2N1TD

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
74
structure length
74
Chain Sequence
GGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 32
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tD00
1L4AC 1KILA 5KJ7A 1KILD 2KOGA 1KILB 1SFCA 5KJ7D 5CCGC 3TSIA 1SFCD 1NHLA 1SFCB 1L4AA 2NPSD 1L4AD 1L4AB 5CCGA 5KJ7C 2H8PD 5CCGD 1SFCC 2WZ7A 2HG5D 3RK2D 2NPSC 3RK2B 3PP5A 1N7SD 3P8CE 2XDJA 3VOPA 1GL2A 1GL2D 2NPSA 1GL2B 3RK2C 1XTGB 2NPSB 3B5NA 5CCHD 3B5ND 1N7SC 3B5NB 3HTKB 2PP6A 4LGDE 4WY4D 1GL2C 2N1TD 3RL0D 3RL0B 4N78E 4OH8B 1N7SA 5CCHC 3B5NC 3M0DC 1T3JA 1N7SB 2M8RA 3HD7D 4WY4C 3RK3D 2N1TC 3RL0C 5CCHA 1URQC 4JF7A 2YMYA 4W7YA 1JTHA 1HVVA 1JTHB 4WY4A 3HD7C 2N1TA 3RK3C 4WY4B 2N1TB 1URQA 2HFED 3KYQA 1URQD 1URQB 3HD7A 4W80A 3HD7B 1KILC 3RK3B 4W7ZA
chains in the Genus database with same CATH superfamily
3D6ZA 1L4AC 3H1JE 2H43A 5C39A 3MUDA 3TSIA 2R44A 2OYHC 3AE9C 3RL0g 1YTZT 4C7RA 1JY2O 2ZYGA 1S1CX 1RY3A 2H8PD 5GTHE 1EDLA 2HODB 1EZVI 3RBXA 1KD1Q 1FOSE 1USEA 4RJTA 2OGUA 3L73D 4MN4C 3N4XA 1QVFO 3ZDMA 1NTME 1RH5B 4K3AA 3L72E 2IX7C 1PIXA 3CD6P 3CX5H 4JPZB 2M8RA 1BDCA 1KFMA 5CBNA 1NTMK 3RK3D 2N1TC 4YPCA 1NTKJ 2O3JA 2H7HA 1NTZD 4LLHA 1GU4A 2JP3A 1IK9A 1R5SA 3F5HA 5GTIH 1MFZA 3USSA 1L0LE 1GDTA 1FS0E 1S5LE 4IL6E 1NU1D 3VMXA 1KB9I 2K9JB 4A7PA 1L0LK 2ITAA 2B89A 3BCCD 2JDIH 3H6PA 2W27A 1PPJD 3L73J 1L4AA 1SQVG 1LT9C 3H1ID 1JO5A 1SQVJ 1QEXA 4D6TG 1LGHB 1SFCC 4D6TJ 1VQMP 1FZBA 2M3BA 3T97B 4QMAA 3QH9A 1YQ4C 3MD0A 2IPPA 2AXTE 1JM0A 3I5CA 2E75C 1NTZJ 4PV1C 5CJ0A 3L75D 1G1JA 3U1CA 2V7QJ 3BASA 2YMKA 1EZVD 3PJSK 2N9BA 3CC2P 4Y28J 1VQ9P 2KI7B 4UB6H 4I7ZC 1RF1A 3AEGC 1NU1J 1S9KE 1JMMA 1T3UA 3G9RA 1JTHB 2N1TA 3AEBC 2WT7A 4Y99B 3CLQA 2WVRA 4WY4B 1VL2A 3L4FA 4H44D 1OMIA 4H44B 2I8DA 3FXDA 3G6EP 3H1IJ 3O8ZA 2CPSA 4O9BA 1OW8A 1L0ND 1SS1A 1VQ4P 2OYIB 1M1JC 2NPSD 3L75G 2HYNA 2L5GB 2YXRB 3L75J 2J59M 5M1BA 2WZ7A 3EQ2A 3KZIE 3B4SA 1D7MA 3RK2D 1QLED 3RK2B 3PP5A 1BGYG 1T8ZA 5AVQB 4Z1MH 4EDFA 3L71G 5KLVK 4N78D 1PGOA 3CWBE 3L71J 3A0BH 5APUA 1KYOE 1Z56A 2QJKB 5KLVD 2QRXA 2W83C 1W5CE 3WUUA 3OW2O 1AFOA 3PRJA 1VDFA 2KSEA 3H1LD 5TJHA 3UIAA 1ZR2A 1T3JA 2A45H 4OGQD 2E42A 1EDIA 1DIPA 4OGQB 4KJMA 2OTLP 4JF7A 2QJYC 3Q5SA 1NYHA 1L0NJ 2KLVA 1PP9E 1NJIQ 2NRGA 2K9YA 4GDOA 2FFDC 3H1HG 3H1HJ 1JY2P 2FKWB 4PJ0H 2O01H 1GTWA 2Z5IA 1K8AQ 1BCCE 3AE1C 5E79E 1OZHA 2JWDA 3CC7P 2IZ1A 2HODA 3HRNA 1LTIC 2BCCD 4H0LD 2O01N 3K5BA 5KJ7D 2JJLA 1OW6A 5AVZB 1FDMA 2ZT9C 5AW0B 2OYOA 2POHA 3TGUG 1P84E 1UIIA 1SQQK 5B66E 3A0HH 1M1JA 1BE3E 1FZCB 2M5AA 5AVUB 1OX3A 1K9MQ 1SQQD 1OIPA 1SQBG 1DEBA 1AA0A 2NZ2A 3VMYA 1DD3A 2YO3A 1XTGB 2KS1A 1N7SC 3V2QA 3HTKB 2P10A 2JEEA 1GL2C 1QL2A 1A02J 3L74G 2ZJSE 3L74J 5AW1B 3B5NC 3Q1MA 2QG4A 1K04A 2W6AA 1X22A 2DW3A 2WPQA 1KYOH 4DOJA 3M9HA 1KQSO 2KZJA 4BRYB 3HD7C 1IK7A 1MV8A 3E1RA 1TU3F 4ASWA 1N7LA 2FFDA 3WUTA 3D6YA 2YKQA 4I2LC 3TNUA 4W7ZA 2HR3A 3V2RA 1YIJP 2OYHB 2IFNA 3A5TA 2QJPC 3IAOA 2YXQB 1KILD 1K05A 4GT1A 1GW4A 1KILB 2KYVA 2FYUG 5BU8B 2FYUJ 1JCDA 3ITKA 1CI6A 5CJ4A 1X9VA 3LW5J 1VQ5P 1M7LA 3P8MC 1YITP 2MJZA 3CCSP 4U3FE 5APVA 2E76D 1YBKA 2E76B 1KMIZ 3C9IA 2P67A 2KXPB 2K1AA 3W67A 1JY3N 5CHXA 2QIWA 5KTBA 1AVOA 2WSSH 1KORA 2LXBA 5KLIC 2HPCB 2J58A 2N1TD 3VMAA 4BWNA 5CBOA 5CCHC 1N7SA 1HGVA 4ZMDA 5APQA 2PRRA 1DD4A 1T2KC 2JKVA 1QVGO 1IFDA 3BVHA 2A06D 2Y0DA 2M0BA 3MIWA 3AE6C 2GM4A 2QVAA 2C9LY 1GW3A 5K5GB 2HFED 3H1KD 1KTMA 1E79H 2WPRA 3HD7A 5B5EH 2N9YB 2HLOA 3OAKA 1NKNA 1LJ2A 2P58A 1ZV8A 2CPBA 1EDKA 3O6QB 1ZRTD 2R32A 2KOGA 2V4HA 1SFCD 3SWKA 1SFCB 3VYIA 1LP1A 1CW5A 3CXHD 1LWUA 2WTYA 2KIKA 3PHLA 1H0TA 1KZUB 1SQXG 2E75D 1X8YA 1SQXJ 4OWFA 4PV1D 1HWTC 4PV1B 1EXJA 2Z4EA 3P7KA 2O1JA 2BEQD 2W6BA 2A06G 4L76A 5TISH 2GA1A 2PAJA 1FE6A 3HE5A 3OJAB 2C0XA 2Q5UA 3GW6A 2A45I 2KNCA 3H1JD 3PH0A 1JEKA 1N86A 2XZRA 2RN0A 3OA7A 1N73C 1SQVE 5CCHA 2WWWA 1R5LA 5AW8B 4D6TE 4NPEA 2P7JA 2KB7P 3MZWB 3QWOC 1RF1C 1SQPG 1IO4A 1SQPJ 3C8VA 3L35A 4L73A 1EXIA 