A;  2XAJ B;  4JBW F;  3G06 A;  5AQO B;  5JDL A;  3F57 A;  2XQA A;  3PTR B;  4TNW A;  1QLB A;  1UX4 A;  3ESL A;  3LK3 B;  3MZK B;  4X20 E;  1IZN B;  4EV6 A;  4ZEY A;  4CI1 B;  2E9X A;  2VKO A;  2IDO B;  2I6H A;  4DUY T;  4YXD A;  2XQ5 A;  3PDY A;  2LEH A;  3UQ7 A;  2C5J A;  1E7P A;  2BS2 A;  4X66 T;  2XAG B;  4L5G A;  1CHU A;  1L0V A;  1W0A A;  1LVK A;  4JUY A;  4IT4 A;  4OX9 T;  3RC8 A;  3TLW A;  3RRC A;  2D5U A;  1R8I A;  2IC6 A;  4LML A;  4TWH A;  2LM9 A;  4U2Y A;  2MTQ A;  3NWI A;  4PW8 A;  4HFB A;  2VL8 A;  3EAB A;  2WDQ A;  1E2A A;  4X64 T;  4TZ4 C;  2MBG A;  4DR5 T;  4DR7 T;  1QUU A;  3U3I A;  3C4W A;  1VCT A;  5JTG A;  5FMN A;  2W0G A;  3O1I A;  4IE6 A;  5JR9 A;  2MOZ A;  2OA5 A;  2CPT A;  2LT3 A;  5ABG A;  4G2A A;  3UU3 A;  2H3R A;  2VVN A;  3ZC0 A;  3FZL B;  1WLX A;  2KLQ A;  2C5I T;  5KXJ A;  3NRX A;  3ZT7 A;  3AEF A;  3PUR A;  3ABV A;  4DND A;  1D0Z A;  4UF0 A;  2H7V C;  2LRL A;  1Y01 A;  4WW0 A;  2XZE A;  4JV5 T;  3K8P C;  2Q9Q D;  4PFP A;  3AE7 A;  4JI4 T;  3RLF F;  3J9X 1;  3L8R A;  4YHJ A;  3HR0 A;  3HKC E;  1OED A;  3EHZ A;  2KND A;  1WR0 A;  3CIR A;  2LKG A;  5LJM A;  1ZP0 A;  3UUN A;  3RIU A;  1MMA A;  1YKH B;  3I0Q A;  5IHY A;  3T1H T;  2UUA T;  3ZJ2 A;  3Q5W A;  1YXR A;  3RQW A;  2W67 A;  2CWO A;  3NZP A;  3KVA A;  4YY3 T;  1HX8 A;  3OYZ A;  3LK2 B;  2N1G A;  3A7M A;  4ADZ A;  4F8H A;  5EK3 A;  2FUP A;  1B7T A;  4XZC A;  3E0Z A;  4YSX A;  4P0A A;  1N36 T;  5DQV A;  3KV4 A;  4KBM B;  1S35 A;  1M7K A;  3VR9 A;  2CA5 A;  5KMG P;  2YU2 A;  5LB7 B;  3UT5 E;  2KSR A;  1XZY A;  1UGO A;  4H9S E;  4KX6 A;  4LF4 T;  4KHZ F;  4HFC A;  3QUJ A;  3AA7 B;  3VHL A;  5AQJ B;  1MIV A;  4CXX A;  1KEY A;  4YJ2 E;  2VAS A;  2H7O A;  5JQG E;  4ZI3 C;  1MNE A;  4DBR A;  2UU9 T;  5HAX A;  4O4H E;  2L3L A;  3WI3 A;  5F5W A;  1KFY A;  4WYV A;  4Z90 A;  5ADX L;  4LMJ A;  2LOP A;  2D0T A;  3BQI A;  2ODU A;  2V7M A;  2YEV C;  1D1A A;  4YTN A;  4EIW A;  2RPA A;  2XPK A;  2EHO