2N1TD

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
74
structure length
74
Chain Sequence
GGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 32
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tD00
5KJ7A 1L4AA 1GL2B 2WZ7A 5CCHD 2NPSC 4W7ZA 1XTGB 3B5NC 1NHLA 3RK3C 1URQC 4WY4A 4WY4B 5CCGC 3RL0D 3HD7C 5KJ7D 1GL2D 4W7YA 3PP5A 2N1TC 3RK2B 1GL2A 1HVVA 1L4AC 4WY4D 1SFCB 3HD7B 1N7SB 4JF7A 1KILB 4N78E 2KOGA 5CCHC 3P8CE 3RK2D 2NPSB 4OH8B 3B5NA 3B5NB 1T3JA 1SFCD 3HD7D 3RK3B 3RL0C 1URQB 1N7SD 5KJ7C 1GL2C 1KILD 1SFCA 2PP6A 3HD7A 3TSIA 1N7SA 2HG5D 2N1TB 1KILA 2HFED 2NPSD 2XDJA 3B5ND 4WY4C 3RK3D 1URQD 1JTHA 3HTKB 2NPSA 1JTHB 1L4AB 3M0DC 2H8PD 5CCGD 1URQA 3VOPA 3RK2C 2N1TD 5CCGA 5CCHA 4LGDE 3KYQA 2M8RA 1SFCC 2N1TA 1L4AD 1N7SC 2YMYA 1KILC 3RL0B 4W80A
chains in the Genus database with same CATH superfamily
1OW6A 3WUVA 5H2FE 4W7ZA 1YBKA 5APYA 3HUSC 1VQNP 2OGUA 1FDMA 4N78D 2E5TA 3FXDA 1VQ8P 3HD7C 3BCCG 1L0ND 4W7YA 2WITA 3W67A 4OWFA 2XZRA 1KORA 2QJKC 4XA4A 2OARA 2XV5A 1SFCB 1P84H 5AVRB 2KS1B 1X9VA 1PP9J 3OAKA 1BDCA 1SQBJ 1IK9A 5E79E 3HE4A 5APSA 2OYOA 4D6TE 2E74D 5H2FH 1URQB 2ZYGA 1LT1A 1FAVA 1OXZA 3H6PA 4WVZA 1EDJA 4RKUJ 1EZVD 1PL5A 1M1JC 1R8EA 1IFMA 5TISE 1M8OB 2K88A 1R5LA 1KILA 2JJLA 3CI9A 3L73E 2RH0A 5CMZA 3RK3D 1FOSF 5AVYB 2Y0DA 1QX8A 5C39A 4A7PA 1Z56A 1K05A 4LGDE 2JKVA 1UIXA 5E79H 2J58A 3V5BA 1YJWP 2JEEA 3H32A 2O01N 1KILC 3A0HE 2KI7B 1JM0A 2G3AA 1SQVG 4ASWA 3VMAA 3L73G 5L8RJ 5CJ0A 1LT9C 5TISH 2FFDA 1X8YA 2Z5IA 1D7MA 2OYHC 4HYTB 2SPZA 2GA1A 1DEEG 3A0BE 4PD4I 3E1IA 1HJBA 4R4MA 3KHUA 3F89A 1OWAA 1OVVA 5AVVB 1SQPJ 5APXA 1WRGA 3SWKA 1S1CX 5APVA 3Q5RA 2VRSA 3A0HH 1KYOE 4QMAA 2XNDH 3HUSB 3SWFA 3H1KE 1SFCD 4U3FG 3OA7A 4H44B 3L70D 3SWYA 3AE8C 4L74A 4TT3H 1GTWA 2KZIA 1Q82Q 2ZJSE 3H1IG 1S5LE 2FYUE 2P58A 1URQD 2QJKB 1U7MA 4HKZH 1E5WA 3A0BH 3BCCD 1H89A 2GM4A 1RQVA 4GOEA 1FDOA 4WWIA 2WT7B 3HE5A 1L2PA 1SQQK 1NTKJ 1KYOH 2K1AA 1H88A 1JY2O 1M1JB 4PV1C 2IFNA 1YJ9P 3ITKA 1XTGB 1ZV8A 3L74G 1CI6A 4C46A 2M0BA 1ZR4A 3V2QA 2YMKA 3IAOA 1M1KQ 1NWQA 4DJGA 1NTZJ 3HE4B 3V2NA 1S5LH 5AW7B 5B5EE 1BCCJ 3KDPB 1GL2A 1JUNA 1GW4A 2W6BA 1KILB 3D71A 3CCRP 1K9MQ 1KQFB 1WMKA 1LT9B 1H8AA 2WSSH 1GL2C 2D2CC 4Z1MH 3BATA 1SQVD 3EQ2A 3L73D 3H32B 5B5EH 1S72P 4OVNF 3H1LE 5DJTB 1J1EC 3SFDC 3CCJP 4UB6E 5AVWB 2FYZA 3IR9A 3GHGA 2K37A 3A7OA 1PP9G 2M8RA 1FZBA 1SQBG 2BASA 1MKMA 1S2EA 2ZVOB 2R44A 1AA0A 2BCCJ 1NHLA 2IPPA 2IYPA 4U3FD 1KQGB 1M56D 4PD4E 3GHGC 2LR2A 4IFFA 2XNXA 1P84I 1N8RQ 2O1KA 3VTPC 3H1ID 1DD4A 1PGQA 2Y0CA 4UB6H 2PFXA 3MUDA 3CX5D 5APWA 1ZXGA 2P2UA 1X79B 4N78E 2A45G 2WTYA 3V2RA 1L0NE 4JPZB 3A5TA 2FXMA 4PV1B 3AE5C 1LTTC 1GK6A 3CL3D 1Q7YQ 4IFDK 5KLIB 2Y0EA 5KJ7C 3AE6C 1KILD 3GF3A 4H13B 1N7SA 4EOTA 2HG5D 1J1DC 4PD4H 3L74D 3Q2YA 3HE5B 2V4HA 1N86A 2NPSA 3AEEC 5AW1B 1MFZA 1VQ4P 1GZLA 1Q81Q 1CI6B 1EZVE 1JB0J 1Q86Q 2N9YB 1SQPG 3WUUA 1DH3A 1N7SC 4HB1A 1KN7A 1YQ3C 1QVFO 2QJPC 1VQ9P 3RK3E 1NJIQ 1GL2B 1QGKB 2FYNC 2D2CB 3JCUE 1T6AA 1NTMK 2NPSC 3AEAC 1VQ6P 1NTKE 1NKNA 2YKPA 3WU2E 4YXWH 5AVUB 4WY4A 1OX3A 1U7JA 3P8CD 3S1KA 3VYIA 1IC2A 2RN0A 3TYYA 4R4LA 3VN0A 1Y8AA 1BCCE 3GF7A 3H1HJ 5BVZA 4BWNA 2V7QJ 1BE3J 2KUBA 3BVHA 2KLVA 1PP9D 1FE6A 5GTHE 1NTKG 1SQBD 2KK7A 3B71A 5CBNA 1SQQJ 3JCUH 5KKZC 1KQLA 3GHGB 3WU2H 1SP4A 2Q3IA 2Q9IA 4PV1D 1Q90D 2XDJA 1N2DC 2WQYC 1NTZG 1M7LA 1JTHA 4WB4A 1S9KD 2R3SA 1BCCG 3BRTB 3A2AA 2ZFCA 4H13D 3L70E 1CZQA 4BRYA 4JBZA 1KYOI 1KFNA 1NTZK 2P67A 4M3LA 3USSA 2XKMA 2AXCA 1FZAA 3Q1MA 1JCDA 5GTHH 2Q5UA 1N73A 2WZ7A 3BCCE 1J1DB 2YNYA 1RHZB 2WMMA 4EDFA 2WSCH 4I6MC 1LP1A 1GL2D 1HGZA 2D2CD 3FWNA 2AXTE 1HGVA 2K9YA 1IFNA 2E75B 2A06G 1GU4A 2PGDA 2MJZA 3RBZA 4H44C 1N7SB 2QG4A 3S4RA 2QJPB 3CMEP 5CCHC 1PPJG 5APUA 3TGUJ 2FYNB 2NPSB 1SQPD 1T3JA 3G9RA 2JDIH 5AW5B 2BCCG 3RBXA 1OW8A 1L0LK 1T8ZA 5AW8B 1SLQA 2KYVA 1GDTA 1VF5B 2ZT9C 4EIJA 2AXTH 1JO5A 2C9NY 2I1JA 1A02F 3I56P 3P32A 2M5AA 4C7NA 1HF9A 2R32A 2N9BA 3VOPA 2Z5HA 1W5CE 3T97A 