2N1TD

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
74
structure length
74
Chain Sequence
b'GGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 32
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tD00
4JF7A 5CCGC 5CCHA 1N7SB 5CCGA 1L4AD 1SFCD 3B5NB 5KJ7D 1L4AC 1SFCC 5KJ7C 2PP6A 1XTGB 1L4AA 1GL2A 1SFCA 5KJ7A 4OH8B 3RK2B 1JTHA 4WY4D 4WY4C 2HG5D 3RK3B 2NPSB 1NHLA 4WY4A 2H8PD 2KOGA 3RL0B 4W7ZA 3B5ND 3B5NC 1GL2D 1GL2C 1N7SA 3B5NA 2WZ7A 1KILB 1T3JA 3P8CE 3KYQA 1URQB 3RK2D 1KILA 3PP5A 2YMYA 1HVVA 2M8RA 2XDJA 3RK3D 2NPSD 3RK3C 2NPSC 4N78E 4W80A 3RL0D 2NPSA 3RL0C 1N7SD 1N7SC 1KILD 2N1TB 1KILC 2N1TA 3HD7B 3RK2C 4W7YA 1URQA 3TSIA 3HTKB 3M0DC 1L4AB 1GL2B 1SFCB 3VOPA 2N1TD 2HFED 2N1TC 1JTHB 1URQD 1URQC 3HD7D 3HD7C 4WY4B 5CCHD 3HD7A 5CCHC 4LGDE 5CCGD
chains in the Genus database with same CATH superfamily
4PV1D 3WU2E 3BCCE 1T2KC 1LT9A 5CCGA 1JNMA 1SFCC 3SFEC 5KJ7A 4BRYB 4BRYA 4AYCA 2RN0A 3IR9A 1JY2N 3BCCD 3HE4B 3CCJP 3L73E 1L0LE 3KDPB 2WPQA 1H88A 3G3ZA 3AEAC 2FYUE 4OGQD 1VQ8P 2XKMA 3F5HA 4DT0A 1URQB 3L73D 1L0LD 2IBZI 1LT1A 1IFPA 3RK3C 4DOJA 1EDIA 3BATA 4R4LA 4IFFA 5AW0B 4PJ0E 3AE5C 2DW3A 1CI6B 5KLVK 5CHXA 1S5LE 1Q2NA 2LR2A 1ZP0C 2KNCB 3II6A 3L35A 1EXJA 4Y99C 1NO4A 3PHLA 2V7QJ 1JY3O 1OZHA 3TSIA 2QIWA 3TGUG 3MIWA 1GU5A 4YXWH 1JO5A 2A06G 2IPPA 3VOPA 2K37A 3CXHI 1OW7A 5APTA 3D6ZA 1IZNB 1NTZJ 3L72E 5KLVE 3L71D 2IFNA 2WSFH 1X8YA 1L4AD 1PV3A 2ZFCA 4GIFA 1SFCA 2K9YA 2IZ1A 2OYHA 2QSIA 1S4XA 3L72D 5KLVD 1KILE 1JOCA 1EDKA 2KOGA 3H1IJ 2WSEH 1QL1A 2RH0A 1A02F 4DJGA 1AVYA 3CL3D 5KAIH 2P67A 3PLNA 3IF4A 4OGQC 2IBZG 3OA7A 3CC2P 1H89A 4UB6E 4JBZA 4EYYQ 3PP5A 4H0LD 5TISH 2JWAA 2HPCA 2XNXA 2KSEA 2J59M 2Z4EA 2YNYA 2A45I 1NTMG 5BVZA 2ZT9B 2R5DA 5APSA 2N1TB 1OW6A 4D6TG 1EZVG 1S1CX 3FXEA 2N1TA 4WWIA 1A02J 1QX8A 1NAFA 3CCUP 5AVVB 1T8ZA 1FZCC 1HH0A 4U3FJ 2B9BA 3N7NA 1FU1A 3SFDC 1KYOI 5AVTB 1GZLA 3VN0A 2WSFJ 3L36A 3MUDC 1M90Q 5AVUB 2WMMA 3WU2H 5CJ4A 3S4RA 3AE1C 1L4AC 1RHZB 3Q5RA 3Q5SA 2Q3EA 3G4SP 1PIXA 1RF0C 2WSEJ 1VF5B 3TK1A 3CCEP 1ZMEC 1JM0A 1PP9G 1LTSC 3RL0B 2XU6A 5DJTB 2OGUA 5GTIE 4I1LA 1N7SA 1EC5A 2Z5HA 1CZQA 3VMXA 1P84D 1KQGB 3JCUE 3L70G 1S9KE 2A45G 4H0LC 1SQPK 4PJ0H 4HKZH 1SQQK 2FXPA 1IFDA 4NPFX 3H1HE 3L75J 1BE3E 2KS1A 1DEBA 1BSHA 2WWWA 1AQTA 3LW5H 4OVNF 2E5YA 4KHXA 1S9KD 4JPZB 3V2PA 2Q7CA 2FYNC 1FZCA 2JR8A 3D71A 5AW6B 3R4YA 1BE3D 5CBNA 1LTTC 1KB9D 2E75B 3K5BA 1S72P 1LJ2A 3TGUD 3CC7P 2HLOA 1SQPE 3C8VA 1L2PA 1IFNA 1SQQE 2A06D 3MUDA 1N73A 3UIAA 1LWUC 1KD1Q 4MN4C 1L4AA 1AA0A 2CPBA 3G71P 2D2CD 3U1AA 1SQQD 3L73J 1L0NG 1L0LJ 4I7ZB 1NTKG 1VQ6P 1FOSE 2OYIC 2KB7P 1GK6A 3EWKA 2HYNA 2OTKE 3BCCG 5AVXB 2R32A 1KC8Q 3SWKA 1KILB 4H44B 3I5CA 5L8RJ 4UB6H 1KILA 3E7KA 1FZBA 2E42A 3HUSA 2XZRA 4B86A 2IBZD 1USEA 2ZXEB 1UIXA 4CPGA 2YO3A 3Q3DA 1G2CA 1HF9A 2C0XA 1IFMA 3LW5J 3H25A 2FYUG 3H32B 1RF1A 4HB1A 3H32A 1S5LX 1N86A 1NTMD 2QM7A 1S2EA 4K35A 3CWBG 3L71J 2W90A 4D6TD 3CXHE 5BU8B 1TU3F 2ZAEB 1N2DC 3KZIH 1LTBC 1GMJA 2BCCE 2KI7B 3VTPC 1DX7A 1KQFB 2OARA 1J1EC 1M7LA 2XNDH 3MP7B 1LWUA 2BCCD 2QJKB 2D2CC 1PGQA 2QEXP 2JEEA 1AVOA 1JTHA 1GTWA 1YJ9P 2FKWB 1LTGC 2OYIA 1P84H 1LT9C 2FYZA 3P32A 3AEBC 3AE3C 3L72G 5KLVG 2R44A 5KLIC 3KPEA 2WZ7A 1BSNA 1PP9D 1W5CE 3JCUH 3GF3A 1VQ5P 4XFJA 1M57D 3ITKA 5B66E 2AXTE 2E74D 3H1LE 1YI2P 4EOTA 2L91A 3CCRP 3VP8A 3M0AA 3HD7B 1KB9H 3T97A 2OTJP 1NTKK 2KZIA 1E5WA 3ZDMA 2IYPA 1QVFO 2FFDB 2PGDA 3GMAA 3H1LD 5AVYB 2FFDA 3C9IA 4K3AA 4U7JA 1KYOE 1QGKB 2J5UA 2ZT9D 2N1TD 1FE6A 4WY4B 3EFGA 1IK7A 2OYOA 1KYOD 3Q5PA 2LKMA 2CPSA 2O01H 1R5SA 5AVWB 3QWOC 1FJKA 1NTKE 