A;  1OXZ A;  1UUS A;  5CA0 E;  2E9X B;  3L09 A;  2Y48 B;  3UQ4 A;  2W4X A;  2YDQ A;  4ZI2 D;  2UXD T;  2C5K T;  2PJQ A;  3KDS E;  4A98 A;  5LNK A;  4E7S A;  5JVD E;  2XJ7 A;  3Q5X A;  4H9R C;  4I43 B;  4B3R T;  3RYF E;  1VOM A;  4H9P C;  3ZYL A;  3GN5 A;  3UFG A;  5L3C B;  2BS4 A;  5ABE A;  3PJA J;  2LSY A;  4X1K E;  1HTJ F;  5HEO A;  3KV9 A;  2VKJ A;  2X9Y A;  3OBV E;  2BVL A;  5HEG A;  4PK5 A;  5JR9 B;  1HR0 T;  2WDV A;  1H7C A;  1IBM T;  5LOV E;  1JNZ A;  3AE1 A;  2LOS A;  5J2T E;  3ZN1 B;  2WY2 A;  4IDP A;  4ZZC A;  1W09 A;  2N9D A;  4YTM A;  1N33 T;  2YU1 A;  4ILU A;  4QX7 B;  5CB4 E;  4O8S A;  3N9P A;  1D1C A;  2WMO A;  2HH7 A;  3N9N A;  2JMH A;  5C8Y E;  1HF8 A;  1HCI A;  4QXC B;  3FZM B;  1HNW T;  2XQ8 A;  4DO0 A;  3AEB A;  1MMD A;  4EAH A;  4LF5 T;  2E9X C;  3K3N A;  3K1S A;  4LFC T;  5L4H A;  2ZLY A;  3TLS A;  3EUH A;  1OED B;  3RX6 A;  3H3M A;  2UXX B;  4HEA A;  2CMR A;  4QX8 B;  3FHN A;  5L3B B;  5AQG B;  2LSK A;  4PAG A;  2CCQ A;  2CXF A;  3LBX A;  3R84 B;  1YQ3 A;  4CN4 A;  4JI7 T;  3UUM A;  3ZYM A;  4CXY A;  2RA1 A;  4LF7 T;  5L3F B;  4AXP A;  2QRX A;  2IW5 B;  3FXD B;  1IAP A;  4OFZ A;  3N2G E;  4WBO A;  1J5W A;  3LK4 2;  2R6G F;  4UIG A;  4LFA T;  1LRZ A;  4U7I A;  3NVO A;  1VRB A;  1NEN A;  2GK9 A;  2CHO A;  3P4P A;  4PK4 A;  2WDR A;  2VKH A;  2KWH A;  3ZMV B;  5HXC A;  4ILB A;  3Q9D A;  4HE8 A;  3AVR A;  3JAD A;  1OWA A;  3AA0 B;  3QK6 A;  3JAF A;  4IGU A;  3VRB A;  1IBL T;  2J4G A;  5LG4 A;  2JQ9 A;  2LSI A;  2BG9 A;  4UEM A;  3P4W A;  2DWG A;  3ZT5 A;  4KHP T;  2L8K A;  1X9B A;  1FEW A;  4O4L E;  1FIO A;  4NXM T;  3VR8 A;  2FJA A;  2VWA A;  3PUS A;  2KXP B;  3NZQ A;  1HX1 B;  4CZZ B;  3NBX X;  2WU5 A;  2WMN A;  4JI5 T;  5HYA A;  1ZOY A;  4XBF B;  2EHO B;  3HKB E;  3MKD A;  4WNK A;  4C91 A;  4MBQ A;  5JRE A;  2X9X A;  4EZH A;  4YLH A;  3OYX A;  4HWC A;  4HN9 A;  1XDO A;  2X0L B;  1LVF A;  2YK0 A;  5FKY A;  4LMK A;  4OK0 A;  2WWU A;  4ZI3 D;  3ZJ1 