2WSFH 2OYIA 1SQVE 3JSVC 5AW2B 3M0AA 5KKZB 3H1JJ 2H7HA 1E79H 3I55P 3CCVP 1VQLP 3CPWO 4AYCA 3PJSK 2C9LY 3TK1A 1NTKD 2IBZG 3CWBJ 2W27A 3V4QA 1ZOYC 1GMJA 1LTJA 3Q3DA 2KLUA 5KJ7D 5APTA 3OW2O 4RO0A 1USDA 1IFIA 3ABVC 2PRRA 1NTZD 3N7NA 1BCCD 3PLNA 4U3FE 4L76A 1FS0E 2I8DA 2KOGA 4DCKA 2QA4P 3L72J 4JYCA 2Z4EA 2E75D 1YQ4C 1BSHA 3OJAB 1LWUA 2AEMA 1GK4A 4H0LC 5KAIE 2WVRA 3H1IE 1RF0A 1N7SD 3AE2C 4BRYB 1KQSO 2E76C 2P10A 1OZHA 1NTMJ 5CHXA 3CX5E 1DIPA 4KT0J 4RJTA 3A3YB 1OW7A 3CC7P 2NPSD 3C9IA 3ZDMA 1OVUA 1SQXJ 2FFDC 2R3CA 1N73B 3L75J 2HR3A 1PGOA 3D6YA 3LIDA 3NXSA 1EDKA 1LWUC 1KILE 1RF0C 2A06D 3KYQA 1VF5D 3Q5SA 4XFJA 2W6JH 3H1HG 5AW0B 3L74E 3NFQA 1BE3G 1LP1B 1YITP 3RGUA 1VQ7P 2WSEH 3G4SP 1IK7A 1K8AQ 5KAIH 1U57A 1PPJD 2O01J 2M3EA 1VQOP 1SQQG 2LKMA 4I7ZB 3CX5H 2ZT9B 3LW5H 2BCCD 2ZAEB 1TU3F 1EZVI 2YXRB 1KB9D 1HVVA 1VQKP 4K3AA 1JY3O 1BGYJ 3AEGC 2L91A 1W2EA 5KLIC 2AEJA 4JF7A 3PHLA 3MP7B 2R5BA 3P8CE 2WPRA 4H13C 3B5NA 1PFIA 2Q6QA 2M5AB 1YI2P 4C7NB 2K9JA 1VQPP 5KAFE 1BDDA 3HRNA 2WPVB 3F5HA 3G3ZA 3VMXA 3CCEP 1VQ5P 1QEXA 4IL6X 1NU1J 2IBZD 4GODA 1YYCA 2FYUK 1PP9E 3CCMP 1SQBE 1KD1Q 5GTIE 4OGQC 5AVTB 1QL2A 3II6A 4B86A 1MV8A 3L37A 3TNUA 5CCGA 2GUSA 1HUCA 3P8MC 1LTJB 1T3UA 3E7KA 4H0LB 2ITAA 3TDKA 3HTKA 4H44D 3TGUG 1S9KE 4I1LA 3GG2A 2E76B 5CCHD 5KAFH 4HJGH 1LTGC 1LTSC 3GMAA 1NH4A 2R5DA 3RL0g 2FFDB 5CCGC 1EQ7A 3KZIE 3M0DA 3AE1C 4EYYQ 1L0LJ 3SSUA 1LWUB 3LIEA 1QL1A 5GTIH 3L71J 5KLVJ 1DX7A 3FXEA 3AEDC 5AW4B 1KTMA 4ZNCA 2ZT9D 1LGHB 4IOIH 2KB7P 2QSIA 3G6EP 2H88C 2OTKE 4CPGA 3H1HD 2B9BA 3H1JG 1BE3D 2CK3H 1AVYA 4MN4C 2C0XA 2QM7A 3CWBG 1GU5A 1SQQD 2HFED 4DOJA 1ZN5A 2Q1KA 3KZIH 5K5GB 2A45H 1SQPE 3P7KA 3MD0A 2FXOA 1YTZT 2Y9ZA 4GOFA 3CCUP 1Y9BA 3MUDC 1JY2P 2BEZF 1FBMA 3L72G 2LXCB 1JY2N 4KJMA 1CW5A 2WPQA 2E75C 4D6TJ 2ZXEB 4PJ0E 1EC5A 4H0LD 1DEBA 3CLQA 1NTMG 4WBAA 4N6JA 4OGQB 2E76D 1SQXG 1FZCA 3L75G 2K9JB 1OMIA 3BASA 4N3YB 5B66E 2JR8A 1AV1A 3TF5A 4RESB 2QVAA 1SQXK 3KQGA 3NMDA 3CC4P 1R5SA 1MUUA 1VF5C 2H43A 3L36A 1NTZE 1YTZI 1FZFA 3TNUB 3TGUD 4PJ0H 3BRVB 1PZQA 4WY4C 3W68A 1Q2NA 2B88A 3HTKB 4C7RA 1RQUA 1KMIZ 2H8PD 3VP8A 3CXHD 3FGAD 2IZ0A 5B66H 1AQ5A 2JWAA 3U1CA 1BGYG 1FC2C 3O6QA 2L5GB 4W80A 1ZP0C 1USEA 3CCQP 3CX5I 2HLOA 2G8YA 2HODA 3MHVA 3WUTA 1G1IA 1T2KC 3E1RA 3H1JD 2C0WA 2HPCA 3H1KJ 3N4XA 3SFEC 1S3JA 2A06E 3AE3C 1G2CA 1NU1G 2QEXP 3CWBD 2B87A 1NAYA 1PPJE 2KZJA 2FYUJ 1J2JB 3WMM0 1JOCA 1NU1K 1PGJA 1YIJP 1JMMA 4OGQD 2BCCE 1LJ2A 1YJNP 2W8ZA 1EDIA 1ZMEC 4BXLA 3HUSA 1RY3A 2OQQA 2E5YA 1KB9E 4JQ0D 1LNQA 3M9BA 3L72D 2W6AA 1N73C 4AUWA 1SVFA 3HD7A 3H25A 2ZYDA 4LLHA 4U7JA 1NTMD 1ZRTD 1L0LG 4YXDC 3GW6A 5CCGD 1KC8Q 3PRJA 3MGNA 3B8EB 3L71G 5KLVG 1SQXD 2ZVNB 1K73Q 2I1KA 3L75D 1NAFA 2N1TA 2FXPA 2WT7A 2IBZE 4I7ZC 5KLVK 2E43A 1KFMA 1FZCB 3IF4A 1KB9H 1M1JA 3KPEA 5AVQB 4NPEA 2OTJP 3EWKA 1PIXA 1HTLC 2P7JA 4WY4B 1HH0A 1VL2A 1YHQP 2Y9YA 4DT0A 3CXHI 3VP9A 2JP3A 3Q5PA 2N1TC 3PP5A 2E42A 1WT6A 2POHA 3H1LJ 3AECC 1N7LA 4XE5B 3EFFK 4GT1A 3VMYA 4L75A 2FBWC 1MFTA 5CBOA 2OYIC 1BGYD 3D70A 3RL0C 2QRXA 1LT9A 2ZYAA 3AE4C 2OYHA 4D6TG 2A45I 3CCLP 1MZ9A 3O6QB 1LTJC 3C8VA 1JTHB 3H1HE 2HODB 2WWWA 1BE3E 1NU1D 1Y47A 2NRGA 3QWOC 1S5LX 2RMZA 2HPCB 2KNCA 1G2CB 3C1LA 3VMZA 2QJYB 1LTAC 1SQQE 3AEBC 1M57D 3MTUE 1SQVK 5BU8B 2B87B 3FX0A 2ZXXA 1X0TA 1S4XA 1H0TA 1L4AA 4KHXA 2YO3A 1UIIA 2CPSA 1IO4A 1L0NJ 4ASVA 5DJUB 1FU1A 1JCCA 1QVGO 1RF1A 3CC2P 1IFJA 1W2BO 2V7QH 2KSJA 1L4AC 4WY4D 2BEQD 1L0LD 3HD7B 2KSEA 1OFCX 5AVZB 2WPSA 4ZKPA 3L71D 5KLVD 2QE7H 1A02J 4ZMDA 1ZW0A 4ZKUA 1RF1C 1FJPA 1P84D 3K5BA 2YIUC 3I5CA 1HBWA 4DZOA 2M3BA 2LXBA 2N1TB 3H1KG 5KTBA 3IFMA 1IFPA 3UIAA 1T2KD 1VQMP 5BU5A 1PV3A 2W83C 2OTLP 2GUVA 1GD2E 4L73A 3AEFC 4YTPC 3M91A 1AJYA 3G71P 2FYUG 3RK2C 3TGUE 2UWJE 1GW3A 3T97B 2AEFA 2OYIB 2W90A 2JWDA 2P1JA 4NPFX 1JEKA 4AQRD 3RL0B 2O3JA 4EI2A 5EFWB 3JC22 3D6ZA 4Y99C 2YKQA 4NPDA 1IZNB 1VDFA 3CXHE 3B5NC 4I2LC 1LTBC 1RH5B 3FWLA 3CD6P 3AE9C 4D6TD 2WSCJ 2FY8A 1FJKA 1OIPA 3V4WA 