3RK2B 1YTZT 3H1KE 1HBWA 3VMAA 1ZOYC 2WT7A 2FXMA 4GKGA 3HE5A 1L0ND 1PPJE 1OIPA 4GOFA 5AVSB 1NTKD 2Q6QA 2K9JB 1ZN5A 2J58A 2OYHC 3H1KD 3P8CE 3KYQA 3SSUA 1VF5D 3M9BA 3HE4A 3TYYA 3RL0D 1LP1B 5KAFH 1N7SD 3OAKA 2W8ZA 2E74C 2YXQB 3TGUJ 1FZFA 4AUWA 1DIPA 3CCLP 4N6JA 2P1JA 2YKQA 1URQA 3CWBE 1CSBA 3S1KA 3PRJA 4ASWA 2FYUD 1IFIA 1GL2B 1ZV8A 4YTPC 2H7HA 4XA4A 1CI6A 2ZT9C 3CWBD 2N1TC 5AW3B 3H1HG 2KNCA 1KV4A 1BE3G 1VQ7P 2O01N 2O01J 3CCMP 2JJLA 2ZXXA 1IFJA 1NKNA 3O6QB 1J1DB 3NMDA 5AVRB 2AXCA 1KFNA 2E75D 1M1KQ 1KFMA 1USDA 5KKZB 1X9VA 5APQA 5AW7B 1SQPG 3B8EB 5H2FE 2N9YB 1SQQG 4NPDA 4W7ZA 4PV1C 2LXCB 4L74A 1H0TB 1H0TA 1ZR2A 4RESB 2W27A 1NTMJ 1HGVA 2H88C 3GLMA 2A45H 1VF5C 4D6TJ 4IOIH 4W80A 2QRXA 3ABVC 1FZGA 3RL0C 3FWNA 1N7SC 3CD6P 1KILD 4H44D 2C9LY 1RE4A 2B87B 3KHUA 2JWDA 2E76B 1SQXK 1IC2A 3HTKB 1JUNA 3AEEC 4PD4I 3U1CA 4KJMA 1KYOH 3GG2A 2IFMA 3QH9A 3TNUB 1FDIA 1MKMA 1AJYA 2Y9ZA 3CX5I 3IAOA 1MZ9A 2ZVOB 3EFFK 4I6MC 1K05A 1SQVK 5CJ0A 1NAYA 1NVOA 3RGUA 5TJHA 2E5TA 4H13B 2E75C 1PP9J 4UB8E 1GK4A 1SQXE 2QJPC 1PGOA 1JY3P 2G3AA 3MD0A 3CCQP 4EIJA 2BCCG 2NPSB 1BGYE 1JCCA 1N73C 2IX7C 3OJAB 3AEGC 2KIKA 5CBOA 3A7OA 2YIUB 3V2RA 3L70J 3IFMA 1X22A 1SQVE 5AW2B 1VQ4P 3A5TA 3SWFA 2YMYA 1FS0E 3L74E 1U7MA 3H6PA 1X0TA 2QG4A 1SQVD 2H43A 4IL6X 1LTAC 4ZKUA 1KILC 4H44C 2GA1A 1OVVA 2Q5UA 4U3FG 4IFMA 3HUSC 3LIDA 4GOEA 1GW3A 1PGJA 1Q90D 2POHA 2QJYB 1FAVA 2O1JA 2V4HA 3M91A 2ZJSE 1S5LH 4EDFA 3BVHA 1Q81Q 2WPVB 1RF1C 1Y9BA 3H1LG 3HD7D 1YITP 3CLQA 1L0NJ 3H1HD 4RKUJ 1NTKJ 1OFCX 5C39A 1Z56A 5AVQB 4C7NB 3CI9A 2M3EA 1FBMA 2P10A 3BCCJ 4WY4D 3C1LA 3MTUE 4TT3H 4N3YB 2P2UA 1GDTA 1RQVA 4A7PA 5E79E 2QJKC 1SQPD 3RK2D 1JY3N 1AFOA 1SQBG 1EQ7A 1YQ4C 2SPZA 3AE6C 1VQ9P 1JY2O 2O1KA 3H1KG 4NPEA 2FYUJ 2KLVA 1PPJG 4IFDK 3CWBJ 1YQ3C 1HTLC 1MV8A 3FXDA 1UIIA 3D6YA 2YKPA 3G9RA 5APVA 1QEXA 1R5LA 1FZAA 2W83C 2LXBA 3IN6A 3U59A 1URQD 2Y0CA 5AW9B 4LC1A 3HD7C 2GUSA 3EQ2A 5CCHD 2FFDC 2FY8A 4HH2A 1RQUA 3LIEA 1WT6A 4UB8H 5APXA 1T6AA 1VQMP 3L72J 5KLVJ 3AE8C 2QM8A 1NWQA 4WY4C 3CXHD 2YO2A 3KQGA 1MFTA 2M0BA 1SS1A 3CMAP 1N8RQ 2IZ0A 1BDCA 5APUA 2PFXA 2RMZA 3MZWB 4RJTA 1IJDB 4C7RA 3SWYA 3FWLA 5AW8B 2MJZA 1G1IA 3I55P 2YKOA 1VPCA 4WVZA 1M1JB 3PTZA 5GTIH 2VRSA 4U3FE 1M8OB 1EXIA 1S3JA 2M5AB 3OW2O 1YJWP 4LLHA 2G8YA 2WSSH 4W7YA 1LTJB 4PD4E 1LTJA 2CK3H 4IL6E 4R4MA 3CX5E 4U3FD 2K88A 2WITA 1W2BO 1FDMA 1QLED 1HJ0A 2PRRA 4BXLA 2BEZF 2HFED 2QE7H 4PD4D 3O8ZA 3GF7A 1URQC 1K04A 3CX5D 2UWJE 3HD7A 5CCHC 1VDFA 1SQBK 2E76D 1SVFA 2W6BA 3B5NB 5KAIE 2PP6A 3RL0g 1T3UA 2KSJA 1P84I 3A0BE 1QL2A 4HJGH 1GD2E 1OVUA 4C46A 3AE2C 1R8EA 4WY4A 2FXOA 3AE9C 3F89A 1VQKP 3G6EP 1YYCA 3BRVB 4ZNCA 1KMIZ 4H13D 4DZOA 1SQBE 4BWNA 3A0HE 2IYOA 5AVZB 3E1IA 2KYVA 1HVVA 4QMAA 4GDOA 1SQXG 2M8RA 3AECC 2KXPB 1RE3A 2NPSD 4WBAA 3Q2YA 2Y0DA 1KB9I 5DJUB 2ZYGA 1BGYG 3M06A 1NJIQ 4XE5B 1SQBD 2WQYC 2K9JA 1NU1G 2FBWC 1SQVG 5AW1B 2AEJA 5CMZA 1PPJD 5KTBA 1FDOA 1LT9B 1LNQA 2Z5IA 3L74G 3H1HJ 3M0DC 5KLIB 1BE3J 2GUVA 1LP1A 3P8CD 1RE4C 3H1JG 2R3CA 2I1JA 1BCCG 1KQSO 1MFZA 4JYBA 2PAJA 2NRGA 3VMZA 1FOSF 1AV1A 2E76C 1YHQP 1IO4A 5CCHA 3CXHH 1AQ5A 1GL2A 2QA4P 5AW5B 1EDLA 4EI2A 1SQPJ 4DCKA 1SQQJ 3A2AA 2AEFA 3CCSP 3WUUA 5AW4B 3AEDC 5K5GB 3GHGB 3L4FA 3N4XA 4AQRD 1OMIA 3GHGA 3O6QA 5APWA 4H13C 1T3JA 1GU4A 3PJSK 1EZVI 1JB0J 3FGAD 2NPSC 3CC4P 4N78E 1VQPP 4O9BA 3WUVA 2IDBA 3L71E 2YIUC 2BEQD 2JP3A 3V2NA 2W6AA 2R5BA 2OQQA 2H89C 4N78D 2K1AA 3S9OA 4PD4H 1NH4A 4IL6H 1KORA 3GW6A 2Y9YA 1U57A 3CX5H 1SFCB 3M0DA 2OYHB 5B66H 1HGZA 2AXTH 4KT0J 3V4WA 1DH3A 1FJPA 1RY3A 4HYTB 4LGDE 1WRGA 4RO0A 1JMMA 2B87A 4Y28J 2QJYC 