1WT6A 1N2DC 1EQ7A 1NTKG 4C7NB 2B87B 3A2AA 3RK3B 1NTMD 1ZN5A 5AW6B 3L72D 5L8RJ 3SFEC 2XKMA 1NHLA 3AE3C 1S5LX 4IL6X 1U7JA 1T6AA 3GHGC 2E5YA 4UB8H 3RBZA 1Q81Q 5CCGD 1ZP0C 3CXHH 1Y9BA 3JC22 3VP8A 5CMZA 3CCJP 4DT0A 4HB1A 4IFDK 1L0LD 1Y8AA 3L73G 1A02F 2R5BA 1NGMB 3NTNA 1IC2A 3G3ZA 1LTGC 2Y9ZA 4EYYQ 1PGPA 2OQQA 2C9NY 3FX0A 1YYCA 3M0DC 5AW9B 1KYOI 1VQ6P 4JYCA 1MFTA 1NTZG 3NXSA 1NTMJ 1U57A 1S4XA 1HJBA 1VF5D 1VF5B 1N73A 5GTHH 1H88A 2IBZI 1NAFA 5DJUB 1YTZI 1URQD 1BGYE 1URQB 3U1AA 1VQOP 3AEDC 3L71E 4KT0J 1NU1G 3AE4C 2WPSA 3CCMP 4H13C 1SLQA 3SFDC 1M56D 5BU5A 3V2NA 1W2BO 3L70D 1USDA 3BCCG 1JOCA 5KKZC 2KP8A 1OW7A 3BCCJ 2P1JA 1OVRA 2ZT9D 3S4RA 1L0LJ 2ZT9B 1PPJG 3PTZA 5AVXB 3H1IG 4KHXA 2OTKE 2WPVB 1VQ8P 4OVNF 5KAFE 4R4LA 1Q7YQ 1S9KD 3E7KA 3NFQA 2WITA 3GHGA 4L75A 4C46A 3H1HE 3HE4B 1BSNA 1N7SD 3HUSA 2LKMA 3VOPA 1GL2D 1GL2B 2NPSB 1G2CA 3B5ND 3B5NB 1S5LH 4IL6H 2FBWC 2O1KA 2Q3EA 1EZVG 2A45G 1KB9E 2W90A 1M90Q 1NO4A 2M3EA 4N78E 4OH8B 4RO0A 1LTJB 3HD7D 3L70G 1X0TA 3KPEA 3S1KA 3L70J 3M0DA 4L74A 2WSCJ 1U7MA 3LIEA 3TGUE 2Y0EA 3L36A 4ZKUA 2O01J 4IOIH 4WVZA 2BASA 4EOTA 2Q6QA 4ASVA 1SQBE 1KYOD 4W80A 2B9BA 2AXTH 1L0NG 3AEAC 3H32B 3M0AA 2B88A 2WSCH 1IFNA 5APYA 1SQBK 1EDJA 3L74E 3CCUP 2IBZD 4N6JA 1J1DC 1Q2NA 3IFMA 1ZXGA 1MZ9A 1ZOYC 1ZMEC 4H0LB 2JR8A 3GF7A 1PZQA 3NMDA 5H2FE 2KUBA 5KLVG 3CCVP 1E5WA 5KLVJ 1BCCD 1J1EC 1LTBC 5CCHD 2K88A 1KV4A 3H1LG 5BVZA 3L37A 5KAIE 3H1LJ 1JY2N 3BRVB 3IF4A 2FYUE 2WMMA 4WY4C 1HF9A 2G8YA 1YI2P 2ZXXA 1HVVA 2IBZG 1BE3D 2YKOA 3RGUA 3KDPB 4XE5B 3KZIH 2KSJA 1OFCX 2J5UA 1PV3A 2YIUB 4DCKA 1OVVA 4K35A 2BCCG 2OYIC 2W6JH 2SPZA 1FC2C 2AXCA 3JCUE 4B86A 2E74D 2BCCJ 2E74B 2K9JA 1KN7A 5AVRB 1PFIA 1FZGA 1FJPA 1GK6A 1BCCJ 3CXHI 1L4AD 1L4AB 5AW7B 2OTJP 4AUWA 2Q9IA 5AW3B 3WU2E 2IZ0A 1UIXA 2FXPA 3T97A 2QJKC 1SQQG 5AVSB 1AJYA 2LR2A 1SQQJ 1FU1A 3D71A 3N7NA 1K73Q 3P8CE 1LWUC 2XDJA 3SSUA 2WQYC 3Q5RA 1RQUA 5E79H 2PP6A 1BE3J 4I6MC 1PGQA 4JBZA 2LXCB 1AQ5A 1YQ3C 3G71P 2QSIA 3TF5A 1IFIA 4AYCA 3IN6A 1JCCA 3RL0C 2P2UA 1RF1B 4ZNCA 4TT3H 1DH3A 4HKZH 1FBMA 1JTHA 4U3FD 2QM8A 4XFJA 1FJKA 4WY4A 3TDKA 1M57D 1P84H 2N1TB 5B66H 2WT7B 1SQXE 5KAIH 3FWLA 2QE7H 2WSEH 3V2PA 2QEXP 1IFJA 2A06E 2FY8A 3BRTB 2AEJA 1QX8A 4GOFA 3CC4P 3Q5PA 3CX5E 1FAVA 2OYIA 1SP4A 3M06A 3CMAP 3EWKA 2E5TA 1FZCC 1VQLP 3PLNA 5GTIE 1HH0A 1DEEG 3SWYA 1Y47A 3SWFA 4PD4E 1LT9B 1JB0J 1RE3C 1SQPE 4EI2A 5EFWB 1H89A 1NTKE 4U3FJ 4WBAA 4LGDE 3WU2H 1ZLLA 3CPWO 1LNQA 3VTPC 2E75B 4LC1A 3D70A 1NTKK 1FZFA 1XTCC 1RF0C 3BATA 4JYBA 3TK1A 4WWIA 5AW4B 3CCLP 1AVYA 1RE4C 3H1KG 4H13D 4H13B 4I7ZB 2RKLA 2GUSA 3H1KJ 2FYNC 4NPFX 1EC5A 3L73E 5KKZB 1KILC 5APXA 2WSFJ 1QL1A 1HUCA 2K37A 1JUNA 1LTAC 1GK4A 5KJ7A 1AQTA 3KXDA 4R4MA 4UB6E 2E76C 5APTA 1SQVK 3RK3E 3Q3DA 2FXOA 3II6A 3CCRP 1NWQA 1SQVD 4HJGH 1NTZE 1OXZA 4D6TD 1FZCA 3E1IA 4YTPC 2WSFH 2K3RA 1M1JB 2H89C 1VPCA 2M5AB 2D2CC 3FGAD 3R2PA 3GMAA 2JO1A 4YXWH 1NTZK 1NU1E 2IYPA 3HTKA 4N3YB 1OVUA 1RE3A 1YJWP 1LTSC 3GF3A 1KQFB 2KS1B 3HUSC 3H1JG 3VMZA 3H1JJ 3IR9A 1G1IA 3BCCE 1HBWA 3I56P 1NU1K 1NH4A 4PD4H 3AECC 1PPJE 3M9QA 3H1IE 1M8OB 3B8EB 4DJGA 1KC8Q 4EIJA 4BRYA 2XU6A 2ZXEB 1AV1A 2Z5HA 1H8AA 2I1JA 3LIDA 3A0BE 1RF0A 2QJYB 3CCEP 1RE4A 2MKVA 2PGDA 3V4WA 1LTTC 2FFDB 1NTMG 1JY3O 2OYHA 3L75E 3TNUB 3L72G 5DJTB 2YKPA 3L72J 2JWAA 1J1DB 1KILA 1EZVE 3M9BA 3AE5C 3MGNA 3CL3D 4GOEA 1CI6B 1HTLC 2E43A 3L70E 1BDDA 2XNXA 2UWJE 4YXDC 2HG5D 2ZVNB 2ZYAA 4PJ0E 2AEFA 5AVVB 1L0LG 1J1EB 3VN0A 1BGYD 3L71D 1GD2E 3B71A 1N8RQ 2HPCA 5AVTB 1L0NE 4WY4D 1HJ0A 2ZYDA 1DX7A 2V7QH 1ZW0A 1FDIA 3MTUE 3R4YA 1VQKP 3ABVC 1N7SB 1J2JB 1MKMA 1M1KQ 2Q3IA 3A0HE 1L0NK 1LT1A 3G4SP 1P84I 1SVFA 1WMKA 3GLMA 1KQLA 5AW2B 2FXMA 4M3LA 3RK3C 1NOHA 3AE7C 3M91A 3H1HD 5AW5B 1IFMA 1PL5A 5KLVE 2VRSA 3HD7B 3FXEA 3O6QA 3I55P 4ZKPA 1LT9A 1KB9D 1R8EA 3H1LE 1SFCA 5CCGC 1BGYJ 1S72P 4HH2A 2FYZA 2KK7A 3CWBD 1LP1B 2QJPB 3EFGA 1HGZA 1S3JA 1CSBA 1LWUB 2Q7CA 3TGUD 2OARA 3AE8C 1Q82Q 1PGJA 1H0TB 2IBZE 3W68A 1JMBA 