2OYHB 1NO4A 3H1JE 2RKLA 3EFGA 2XU6A 3V2PA 3CMAP 3L70J 1KV4A 3CWBE 4OH8B 4IL6E 5AVXB 3HD7D 1EDLA 5APQA 2J5UA 4JYBA 3CXHH 1X22A 2YKOA 2KNCB 3MIWA 4GDOA 3BCCJ 1FZGA 4Y28J 3M06A 3L35A 1H0TB 2B89A 1L4AB 2IDBA 3M0DC 4UB8E 4O9BA 1SQBK 1SS1A 3M9HA 3L72E 2QIWA 2N1TD 2HYNA 3KXDA 2E74C 3H1LG 3U1AA 1KB9I 3QH9A 5AW3B 1RF1B 1XTCC 4IL6H 5KJ7A 4LC1A 2WSFJ 1NTME 1PGPA 1ZRTE 2YIUB 5AW6B 1ZLLA 1LTIC 3R4YA 1SQXE 1CSBA 3RK3C 1NGMB 2JO1A 3L75E 3RL0D 1OVRA 3GLMA 1KYOD 1RE3A 4YPCA 1HWTC 2KP8A 3H1KD 4UB8H 3MZWB 3RK2B 1JY3P 1AQTA 1HJ0A 5AW9B 2IBZI 1FDIA 1JY3N 1JMBA 4IFMA 2FYUD 4Y99B 3B5NB 1DD3A 1QLED 1SQVJ 1RE3C 3L73J 2Q7CA 5M1BA 3B4SA 3U59A 2FKWB 1SFCA 1BSNA 2IYOA 1L0NG 2KS1A 2O1JA 1AFOA 1RE4A 3PTZA 3L4FA 3CCSP 1BGYE 1L0NK 1NVOA 2NZ2A 2KIKA 1KZUB 3AE7C 3V6IA 1IJDB 1SQPK 1URQA 5AVSB 1FOSE 2Q3EA 3R2PA 2DW3A 1FZCC 2H89C 2YXQB 1SFCC 2O01H 1RE4C 1L4AD 1J1EB 2YMYA 4U3FJ 2J59M 1EZVG 3PH0A 2IX7C 2KXPB 1NU1E 4K35A 2PAJA 2WSEJ 1URQC 3M9QA 3H1IJ 1EXIA 2YO2A 2QM8A 1K04A 4TLFA 3LW5J 3O8ZA 1IFDA 2K3RA 1G1JA 4HH2A 2E74B 2IZ1A 4GIFA 3IN6A 2CPBA 2IFMA 1ZR2A 3S9OA 1NTKK 1EXJA 3RK2D 3H1LD 3L74J 3RK3B 2PP6A 1L0LE 5CJ4A 3NTNA 3TSIA 1NYHA 1VPCA 1AVOA 3L71E 5KLVE 1NKZB 3B5ND 1M90Q 2QJYC 1JNMA 1NOHA 1P84E 5CCHA 4PD4D 5TJHA 2MKVA 4GKGA 3L70G 1FZEA
chains in the Genus database with same CATH topology
3HTKA 1S9KE 1L4AA 1GL2B 4KHXA 2YO3A 2CPSA 4I1LA 1NTMK 5CCHD 2NPSC 1IO4A 4W7ZA 5APYA 3HUSC 1LTGC 1LTSC 1NKNA 1FU1A 2YKPA 1JCCA 5AVUB 1NH4A 4WY4A 2R5DA 2FFDB 4N78D 1FDMA 5CCGC 1EQ7A 3HD7C 3P8CD 1RF1A 3M0DA 3VYIA 4W7YA 1LWUB 3LIEA 1IC2A 2WITA 1IFJA 3TYYA 1QL1A 3VN0A 2XZRA 1DX7A 2KSJA 4XA4A 2OARA 1L4AC 2XV5A 5AW4B 4WY4D 1SFCB 5AVRB 1X9VA 3HD7B 3OAKA 1LGHB 5AVZB 5BVZA 2KB7P 2WPSA 1IK9A 4ZKPA 3BVHA 3HE4A 1A02J 2KLVA 5APSA 4ZKUA 1RF1C 1URQB 1KQLA 1FJPA 1FAVA 1OXZA 2C0XA 3H6PA 3I5CA 1HBWA 3GHGB 1M1JC 4DZOA 1IFMA 2QM7A 1SP4A 2Q3IA 2M3BA 2Q9IA 2N1TB 1KILA 5KTBA 2JJLA 2HFED 3IFMA 1GU5A 1ZN5A 2XDJA 1N2DC 3CI9A 4DOJA 5CMZA 3UIAA 1T2KD 3RK3D 5BU5A 1M7LA 1JTHA 4WB4A 1S9KD 5AVYB 1FOSF 2A45H 3BRTB 2GUVA 3P7KA 3A2AA 1GD2E 2ZFCA 3MD0A 1YTZT 3M91A 1Z56A 3RK2C 1CZQA 1KFNA 1NTZK 1GW3A 2P67A 4LGDE 4M3LA 2OYIB 2J58A 3V5BA 2XKMA 1JY2P 2JEEA 2P1JA 1FBMA 1FZAA 3H32A 1KILC 3RL0B 4AQRD 1JCDA 2Q5UA 1N73A 4Y99C 2WZ7A 1JY2N 2YKQA 1VDFA 3B5NC 1CW5A 2WPQA 1J1DB 2YNYA 4I2LC 5CJ0A 1LTBC 2ZXEB 1LT9C 1DEBA 2FFDA 3CLQA 2WSCH 1X8YA 2Z5IA 4WBAA 2OYHC 4I6MC 4HYTB 1GL2D 1HGZA 4N6JA 1HGVA 1IFNA 1FZCA 3E1IA 1HJBA 1GU4A 3BASA 1FJKA 2MJZA 4N3YB 3V4WA 1OWAA 2OYHB 1NO4A 5AVVB 4RESB 1N7SB 5APXA 1WRGA 1SQXK 3KQGA 3NMDA 3EFGA 2XU6A 5CCHC 3V2PA 5APVA 5APUA 2VRSA 2NPSB 4OH8B 3HUSB 3SWFA 1T3JA 5AVXB 1SFCD 1MUUA 3HD7D 3OA7A 2H43A 3L36A 5APQA 4JYBA 5AW5B 1YTZI 1FZFA 3SWYA 3TNUB 2YKOA 3BRVB 3MIWA 1L0LK 1GTWA 1T8ZA 1FZGA 5AW8B 1SLQA 3M06A 2KYVA 4WY4C 1GDTA 3L35A 4EIJA 1URQD 3HTKB 1JO5A 2C9NY 1L4AB 4C7RA 2I1JA 1E5WA 3M0DC 2H8PD 1A02F 1H89A 3VP8A 2GM4A 3P32A 4O9BA 1SQBK 4C7NA 3M9HA 2R32A 2N9BA 3VOPA 1AQ5A 2N1TD 2Z5HA 2HYNA 3U1CA 3T97A 2WSFH 2OYIA 3U1AA 5AW3B 2L5GB 1RF1B 5AW2B 1XTCC 2WT7B 3HE5A 3M0AA 1SQQK 2H7HA 4W80A 1H88A 1JY2O 4LC1A 5KJ7A 5AW6B 4AYCA 2HLOA 1M1JB 2HODA 2IFNA 1ZLLA 1LTIC 1XTGB 1G1IA 2C9LY 1ZV8A 1CI6A 3TK1A 1T2KC 4C46A 1CSBA 3RK3C 2C0WA 1ZR4A 2HPCA 3N4XA 3V2QA 2W27A 3V4QA 1G2CA 1LTJA 3RL0D 1NWQA 3HE4B 3V2NA 5AW7B 5KJ7D 5APTA 1RE3A 1HWTC 2KP8A 3KDPB 1IFIA 3RK2B 1GL2A 1JY3P 1JUNA 1J2JB 5AW9B 3N7NA 3WMM0 1JOCA 1NU1K 1JY3N 1GW4A 2W6BA 1JMMA 1KILB 4IFMA 2KOGA 4JYCA 2Z4EA 4Y99B 3OJAB 1LWUA 3HUSA 1RY3A 3B5NB 1GK4A 1RE3C 1LT9B 1RF0A 2Q7CA 3M9BA 1N7SD 1H8AA 3U59A 4AUWA 2W6AA 1N73C 1GL2C 2FKWB 1SFCA 2O1JA 1SVFA 3HD7A 1AFOA 5CHXA 1RE4A 4LLHA 3BATA 3L4FA 3A3YB 3EQ2A 2NPSD 3C9IA 3H32B 2FFDC 2R3CA 1L0NK 1N73B 3LIDA 3NXSA 1KZUB 5CCGD 1J1EC 3MGNA 1LWUC 1IJDB 1SQPK 3B8EB 1URQA 5AVSB 5AVWB 2FYZA 1FOSE 3R2PA 3IR9A 1FZCC 1RF0C 2I1KA 3GHGA 3A7OA 3KYQA 2M8RA 1SFCC 1NAFA 2N1TA 1FZBA 5AW0B 