A;  4MLK A;  1ZKE A;  3AE9 A;  5EZY E;  3ZMU B;  4UXN B;  3GN5 B;  5IYZ E;  1XDP A;  2PFV A;  2WSS V;  4H9O C;  3U78 A;  2ACZ A;  4UV9 B;  3KV5 A;  4YSY A;  5AFU L;  2LLY A;  3N2O A;  5JDM A;  3AVS A;  1E1H B;  2KWI B;  4QHO A;  1WYB A;  2M6I A;  2XHE B;  3X1D A;  2FBW A;  4UVA B;  4EYU A;  3E22 E;  4P1N A;  3AE2 A;  1WCR A;  3FB2 A;  1D1B A;  1YKE B;  3CX7 B;  5F3J A; 
#chains in the Genus database with same CATH homology
 2UXN B;  3V5U A;  1B7T A;  4XZC A;  2E8I A;  3E0Z A;  2SPC A;  4P0A A;  1MIW A;  5DQV A;  3KV4 A;  1O3X A;  2XAF B;  3A5X A;  3I1A A;  4GOU A;  4KBM B;  4ZI7 E;  1S35 A;  5FY1 A;  5M4Y A;  2CA5 A;  4YFS A;  5KMG P;  4CI2 B;  2YU2 A;  4IST A;  4IE5 A;  3J7Y q;  4P0B A;  2CLY C;  1G73 A;  4J2C A;  1LKX A;  3UT5 E;  2ODV A;  3Q2M A;  3KVB A;  5FY0 A;  4P09 A;  4M1P A;  5BMV E;  2EHO C;  4IE7 A;  4H9S E;  4CI3 B;  2CM0 A;  3CQC B;  4I50 E;  2PG8 A;  4HGA A;  5FP3 A;  4GYR A;  3DTO A;  2WM9 A;  4IHJ E;  3QUJ A;  4KP3 C;  3AA7 B;  3VHL A;  5LHI B;  5H6R B;  4BJN A;  5L2L A;  3BK9 A;  4XAX B;  4ERR A;  2LE8 A;  1MIV A;  2D2S A;  3WAJ A;  1U4Q A;  4CXX A;  3D0T A;  2K5B B;  2Z6E A;  3B57 A;  5KDM C;  5FXX A;  4YJ2 E;  4JEU B;  3KBU A;  4H9N C;  3N9O A;  4V1A v;  5GON E;  2VAS A;  2H7O A;  5JQG E;  4ZI3 C;  4GIW A;  2Q9Q C;  1MNE A;  4N78 D;  3K3O A;  4UF0 B;  4YJ3 E;  4DBR A;  3HI2 A;  3SS1 A;  2X66 A;  2V7K A;  2NW9 A;  3E08 A;  5HAX A;  3RYI E;  4O4H E;  3RKO A;  2L3L A;  3LBX B;  3WI3 A;  2XAS B;  4OHF A;  4PK6 A;  1FMW A;  2M67 A;  4GYS A;  1HFA A;  3AA6 B;  4B6X A;  4O2A E;  2KT9 A;  4U74 A;  2ZM0 A;  2L9Q A;  3CKD A;  3HA4 A;  5FYM A;  5JDQ A;  1HG2 A;  3EDV A;  4O2B E;  3FBL A;  1UCU A;  2X51 A;  2QGS A;  3N9Q A;  5ADX L;  1WR6 A;  2LOP A;  2D0T A;  4CQI A;  3BQI A;  1FMV A;  2ODU A;  4KUM B;  4ANJ A;  2V7M A;  3P8C D;  2YEV C;  5DQW A;  1NWM X;  3CQX C;  1D1A A;  4PJJ A;  2MYS A;  3KFW X;  2A3D A;  5JDG A;  4WBN E;  3HL6 A;  3ZYK A;  4EIW A;  2E9X