4AQRD 1SQBD 3EFFK 3A7OA 3U59A 2QM7A 4GIFA 2BCCE 4XA4A 3HE5B 1YJ9P 1PP9D 3RL0D 3RL0B 2KNCB 3L74D 2KZIA 4I1LA 1VF5C 2AEMA 1GU5A 5KLIB 1RHZB 1NVOA 1URQC 5KAFH 3AEEC 1ZR4A 4U7JA 5AVYB 1SQQE 3F89A 1YJNP 3WMM0 2L91A 3CWBG 1T2KD 3FWNA 4HYTB 3KHUA 3JSVC 3CWBJ 4C7NA 3KQGA 1Q86Q 2B87A 4Y99C 2KLUA 5APWA 4H44C 2RMZA 3AE2C 3TGUJ 1P84D 2H88C 2FYUK 4RKUJ 1KB9H 1W2EA 1SQBJ 2FYUD 2BEZF 2R3SA 1S2EA 1CZQA 5CCGA 1PP9G 3V6IA 1IFPA 2C0WA 3WUVA 1PP9J 3CX5I 2G3AA 2Q1KA 2NPSC 5B5EE 3C1LA 3Q2YA 1BCCG 2XNDH 2W8ZA 1Q90D 3P32A 3RK2C 3V5BA 4CPGA 2IDBA 4DZOA 1FDOA 1LTJC 1KFNA 4PD4I 1FZEA 3A3YB 1KILE 1L2PA 2IFMA 4GKGA 1JY3P 2CK3H 1FOSF 2YMYA 1BE3G 2FYNB 1GZLA 4OGQC 2YNYA 2ZVOB 2IYOA 1JNMA 1URQA 1N73B 3V4QA 2WSEJ 2I1KA 3P8CD 5TISE 5H2FH 1GMJA 4RESB 3MUDC 3AEFC 2RH0A 3GG2A 2R5DA 2ZFCA 1X79B 4H0LC 3VP9A 4GODA 4IFFA 3H25A 2ZAEB 4BXLA 5KJ7C 1RQVA 2D2CD 2D2CB 2XV5A 3LW5H 1BSHA 1YHQP 3TYYA 1SQXK 5AVWB 3HE4A 4WB4A 3MHVA 3H1KE 3GHGB 1SQXD 1WRGA 1GL2A 1VQNP 3HUSB 2NPSA 3CCQP 3B5NA 1IJDB 1NKZB 1NAYA 1MUUA 2R3CA 3CMEP 1G2CB 1IZNB 4JQ0D 1ZRTE 3JCUH 3CX5D 2Y9YA 1KQGB 2PFXA 3CI9A 3S9OA 2Y0CA 1LTJA 4UB8E 3CXHE 4U3FG 2QA4P 4NPDA 1VQ7P 4W7YA 2YIUC 5APSA 1SQPK 1FZAA 4PD4D 3KYQA 2E74C 1SQPD 3MP7B 4TLFA 1QGKB 3H32A 1NTKD 2GUVA 1OWAA 1VQPP 2YO2A 4IFMA
chains in the Genus database with same CATH topology
3A5TA 1J1DB 1L4AC 1KILA 2WSCH 2H43A 1IFNA 5APYA 1KILD 1SQBK 3M9BA 4GT1A 1GW4A 1KILB 2KYVA 3MUDA 3TSIA 5BU8B 2OYHC 3MGNA 1JCDA 3CL3D 4N6JA 1CI6A 5CJ4A 1X9VA 1J1DC 1CI6B 1YTZT 1HTLC 1JY2O 4C7RA 1M7LA 3IFMA 3P8MC 2MJZA 2E43A 2XNXA 1RY3A 2H8PD 1MZ9A 5APVA 2HG5D 2HODB 3C9IA 2P67A 5AVVB 3NMDA 1J1EB 1FOSE 3VN0A 1JY3N 5CHXA 1GD2E 1E5WA 5KTBA 1J1EC 1LTBC 5CCHD 3N4XA 2HPCA 5AVTB 4WY4D 5BVZA 2HPCB 2J58A 2N1TD 2IX7C 3L37A 1JY2N 5CCHC 1N7SA 3BRVB 1DX7A 1HGVA 3MTUE 1N7SB 2M8RA 5APQA 1J2JB 1KFMA 4WY4C 1NTMK 3RK3D 2N1TC 2Q3IA 1L0NK 1T2KC 2H7HA 1IFDA 3BVHA 1SVFA 4LLHA 1HVVA 1GU4A 5AW2B 1KQLA 3MIWA 2FXMA 2YKOA 4M3LA 1IK9A 2GM4A 3RK3C 3KDPB 2C9LY 1NOHA 4XE5B 1GW3A 1MFZA 3M91A 2HFED 5AW5B 2KSJA 1GDTA 1IFMA 2WPRA 3HD7A 2VRSA 3HD7B 2HLOA 2OYIC 4B86A 3VMXA 3OAKA 1NKNA 1ZV8A 5AVRB 4ZKPA 1LT9A 2CPBA 1L0LK 2R32A 2KOGA 1SFCA 5CCGC 1PFIA 3H6PA 1SFCD 4HH2A 1SFCB 1FZGA 1FJPA 1GK6A 2FYZA 2W27A 3VYIA 1L4AA 1CW5A 1LT9C 1L4AD 1L4AB 3EFGA 5AW7B 1JO5A 1LWUA 4AUWA 2Q9IA 2WTYA 5AW3B 1HGZA 1LGHB 1SFCC 1CSBA 1LWUB 2Q7CA 1FZBA 3T97A 5AVSB 2M3BA 1KZUB 2OARA 1FU1A 1X8YA 3MD0A 3N7NA 3P8CE 1HWTC 1LWUC 2XDJA 2Z4EA 3P7KA 2O1JA 4AQRD 2IPPA 3A7OA 2W6BA 3I5CA 2PAJA 3U59A 2QM7A 3HE5A 5CJ0A 4GIFA 3OJAB 4XA4A 3HE5B 2PP6A 4I6MC 2C0XA 1G1JA 3U1CA 2Q5UA 1AQ5A 3BASA 2A45I 3RL0D 3RL0B 4I1LA 2N9BA 1GU5A 1IFIA 4AYCA 1N86A 2XZRA 1RF1A 1JCCA 3OA7A 3RL0C 2P2UA 1S9KE 1RF1B 1N73C 5CCHA 1DH3A 1URQC 2WWWA 1JMMA 1FBMA 5AW8B 1JTHA 2QM8A 1T3UA 2P7JA 1FJKA 1JTHB 1ZR4A 2KB7P 4WY4A 2N1TA 2WT7A 5AVYB 4Y99B 3CLQA 1RF1C 4WY4B 2N1TB 3L4FA 2WT7B 1IO4A 3WMM0 1T2KD 4HYTB 3L35A 4C7NA 3KQGA 1WT6A 3O8ZA 1N2DC 1EQ7A 2WSEH 4Y99C 4C7NB 2CPSA 3V2PA 3A2AA 3RK3B 5APWA 4O9BA 1IFJA 3BRTB 1ZN5A 5AW6B 1FAVA 2FYUK 2OYIA 1SP4A 3M06A 2XKMA 2OYIB 1W2EA 1NHLA 1FZCC 1M1JC 2NPSD 2HYNA 2L5GB 3GHGC 1CZQA 5CCGA 5CCGD 2J59M 1HH0A 2C0WA 2WZ7A 3EQ2A 3SWYA 3SWFA 3VP8A 3RK2D 2NPSC 3RK2B 3PP5A 5CMZA 1T8ZA 1LT9B 5AVQB 1RE3C 5KLVK 4IFDK 4N78D 5APUA 1Z56A 1A02F 2R5BA 3P32A 3RK2C 3NTNA 3V5BA 1H89A 4DZOA 1IC2A 3G3ZA 1LTGC 1LTJC 1AFOA 4WBAA 1VDFA 4LGDE 1ZLLA 1KFNA 1FZEA 3A3YB 3VTPC 3UIAA 2C9NY 1YYCA 4LC1A 3M0DC 1T3JA 1ZR2A 5AW9B 2IFMA 4GKGA 2A45H 1NTKK 1FZFA 1JY3P 4JYCA 2E42A 1FOSF 4JF7A 3NXSA 1XTCC 2YMYA 1RF0C 1HJBA 3BATA 4JYBA 1GZLA 3TK1A 2KLVA 5AW4B 1RE4C 2FFDC 1N73A 2YNYA 1H88A 1NAFA 1JNMA 1URQA 2GUSA 1YTZI 3V4QA 1N73B 1URQD 1URQB 2I1KA 3P8CD 1JY2P 2FKWB 3U1AA 2O01H 1GTWA 2Z5IA 2WPSA 1SLQA 5BU5A 1KILC 5APXA 3V2NA 4RESB 1QL1A 2HODA 1HUCA 3HRNA 1JUNA 1LTIC 1LTAC 1GK4A 1JOCA 2KP8A 5KJ7A 2P1JA 2R5DA 2ZFCA 5KJ7D 1X79B 5AVXB 2JJLA 4KHXA 