2BASA 2O01H 3NFQA 1RE4C 1L4AD 2WT7A 1J1EB 2YMYA 2WSEH 5KLVK 2E43A 2J59M 1KFMA 1FZCB 1M1JA 3KPEA 5AVQB 2IX7C 1NHLA 2PAJA 2IPPA 1URQC 2LKMA 3M9QA 1HTLC 2P7JA 4WY4B 1HH0A 3LW5H 3GHGC 4IFFA 2XNXA 3VP9A 2YO2A 2N1TC 3PP5A 2QM8A 2O1KA 3VTPC 3O8ZA 2E42A 1IFDA 1WT6A 1G1JA 1HVVA 4HH2A 2POHA 4GIFA 1JY3O 3MUDA 2CPBA 1N7LA 2IFMA 1ZR2A 4XE5B 5APWA 1W2EA 1NTKK 2P2UA 4JF7A 1X79B 4N78E 2A45G 2WTYA 4GT1A 2R5BA 3VMYA 3V2RA 3P8CE 2WPRA 3A5TA 3RK2D 2OYIC 2FXMA 3B5NA 1PFIA 1LTTC 1GK6A 3CL3D 3RL0C 3RK3B 1LT9A 4C7NB 4IFDK 3HRNA 5KJ7C 1KILD 2PP6A 3G3ZA 3VMXA 5CJ4A 2OYHA 3NTNA 1N7SA 3TSIA 4EOTA 2A45I 2HG5D 1J1DC 1MZ9A 1VPCA 3HE5B 1NKZB 3B5ND 1YYCA 2FYUK 1LTJC 1JNMA 1N86A 2NPSA 1JTHB 5AW1B 5AVTB 2HODB 2WWWA 1MFZA 1GZLA 1NOHA 1QL2A 3II6A 4B86A 1CI6B 1MV8A 3L37A 3TNUA 5CCGA 5CCHA 2GUSA 2HPCB 1HUCA 3P8MC 1G2CB 1LTJB 3VMZA 1LTAC 1T3UA 1DH3A 3MTUE 1N7SC 1SQVK 4GKGA 5BU8B 1FZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJ7 A;  1L4A A;  1GL2 B;  2WZ7 A;  5CCH D;  2NPS C;  4W7Z A;  1XTG B;  3B5N C;  1NHL A;  3RK3 C;  1URQ C;  4WY4 A;  4WY4 B;  5CCG C;  3RL0 D;  3HD7 C;  5KJ7 D;  1GL2 D;  4W7Y A;  3PP5 A;  2N1T C;  3RK2 B;  1GL2 A;  1HVV A;  1L4A C;  4WY4 D;  1SFC B;  3HD7 B;  1N7S B;  4JF7 A;  1KIL B;  4N78 E;  2KOG A;  5CCH C;  3P8C E;  3RK2 D;  2NPS B;  4OH8 B;  3B5N A;  3B5N B;  1T3J A;  1SFC D;  3HD7 D;  3RK3 B;  3RL0 C;  1URQ B;  1N7S D;  5KJ7 C;  1GL2 C;  1KIL D;  1SFC A;  2PP6 A;  3HD7 A;  3TSI A;  1N7S A;  2HG5 D;  2N1T B;  1KIL A;  2HFE D;  2NPS D;  2XDJ A;  3B5N D;  4WY4 C;  3RK3 D;  1URQ D;  1JTH A;  3HTK B;  2NPS A;  1JTH B;  1L4A B;  3M0D C;  2H8P D;  5CCG D;  1URQ A;  3VOP A;  3RK2 C;  2N1T D;  5CCG A;  5CCH A;  4LGD E;  3KYQ A;  2M8R A;  1SFC C;  2N1T A;  1L4A D;  1N7S C;  2YMY A;  1KIL C;  3RL0 B;  4W80 A; 
#chains in the Genus database with same CATH topology
 1OW6 A;  3WUV A;  5H2F E;  4W7Z A;  1YBK A;  5APY A;  3HUS C;  1VQN P;  2OGU A;  1FDM A;  4N78 D;  2E5T A;  3FXD A;  1VQ8 P;  3HD7 C;  3BCC G;  1L0N D;  4W7Y A;  2WIT A;  3W67 A;  4OWF A;  2XZR A;  1KOR A;  2QJK C;  4XA4 A;  2OAR A;  2XV5 A;  1SFC B;  1P84 H;  5AVR B;  2KS1 B;  1X9V A;  1PP9 J;  3OAK A;  1BDC A;  1SQB J;  1IK9 A;  5E79 E;  3HE4 A;  5APS A;  2OYO A;  4D6T E;  2E74 D;  5H2F H;  1URQ B;  2ZYG A;  1LT1 A;  1FAV A;  1OXZ A;  3H6P A;  4WVZ A;  1EDJ A;  4RKU J;  1EZV D;  1PL5 A;  1M1J C;  1R8E A;  1IFM A;  5TIS E;  1M8O B;  2K88 A;  1R5L A;  1KIL A;  2JJL A;  3CI9 A;  3L73 E;  2RH0 A;  5CMZ A;  3RK3 D;  1FOS F;  5AVY B;  2Y0D A;  1QX8 A;  5C39 A;  4A7P A;  1Z56 A;  1K05 A;  4LGD E;  2JKV A;  1UIX A;  5E79 H;  2J58 A;  3V5B A;  1YJW P;  2JEE A;  3H32 A;  2O01 N;  1KIL C;  3A0H E;  2KI7 B;  1JM0 A;  2G3A A;  1SQV G;  4ASW A;  3VMA A;  3L73 G;  5L8R J;  5CJ0 A;  1LT9 C;  5TIS H;  2FFD A;  1X8Y A;  2Z5I A;  1D7M A;  2OYH C;  4HYT B;  2SPZ A;  2GA1 A;  1DEE G;  3A0B E;  4PD4 I;  3E1I A;  1HJB A;  4R4M A;  3KHU A;  3F89 A;  1OWA A;  1OVV A;  5AVV B;  1SQP J;  5APX A;  1WRG A;  3SWK A;  1S1C X;  5APV A;  3Q5R A;  2VRS A;  3A0H H;  1KYO E;  4QMA A;  2XND H;  3HUS B;  3SWF A;  3H1K E;  1SFC D;  4U3F G;  3OA7 A;  4H44 B;  3L70 D;  3SWY A;  3AE8 C;  4L74 A;  4TT3 H;  1GTW A;  2KZI A;  1Q82 Q;  2ZJS E;  3H1I G;  1S5L E;  2FYU E;  2P58 A;  1URQ D;  2QJK B;  1U7M A;  4HKZ H;  1E5W A;  3A0B H;  3BCC D;  1H89 A;  2GM4 A;  1RQV A;  4GOE A;  1FDO A;  4WWI A;  2WT7 B;  3HE5 A;  1L2P A;  1SQQ K;  1NTK J;  1KYO H;  2K1A A;  1H88 A;  1JY2 O;  1M1J B;  4PV1 C;  2IFN A;  1YJ9 P;  3ITK A;  1XTG B;  1ZV8 A;  3L74 G;  1CI6 A;  4C46 A;  2M0B A;  1ZR4 A;  3V2Q A;  2YMK A;  3IAO A;  1M1K Q;  1NWQ A;  4DJG A;  1NTZ J;  3HE4 B;  3V2N A;  1S5L H;  5AW7 B;  5B5E E;  1BCC J;  3KDP B;  1GL2 A;  1JUN A;  1GW4 A;  2W6B A;  1KIL B;  3D71 A;  3CCR P;  1K9M Q;  1KQF B;  1WMK A;  1LT9 B;  1H8A A;  2WSS H;  1GL2 C;  2D2C C;  4Z1M H;  3BAT A;  1SQV D;  3EQ2 