D;  5FXW A;  1SA0 E;  3R6N A;  4DBQ A;  5JRC A;  2KZ7 B;  2EHO A;  1D0Y A;  1OXZ A;  4U72 A;  2KIN B;  2E9X B;  2XUE A;  5CA0 E;  3L09 A;  2Y48 B;  4I55 E;  3UUL A;  3C4X A;  1MND A;  3CX8 B;  1U5P A;  3ZMT B;  3C51 A;  3MXZ A;  5LHH B;  4Z8X A;  4MFR A;  2LJL A;  3H37 A;  4ZI2 D;  1SHZ C;  3K3Q C;  2C5K T;  2PJQ A;  3KDS E;  3ZMZ B;  3RC3 A;  2A72 A;  5LNK A;  1ZV4 X;  4JLE A;  4FI5 A;  5JH7 E;  4L0R A;  4E7S A;  4ZS3 A;  5JVD E;  2W63 A;  2Y8D A;  2X9H A;  3Q5X A;  4H9R C;  3O1H A;  3O9X A;  4QXH B;  3FBZ A;  3VKG A;  2ACX A;  4I43 B;  5FXZ A;  3RYF E;  3ZEF B;  5L3E B;  1VOM A;  4IE4 A;  4H9P C;  3ZYL A;  2Q9Q A;  5HXE A;  3ANW B;  3GN5 A;  3M65 A;  5L3C B;  4BAY B;  3ETV A;  5A1L A;  3NRY A;  3HKE E;  5EK4 A;  3RH3 A;  5JDF A;  5LHG B;  4X1K E;  2LSY A;  2PBI A;  3C4Z A;  1HTJ F;  4NUU A;  1EZ3 A;  3GWH A;  3ZCJ A;  3LJC A;  3CVR A;  1UX5 A;  5HXR A;  3KV9 A;  4L9I A;  1Z0P A;  5HWY A;  4DMV A;  2LHN A;  3N9L A;  3GA8 A;  2V7I A;  3AB3 B;  2VKJ A;  3PU3 A;  2V26 A;  4AKL A;  2X9Y A;  3DJB A;  3OBV E;  5LXT E;  2YIN A;  2D0U A;  2BVL A;  3ETU A;  4IDZ A;  4QWN B;  2VB6 A;  5LYJ E;  4PK5 A;  4EOZ B;  5JR9 B;  2W62 A;  2HPJ A;  2NWB A;  3CML A;  2DNX A;  2HPL A;  2JMK A;  5JDN A;  4UV8 B;  3PE0 A;  5HWX A;  5L3G B;  5DJQ C;  1H7C A;  4TUY E;  5F8P A;  3N2K E;  4HFV A;  5LOV E;  4TV9 E;  3LG7 A;  1BR4 A;  2LOS A;  4F6R C;  1KK7 A;  5J2T E;  1IJ5 A;  3ZN1 B;  2C0S A;  2N9D A;  3ZN0 B;  5TAO A;  5JDH A;  1NAF A;  3PUQ A;  4GK5 E;  3C50 A;  2YU1 A;  3N9M A;  2JPF A;  4ILU A;  4QX7 B;  5CB4 E;  2CXL A;  3CQG B;  5LGT B;  5L3D B;  2BDE A;  3MK7 C;  3AA1 B;  2QA7 A;  4O8S A;  3VKH A;  4TN7 B;  3N9P A;  1D1C A;  2N2N A;  2WMO A;  1MIY A;  2HH7 A;  3H3A A;  1WRD A;  4JEH B;  5KX5 E;  3GMI A;  2DWK A;  1T98 A;  3N9N A;  2IAK A;  4EXT A;  4ISS A;  2JMH A;  5C8Y E;  1HF8 A;  3MA9 A;  3SOL A;  3V5S A;  2B1E A;  2K48 A;  3IBP A;  1HCI A;  2XAH B;  2NP9 A;  4ZOL E;  4QXC B;  4DMW