5APTA 3VP9A 1SQVK 4IFFA 3II6A 5AVZB 1S9KD 1FDMA 1NWQA 5KJ7C 5AW0B 1OXZA 2POHA 2XV5A 3LW5H 3NFQA 2WITA 1SQQK 1FZCA 3E1IA 3TYYA 2WSFH 1M1JA 1SQXK 1FZCB 5AVWB 5AVUB 3HE4A 1M1JB 3GHGA 4WB4A 4C46A 1VPCA 3HE4B 3GHGB 1N7SD 3R2PA 3HUSA 1WRGA 2LKMA 3VOPA 1DEBA 1GL2A 3HUSB 1NTZK 3VMYA 1GL2D 2NPSA 1GL2B 2YO3A 1XTGB 2NPSB 3B5NA 1IJDB 1NKZB 4N3YB 3HTKA 1G2CA 1RE3A 1MUUA 3B5ND 1N7SC 3B5NB 1LTSC 2R3CA 3HTKB 3V2QA 1G2CB 3HUSC 2O1KA 2A45G 2JEEA 1GL2C 1QL2A 3VMZA 1A02J 3IR9A 1G1IA 1NO4A 1HBWA 3CI9A 4N78E 4OH8B 5AW1B 3B5NC 1NU1K 1LTJA 1NH4A 2W6AA 3M9QA 1LTJB 3HD7D 2WPQA 3KPEA 3B8EB 3M0DA 4DOJA 3M9HA 4EIJA 4W7YA 2XU6A 2ZXEB 3LIEA 2Z5HA 1H8AA 3HD7C 3L36A 5APSA 4ZKUA 1MV8A 1SQPK 2I1JA 3LIDA 1FZAA 3KYQA 1RF0A 2BASA 4EOTA 1N7LA 1RE4A 2FFDA 4W80A 3V4WA 1LTTC 2FFDB 2YKQA 4I2LC 1JY3O 3H32A 3TNUA 2OYHA 4W7ZA 3V2RA 2GUVA 3TNUB 1OWAA 3H32B 2OYHB 2IFNA 3M0AA 2YO2A 4IFMA 2YKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4A C;  1KIL A;  5KJ7 A;  1KIL D;  2KOG A;  1KIL B;  1SFC A;  5KJ7 D;  5CCG C;  3TSI A;  1SFC D;  1NHL A;  1SFC B;  1L4A A;  2NPS D;  1L4A D;  1L4A B;  5CCG A;  5KJ7 C;  2H8P D;  5CCG D;  1SFC C;  2WZ7 A;  2HG5 D;  3RK2 D;  2NPS C;  3RK2 B;  3PP5 A;  1N7S D;  3P8C E;  2XDJ A;  3VOP A;  1GL2 A;  1GL2 D;  2NPS A;  1GL2 B;  3RK2 C;  1XTG B;  2NPS B;  3B5N A;  5CCH D;  3B5N D;  1N7S C;  3B5N B;  3HTK B;  2PP6 A;  4LGD E;  4WY4 D;  1GL2 C;  2N1T D;  3RL0 D;  3RL0 B;  4N78 E;  4OH8 B;  1N7S A;  5CCH C;  3B5N C;  3M0D C;  1T3J A;  1N7S B;  2M8R A;  3HD7 D;  4WY4 C;  3RK3 D;  2N1T C;  3RL0 C;  5CCH A;  1URQ C;  4JF7 A;  2YMY A;  4W7Y A;  1JTH A;  1HVV A;  1JTH B;  4WY4 A;  3HD7 C;  2N1T A;  3RK3 C;  4WY4 B;  2N1T B;  1URQ A;  2HFE D;  3KYQ A;  1URQ D;  1URQ B;  3HD7 A;  4W80 A;  3HD7 B;  1KIL C;  3RK3 B;  4W7Z A; 
#chains in the Genus database with same CATH topology
 3D6Z A;  1L4A C;  3H1J E;  2H43 A;  5C39 A;  3MUD A;  3TSI A;  2R44 A;  2OYH C;  3AE9 C;  3RL0 g;  1YTZ T;  4C7R A;  1JY2 O;  2ZYG A;  1S1C X;  1RY3 A;  2H8P D;  5GTH E;  1EDL A;  2HOD B;  1EZV I;  3RBX A;  1KD1 Q;  1FOS E;  1USE A;  4RJT A;  2OGU A;  3L73 D;  4MN4 C;  3N4X A;  1QVF O;  3ZDM A;  1NTM E;  1RH5 B;  4K3A A;  3L72 E;  2IX7 C;  1PIX A;  3CD6 P;  3CX5 H;  4JPZ B;  2M8R A;  1BDC A;  1KFM A;  5CBN A;  1NTM K;  3RK3 D;  2N1T C;  4YPC A;  1NTK J;  2O3J A;  2H7H A;  1NTZ D;  4LLH A;  1GU4 A;  2JP3 A;  1IK9 A;  1R5S A;  3F5H A;  5GTI H;  1MFZ A;  3USS A;  1L0L E;  1GDT A;  1FS0 E;  1S5L E;  4IL6 E;  1NU1 D;  3VMX A;  1KB9 I;  2K9J B;  4A7P A;  1L0L K;  2ITA A;  2B89 A;  3BCC D;  2JDI H;  3H6P A;  2W27 A;  1PPJ D;  3L73 J;  1L4A A;  1SQV G;  1LT9 C;  3H1I D;  1JO5 A;  1SQV J;  1QEX A;  4D6T G;  1LGH B;  1SFC C;  4D6T J;  1VQM P;  1FZB A;  2M3B A;  3T97 B;  4QMA A;  3QH9 A;  1YQ4 C;  3MD0 A;  2IPP A;  2AXT E;  1JM0 A;  3I5C A;  2E75 C;  1NTZ J;  4PV1 C;  5CJ0 A;  3L75 D;  1G1J A;  3U1C A;  2V7Q J;  3BAS A;  2YMK A;  1EZV D;  3PJS K;  2N9B A;  3CC2 P;  4Y28 J;  1VQ9 P;  2KI7 B;  4UB6 H;  4I7Z C;  1RF1 A;  3AEG C;  1NU1 J;  1S9K E;  1JMM A;  1T3U A;  3G9R A;  1JTH B;  2N1T A;  3AEB C;  2WT7 A;  4Y99 B;  3CLQ A;  2WVR A;  4WY4 B;  1VL2 A;  3L4F A;  4H44 D;  1OMI A;  4H44 B;  2I8D A;  3FXD A;  3G6E P;  3H1I J;  3O8Z A;  2CPS A;  4O9B A;  1OW8 A;  1L0N D;  1SS1 A;  1VQ4 P;  2OYI B;  1M1J C;  2NPS D;  3L75 G;  2HYN A;  2L5G B;  2YXR B;  3L75 J;  2J59 M;  5M1B A;  2WZ7 A;  3EQ2 A;  3KZI E;  3B4S A;  1D7M A;  3RK2 D;  1QLE D;  3RK2 B;  3PP5 A;  1BGY G;  1T8Z A;  5AVQ B;  4Z1M H;  4EDF A;  3L71 G;  5KLV K;  4N78 D;  1PGO A;  3CWB E;  3L71 J;  3A0B H;  5APU A;  1KYO E;  1Z56 A;  2QJK B;  5KLV D;  2QRX A;  2W83 C;  1W5C E;  3WUU A;  3OW2 O;  1AFO A;  3PRJ A;  1VDF A;  2KSE A;  3H1L D;  5TJH A;  3UIA A;  1ZR2 A;  1T3J A;  2A45 H;  4OGQ D;  2E42 A;  1EDI A;  1DIP A;  4OGQ B;  4KJM A;  2OTL P;  4JF7 A;  2QJY C;  3Q5S A;  1NYH A;  1L0N