3HTKA 1SP4A 2E74B 1NTZG 3A0BH 3M9QA 2BCCJ 3TNUA 2C9NY 3USSA 2KLUA 1NU1K 2Q3IA 2HPCB 2E43A 3RK3B 1K8AQ 1G1JA 1K9MQ 3VMYA 3W68A 1OW8A 3B4SA 3H1IG 3A0HH 1ZR4A 1E79H 4Y99B 3TF5A 1PFIA 3JC22 1Y8AA 2HR3A 4GT1A 2W6JH 3NTNA 3PH0A 2NPSA 3B71A 3KZIE 1SQXD 1NU1E 2RKLA 1Q86Q 4I7ZC 1BGYD 3E1RA 1NGMB 2KP8A 1ZRTE 4L76A 4PV1B 3H1LJ 1NU1D 1PZQA 1VQNP 3H1JE 3MGNA 2BASA 1BCCE 1OVRA 1QVGO 3CMEP 3L74D 1ZRTD 4JQ0D 2XV5A 2N9BA 4JF7A 1P84E 3H1JD 5GTHE 1N7SB 3CPWO 1BCCD 3V5BA 1PGPA 4OGQB 2WPSA 5APYA 2Y0EA 1J2JB 4OH8B 1X79B 3RBXA 1HJBA 4ASVA 1ZLLA 2Q1KA 5B5EE 2ZYAA 2H8PD 2YMKA 1DD4A 1KZUB 3B5ND 1SQBJ 3BRTB 2JKVA 3VYIA 4L73A 2KS1B 3H1KJ 3AE7C 4C7NA 2ITAA 1KB9E 2WTYA 3TGUE 1IK9A 1FZCB 2A06E 5H2FH 1NOHA 2KUBA 2P58A 2I1KA 2AEMA 2C0WA 2O3JA 2QJPB 1NTZK 2KZJA 2ZYDA 3Q1MA 1NKZB 1HWTC 1Q82Q 1XTCC 2Q9IA 1N73B 1HUCA 3L75G 2HODB 1M1JC 1L4AB 2HODA 4GODA 1NTMK 1MUUA 2NZ2A 3VP9A 3RBZA 3P7KA 1FZEA 1LTJC 1RF0A 3CCVP 5CCGD 2M3BA 3BASA 4I2LC 1D7MA 1NTZE 5KJ7D 2IBZE 4YPCA 3TDKA 1GW4A 3HUSB 2R3SA 1OWAA 1JMBA 1NTZD 4ZKPA 4H0LB 1NTME 4YXDC 1G2CB 3L73G 3L37A 5KAFE 1L0LG 1VL2A 4WB4A 1Y47A 3B5NC 5EFWB 1GL2D 3P8MC 1OXZA 4D6TE 1EZVE 3H1IE 1N7LA 1RF1B 4JYCA 1DD3A 3KXDA 1KQLA 2OTLP 2YXRB 4L75A 1LGHB 1K73Q 2ZVNB 2FYNB 1EZVD 1DEEG 3H1ID 1W2EA 1Q7YQ 1ZXGA 1LTIC 2WPRA 3RK2C 3MHVA 1RE3C 2QVAA 5BU5A 1YJNP 1KTMA 3V4QA 3FX0A 1LWUB 1M1JA 2WSCH 3R2PA 2B89A 3L71G 1JTHB 1BDDA 2M5AA 3HRNA 1H8AA 1PP9E 1JY2P 2OYIB 5M1BA 1WMKA 2KK7A 3AE4C 5CCGC 1YTZI 1EDJA 1U7JA 5GTHH 1T2KD 1SFCD 2L5GB 1JEKA 5KJ7C 1XTGB 1VQOP 4OWFA 4M3LA 1FC2C 4TLFA 3L70E 3NXSA 1YBKA 3D70A 1NYHA 3WUTA 2HG5D 1NHLA 5B5EH 3WMM0 3RK3E 1KN7A 1GL2C 1SQXJ 3B5NA 3L70D 3T97B 1RH5B 1BGYJ 3NFQA 1L0NK 2P7JA 2WVRA 1VQLP 4ZMDA 2XDJA 3RK3D 5TISE 4Z1MH 1CW5A 1NU1J 2GM4A 1SLQA 1SQVJ 3GHGC 1J1DC 1YIJP 1JCDA 1PL5A 5E79H 3JSVC 2I8DA 3L74J 3L75E 3W67A 2MKVA 5KKZC 2WSCJ 1J1EB 3H1JJ 2V7QH 1BCCJ 2K3RA 1ZW0A 1L0LK 3A3YB 1L0NE 3V6IA 2D2CB 3L75D 2JDIH 1OX3A 2B88A 3I56P 2JO1A 3AEFC 3M9HA 2WT7B 2FYUK 3V2QA 1M56D 3HE5B
chains in the Genus database with same CATH topology
1J1EC 1JMMA 1M7LA 1T2KC 1LT9A 5CCGA 1JNMA 1SFCC 3HTKA 1Z56A 1SP4A 5AVQB 3M9QA 5KJ7A 1LWUA 4C7NB 3CI9A 3TNUA 2C9NY 1FBMA 2JEEA 4AYCA 3IR9A 1JY2N 1JTHA 1GTWA 4WY4D 1NU1K 3HE4B 2FKWB 2Q3IA 2HPCB 2E43A 3RK3B 1LTGC 3MTUE 2OYIA 1LT9C 4N3YB 2FYZA 3P32A 2P2UA 3KDPB 2WPQA 1H88A 3G3ZA 1G1JA 1GDTA 3KPEA 2WZ7A 3VMYA 2XKMA 1URQB 3RK2D 1JY3N 1AFOA 1ZR4A 4Y99B 1EQ7A 1PFIA 1JY2O 2O1KA 4GT1A 3RK3C 4DOJA 3NTNA 2NPSA 3BATA 4IFFA 5AW0B 2KLVA 1CI6B 5KLVK 5CHXA 4IFDK 4EOTA 3II6A 3VP8A 1HTLC 3L35A 3M0AA 3HD7B 4Y99C 1NO4A 1MV8A 3T97A 1JY3O 3TSIA 1NTKK 2KP8A 1E5WA 3MIWA 1GU5A 2FFDB 2YKPA 5APVA 5AVYB 2FFDA 3C9IA 1JO5A 1FZAA 2IPPA 3VOPA 3MGNA 2BASA 2N1TD 5APTA 3U59A 1URQD 5AW9B 4LC1A 3HD7C 2GUSA 3EQ2A 2XV5A 3EFGA 4WY4B 5CCHD 2N9BA 4JF7A 2FFDC 2IFNA 2WSFH 2LKMA 1N7SB 1X8YA 1L4AD 2CPSA 2O01H 3V5BA 2ZFCA 4GIFA 4HH2A 5AVWB 1SFCA 3LIEA 2WPSA 5APYA 1WT6A 2OYHA 1FJKA 5APXA 1J2JB 4OH8B 3RK2B 1X79B 1YTZT 1HJBA 2QM8A 1JOCA 1NWQA 1HBWA 1ZLLA 4WY4C 2YO2A 2WT7A 2FXMA 3KQGA 2H8PD 4GKGA 2KOGA 1KZUB 1QL1A 2WSEH 1A02F 3HE5A 3B5ND 5AVSB 3BRTB 3CL3D 2P67A 3VYIA 5APUA 1ZN5A 2J58A 2OYHC 1IJDB 4C7RA 3OA7A 3P8CE 4C7NA 3KYQA 3SWYA 5AW8B 1H89A 2MJZA 2WTYA 3PP5A 1G1IA 1IK9A 2YKOA 1FZCB 1VPCA 3M9BA 3HE4A 3TYYA 3RL0D 2HPCA 2XNXA 1M1JB 2J59M 1N7SD 2Z4EA 3OAKA 2YNYA 2A45I 5BVZA 1NOHA 2I1KA 2VRSA 2C0WA 2R5DA 5APSA 1FZFA 2N1TB 4AUWA 1NTZK 2N1TA 4LLHA 4N6JA 2P1JA 1A02J 2YKQA 4W7YA 1LTJB 1URQA 1NKZB 1CSBA 1HWTC 1LTJA 1NAFA 5AVVB 1XTCC 1T8ZA 2Q9IA 