A;  4O4J E;  3ZCI A;  4I4T E;  3EVY A;  3I9W A;  4AKI A;  4DO0 A;  1ZHC A;  3C64 A;  3JC6 C;  1BR0 A;  3W15 B;  1MMD A;  3OKQ A;  2JJ9 A;  4ZS2 A;  4EAH A;  4UVB B;  4ASK A;  5LBM A;  3IEE A;  4BA9 A;  2E9X C;  3K3N A;  2ZM8 A;  2CLY B;  3HKD E;  2ZLY A;  1YD8 G;  5DAB A;  4IE0 A;  3S4U A;  1BR2 A;  2WAU A;  3T8O A;  3RPU A;  3OJA A;  4TX5 A;  3EUH A;  4EB6 E;  1KNZ A;  4ZI2 C;  3PUA A;  3RX6 A;  2LHR A;  3TKL B;  1US7 B;  4OYK A;  2CXD A;  5FNV E;  4AQF A;  4C90 A;  4K0U A;  3ZC1 A;  2UXX B;  3F2E A;  4H9Q C;  4HEA A;  2P9B A;  1BR1 A;  2CMR A;  2CWY A;  4PJL A;  4PFO A;  4QX8 B;  2NTY A;  3FHN A;  5LP6 E;  2LSG A;  4OYJ A;  5L3B B;  2LSK A;  3VU7 H;  3F31 A;  4PAG A;  2NW7 A;  2CCQ A;  3PU8 A;  3B13 A;  2JRK A;  2CXF A;  5LJN A;  3LBX A;  2V1D B;  2DLR A;  3R84 B;  1HG5 A;  4PJN A;  3N5L A;  4PJM A;  5HXH A;  3C98 B;  3UUM A;  3ZYM A;  2X68 A;  2G0U A;  2RA1 A;  4CXY A;  4AQG A;  5L3F B;  3ONX A;  5HXS A;  2ZMA A;  4H63 V;  4AXP A;  4UVC B;  2IW5 B;  2RP4 A;  2V7J A;  1QSD A;  3FXD B;  3O4X E;  3MAC A;  4AKR B;  5CA1 E;  4BJM A;  1S94 A;  4AI6 A;  1YW0 A;  2DCF A;  1IAP A;  2XAJ B;  4OFZ A;  5LA6 E;  3N2G E;  4WBO A;  1CUN A;  3LK4 2;  3MJX A;  5JDL A;  2DI4 A;  3F57 A;  3PTR B;  4UIG A;  2BZB A;  3ZPO A;  2JQQ A;  4QKN A;  1LRZ A;  1V9D A;  1UX4 A;  3ESL A;  3LK3 B;  2IC9 A;  3MZK B;  4FJO A;  5LBQ B;  4X20 E;  1WYC A;  1IZN B;  1VRB A;  4CI1 B;  3IHR A;  2E9X A;  2VKO A;  3PUG A;  2GK9 A;  4A56 A;  5LCY A;  4TV8 E;  4PK4 A;  2VKH A;  3PDY A;  2KMF A;  2KWH A;  3ZMV B;  5HXC A;  2LEH A;  2C5J A;  2X67 A;  3KV6 A;  3Q9D A;  4HE8 A;  2XAG B;  4L5G A;  3AVR A;  3RYC E;  4AQF C;  1OWA A;  3AA0 B;  3QK6 A;  5E0O A;  5ETW A;  2XTL A;  1LVK A;  3CX6 B;  4GK0 E;  4IGU A;  4JUY A;  2XAQ B;  5LG4 A;  2X9W A;  2LSI A;  3RC8 A;  3AAI A;  4UEL A;  1ZEE A;  4UEM A;  4E7Z A;  3RRC A;  2NW8 A;  2CEA A;  2D5U A;  2V7L A;  2DWG A;  3KIN B;  2IC6 A;  3LFM A;  3ZLI A;  2LM9 A;  1MMN