J;  2KLV A;  1PP9 E;  1NJI Q;  2NRG A;  2K9Y A;  4GDO A;  2FFD C;  3H1H G;  3H1H J;  1JY2 P;  2FKW B;  4PJ0 H;  2O01 H;  1GTW A;  2Z5I A;  1K8A Q;  1BCC E;  3AE1 C;  5E79 E;  1OZH A;  2JWD A;  3CC7 P;  2IZ1 A;  2HOD A;  3HRN A;  1LTI C;  2BCC D;  4H0L D;  2O01 N;  3K5B A;  5KJ7 D;  2JJL A;  1OW6 A;  5AVZ B;  1FDM A;  2ZT9 C;  5AW0 B;  2OYO A;  2POH A;  3TGU G;  1P84 E;  1UII A;  1SQQ K;  5B66 E;  3A0H H;  1M1J A;  1BE3 E;  1FZC B;  2M5A A;  5AVU B;  1OX3 A;  1K9M Q;  1SQQ D;  1OIP A;  1SQB G;  1DEB A;  1AA0 A;  2NZ2 A;  3VMY A;  1DD3 A;  2YO3 A;  1XTG B;  2KS1 A;  1N7S C;  3V2Q A;  3HTK B;  2P10 A;  2JEE A;  1GL2 C;  1QL2 A;  1A02 J;  3L74 G;  2ZJS E;  3L74 J;  5AW1 B;  3B5N C;  3Q1M A;  2QG4 A;  1K04 A;  2W6A A;  1X22 A;  2DW3 A;  2WPQ A;  1KYO H;  4DOJ A;  3M9H A;  1KQS O;  2KZJ A;  4BRY B;  3HD7 C;  1IK7 A;  1MV8 A;  3E1R A;  1TU3 F;  4ASW A;  1N7L A;  2FFD A;  3WUT A;  3D6Y A;  2YKQ A;  4I2L C;  3TNU A;  4W7Z A;  2HR3 A;  3V2R A;  1YIJ P;  2OYH B;  2IFN A;  3A5T A;  2QJP C;  3IAO A;  2YXQ B;  1KIL D;  1K05 A;  4GT1 A;  1GW4 A;  1KIL B;  2KYV A;  2FYU G;  5BU8 B;  2FYU J;  1JCD A;  3ITK A;  1CI6 A;  5CJ4 A;  1X9V A;  3LW5 J;  1VQ5 P;  1M7L A;  3P8M C;  1YIT P;  2MJZ A;  3CCS P;  4U3F E;  5APV A;  2E76 D;  1YBK A;  2E76 B;  1KMI Z;  3C9I A;  2P67 A;  2KXP B;  2K1A A;  3W67 A;  1JY3 N;  5CHX A;  2QIW A;  5KTB A;  1AVO A;  2WSS H;  1KOR A;  2LXB A;  5KLI C;  2HPC B;  2J58 A;  2N1T D;  3VMA A;  4BWN A;  5CBO A;  5CCH C;  1N7S A;  1HGV A;  4ZMD A;  5APQ A;  2PRR A;  1DD4 A;  1T2K C;  2JKV A;  1QVG O;  1IFD A;  3BVH A;  2A06 D;  2Y0D A;  2M0B A;  3MIW A;  3AE6 C;  2GM4 A;  2QVA A;  2C9L Y;  1GW3 A;  5K5G B;  2HFE D;  3H1K D;  1KTM A;  1E79 H;  2WPR A;  3HD7 A;  5B5E H;  2N9Y B;  2HLO A;  3OAK A;  1NKN A;  1LJ2 A;  2P58 A;  1ZV8 A;  2CPB A;  1EDK A;  3O6Q B;  1ZRT D;  2R32 A;  2KOG A;  2V4H A;  1SFC D;  3SWK A;  1SFC B;  3VYI A;  1LP1 A;  1CW5 A;  3CXH D;  1LWU A;  2WTY A;  2KIK A;  3PHL A;  1H0T A;  1KZU B;  1SQX G;  2E75 D;  1X8Y A;  1SQX J;  4OWF A;  4PV1 D;  1HWT C;  4PV1 B;  1EXJ A;  2Z4E A;  3P7K A;  2O1J A;  2BEQ D;  2W6B A;  2A06 G;  4L76 A;  5TIS H;  2GA1 A;  2PAJ A;  1FE6 A;  3HE5 A;  3OJA B;  2C0X A;  2Q5U A;  3GW6 A;  2A45 I;  2KNC A;  3H1J D;  3PH0 A;  1JEK A;  1N86 A;  2XZR A;  2RN0 A;  3OA7 A;  1N73 C;  1SQV E;  5CCH A;  2WWW A;  1R5L A;  5AW8 B;  4D6T E;  4NPE A;  2P7J A;  2KB7 P;  3MZW B;  3QWO C;  1RF1 C;  1SQP G;  1IO4 A;  1SQP J;  3C8V A;  3L35 A;  4L73 A;  1EXI A;  1WT6 A;  1N2D C;  1EQ7 A;  1NTK G;  4C7N B;  2B87 B;  3A2A A;  3RK3 B;  1NTM D;  1ZN5 A;  5AW6 B;  3L72 D;  5L8R J;  3SFE C;  2XKM A;  1NHL A;  3AE3 C;  1S5L X;  4IL6 X;  1U7J A;  1T6A A;  3GHG C;  2E5Y A;  4UB8 H;  3RBZ A;  1Q81 Q;  5CCG D;  1ZP0 C;  3CXH H;  1Y9B A;  3JC2 2;  3VP8 A;  5CMZ A;  3CCJ P;  4DT0 A;  4HB1 A;  4IFD K;  1L0L D;  1Y8A A;  3L73 G;  1A02 F;  2R5B A;  1NGM B;  3NTN A;  1IC2 A;  3G3Z A;  1LTG C;  2Y9Z A;  4EYY Q;  1PGP A;  2OQQ A;  2C9N Y;  3FX0 A;  1YYC A;  3M0D C;  5AW9 B;  1KYO I;  1VQ6 P;  4JYC A;  1MFT A;  1NTZ G;  3NXS A;  1NTM J;  1U57 A;  1S4X A;  1HJB A;  1VF5 D;  1VF5 B;  1N73 A;  5GTH H;  1H88 A;  2IBZ I;  1NAF A;  5DJU B;  1YTZ I;  1URQ D;  1BGY E;  1URQ B;  3U1A A;  1VQO P;  3AED C;  3L71 E;  4KT0 J;  1NU1 G;  3AE4 C;  2WPS A;  3CCM P;  4H13 C;  1SLQ A;  3SFD C;  1M56 D;  5BU5 A;  3V2N A;  1W2B O;  3L70 D;  1USD A;  3BCC G;  1JOC A;  5KKZ C;  2KP8 A;  1OW7 A;  3BCC J;  2P1J A;  1OVR A;  2ZT9 D;  3S4R A;  1L0L J;  2ZT9 B;  1PPJ G;  3PTZ A;  5AVX B;  3H1I G;  4KHX A;  2OTK E;  2WPV B;  1VQ8 P;  4OVN F;  5KAF E;  4R4L A;  1Q7Y Q;  1S9K D;  3E7K A;  3NFQ A;  2WIT A;  3GHG A;  4L75 A;  4C46 A;  3H1H E;  3HE4 B;  1BSN A;  1N7S D;  3HUS A;  2LKM A;  3VOP A;  1GL2 D;  1GL2 B;  2NPS B;  1G2C A;  3B5N D;  3B5N B;  1S5L H;  4IL6 H;  2FBW C;  2O1K A;  2Q3E A;  1EZV