1N73B 1HUCA 1FZCC 1HH0A 2HODB 1M1JC 1IFIA 2WITA 1L4AB 1GL2B 2HODA 1ZV8A 1FDMA 3N7NA 2H7HA 1NTMK 1FU1A 1CI6A 4XA4A 1MUUA 2HFED 3VP9A 2N1TC 3O8ZA 5AW3B 1URQC 5AVTB 3P7KA 1GZLA 3VN0A 1FZEA 1LTJC 1RF0A 3HD7A 3L36A 5CCHC 1VDFA 1SQBK 5AVUB 1SVFA 5CCGD 2M3BA 3BASA 5CJ4A 2W6BA 2JJLA 4I2LC 5KJ7D 3B5NB 1IFJA 1L4AC 1NKNA 2PP6A 1T3UA 1J1DB 2KSJA 3NMDA 5AVRB 1KFNA 1QL2A 1GW4A 1GD2E 3HUSB 4C46A 1RF0C 1OWAA 1KFMA 1X9VA 3TK1A 5APQA 5AW7B 4WY4A 4ZKPA 3B8EB 1G2CB 1LTSC 3RL0B 3L37A 4W7ZA 2XU6A 4WB4A 3B5NC 1GL2D 3P8MC 1OXZA 1YYCA 4I1LA 1N7SA 3BRVB 2Z5HA 1CZQA 1N7LA 1ZR2A 1RF1B 4JYCA 4RESB 4DZOA 3VMXA 2W27A 5AVZB 1KQLA 3E1IA 2KYVA 1HVVA 1HGVA 2A45H 1LGHB 2M8RA 1RE3A 2NPSD 4WBAA 4W80A 1S9KE 2A45G 1FZGA 3RL0C 1SQPK 1SQQK 1IFDA 1N7SC 3M06A 4XE5B 1KILD 1W2EA 1LTIC 2WPRA 2C9LY 1RE4A 1DEBA 2WWWA 3RK2C 3LW5H 4KHXA 1S9KD 1RE3C 5AW1B 5CMZA 3V2PA 5KTBA 2Q7CA 1LT9B 5BU5A 1SQXK 1IC2A 2Z5IA 3HTKB 1FZCA 3V4QA 1JUNA 3M0DC 3U1CA 1LWUB 5AW6B 2GUVA 1M1JA 2IFMA 2WSCH 3R2PA 1LTTC 3TNUB 3P8CD 1RE4C 1JTHB 2R3CA 1MZ9A 2I1JA 2HLOA 3HRNA 1MFZA 1H8AA 2PAJA 4JYBA 1IFNA 1JY2P 2OYIB 4I6MC 3VMZA 1FOSF 1SQVK 5CJ0A 1IO4A 5CCGC 1YTZI 3MUDA 5CCHA 1T2KD 1N73A 1AQ5A 1SFCD 2L5GB 3UIAA 5KJ7C 1LWUC 1XTGB 1L4AA 1GL2A 5AW5B 2CPBA 4M3LA 3U1AA 3A2AA 1GK4A 3NXSA 1JY3P 1FOSE 2HG5D 2OYIC 3MD0A 4EIJA 2NPSB 1NHLA 5AW4B 2KB7P 1GK6A 1JCCA 1N73C 2IX7C 3OJAB 3WMM0 2HYNA 3A7OA 3GHGB 1GL2C 3L4FA 3N4XA 3V2RA 4AQRD 3B5NA 5AVXB 3GHGA 2R32A 1KILB 5APWA 1T3JA 3I5CA 3IFMA 1GU4A 1KILA 5AW2B 3A5TA 3NFQA 1L0NK 3SWFA 1FZBA 2YMYA 2P7JA 2E42A 3HUSA 2XZRA 2XDJA 3RK3D 2NPSC 4B86A 4N78E 2ZXEB 1CW5A 3H6PA 2YO3A 4O9BA 2GM4A 1G2CA 1SLQA 3GHGC 2H43A 1LTAC 1J1DC 1IFMA 2C0XA 4ZKUA 3V2NA 1JCDA 1KILC 2W6AA 2R5BA 2Q5UA 3H32B 1RF1A 4IFMA 3H32A 4N78D 3HUSC 1N86A 3LIDA 2QM7A 1GW3A 1NH4A 1J1EB 2POHA 5BU8B 1FAVA 1SFCB 2O1JA 1N2DC 1L0LK 1LTBC 3M0DA 3A3YB 2OYHB 3M91A 1HGZA 3BVHA 1RF1C 3V4WA 3M9HA 1DH3A 3HD7D 2WT7B 2FYUK 3V2QA 3CLQA 3VTPC 1DX7A 1FJPA 1RY3A 4HYTB 4LGDE 1WRGA 3HE5B 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF7 A;  5CCG C;  5CCH A;  1N7S B;  5CCG A;  1L4A D;  1SFC D;  3B5N B;  5KJ7 D;  1L4A C;  1SFC C;  5KJ7 C;  2PP6 A;  1XTG B;  1L4A A;  1GL2 A;  1SFC A;  5KJ7 A;  4OH8 B;  3RK2 B;  1JTH A;  4WY4 D;  4WY4 C;  2HG5 D;  3RK3 B;  2NPS B;  1NHL A;  4WY4 A;  2H8P D;  2KOG A;  3RL0 B;  4W7Z A;  3B5N D;  3B5N C;  1GL2 D;  1GL2 C;  1N7S A;  3B5N A;  2WZ7 A;  1KIL B;  1T3J A;  3P8C E;  3KYQ A;  1URQ B;  3RK2 D;  1KIL A;  3PP5 A;  2YMY A;  1HVV A;  2M8R A;  2XDJ A;  3RK3 D;  2NPS D;  3RK3 C;  2NPS C;  4N78 E;  4W80 A;  3RL0 D;  2NPS A;  3RL0 C;  1N7S D;  1N7S C;  1KIL D;  2N1T B;  1KIL C;  2N1T A;  3HD7 B;  3RK2 C;  4W7Y A;  1URQ A;  3TSI A;  3HTK B;  3M0D C;  1L4A B;  1GL2 B;  1SFC B;  3VOP A;  2N1T D;  2HFE D;  2N1T C;  1JTH B;  1URQ D;  1URQ C;  3HD7 D;  3HD7 C;  4WY4 B;  5CCH D;  3HD7 A;  5CCH C;  4LGD E;  5CCG D; 
#chains in the Genus database with same CATH topology
 4PV1 D;  3WU2 E;  3BCC E;  1T2K C;  1LT9 A;  5CCG A;  1JNM A;  1SFC C;  3SFE C;  5KJ7 A;  4BRY B;  4BRY A;  4AYC A;  2RN0 A;  3IR9 A;  1JY2 N;  3BCC D;  3HE4 B;  3CCJ P;  3L73 E;  1L0L E;  3KDP B;  2WPQ A;  1H88 A;  3G3Z A;  3AEA C;  2FYU E;  4OGQ D;  1VQ8 P;  2XKM A;  3F5H A;  4DT0 A;  1URQ B;  3L73 D;  1L0L D;  2IBZ I;  1LT1 A;  1IFP A;  3RK3 C;  4DOJ A;  1EDI A;  3BAT A;  4R4L A;  4IFF A;  5AW0 B;  4PJ0 E;  3AE5 C;  2DW3 A;  1CI6 B;  5KLV K;  5CHX A;  1S5L E;  1Q2N A;  2LR2 A;  1ZP0 C;  2KNC B;  3II6 A;  3L35 A;  1EXJ A;  4Y99 C;  1NO4 A;  3PHL A;  