A;  2MTQ A;  3ANW A;  4AKH A;  4PW8 A;  2VL8 A;  3RYH E;  4HKA A;  2L8K A;  1FEW A;  3P7I A;  1FIO A;  4O4L E;  1X79 A;  1IJ6 A;  4TZ4 C;  2MBG A;  3QC9 A;  2VWA A;  1QUU A;  3U3I A;  3C4W A;  4KMC A;  3PUS A;  2WBL A;  2W61 A;  2KXP B;  5EK2 A;  5FMN A;  1Y64 B;  3NZQ A;  2W0G A;  3WAK A;  5LGN B;  4O4I E;  3O1I A;  4IE6 A;  5JR9 A;  2MOZ A;  4PNI A;  3I0O A;  3NBX X;  4CZZ B;  2K24 A;  4EYY R;  2OA5 A;  2XQY A;  4ZHQ E;  4NUV A;  2LT3 A;  4X1I E;  1HS7 A;  2WMN A;  3BQK A;  4G2A A;  5FXV A;  3FXE B;  4CXW A;  2H3R A;  5HYA A;  3EDU A;  2EHO D;  3ZC0 A;  1MMG A;  3UFE A;  2VK9 A;  3AAE B;  5JRC B;  3L3P A;  4XBF B;  2EHO B;  3HKB E;  4EZ4 A;  3MKD A;  2I59 A;  4WNK A;  1WLX A;  2KLQ A;  4C91 A;  3CWZ B;  4MBQ A;  5FY7 A;  5JRE A;  2C5I T;  2CE7 A;  3NRX A;  2NTX A;  4HTE A;  1AJ3 A;  2X9X A;  3PUR A;  1G8X A;  4EZH A;  4YLH A;  4DND A;  3OYX A;  2W00 A;  1D0Z A;  3BQL A;  4HN9 A;  3CPZ A;  4UF0 A;  4G63 A;  2H7V C;  2X0L B;  1LVF A;  2YK0 A;  4WW0 A;  4OK0 A;  2WWU A;  4ZI3 D;  3K8P C;  5J2U E;  3ZJ1 A;  2Q9Q D;  4MLK A;  1ZKE A;  3SWH A;  2LSJ A;  5EZY E;  4PFP A;  3ZMU B;  3JC6 D;  4X1Y E;  2Q9Q B;  4UXN B;  4H63 H;  3GN5 B;  5IYZ E;  2PFV A;  2WSS V;  4H9O C;  4QXB B;  3U78 A;  4AKG A;  3J9X 1;  4UV9 B;  3KV5 A;  4MAL A;  2Y6X A;  4YHJ A;  3I9Y A;  3HR0 A;  3RRW A;  3SRZ A;  5AFU L;  4IIJ E;  5JR9 C;  3HKC E;  5LGU B;  3O1J A;  3N2O A;  5JDM A;  2KND A;  2VKD A;  3AVS A;  3DP7 A;  1E1H B;  2K9A A;  2KWI B;  2J1D G;  4QHO A;  1WYB A;  2XHE B;  3KBT A;  5LJM A;  3UUX B;  2ES0 A;  3UUN A;  3UTK A;  4UVA B;  3AAA B;  2A2F X;  1MMA A;  4DVD A;  1YKH B;  2ZM2 A;  3I0Q A;  5IHY A;  4EYU A;  3E22 E;  2DHR A;  3ZJ2 A;  3Q5W A;  5J1G A;  1D0X A;  3FB2 A;  2CWO A;  1D1B A;  5H6Q B;  3NZP A;  3KVA A;  2NOX A;  3ZMS B;  3IF8 B;  1HX8 A;  3OYZ A;  2BVM A;  3LK2 B;  2N1G A;  1YKE B;  3CX7 B;  4ADZ A;  5EK3 A;  4MHC A;  5F3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...