A;  3L73 D;  3H32 B;  5B5E H;  1S72 P;  4OVN F;  3H1L E;  5DJT B;  1J1E C;  3SFD C;  3CCJ P;  4UB6 E;  5AVW B;  2FYZ A;  3IR9 A;  3GHG A;  2K37 A;  3A7O A;  1PP9 G;  2M8R A;  1FZB A;  1SQB G;  2BAS A;  1MKM A;  1S2E A;  2ZVO B;  2R44 A;  1AA0 A;  2BCC J;  1NHL A;  2IPP A;  2IYP A;  4U3F D;  1KQG B;  1M56 D;  4PD4 E;  3GHG C;  2LR2 A;  4IFF A;  2XNX A;  1P84 I;  1N8R Q;  2O1K A;  3VTP C;  3H1I D;  1DD4 A;  1PGQ A;  2Y0C A;  4UB6 H;  2PFX A;  3MUD A;  3CX5 D;  5APW A;  1ZXG A;  2P2U A;  1X79 B;  4N78 E;  2A45 G;  2WTY A;  3V2R A;  1L0N E;  4JPZ B;  3A5T A;  2FXM A;  4PV1 B;  3AE5 C;  1LTT C;  1GK6 A;  3CL3 D;  1Q7Y Q;  4IFD K;  5KLI B;  2Y0E A;  5KJ7 C;  3AE6 C;  1KIL D;  3GF3 A;  4H13 B;  1N7S A;  4EOT A;  2HG5 D;  1J1D C;  4PD4 H;  3L74 D;  3Q2Y A;  3HE5 B;  2V4H A;  1N86 A;  2NPS A;  3AEE C;  5AW1 B;  1MFZ A;  1VQ4 P;  1GZL A;  1Q81 Q;  1CI6 B;  1EZV E;  1JB0 J;  1Q86 Q;  2N9Y B;  1SQP G;  3WUU A;  1DH3 A;  1N7S C;  4HB1 A;  1KN7 A;  1YQ3 C;  1QVF O;  2QJP C;  1VQ9 P;  3RK3 E;  1NJI Q;  1GL2 B;  1QGK B;  2FYN C;  2D2C B;  3JCU E;  1T6A A;  1NTM K;  2NPS C;  3AEA C;  1VQ6 P;  1NTK E;  1NKN A;  2YKP A;  3WU2 E;  4YXW H;  5AVU B;  4WY4 A;  1OX3 A;  1U7J A;  3P8C D;  3S1K A;  3VYI A;  1IC2 A;  2RN0 A;  3TYY A;  4R4L A;  3VN0 A;  1Y8A A;  1BCC E;  3GF7 A;  3H1H J;  5BVZ A;  4BWN A;  2V7Q J;  1BE3 J;  2KUB A;  3BVH A;  2KLV A;  1PP9 D;  1FE6 A;  5GTH E;  1NTK G;  1SQB D;  2KK7 A;  3B71 A;  5CBN A;  1SQQ J;  3JCU H;  5KKZ C;  1KQL A;  3GHG B;  3WU2 H;  1SP4 A;  2Q3I A;  2Q9I A;  4PV1 D;  1Q90 D;  2XDJ A;  1N2D C;  2WQY C;  1NTZ G;  1M7L A;  1JTH A;  4WB4 A;  1S9K D;  2R3S A;  1BCC G;  3BRT B;  3A2A A;  2ZFC A;  4H13 D;  3L70 E;  1CZQ A;  4BRY A;  4JBZ A;  1KYO I;  1KFN A;  1NTZ K;  2P67 A;  4M3L A;  3USS A;  2XKM A;  2AXC A;  1FZA A;  3Q1M A;  1JCD A;  5GTH H;  2Q5U A;  1N73 A;  2WZ7 A;  3BCC E;  1J1D B;  2YNY A;  1RHZ B;  2WMM A;  4EDF A;  2WSC H;  4I6M C;  1LP1 A;  1GL2 D;  1HGZ A;  2D2C D;  3FWN A;  2AXT E;  1HGV A;  2K9Y A;  1IFN A;  2E75 B;  2A06 G;  1GU4 A;  2PGD A;  2MJZ A;  3RBZ A;  4H44 C;  1N7S B;  2QG4 A;  3S4R A;  2QJP B;  3CME P;  5CCH C;  1PPJ G;  5APU A;  3TGU J;  2FYN B;  2NPS B;  1SQP D;  1T3J A;  3G9R A;  2JDI H;  5AW5 B;  2BCC G;  3RBX A;  1OW8 A;  1L0L K;  1T8Z A;  5AW8 B;  1SLQ A;  2KYV A;  1GDT A;  1VF5 B;  2ZT9 C;  4EIJ A;  2AXT H;  1JO5 A;  2C9N Y;  2I1J A;  1A02 F;  3I56 P;  3P32 A;  2M5A A;  4C7N A;  1HF9 A;  2R32 A;  2N9B A;  3VOP A;  2Z5H A;  1W5C E;  3T97 A;  2WSF H;  2OYI A;  1SQV E;  3JSV C;  5AW2 B;  3M0A A;  5KKZ B;  3H1J J;  2H7H A;  1E79 H;  3I55 P;  3CCV P;  1VQL P;  3CPW O;  4AYC A;  3PJS K;  2C9L Y;  3TK1 A;  1NTK D;  2IBZ G;  3CWB J;  2W27 A;  3V4Q A;  1ZOY C;  1GMJ A;  1LTJ A;  3Q3D A;  2KLU A;  5KJ7 D;  5APT A;  3OW2 O;  4RO0 A;  1USD A;  1IFI A;  3ABV C;  2PRR A;  1NTZ D;  3N7N A;  1BCC D;  3PLN A;  4U3F E;  4L76 A;  1FS0 E;  2I8D A;  2KOG A;  4DCK A;  2QA4 P;  3L72 J;  4JYC A;  2Z4E A;  2E75 D;  1YQ4 C;  1BSH A;  3OJA B;  1LWU A;  2AEM A;  1GK4 A;  4H0L C;  5KAI E;  2WVR A;  3H1I E;  1RF0 A;  1N7S D;  3AE2 C;  4BRY B;  1KQS O;  2E76 C;  2P10 A;  1OZH A;  1NTM J;  5CHX A;  3CX5 E;  1DIP A;  4KT0 J;  4RJT A;  3A3Y B;  1OW7 A;  3CC7 P;  2NPS D;  3C9I A;  3ZDM A;  1OVU A;  1SQX J;  2FFD C;  2R3C A;  1N73 B;  3L75 J;  2HR3 A;  1PGO A;  3D6Y A;  3LID A;  3NXS A;  1EDK A;  1LWU C;  1KIL E;  1RF0 C;  2A06 D;  3KYQ A;  1VF5 D;  3Q5S A;  4XFJ A;  2W6J H;  3H1H G;  5AW0 B;  3L74 E;  3NFQ A;  1BE3 G;  1LP1 B;  1YIT P;  3RGU A;  1VQ7 P;  2WSE H;  3G4S P;  1IK7 A;  1K8A Q;  5KAI H;  1U57 A;  1PPJ D;  2O01 J;  2M3E A;  1VQO P;  1SQQ G;  2LKM A;  4I7Z B;  3CX5 H;  2ZT9 B;  3LW5 H;  2BCC D;  2ZAE B;  1TU3 F;  1EZV I;  2YXR B;  1KB9 D;  1HVV A;  1VQK P;  4K3A A;  1JY3 O;  1BGY J;  3AEG C;  2L91 A;  1W2E A;  5KLI C;  2AEJ A;  4JF7 A;  3PHL A;  3MP7 