2V7Q J;  1JY3 O;  1OZH A;  3TSI A;  2QIW A;  3TGU G;  3MIW A;  1GU5 A;  4YXW H;  1JO5 A;  2A06 G;  2IPP A;  3VOP A;  2K37 A;  3CXH I;  1OW7 A;  5APT A;  3D6Z A;  1IZN B;  1NTZ J;  3L72 E;  5KLV E;  3L71 D;  2IFN A;  2WSF H;  1X8Y A;  1L4A D;  1PV3 A;  2ZFC A;  4GIF A;  1SFC A;  2K9Y A;  2IZ1 A;  2OYH A;  2QSI A;  1S4X A;  3L72 D;  5KLV D;  1KIL E;  1JOC A;  1EDK A;  2KOG A;  3H1I J;  2WSE H;  1QL1 A;  2RH0 A;  1A02 F;  4DJG A;  1AVY A;  3CL3 D;  5KAI H;  2P67 A;  3PLN A;  3IF4 A;  4OGQ C;  2IBZ G;  3OA7 A;  3CC2 P;  1H89 A;  4UB6 E;  4JBZ A;  4EYY Q;  3PP5 A;  4H0L D;  5TIS H;  2JWA A;  2HPC A;  2XNX A;  2KSE A;  2J59 M;  2Z4E A;  2YNY A;  2A45 I;  1NTM G;  5BVZ A;  2ZT9 B;  2R5D A;  5APS A;  2N1T B;  1OW6 A;  4D6T G;  1EZV G;  1S1C X;  3FXE A;  2N1T A;  4WWI A;  1A02 J;  1QX8 A;  1NAF A;  3CCU P;  5AVV B;  1T8Z A;  1FZC C;  1HH0 A;  4U3F J;  2B9B A;  3N7N A;  1FU1 A;  3SFD C;  1KYO I;  5AVT B;  1GZL A;  3VN0 A;  2WSF J;  3L36 A;  3MUD C;  1M90 Q;  5AVU B;  2WMM A;  3WU2 H;  5CJ4 A;  3S4R A;  3AE1 C;  1L4A C;  1RHZ B;  3Q5R A;  3Q5S A;  2Q3E A;  3G4S P;  1PIX A;  1RF0 C;  2WSE J;  1VF5 B;  3TK1 A;  3CCE P;  1ZME C;  1JM0 A;  1PP9 G;  1LTS C;  3RL0 B;  2XU6 A;  5DJT B;  2OGU A;  5GTI E;  4I1L A;  1N7S A;  1EC5 A;  2Z5H A;  1CZQ A;  3VMX A;  1P84 D;  1KQG B;  3JCU E;  3L70 G;  1S9K E;  2A45 G;  4H0L C;  1SQP K;  4PJ0 H;  4HKZ H;  1SQQ K;  2FXP A;  1IFD A;  4NPF X;  3H1H E;  3L75 J;  1BE3 E;  2KS1 A;  1DEB A;  1BSH A;  2WWW A;  1AQT A;  3LW5 H;  4OVN F;  2E5Y A;  4KHX A;  1S9K D;  4JPZ B;  3V2P A;  2Q7C A;  2FYN C;  1FZC A;  2JR8 A;  3D71 A;  5AW6 B;  3R4Y A;  1BE3 D;  5CBN A;  1LTT C;  1KB9 D;  2E75 B;  3K5B A;  1S72 P;  1LJ2 A;  3TGU D;  3CC7 P;  2HLO A;  1SQP E;  3C8V A;  1L2P A;  1IFN A;  1SQQ E;  2A06 D;  3MUD A;  1N73 A;  3UIA A;  1LWU C;  1KD1 Q;  4MN4 C;  1L4A A;  1AA0 A;  2CPB A;  3G71 P;  2D2C D;  3U1A A;  1SQQ D;  3L73 J;  1L0N G;  1L0L J;  4I7Z B;  1NTK G;  1VQ6 P;  1FOS E;  2OYI C;  2KB7 P;  1GK6 A;  3EWK A;  2HYN A;  2OTK E;  3BCC G;  5AVX B;  2R32 A;  1KC8 Q;  3SWK A;  1KIL B;  4H44 B;  3I5C A;  5L8R J;  4UB6 H;  1KIL A;  3E7K A;  1FZB A;  2E42 A;  3HUS A;  2XZR A;  4B86 A;  2IBZ D;  1USE A;  2ZXE B;  1UIX A;  4CPG A;  2YO3 A;  3Q3D A;  1G2C A;  1HF9 A;  2C0X A;  1IFM A;  3LW5 J;  3H25 A;  2FYU G;  3H32 B;  1RF1 A;  4HB1 A;  3H32 A;  1S5L X;  1N86 A;  1NTM D;  2QM7 A;  1S2E A;  4K35 A;  3CWB G;  3L71 J;  2W90 A;  4D6T D;  3CXH E;  5BU8 B;  1TU3 F;  2ZAE B;  1N2D C;  3KZI H;  1LTB C;  1GMJ A;  2BCC E;  2KI7 B;  3VTP C;  1DX7 A;  1KQF B;  2OAR A;  1J1E C;  1M7L A;  2XND H;  3MP7 B;  1LWU A;  2BCC D;  2QJK B;  2D2C C;  1PGQ A;  2QEX P;  2JEE A;  1AVO A;  1JTH A;  1GTW A;  1YJ9 P;  2FKW B;  1LTG C;  2OYI A;  1P84 H;  1LT9 C;  2FYZ A;  3P32 A;  3AEB C;  3AE3 C;  3L72 G;  5KLV G;  2R44 A;  5KLI C;  3KPE A;  2WZ7 A;  1BSN A;  1PP9 D;  1W5C E;  3JCU H;  3GF3 A;  1VQ5 P;  4XFJ A;  1M57 D;  3ITK A;  5B66 E;  2AXT E;  2E74 D;  3H1L E;  1YI2 P;  4EOT A;  2L91 A;  3CCR P;  3VP8 A;  3M0A A;  3HD7 B;  1KB9 H;  3T97 A;  2OTJ P;  1NTK K;  2KZI A;  1E5W A;  3ZDM A;  2IYP A;  1QVF O;  2FFD B;  2PGD A;  3GMA A;  3H1L D;  5AVY B;  2FFD A;  3C9I A;  4K3A A;  4U7J A;  1KYO E;  1QGK B;  2J5U A;  2ZT9 D;  2N1T D;  1FE6 A;  4WY4 B;  3EFG A;  1IK7 A;  2OYO A;  1KYO D;  3Q5P A;  2LKM A;  2CPS A;  2O01 H;  1R5S A;  5AVW B;  3QWO C;  1FJK A;  1NTK E;  3RK2 B;  1YTZ T;  3H1K E;  1HBW A;  3VMA A;  1ZOY C;  2WT7 A;  2FXM A;  4GKG A;  3HE5 A;  