G;  2A45 G;  1KB9 E;  2W90 A;  1M90 Q;  1NO4 A;  2M3E A;  4N78 E;  4OH8 B;  4RO0 A;  1LTJ B;  3HD7 D;  3L70 G;  1X0T A;  3KPE A;  3S1K A;  3L70 J;  3M0D A;  4L74 A;  2WSC J;  1U7M A;  3LIE A;  3TGU E;  2Y0E A;  3L36 A;  4ZKU A;  2O01 J;  4IOI H;  4WVZ A;  2BAS A;  4EOT A;  2Q6Q A;  4ASV A;  1SQB E;  1KYO D;  4W80 A;  2B9B A;  2AXT H;  1L0N G;  3AEA C;  3H32 B;  3M0A A;  2B88 A;  2WSC H;  1IFN A;  5APY A;  1SQB K;  1EDJ A;  3L74 E;  3CCU P;  2IBZ D;  4N6J A;  1J1D C;  1Q2N A;  3IFM A;  1ZXG A;  1MZ9 A;  1ZOY C;  1ZME C;  4H0L B;  2JR8 A;  3GF7 A;  1PZQ A;  3NMD A;  5H2F E;  2KUB A;  5KLV G;  3CCV P;  1E5W A;  5KLV J;  1BCC D;  1J1E C;  1LTB C;  5CCH D;  2K88 A;  1KV4 A;  3H1L G;  5BVZ A;  3L37 A;  5KAI E;  3H1L J;  1JY2 N;  3BRV B;  3IF4 A;  2FYU E;  2WMM A;  4WY4 C;  1HF9 A;  2G8Y A;  1YI2 P;  2ZXX A;  1HVV A;  2IBZ G;  1BE3 D;  2YKO A;  3RGU A;  3KDP B;  4XE5 B;  3KZI H;  2KSJ A;  1OFC X;  2J5U A;  1PV3 A;  2YIU B;  4DCK A;  1OVV A;  4K35 A;  2BCC G;  2OYI C;  2W6J H;  2SPZ A;  1FC2 C;  2AXC A;  3JCU E;  4B86 A;  2E74 D;  2BCC J;  2E74 B;  2K9J A;  1KN7 A;  5AVR B;  1PFI A;  1FZG A;  1FJP A;  1GK6 A;  1BCC J;  3CXH I;  1L4A D;  1L4A B;  5AW7 B;  2OTJ P;  4AUW A;  2Q9I A;  5AW3 B;  3WU2 E;  2IZ0 A;  1UIX A;  2FXP A;  3T97 A;  2QJK C;  1SQQ G;  5AVS B;  1AJY A;  2LR2 A;  1SQQ J;  1FU1 A;  3D71 A;  3N7N A;  1K73 Q;  3P8C E;  1LWU C;  2XDJ A;  3SSU A;  2WQY C;  3Q5R A;  1RQU A;  5E79 H;  2PP6 A;  1BE3 J;  4I6M C;  1PGQ A;  4JBZ A;  2LXC B;  1AQ5 A;  1YQ3 C;  3G71 P;  2QSI A;  3TF5 A;  1IFI A;  4AYC A;  3IN6 A;  1JCC A;  3RL0 C;  2P2U A;  1RF1 B;  4ZNC A;  4TT3 H;  1DH3 A;  4HKZ H;  1FBM A;  1JTH A;  4U3F D;  2QM8 A;  4XFJ A;  1FJK A;  4WY4 A;  3TDK A;  1M57 D;  1P84 H;  2N1T B;  5B66 H;  2WT7 B;  1SQX E;  5KAI H;  3FWL A;  2QE7 H;  2WSE H;  3V2P A;  2QEX P;  1IFJ A;  2A06 E;  2FY8 A;  3BRT B;  2AEJ A;  1QX8 A;  4GOF A;  3CC4 P;  3Q5P A;  3CX5 E;  1FAV A;  2OYI A;  1SP4 A;  3M06 A;  3CMA P;  3EWK A;  2E5T A;  1FZC C;  1VQL P;  3PLN A;  5GTI E;  1HH0 A;  1DEE G;  3SWY A;  1Y47 A;  3SWF A;  4PD4 E;  1LT9 B;  1JB0 J;  1RE3 C;  1SQP E;  4EI2 A;  5EFW B;  1H89 A;  1NTK E;  4U3F J;  4WBA A;  4LGD E;  3WU2 H;  1ZLL A;  3CPW O;  1LNQ A;  3VTP C;  2E75 B;  4LC1 A;  3D70 A;  1NTK K;  1FZF A;  1XTC C;  1RF0 C;  3BAT A;  4JYB A;  3TK1 A;  4WWI A;  5AW4 B;  3CCL P;  1AVY A;  1RE4 C;  3H1K G;  4H13 D;  4H13 B;  4I7Z B;  2RKL A;  2GUS A;  3H1K J;  2FYN C;  4NPF X;  1EC5 A;  3L73 E;  5KKZ B;  1KIL C;  5APX A;  2WSF J;  1QL1 A;  1HUC A;  2K37 A;  1JUN A;  1LTA C;  1GK4 A;  5KJ7 A;  1AQT A;  3KXD A;  4R4M A;  4UB6 E;  2E76 C;  5APT A;  1SQV K;  3RK3 E;  3Q3D A;  2FXO A;  3II6 A;  3CCR P;  1NWQ A;  1SQV D;  4HJG H;  1NTZ E;  1OXZ A;  4D6T D;  1FZC A;  3E1I A;  4YTP C;  2WSF H;  2K3R A;  1M1J B;  2H89 C;  1VPC A;  2M5A B;  2D2C C;  3FGA D;  3R2P A;  3GMA A;  2JO1 A;  4YXW H;  1NTZ K;  1NU1 E;  2IYP A;  3HTK A;  4N3Y B;  1OVU A;  1RE3 A;  1YJW P;  1LTS C;  3GF3 A;  1KQF B;  2KS1 B;  3HUS C;  3H1J G;  3VMZ A;  3H1J J;  3IR9 A;  1G1I A;  3BCC E;  1HBW A;  3I56 P;  1NU1 K;  1NH4 A;  4PD4 H;  3AEC C;  1PPJ E;  3M9Q A;  3H1I E;  1M8O B;  3B8E B;  4DJG A;  1KC8 Q;  4EIJ A;  4BRY A;  2XU6 A;  2ZXE B;  1AV1 A;  2Z5H A;  1H8A A;  2I1J A;  3LID A;  3A0B E;  1RF0 A;  2QJY B;  3CCE P;  1RE4 A;  2MKV A;  2PGD A;  3V4W A;  1LTT C;  2FFD B;  1NTM G;  1JY3 O;  2OYH A;  3L75 E;  3TNU B;  3L72 G;  5DJT B;  2YKP A;  3L72 J;  2JWA A;  1J1D B;  1KIL A;  1EZV E;  3M9B A;  3AE5 C;  3MGN A;  3CL3 D;  4GOE A;  1CI6 B;  1HTL C;  2E43 A;  3L70 E;  1BDD A;  2XNX A;  2UWJ E;  4YXD C;  2HG5 D;  2ZVN B;  2ZYA A;  4PJ0 E;  2AEF A;  5AVV B;  1L0L G;  1J1E B;  3VN0 A;  1BGY D;  3L71 D;  1GD2 E;  3B71 A;  1N8R Q;  2HPC A;  5AVT B;  1L0N E;  4WY4 D;  1HJ0 A;  2ZYD A;  1DX7 A;  2V7Q H;  1ZW0 A;  1FDI A;  3MTU E;  3R4Y A;  1VQK P;  