B;  2R5B A;  3P8C E;  2WPR A;  4H13 C;  3B5N A;  1PFI A;  2Q6Q A;  2M5A B;  1YI2 P;  4C7N B;  2K9J A;  1VQP P;  5KAF E;  1BDD A;  3HRN A;  2WPV B;  3F5H A;  3G3Z A;  3VMX A;  3CCE P;  1VQ5 P;  1QEX A;  4IL6 X;  1NU1 J;  2IBZ D;  4GOD A;  1YYC A;  2FYU K;  1PP9 E;  3CCM P;  1SQB E;  1KD1 Q;  5GTI E;  4OGQ C;  5AVT B;  1QL2 A;  3II6 A;  4B86 A;  1MV8 A;  3L37 A;  3TNU A;  5CCG A;  2GUS A;  1HUC A;  3P8M C;  1LTJ B;  1T3U A;  3E7K A;  4H0L B;  2ITA A;  3TDK A;  3HTK A;  4H44 D;  3TGU G;  1S9K E;  4I1L A;  3GG2 A;  2E76 B;  5CCH D;  5KAF H;  4HJG H;  1LTG C;  1LTS C;  3GMA A;  1NH4 A;  2R5D A;  3RL0 g;  2FFD B;  5CCG C;  1EQ7 A;  3KZI E;  3M0D A;  3AE1 C;  4EYY Q;  1L0L J;  3SSU A;  1LWU B;  3LIE A;  1QL1 A;  5GTI H;  3L71 J;  5KLV J;  1DX7 A;  3FXE A;  3AED C;  5AW4 B;  1KTM A;  4ZNC A;  2ZT9 D;  1LGH B;  4IOI H;  2KB7 P;  2QSI A;  3G6E P;  2H88 C;  2OTK E;  4CPG A;  3H1H D;  2B9B A;  3H1J G;  1BE3 D;  2CK3 H;  1AVY A;  4MN4 C;  2C0X A;  2QM7 A;  3CWB G;  1GU5 A;  1SQQ D;  2HFE D;  4DOJ A;  1ZN5 A;  2Q1K A;  3KZI H;  5K5G B;  2A45 H;  1SQP E;  3P7K A;  3MD0 A;  2FXO A;  1YTZ T;  2Y9Z A;  4GOF A;  3CCU P;  1Y9B A;  3MUD C;  1JY2 P;  2BEZ F;  1FBM A;  3L72 G;  2LXC B;  1JY2 N;  4KJM A;  1CW5 A;  2WPQ A;  2E75 C;  4D6T J;  2ZXE B;  4PJ0 E;  1EC5 A;  4H0L D;  1DEB A;  3CLQ A;  1NTM G;  4WBA A;  4N6J A;  4OGQ B;  2E76 D;  1SQX G;  1FZC A;  3L75 G;  2K9J B;  1OMI A;  3BAS A;  4N3Y B;  5B66 E;  2JR8 A;  1AV1 A;  3TF5 A;  4RES B;  2QVA A;  1SQX K;  3KQG A;  3NMD A;  3CC4 P;  1R5S A;  1MUU A;  1VF5 C;  2H43 A;  3L36 A;  1NTZ E;  1YTZ I;  1FZF A;  3TNU B;  3TGU D;  4PJ0 H;  3BRV B;  1PZQ A;  4WY4 C;  3W68 A;  1Q2N A;  2B88 A;  3HTK B;  4C7R A;  1RQU A;  1KMI Z;  2H8P D;  3VP8 A;  3CXH D;  3FGA D;  2IZ0 A;  5B66 H;  1AQ5 A;  2JWA A;  3U1C A;  1BGY G;  1FC2 C;  3O6Q A;  2L5G B;  4W80 A;  1ZP0 C;  1USE A;  3CCQ P;  3CX5 I;  2HLO A;  2G8Y A;  2HOD A;  3MHV A;  3WUT A;  1G1I A;  1T2K C;  3E1R A;  3H1J D;  2C0W A;  2HPC A;  3H1K J;  3N4X A;  3SFE C;  1S3J A;  2A06 E;  3AE3 C;  1G2C A;  1NU1 G;  2QEX P;  3CWB D;  2B87 A;  1NAY A;  1PPJ E;  2KZJ A;  2FYU J;  1J2J B;  3WMM 0;  1JOC A;  1NU1 K;  1PGJ A;  1YIJ P;  1JMM A;  4OGQ D;  2BCC E;  1LJ2 A;  1YJN P;  2W8Z A;  1EDI A;  1ZME C;  4BXL A;  3HUS A;  1RY3 A;  2OQQ A;  2E5Y A;  1KB9 E;  4JQ0 D;  1LNQ A;  3M9B A;  3L72 D;  2W6A A;  1N73 C;  4AUW A;  1SVF A;  3HD7 A;  3H25 A;  2ZYD A;  4LLH A;  4U7J A;  1NTM D;  1ZRT D;  1L0L G;  4YXD C;  3GW6 A;  5CCG D;  1KC8 Q;  3PRJ A;  3MGN A;  3B8E B;  3L71 G;  5KLV G;  1SQX D;  2ZVN B;  1K73 Q;  2I1K A;  3L75 D;  1NAF A;  2N1T A;  2FXP A;  2WT7 A;  2IBZ E;  4I7Z C;  5KLV K;  2E43 A;  1KFM A;  1FZC B;  3IF4 A;  1KB9 H;  1M1J A;  3KPE A;  5AVQ B;  4NPE A;  2OTJ P;  3EWK A;  1PIX A;  1HTL C;  2P7J A;  4WY4 B;  1HH0 A;  1VL2 A;  1YHQ P;  2Y9Y A;  4DT0 A;  3CXH I;  3VP9 A;  2JP3 A;  3Q5P A;  2N1T C;  3PP5 A;  2E42 A;  1WT6 A;  2POH A;  3H1L J;  3AEC C;  1N7L A;  4XE5 B;  3EFF K;  4GT1 A;  3VMY A;  4L75 A;  2FBW C;  1MFT A;  5CBO A;  2OYI C;  1BGY D;  3D70 A;  3RL0 C;  2QRX A;  1LT9 A;  2ZYA A;  3AE4 C;  2OYH A;  4D6T G;  2A45 I;  3CCL P;  1MZ9 A;  3O6Q B;  1LTJ C;  3C8V A;  1JTH B;  3H1H E;  2HOD B;  2WWW A;  1BE3 E;  1NU1 D;  1Y47 A;  2NRG A;  3QWO C;  1S5L X;  2RMZ A;  2HPC B;  2KNC A;  1G2C B;  3C1L A;  3VMZ A;  2QJY B;  1LTA C;  1SQQ E;  3AEB C;  1M57 D;  3MTU E;  1SQV K;  5BU8 B;  2B87 B;  3FX0 A;  2ZXX A;  1X0T A;  1S4X A;  1H0T A;  1L4A A;  4KHX A;  2YO3 A;  1UII A;  2CPS A;  1IO4 A;  1L0N J;  4ASV A;  5DJU B;  1FU1 A;  1JCC A;  1QVG O;  1RF1 A;  3CC2 P;  1IFJ A;  1W2B O;  2V7Q H;  2KSJ A;  1L4A C;  4WY4 D;  2BEQ D;  1L0L D;  3HD7 B;  2KSE A;  1OFC X;  5AVZ B;  2WPS A;  4ZKP A;  3L71 D;  5KLV D;  2QE7 H;  1A02 J;  4ZMD A;  1ZW0 A;  4ZKU A;  1RF1 C;  1FJP A;  1P84 D;  3K5B A;  2YIU C;  3I5C A;  1HBW A;  