1L0N D;  1PPJ E;  1OIP A;  4GOF A;  5AVS B;  1NTK D;  2Q6Q A;  2K9J B;  1ZN5 A;  2J58 A;  2OYH C;  3H1K D;  3P8C E;  3KYQ A;  3SSU A;  1VF5 D;  3M9B A;  3HE4 A;  3TYY A;  3RL0 D;  1LP1 B;  5KAF H;  1N7S D;  3OAK A;  2W8Z A;  2E74 C;  2YXQ B;  3TGU J;  1FZF A;  4AUW A;  1DIP A;  3CCL P;  4N6J A;  2P1J A;  2YKQ A;  1URQ A;  3CWB E;  1CSB A;  3S1K A;  3PRJ A;  4ASW A;  2FYU D;  1IFI A;  1GL2 B;  1ZV8 A;  4YTP C;  2H7H A;  4XA4 A;  1CI6 A;  2ZT9 C;  3CWB D;  2N1T C;  5AW3 B;  3H1H G;  2KNC A;  1KV4 A;  1BE3 G;  1VQ7 P;  2O01 N;  2O01 J;  3CCM P;  2JJL A;  2ZXX A;  1IFJ A;  1NKN A;  3O6Q B;  1J1D B;  3NMD A;  5AVR B;  2AXC A;  1KFN A;  2E75 D;  1M1K Q;  1KFM A;  1USD A;  5KKZ B;  1X9V A;  5APQ A;  5AW7 B;  1SQP G;  3B8E B;  5H2F E;  2N9Y B;  1SQQ G;  4NPD A;  4W7Z A;  4PV1 C;  2LXC B;  4L74 A;  1H0T B;  1H0T A;  1ZR2 A;  4RES B;  2W27 A;  1NTM J;  1HGV A;  2H88 C;  3GLM A;  2A45 H;  1VF5 C;  4D6T J;  4IOI H;  4W80 A;  2QRX A;  3ABV C;  1FZG A;  3RL0 C;  3FWN A;  1N7S C;  3CD6 P;  1KIL D;  4H44 D;  2C9L Y;  1RE4 A;  2B87 B;  3KHU A;  2JWD A;  2E76 B;  1SQX K;  1IC2 A;  3HTK B;  1JUN A;  3AEE C;  4PD4 I;  3U1C A;  4KJM A;  1KYO H;  3GG2 A;  2IFM A;  3QH9 A;  3TNU B;  1FDI A;  1MKM A;  1AJY A;  2Y9Z A;  3CX5 I;  3IAO A;  1MZ9 A;  2ZVO B;  3EFF K;  4I6M C;  1K05 A;  1SQV K;  5CJ0 A;  1NAY A;  1NVO A;  3RGU A;  5TJH A;  2E5T A;  4H13 B;  2E75 C;  1PP9 J;  4UB8 E;  1GK4 A;  1SQX E;  2QJP C;  1PGO A;  1JY3 P;  2G3A A;  3MD0 A;  3CCQ P;  4EIJ A;  2BCC G;  2NPS B;  1BGY E;  1JCC A;  1N73 C;  2IX7 C;  3OJA B;  3AEG C;  2KIK A;  5CBO A;  3A7O A;  2YIU B;  3V2R A;  3L70 J;  3IFM A;  1X22 A;  1SQV E;  5AW2 B;  1VQ4 P;  3A5T A;  3SWF A;  2YMY A;  1FS0 E;  3L74 E;  1U7M A;  3H6P A;  1X0T A;  2QG4 A;  1SQV D;  2H43 A;  4IL6 X;  1LTA C;  4ZKU A;  1KIL C;  4H44 C;  2GA1 A;  1OVV A;  2Q5U A;  4U3F G;  4IFM A;  3HUS C;  3LID A;  4GOE A;  1GW3 A;  1PGJ A;  1Q90 D;  2POH A;  2QJY B;  1FAV A;  2O1J A;  2V4H A;  3M91 A;  2ZJS E;  1S5L H;  4EDF A;  3BVH A;  1Q81 Q;  2WPV B;  1RF1 C;  1Y9B A;  3H1L G;  3HD7 D;  1YIT P;  3CLQ A;  1L0N J;  3H1H D;  4RKU J;  1NTK J;  1OFC X;  5C39 A;  1Z56 A;  5AVQ B;  4C7N B;  3CI9 A;  2M3E A;  1FBM A;  2P10 A;  3BCC J;  4WY4 D;  3C1L A;  3MTU E;  4TT3 H;  4N3Y B;  2P2U A;  1GDT A;  1RQV A;  4A7P A;  5E79 E;  2QJK C;  1SQP D;  3RK2 D;  1JY3 N;  1AFO A;  1SQB G;  1EQ7 A;  1YQ4 C;  2SPZ A;  3AE6 C;  1VQ9 P;  1JY2 O;  2O1K A;  3H1K G;  4NPE A;  2FYU J;  2KLV A;  1PPJ G;  4IFD K;  3CWB J;  1YQ3 C;  1HTL C;  1MV8 A;  3FXD A;  1UII A;  3D6Y A;  2YKP A;  3G9R A;  5APV A;  1QEX A;  1R5L A;  1FZA A;  2W83 C;  2LXB A;  3IN6 A;  3U59 A;  1URQ D;  2Y0C A;  5AW9 B;  4LC1 A;  3HD7 C;  2GUS A;  3EQ2 A;  5CCH D;  2FFD C;  2FY8 A;  4HH2 A;  1RQU A;  3LIE A;  1WT6 A;  4UB8 H;  5APX A;  1T6A A;  1VQM P;  3L72 J;  5KLV J;  3AE8 C;  2QM8 A;  1NWQ A;  4WY4 C;  3CXH D;  2YO2 A;  3KQG A;  1MFT A;  2M0B A;  1SS1 A;  3CMA P;  1N8R Q;  2IZ0 A;  1BDC A;  5APU A;  2PFX A;  2RMZ A;  3MZW B;  4RJT A;  1IJD B;  4C7R A;  3SWY A;  3FWL A;  5AW8 B;  2MJZ A;  1G1I A;  3I55 P;  2YKO A;  1VPC A;  4WVZ A;  1M1J B;  3PTZ A;  5GTI H;  2VRS A;  4U3F E;  1M8O B;  1EXI A;  1S3J A;  2M5A B;  3OW2 O;  1YJW P;  4LLH A;  2G8Y A;  2WSS H;  4W7Y A;  1LTJ B;  4PD4 E;  1LTJ A;  2CK3 H;  4IL6 E;  4R4M A;  3CX5 E;  4U3F D;  2K88 A;  2WIT A;  1W2B O;  1FDM A;  1QLE D;  1HJ0 A;  2PRR A;  4BXL A;  2BEZ F;  2HFE D;  2QE7 H;  4PD4 D;  3O8Z A;  3GF7 A;  1URQ C;  1K04 A;  3CX5 D;  2UWJ E;  3HD7 A;  5CCH C;  1VDF A;  1SQB K;  2E76 D;  1SVF A;  2W6B A;  3B5N B;  5KAI E;  2PP6 A;  3RL0 g;  1T3U A;  2KSJ A;  1P84 I;  3A0B E;  1QL2 A;  4HJG H;  1GD2 E;  1OVU A;  4C46 A;  3AE2 C;  1R8E A;  4WY4 A;  2FXO A;  3AE9 C;  3F89 A;  1VQK P;  3G6E P;  1YYC A;  3BRV B;  4ZNC A;  1KMI Z;  4H13 D;  4DZO A;  1SQB E;  4BWN A;  3A0H E;  2IYO A;  5AVZ B;  3E1I A;  2KYV A;  1HVV A;  4QMA A;  4GDO A;  1SQX G;  2M8R A;  3AEC C;  2KXP B;  1RE3 A;  2NPS D;  4WBA A;  3Q2Y A;  2Y0D A;  1KB9 I;  5DJU B;  2ZYG A;  1BGY G;  3M06 A;  1NJI Q;  4XE5 B;  1SQB D;  2WQY C;  2K9J A;  1NU1 G;  2FBW C;  1SQV G;  5AW1 B;  2AEJ A;  5CMZ A;  1PPJ D;  5KTB A;  1FDO A;  1LT9 B;  1LNQ A;  2Z5I A;  3L74 G;  3H1H J;  3M0D C;  5KLI B;  1BE3 J;  2GUV A;  1LP1 A;  3P8C D;  1RE4 C;  3H1J G;  2R3C A;  2I1J A;  1BCC G;  1KQS O;  1MFZ A;  4JYB A;  2PAJ A;  2NRG A;  3VMZ A;  1FOS F;  1AV1 A;  2E76 C;  1YHQ P;  1IO4 A;  5CCH A;  3CXH H;  1AQ5 A;  1GL2 A;  2QA4 P;  5AW5 B;  1EDL A;  4EI2 A;  1SQP J;  4DCK A;  1SQQ J;  3A2A A;  2AEF A;  3CCS P;  3WUU A;  5AW4 B;  3AED C;  5K5G B;  3GHG B;  3L4F A;  3N4X A;  4AQR D;  1OMI A;  3GHG A;  3O6Q A;  5APW A;  4H13 C;  1T3J A;  1GU4 A;  3PJS K;  1EZV I;  1JB0 J;  3FGA D;  2NPS C;  3CC4 P;  4N78 E;  1VQP P;  4O9B A;  3WUV A;  2IDB A;  3L71 E;  2YIU C;  2BEQ D;  2JP3 A;  3V2N A;  2W6A A;  2R5B A;  2OQQ A;  2H89 C;  4N78 D;  2K1A A;  3S9O A;  4PD4 H;  1NH4 A;  4IL6 H;  1KOR A;  3GW6 A;  2Y9Y A;  1U57 A;  3CX5 H;  1SFC B;  3M0D A;  2OYH B;  5B66 H;  1HGZ A;  2AXT H;  4KT0 J;  3V4W A;  1DH3 A;  1FJP A;  1RY3 A;  4HYT B;  4LGD E;  1WRG A;  4RO0 A;  1JMM A;  2B87 A;  4Y28 J;  2QJY C;  3HTK A;  1SP4 A;  2E74 B;  1NTZ G;  3A0B H;  3M9Q A;  2BCC J;  3TNU A;  2C9N Y;  3USS A;  2KLU A;  1NU1 K;  2Q3I A;  2HPC B;  2E43 A;  3RK3 B;  1K8A Q;  1G1J A;  1K9M Q;  3VMY A;  3W68 A;  1OW8 A;  3B4S A;  3H1I G;  3A0H H;  1ZR4 A;  1E79 H;  4Y99 B;  3TF5 A;  1PFI A;  3JC2 2;  1Y8A A;  2HR3 A;  4GT1 A;  2W6J H;  3NTN A;  3PH0 A;  2NPS A;  3B71 A;  3KZI E;  1SQX D;  1NU1 E;  2RKL A;  1Q86 Q;  4I7Z C;  1BGY D;  3E1R A;  1NGM B;  2KP8 A;  1ZRT E;  4L76 A;  4PV1 B;  3H1L J;  1NU1 D;  1PZQ A;  1VQN P;  3H1J E;  3MGN A;  2BAS A;  1BCC E;  1OVR A;  1QVG O;  3CME P;  3L74 D;  1ZRT D;  4JQ0 D;  2XV5 A;  2N9B A;  4JF7 A;  1P84 E;  3H1J D;  5GTH E;  1N7S B;  3CPW O;  1BCC D;  3V5B A;  1PGP A;  4OGQ B;  2WPS A;  5APY A;  2Y0E A;  1J2J B;  4OH8 B;  1X79 B;  3RBX A;  1HJB A;  4ASV A;  1ZLL A;  2Q1K A;  5B5E E;  2ZYA A;  2H8P D;  2YMK A;  1DD4 A;  1KZU B;  3B5N D;  1SQB J;  3BRT B;  2JKV A;  3VYI A;  4L73 A;  2KS1 B;  3H1K J;  3AE7 C;  4C7N A;  2ITA A;  1KB9 E;  2WTY A;  3TGU E;  1IK9 A;  1FZC B;  2A06 E;  5H2F H;  1NOH A;  2KUB A;  2P58 A;  2I1K A;  2AEM A;  2C0W A;  2O3J A;  2QJP B;  1NTZ K;  2KZJ A;  2ZYD A;  3Q1M A;  1NKZ B;  1HWT C;  1Q82 Q;  1XTC C;  2Q9I A;  1N73 B;  1HUC A;  3L75 G;  2HOD B;  1M1J C;  1L4A B;  2HOD A;  4GOD A;  1NTM K;  1MUU A;  2NZ2 A;  3VP9 A;  3RBZ A;  3P7K A;  1FZE A;  1LTJ C;  1RF0 A;  3CCV P;  5CCG D;  2M3B A;  3BAS A;  4I2L C;  1D7M A;  1NTZ E;  5KJ7 D;  2IBZ E;  4YPC A;  3TDK A;  1GW4 A;  3HUS B;  2R3S A;  1OWA A;  1JMB A;  1NTZ D;  4ZKP A;  4H0L B;  1NTM E;  4YXD C;  1G2C B;  3L73 G;  3L37 A;  5KAF E;  1L0L G;  1VL2 A;  4WB4 A;  1Y47 A;  3B5N C;  5EFW B;  1GL2 D;  3P8M C;  1OXZ A;  4D6T E;  1EZV E;  3H1I E;  1N7L A;  1RF1 B;  4JYC A;  1DD3 A;  3KXD A;  1KQL A;  2OTL P;  2YXR B;  4L75 A;  1LGH B;  1K73 Q;  2ZVN B;  2FYN B;  1EZV D;  