3ABV C;  1N7S B;  1J2J B;  1MKM A;  1M1K Q;  2Q3I A;  3A0H E;  1L0N K;  1LT1 A;  3G4S P;  1P84 I;  1SVF A;  1WMK A;  3GLM A;  1KQL A;  5AW2 B;  2FXM A;  4M3L A;  3RK3 C;  1NOH A;  3AE7 C;  3M91 A;  3H1H D;  5AW5 B;  1IFM A;  1PL5 A;  5KLV E;  2VRS A;  3HD7 B;  3FXE A;  3O6Q A;  3I55 P;  4ZKP A;  1LT9 A;  1KB9 D;  1R8E A;  3H1L E;  1SFC A;  5CCG C;  1BGY J;  1S72 P;  4HH2 A;  2FYZ A;  2KK7 A;  3CWB D;  1LP1 B;  2QJP B;  3EFG A;  1HGZ A;  1S3J A;  1CSB A;  1LWU B;  2Q7C A;  3TGU D;  2OAR A;  3AE8 C;  1Q82 Q;  1PGJ A;  1H0T B;  2IBZ E;  3W68 A;  1JMB A;  4AQR D;  1SQB D;  3EFF K;  3A7O A;  3U59 A;  2QM7 A;  4GIF A;  2BCC E;  4XA4 A;  3HE5 B;  1YJ9 P;  1PP9 D;  3RL0 D;  3RL0 B;  2KNC B;  3L74 D;  2KZI A;  4I1L A;  1VF5 C;  2AEM A;  1GU5 A;  5KLI B;  1RHZ B;  1NVO A;  1URQ C;  5KAF H;  3AEE C;  1ZR4 A;  4U7J A;  5AVY B;  1SQQ E;  3F89 A;  1YJN P;  3WMM 0;  2L91 A;  3CWB G;  1T2K D;  3FWN A;  4HYT B;  3KHU A;  3JSV C;  3CWB J;  4C7N A;  3KQG A;  1Q86 Q;  2B87 A;  4Y99 C;  2KLU A;  5APW A;  4H44 C;  2RMZ A;  3AE2 C;  3TGU J;  1P84 D;  2H88 C;  2FYU K;  4RKU J;  1KB9 H;  1W2E A;  1SQB J;  2FYU D;  2BEZ F;  2R3S A;  1S2E A;  1CZQ A;  5CCG A;  1PP9 G;  3V6I A;  1IFP A;  2C0W A;  3WUV A;  1PP9 J;  3CX5 I;  2G3A A;  2Q1K A;  2NPS C;  5B5E E;  3C1L A;  3Q2Y A;  1BCC G;  2XND H;  2W8Z A;  1Q90 D;  3P32 A;  3RK2 C;  3V5B A;  4CPG A;  2IDB A;  4DZO A;  1FDO A;  1LTJ C;  1KFN A;  4PD4 I;  1FZE A;  3A3Y B;  1KIL E;  1L2P A;  2IFM A;  4GKG A;  1JY3 P;  2CK3 H;  1FOS F;  2YMY A;  1BE3 G;  2FYN B;  1GZL A;  4OGQ C;  2YNY A;  2ZVO B;  2IYO A;  1JNM A;  1URQ A;  1N73 B;  3V4Q A;  2WSE J;  2I1K A;  3P8C D;  5TIS E;  5H2F H;  1GMJ A;  4RES B;  3MUD C;  3AEF C;  2RH0 A;  3GG2 A;  2R5D A;  2ZFC A;  1X79 B;  4H0L C;  3VP9 A;  4GOD A;  4IFF A;  3H25 A;  2ZAE B;  4BXL A;  5KJ7 C;  1RQV A;  2D2C D;  2D2C B;  2XV5 A;  3LW5 H;  1BSH A;  1YHQ P;  3TYY A;  1SQX K;  5AVW B;  3HE4 A;  4WB4 A;  3MHV A;  3H1K E;  3GHG B;  1SQX D;  1WRG A;  1GL2 A;  1VQN P;  3HUS B;  2NPS A;  3CCQ P;  3B5N A;  1IJD B;  1NKZ B;  1NAY A;  1MUU A;  2R3C A;  3CME P;  1G2C B;  1IZN B;  4JQ0 D;  1ZRT E;  3JCU H;  3CX5 D;  2Y9Y A;  1KQG B;  2PFX A;  3CI9 A;  3S9O A;  2Y0C A;  1LTJ A;  4UB8 E;  3CXH E;  4U3F G;  2QA4 P;  4NPD A;  1VQ7 P;  4W7Y A;  2YIU C;  5APS A;  1SQP K;  1FZA A;  4PD4 D;  3KYQ A;  2E74 C;  1SQP D;  3MP7 B;  4TLF A;  1QGK B;  3H32 A;  1NTK D;  2GUV A;  1OWA A;  1VQP P;  2YO2 A;  4IFM A; 
#chains in the Genus database with same CATH homology
 3A5T A;  1J1D B;  1L4A C;  1KIL A;  2WSC H;  2H43 A;  1IFN A;  5APY A;  1KIL D;  1SQB K;  3M9B A;  4GT1 A;  1GW4 A;  1KIL B;  2KYV A;  3MUD A;  3TSI A;  5BU8 B;  2OYH C;  3MGN A;  1JCD A;  3CL3 D;  4N6J A;  1CI6 A;  5CJ4 A;  1X9V A;  1J1D C;  1CI6 B;  1YTZ T;  1HTL C;  1JY2 O;  4C7R A;  1M7L A;  3IFM A;  3P8M C;  2MJZ A;  2E43 A;  2XNX A;  1RY3 A;  2H8P D;  1MZ9 A;  5APV A;  2HG5 D;  2HOD B;  3C9I A;  2P67 A;  5AVV B;  3NMD A;  1J1E B;  1FOS E;  3VN0 A;  1JY3 N;  5CHX A;  1GD2 E;  1E5W A;  5KTB A;  1J1E C;  1LTB C;  5CCH D;  3N4X A;  2HPC A;  5AVT B;  4WY4 D;  5BVZ A;  2HPC B;  2J58 A;  2N1T D;  2IX7 C;  3L37 A;  1JY2 N;  5CCH C;  1N7S A;  3BRV B;  1DX7 A;  1HGV A;  3MTU E;  1N7S B;  2M8R A;  5APQ A;  1J2J B;  1KFM A;  4WY4 C;  1NTM K;  3RK3 D;  2N1T C;  2Q3I A;  1L0N K;  1T2K C;  2H7H A;  1IFD A;  3BVH A;  1SVF A;  4LLH A;  1HVV A;  1GU4 A;  5AW2 B;  1KQL A;  3MIW A;  2FXM A;  2YKO A;  4M3L A;  1IK9 A;  2GM4 A;  3RK3 C;  3KDP B;  2C9L Y;  1NOH A;  4XE5 B;  1GW3 A;  1MFZ A;  3M91 A;  2HFE D;  5AW5 B;  2KSJ A;  1GDT A;  1IFM A;  2WPR A;  3HD7 A;  2VRS A;  3HD7 B;  2HLO A;  2OYI C;  4B86 A;  3VMX A;  3OAK A;  1NKN A;  1ZV8 A;  5AVR B;  4ZKP A;  1LT9 A;  2CPB A;  1L0L K;  2R32 A;  2KOG A;  1SFC A;  5CCG C;  1PFI A;  3H6P A;  1SFC D;  4HH2 A;  1SFC B;  1FZG A;  1FJP A;  1GK6 A;  