4DZO A;  2M3B A;  2LXB A;  2N1T B;  3H1K G;  5KTB A;  3IFM A;  1IFP A;  3UIA A;  1T2K D;  1VQM P;  5BU5 A;  1PV3 A;  2W83 C;  2OTL P;  2GUV A;  1GD2 E;  4L73 A;  3AEF C;  4YTP C;  3M91 A;  1AJY A;  3G71 P;  2FYU G;  3RK2 C;  3TGU E;  2UWJ E;  1GW3 A;  3T97 B;  2AEF A;  2OYI B;  2W90 A;  2JWD A;  2P1J A;  4NPF X;  1JEK A;  4AQR D;  3RL0 B;  2O3J A;  4EI2 A;  5EFW B;  3JC2 2;  3D6Z A;  4Y99 C;  2YKQ A;  4NPD A;  1IZN B;  1VDF A;  3CXH E;  3B5N C;  4I2L C;  1LTB C;  1RH5 B;  3FWL A;  3CD6 P;  3AE9 C;  4D6T D;  2WSC J;  2FY8 A;  1FJK A;  1OIP A;  3V4W A;  2OYH B;  1NO4 A;  3H1J E;  2RKL A;  3EFG A;  2XU6 A;  3V2P A;  3CMA P;  3L70 J;  1KV4 A;  3CWB E;  4OH8 B;  4IL6 E;  5AVX B;  3HD7 D;  1EDL A;  5APQ A;  2J5U A;  4JYB A;  3CXH H;  1X22 A;  2YKO A;  2KNC B;  3MIW A;  4GDO A;  3BCC J;  1FZG A;  4Y28 J;  3M06 A;  3L35 A;  1H0T B;  2B89 A;  1L4A B;  2IDB A;  3M0D C;  4UB8 E;  4O9B A;  1SQB K;  1SS1 A;  3M9H A;  3L72 E;  2QIW A;  2N1T D;  2HYN A;  3KXD A;  2E74 C;  3H1L G;  3U1A A;  1KB9 I;  3QH9 A;  5AW3 B;  1RF1 B;  1XTC C;  4IL6 H;  5KJ7 A;  4LC1 A;  2WSF J;  1NTM E;  1PGP A;  1ZRT E;  2YIU B;  5AW6 B;  1ZLL A;  1LTI C;  3R4Y A;  1SQX E;  1CSB A;  3RK3 C;  1NGM B;  2JO1 A;  3L75 E;  3RL0 D;  1OVR A;  3GLM A;  1KYO D;  1RE3 A;  4YPC A;  1HWT C;  2KP8 A;  3H1K D;  4UB8 H;  3MZW B;  3RK2 B;  1JY3 P;  1AQT A;  1HJ0 A;  5AW9 B;  2IBZ I;  1FDI A;  1JY3 N;  1JMB A;  4IFM A;  2FYU D;  4Y99 B;  3B5N B;  1DD3 A;  1QLE D;  1SQV J;  1RE3 C;  3L73 J;  2Q7C A;  5M1B A;  3B4S A;  3U59 A;  2FKW B;  1SFC A;  1BSN A;  2IYO A;  1L0N G;  2KS1 A;  2O1J A;  1AFO A;  1RE4 A;  3PTZ A;  3L4F A;  3CCS P;  1BGY E;  1L0N K;  1NVO A;  2NZ2 A;  2KIK A;  1KZU B;  3AE7 C;  3V6I A;  1IJD B;  1SQP K;  1URQ A;  5AVS B;  1FOS E;  2Q3E A;  3R2P A;  2DW3 A;  1FZC C;  2H89 C;  2YXQ B;  1SFC C;  2O01 H;  1RE4 C;  1L4A D;  1J1E B;  2YMY A;  4U3F J;  2J59 M;  1EZV G;  3PH0 A;  2IX7 C;  2KXP B;  1NU1 E;  4K35 A;  2PAJ A;  2WSE J;  1URQ C;  3M9Q A;  3H1I J;  1EXI A;  2YO2 A;  2QM8 A;  1K04 A;  4TLF A;  3LW5 J;  3O8Z A;  1IFD A;  2K3R A;  1G1J A;  4HH2 A;  2E74 B;  2IZ1 A;  4GIF A;  3IN6 A;  2CPB A;  2IFM A;  1ZR2 A;  3S9O A;  1NTK K;  1EXJ A;  3RK2 D;  3H1L D;  3L74 J;  3RK3 B;  2PP6 A;  1L0L E;  5CJ4 A;  3NTN A;  3TSI A;  1NYH A;  1VPC A;  1AVO A;  3L71 E;  5KLV E;  1NKZ B;  3B5N D;  1M90 Q;  2QJY C;  1JNM A;  1NOH A;  1P84 E;  5CCH A;  4PD4 D;  5TJH A;  2MKV A;  4GKG A;  3L70 G;  1FZE A; 
#chains in the Genus database with same CATH homology
 3HTK A;  1S9K E;  1L4A A;  1GL2 B;  4KHX A;  2YO3 A;  2CPS A;  4I1L A;  1NTM K;  5CCH D;  2NPS C;  1IO4 A;  4W7Z A;  5APY A;  3HUS C;  1LTG C;  1LTS C;  1NKN A;  1FU1 A;  2YKP A;  1JCC A;  5AVU B;  1NH4 A;  4WY4 A;  2R5D A;  2FFD B;  4N78 D;  1FDM A;  5CCG C;  1EQ7 A;  3HD7 C;  3P8C D;  1RF1 A;  3M0D A;  3VYI A;  4W7Y A;  1LWU B;  3LIE A;  1IC2 A;  2WIT A;  1IFJ A;  3TYY A;  1QL1 A;  3VN0 A;  2XZR A;  1DX7 A;  2KSJ A;  4XA4 A;  2OAR A;  1L4A C;  2XV5 A;  5AW4 B;  4WY4 D;  1SFC B;  5AVR B;  1X9V A;  3HD7 B;  3OAK A;  1LGH B;  5AVZ B;  5BVZ A;  2KB7 P;  2WPS A;  1IK9 A;  4ZKP A;  3BVH A;  3HE4 A;  1A02 J;  2KLV A;  5APS A;  4ZKU A;  1RF1 C;  1URQ B;  1KQL A;  1FJP A;  1FAV A;  1OXZ A;  2C0X A;  3H6P A;  3I5C A;  1HBW A;  3GHG B;  1M1J C;  4DZO A;  1IFM A;  2QM7 A;  1SP4 A;  2Q3I A;  2M3B A;  2Q9I A;  2N1T B;  1KIL A;  5KTB A;  2JJL A;  2HFE D;  3IFM A;  1GU5 A;  1ZN5 A;  2XDJ A;  1N2D C;  3CI9 A;  4DOJ A;  5CMZ A;  3UIA A;  1T2K D;  3RK3 D;  5BU5 A;  1M7L A;  1JTH A;  4WB4 A;  1S9K D;  5AVY B;  1FOS F;  2A45 H;  3BRT B;  2GUV A;  3P7K A;  3A2A A;  1GD2 E;  2ZFC A;  3MD0 A;  1YTZ T;  3M91 A;  1Z56 A;  3RK2 C;  1CZQ A;  1KFN A;  1NTZ K;  1GW3 A;  2P67 A;  4LGD E;  4M3L A;  2OYI B;  2J58 A;  3V5B A;  2XKM A;  1JY2 P;  2JEE A;  2P1J A;  1FBM A;  1FZA A;  3H32 A;  1KIL C;  3RL0 B;  4AQR D;  1JCD A;  2Q5U A;  1N73 A;  4Y99 C;  2WZ7 A;  1JY2 N;  2YKQ A;  1VDF A;  3B5N C;  1CW5 A;  2WPQ A;  1J1D B;  2YNY A;  4I2L C;  5CJ0 A;  1LTB C;  2ZXE B;  1LT9 C;  1DEB A;  2FFD A;  3CLQ A;  2WSC H;  1X8Y A;  2Z5I A;  4WBA A;  2OYH C;  4I6M C;  4HYT B;  1GL2 D;  1HGZ A;  4N6J A;  1HGV A;  1IFN A;  1FZC A;  3E1I A;  1HJB A;  1GU4 A;  3BAS A;  1FJK A;  2MJZ A;  4N3Y B;  3V4W A;  1OWA A;  2OYH B;  1NO4 A;  5AVV B;  4RES B;  1N7S B;  5APX A;  1WRG A;  1SQX K;  3KQG A;  3NMD A;  3EFG A;  2XU6 A;  5CCH C;  3V2P A;  5APV A;  5APU A;  2VRS A;  2NPS B;  4OH8 B;  3HUS B;  3SWF A;  1T3J A;  5AVX B;  1SFC D;  1MUU A;  3HD7 D;  3OA7 A;  2H43 A;  3L36 A;  5APQ A;  4JYB A;  5AW5 B;  1YTZ I;  1FZF A;  3SWY A;  3TNU B;  2YKO A;  3BRV B;  3MIW A;  1L0L K;  1GTW A;  1T8Z A;  1FZG A;  5AW8 B;  1SLQ A;  3M06 A;  2KYV A;  4WY4 C;  1GDT A;  3L35 A;  4EIJ A;  1URQ D;  3HTK B;  1JO5 A;  2C9N Y;  1L4A B;  4C7R A;  2I1J A;  1E5W A;  3M0D C;  2H8P D;  1A02 F;  1H89 A;  3VP8 A;  2GM4 A;  3P32 A;  4O9B A;  1SQB K;  4C7N A;  3M9H A;  2R32 A;  2N9B A;  3VOP A;  1AQ5 A;  2N1T D;  2Z5H A;  2HYN A;  3U1C A;  3T97 A;  2WSF H;  2OYI A;  3U1A A;  5AW3 B;  2L5G B;  1RF1 B;  5AW2 B;  1XTC C;  2WT7 B;  3HE5 A;  3M0A A;  1SQQ K;  2H7H A;  4W80 A;  1H88 A;  1JY2 O;  4LC1 A;  5KJ7 A;  5AW6 B;  4AYC A;  2HLO A;  1M1J B;  2HOD A;  2IFN A;  1ZLL A;  1LTI C;  1XTG B;  1G1I A;  2C9L Y;  1ZV8 A;  1CI6 A;  3TK1 A;  1T2K C;  4C46 A;  1CSB A;  3RK3 C;  2C0W A;  1ZR4 A;  2HPC A;  3N4X A;  3V2Q A;  2W27 A;  3V4Q A;  1G2C A;  1LTJ A;  3RL0 D;  1NWQ A;  3HE4 B;  3V2N A;  5AW7 B;  5KJ7 D;  5APT A;  1RE3 A;  1HWT C;  2KP8 A;  3KDP B;  1IFI A;  3RK2 B;  1GL2 A;  1JY3 P;  1JUN A;  1J2J B;  5AW9 B;  3N7N A;  3WMM 0;  1JOC A;  1NU1 K;  1JY3 N;  1GW4 A;  2W6B A;  1JMM A;  1KIL B;  4IFM A;  2KOG A;  4JYC A;  2Z4E A;  4Y99 B;  3OJA B;  1LWU A;  3HUS A;  1RY3 A;  3B5N B;  1GK4 A;  1RE3 C;  1LT9 B;  1RF0 A;  2Q7C A;  3M9B A;  1N7S D;  1H8A A;  3U59 A;  4AUW A;  2W6A A;  1N73 C;  1GL2 C;  2FKW B;  1SFC A;  2O1J A;  1SVF A;  3HD7 A;  1AFO A;  5CHX A;  1RE4 A;  4LLH A;  3BAT A;  3L4F A;  3A3Y B;  3EQ2 A;  2NPS D;  3C9I A;  3H32 B;  2FFD C;  2R3C A;  1L0N K;  1N73 B;  3LID A;  3NXS A;  1KZU B;  5CCG D;  1J1E C;  3MGN A;  1LWU C;  1IJD B;  1SQP K;  3B8E B;  1URQ A;  5AVS B;  5AVW B;  2FYZ A;  1FOS E;  3R2P A;  3IR9 A;  1FZC C;  1RF0 C;  2I1K A;  3GHG A;  3A7O A;  3KYQ A;  2M8R A;  1SFC C;  1NAF A;  2N1T A;  1FZB A;  5AW0 B;  2BAS A;  2O01 H;  3NFQ A;  1RE4 C;  1L4A D;  2WT7 A;  1J1E B;  2YMY A;  2WSE H;  5KLV K;  2E43 A;  2J59 M;  1KFM A;  1FZC B;  1M1J A;  3KPE A;  5AVQ B;  2IX7 C;  1NHL A;  2PAJ A;  2IPP A;  1URQ C;  2LKM A;  3M9Q A;  1HTL C;  2P7J A;  4WY4 B;  1HH0 A;  3LW5 H;  3GHG C;  4IFF A;  2XNX A;  3VP9 A;  2YO2 A;  2N1T C;  3PP5 A;  2QM8 A;  2O1K A;  3VTP C;  3O8Z A;  2E42 A;  1IFD A;  1WT6 A;  1G1J A;  1HVV A;  4HH2 A;  2POH A;  4GIF A;  1JY3 O;  3MUD A;  2CPB A;  1N7L A;  2IFM A;  1ZR2 A;  4XE5 B;  5APW A;  1W2E A;  1NTK K;  2P2U A;  4JF7 A;  1X79 B;  4N78 E;  2A45 G;  2WTY A;  4GT1 A;  2R5B A;  3VMY A;  3V2R A;  3P8C E;  2WPR A;  3A5T A;  3RK2 D;  2OYI C;  2FXM A;  3B5N A;  1PFI A;  1LTT C;  1GK6 A;  3CL3 D;  3RL0 C;  3RK3 B;  1LT9 A;  4C7N B;  4IFD K;  3HRN A;  5KJ7 C;  1KIL D;  2PP6 A;  3G3Z A;  3VMX A;  5CJ4 A;  2OYH A;  3NTN A;  1N7S A;  3TSI A;  4EOT A;  2A45 I;  2HG5 D;  1J1D C;  1MZ9 A;  1VPC A;  3HE5 B;  1NKZ B;  3B5N D;  1YYC A;  2FYU K;  1LTJ C;  1JNM A;  1N86 A;  2NPS A;  1JTH B;  5AW1 B;  5AVT B;  2HOD B;  2WWW A;  1MFZ A;  1GZL A;  1NOH A;  1QL2 A;  3II6 A;  4B86 A;  1CI6 B;  1MV8 A;  3L37 A;  3TNU A;  5CCG A;  5CCH A;  2GUS A;  2HPC B;  1HUC A;  3P8M C;  1G2C B;  1LTJ B;  3VMZ A;  1LTA C;  1T3U A;  1DH3 A;  3MTU E;  1N7S C;  1SQV K;  4GKG A;  5BU8 B;  1FZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...