2FYZ A;  2W27 A;  3VYI A;  1L4A A;  1CW5 A;  1LT9 C;  1L4A D;  1L4A B;  3EFG A;  5AW7 B;  1JO5 A;  1LWU A;  4AUW A;  2Q9I A;  2WTY A;  5AW3 B;  1HGZ A;  1LGH B;  1SFC C;  1CSB A;  1LWU B;  2Q7C A;  1FZB A;  3T97 A;  5AVS B;  2M3B A;  1KZU B;  2OAR A;  1FU1 A;  1X8Y A;  3MD0 A;  3N7N A;  3P8C E;  1HWT C;  1LWU C;  2XDJ A;  2Z4E A;  3P7K A;  2O1J A;  4AQR D;  2IPP A;  3A7O A;  2W6B A;  3I5C A;  2PAJ A;  3U59 A;  2QM7 A;  3HE5 A;  5CJ0 A;  4GIF A;  3OJA B;  4XA4 A;  3HE5 B;  2PP6 A;  4I6M C;  2C0X A;  1G1J A;  3U1C A;  2Q5U A;  1AQ5 A;  3BAS A;  2A45 I;  3RL0 D;  3RL0 B;  4I1L A;  2N9B A;  1GU5 A;  1IFI A;  4AYC A;  1N86 A;  2XZR A;  1RF1 A;  1JCC A;  3OA7 A;  3RL0 C;  2P2U A;  1S9K E;  1RF1 B;  1N73 C;  5CCH A;  1DH3 A;  1URQ C;  2WWW A;  1JMM A;  1FBM A;  5AW8 B;  1JTH A;  2QM8 A;  1T3U A;  2P7J A;  1FJK A;  1JTH B;  1ZR4 A;  2KB7 P;  4WY4 A;  2N1T A;  2WT7 A;  5AVY B;  4Y99 B;  3CLQ A;  1RF1 C;  4WY4 B;  2N1T B;  3L4F A;  2WT7 B;  1IO4 A;  3WMM 0;  1T2K D;  4HYT B;  3L35 A;  4C7N A;  3KQG A;  1WT6 A;  3O8Z A;  1N2D C;  1EQ7 A;  2WSE H;  4Y99 C;  4C7N B;  2CPS A;  3V2P A;  3A2A A;  3RK3 B;  5APW A;  4O9B A;  1IFJ A;  3BRT B;  1ZN5 A;  5AW6 B;  1FAV A;  2FYU K;  2OYI A;  1SP4 A;  3M06 A;  2XKM A;  2OYI B;  1W2E A;  1NHL A;  1FZC C;  1M1J C;  2NPS D;  2HYN A;  2L5G B;  3GHG C;  1CZQ A;  5CCG A;  5CCG D;  2J59 M;  1HH0 A;  2C0W A;  2WZ7 A;  3EQ2 A;  3SWY A;  3SWF A;  3VP8 A;  3RK2 D;  2NPS C;  3RK2 B;  3PP5 A;  5CMZ A;  1T8Z A;  1LT9 B;  5AVQ B;  1RE3 C;  5KLV K;  4IFD K;  4N78 D;  5APU A;  1Z56 A;  1A02 F;  2R5B A;  3P32 A;  3RK2 C;  3NTN A;  3V5B A;  1H89 A;  4DZO A;  1IC2 A;  3G3Z A;  1LTG C;  1LTJ C;  1AFO A;  4WBA A;  1VDF A;  4LGD E;  1ZLL A;  1KFN A;  1FZE A;  3A3Y B;  3VTP C;  3UIA A;  2C9N Y;  1YYC A;  4LC1 A;  3M0D C;  1T3J A;  1ZR2 A;  5AW9 B;  2IFM A;  4GKG A;  2A45 H;  1NTK K;  1FZF A;  1JY3 P;  4JYC A;  2E42 A;  1FOS F;  4JF7 A;  3NXS A;  1XTC C;  2YMY A;  1RF0 C;  1HJB A;  3BAT A;  4JYB A;  1GZL A;  3TK1 A;  2KLV A;  5AW4 B;  1RE4 C;  2FFD C;  1N73 A;  2YNY A;  1H88 A;  1NAF A;  1JNM A;  1URQ A;  2GUS A;  1YTZ I;  3V4Q A;  1N73 B;  1URQ D;  1URQ B;  2I1K A;  3P8C D;  1JY2 P;  2FKW B;  3U1A A;  2O01 H;  1GTW A;  2Z5I A;  2WPS A;  1SLQ A;  5BU5 A;  1KIL C;  5APX A;  3V2N A;  4RES B;  1QL1 A;  2HOD A;  1HUC A;  3HRN A;  1JUN A;  1LTI C;  1LTA C;  1GK4 A;  1JOC A;  2KP8 A;  5KJ7 A;  2P1J A;  2R5D A;  2ZFC A;  5KJ7 D;  1X79 B;  5AVX B;  2JJL A;  4KHX A;  5APT A;  3VP9 A;  1SQV K;  4IFF A;  3II6 A;  5AVZ B;  1S9K D;  1FDM A;  1NWQ A;  5KJ7 C;  5AW0 B;  1OXZ A;  2POH A;  2XV5 A;  3LW5 H;  3NFQ A;  2WIT A;  1SQQ K;  1FZC A;  3E1I A;  3TYY A;  2WSF H;  1M1J A;  1SQX K;  1FZC B;  5AVW B;  5AVU B;  3HE4 A;  1M1J B;  3GHG A;  4WB4 A;  4C46 A;  1VPC A;  3HE4 B;  3GHG B;  1N7S D;  3R2P A;  3HUS A;  1WRG A;  2LKM A;  3VOP A;  1DEB A;  1GL2 A;  3HUS B;  1NTZ K;  3VMY A;  1GL2 D;  2NPS A;  1GL2 B;  2YO3 A;  1XTG B;  2NPS B;  3B5N A;  1IJD B;  1NKZ B;  4N3Y B;  3HTK A;  1G2C A;  1RE3 A;  1MUU A;  3B5N D;  1N7S C;  3B5N B;  1LTS C;  2R3C A;  3HTK B;  3V2Q A;  1G2C B;  3HUS C;  2O1K A;  2A45 G;  2JEE A;  1GL2 C;  1QL2 A;  3VMZ A;  1A02 J;  3IR9 A;  1G1I A;  1NO4 A;  1HBW A;  3CI9 A;  4N78 E;  4OH8 B;  5AW1 B;  3B5N C;  1NU1 K;  1LTJ A;  1NH4 A;  2W6A A;  3M9Q A;  1LTJ B;  3HD7 D;  2WPQ A;  3KPE A;  3B8E B;  3M0D A;  4DOJ A;  3M9H A;  4EIJ A;  4W7Y A;  2XU6 A;  2ZXE B;  3LIE A;  2Z5H A;  1H8A A;  3HD7 C;  3L36 A;  5APS A;  4ZKU A;  1MV8 A;  1SQP K;  2I1J A;  3LID A;  1FZA A;  3KYQ A;  1RF0 A;  2BAS A;  4EOT A;  1N7L A;  1RE4 A;  2FFD A;  4W80 A;  3V4W A;  1LTT C;  2FFD B;  2YKQ A;  4I2L C;  1JY3 O;  3H32 A;  3TNU A;  2OYH A;  4W7Z A;  3V2R A;  2GUV A;  3TNU B;  1OWA A;  3H32 B;  2OYH B;  2IFN A;  3M0A A;  2YO2 A;  4IFM A;  2YKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...