1DEE G;  3H1I D;  1W2E A;  1Q7Y Q;  1ZXG A;  1LTI C;  2WPR A;  3RK2 C;  3MHV A;  1RE3 C;  2QVA A;  5BU5 A;  1YJN P;  1KTM A;  3V4Q A;  3FX0 A;  1LWU B;  1M1J A;  2WSC H;  3R2P A;  2B89 A;  3L71 G;  1JTH B;  1BDD A;  2M5A A;  3HRN A;  1H8A A;  1PP9 E;  1JY2 P;  2OYI B;  5M1B A;  1WMK A;  2KK7 A;  3AE4 C;  5CCG C;  1YTZ I;  1EDJ A;  1U7J A;  5GTH H;  1T2K D;  1SFC D;  2L5G B;  1JEK A;  5KJ7 C;  1XTG B;  1VQO P;  4OWF A;  4M3L A;  1FC2 C;  4TLF A;  3L70 E;  3NXS A;  1YBK A;  3D70 A;  1NYH A;  3WUT A;  2HG5 D;  1NHL A;  5B5E H;  3WMM 0;  3RK3 E;  1KN7 A;  1GL2 C;  1SQX J;  3B5N A;  3L70 D;  3T97 B;  1RH5 B;  1BGY J;  3NFQ A;  1L0N K;  2P7J A;  2WVR A;  1VQL P;  4ZMD A;  2XDJ A;  3RK3 D;  5TIS E;  4Z1M H;  1CW5 A;  1NU1 J;  2GM4 A;  1SLQ A;  1SQV J;  3GHG C;  1J1D C;  1YIJ P;  1JCD A;  1PL5 A;  5E79 H;  3JSV C;  2I8D A;  3L74 J;  3L75 E;  3W67 A;  2MKV A;  5KKZ C;  2WSC J;  1J1E B;  3H1J J;  2V7Q H;  1BCC J;  2K3R A;  1ZW0 A;  1L0L K;  3A3Y B;  1L0N E;  3V6I A;  2D2C B;  3L75 D;  2JDI H;  1OX3 A;  2B88 A;  3I56 P;  2JO1 A;  3AEF C;  3M9H A;  2WT7 B;  2FYU K;  3V2Q A;  1M56 D;  3HE5 B; 
#chains in the Genus database with same CATH homology
 1J1E C;  1JMM A;  1M7L A;  1T2K C;  1LT9 A;  5CCG A;  1JNM A;  1SFC C;  3HTK A;  1Z56 A;  1SP4 A;  5AVQ B;  3M9Q A;  5KJ7 A;  1LWU A;  4C7N B;  3CI9 A;  3TNU A;  2C9N Y;  1FBM A;  2JEE A;  4AYC A;  3IR9 A;  1JY2 N;  1JTH A;  1GTW A;  4WY4 D;  1NU1 K;  3HE4 B;  2FKW B;  2Q3I A;  2HPC B;  2E43 A;  3RK3 B;  1LTG C;  3MTU E;  2OYI A;  1LT9 C;  4N3Y B;  2FYZ A;  3P32 A;  2P2U A;  3KDP B;  2WPQ A;  1H88 A;  3G3Z A;  1G1J A;  1GDT A;  3KPE A;  2WZ7 A;  3VMY A;  2XKM A;  1URQ B;  3RK2 D;  1JY3 N;  1AFO A;  1ZR4 A;  4Y99 B;  1EQ7 A;  1PFI A;  1JY2 O;  2O1K A;  4GT1 A;  3RK3 C;  4DOJ A;  3NTN A;  2NPS A;  3BAT A;  4IFF A;  5AW0 B;  2KLV A;  1CI6 B;  5KLV K;  5CHX A;  4IFD K;  4EOT A;  3II6 A;  3VP8 A;  1HTL C;  3L35 A;  3M0A A;  3HD7 B;  4Y99 C;  1NO4 A;  1MV8 A;  3T97 A;  1JY3 O;  3TSI A;  1NTK K;  2KP8 A;  1E5W A;  3MIW A;  1GU5 A;  2FFD B;  2YKP A;  5APV A;  5AVY B;  2FFD A;  3C9I A;  1JO5 A;  1FZA A;  2IPP A;  3VOP A;  3MGN A;  2BAS A;  2N1T D;  5APT A;  3U59 A;  1URQ D;  5AW9 B;  4LC1 A;  3HD7 C;  2GUS A;  3EQ2 A;  2XV5 A;  3EFG A;  4WY4 B;  5CCH D;  2N9B A;  4JF7 A;  2FFD C;  2IFN A;  2WSF H;  2LKM A;  1N7S B;  1X8Y A;  1L4A D;  2CPS A;  2O01 H;  3V5B A;  2ZFC A;  4GIF A;  4HH2 A;  5AVW B;  1SFC A;  3LIE A;  2WPS A;  5APY A;  1WT6 A;  2OYH A;  1FJK A;  5APX A;  1J2J B;  4OH8 B;  3RK2 B;  1X79 B;  1YTZ T;  1HJB A;  2QM8 A;  1JOC A;  1NWQ A;  1HBW A;  1ZLL A;  4WY4 C;  2YO2 A;  2WT7 A;  2FXM A;  3KQG A;  2H8P D;  4GKG A;  2KOG A;  1KZU B;  1QL1 A;  2WSE H;  1A02 F;  3HE5 A;  3B5N D;  5AVS B;  3BRT B;  3CL3 D;  2P67 A;  3VYI A;  5APU A;  1ZN5 A;  2J58 A;  2OYH C;  1IJD B;  4C7R A;  3OA7 A;  3P8C E;  4C7N A;  3KYQ A;  3SWY A;  5AW8 B;  1H89 A;  2MJZ A;  2WTY A;  3PP5 A;  1G1I A;  1IK9 A;  2YKO A;  1FZC B;  1VPC A;  3M9B A;  3HE4 A;  3TYY A;  3RL0 D;  2HPC A;  2XNX A;  1M1J B;  2J59 M;  1N7S D;  2Z4E A;  3OAK A;  2YNY A;  2A45 I;  5BVZ A;  1NOH A;  2I1K A;  2VRS A;  2C0W A;  2R5D A;  5APS A;  1FZF A;  2N1T B;  4AUW A;  1NTZ K;  2N1T A;  4LLH A;  4N6J A;  2P1J A;  1A02 J;  2YKQ A;  4W7Y A;  1LTJ B;  1URQ A;  1NKZ B;  1CSB A;  1HWT C;  1LTJ A;  1NAF A;  5AVV B;  1XTC C;  1T8Z A;  2Q9I A;  1N73 B;  1HUC A;  1FZC C;  1HH0 A;  2HOD B;  1M1J C;  1IFI A;  2WIT A;  1L4A B;  1GL2 B;  2HOD A;  1ZV8 A;  1FDM A;  3N7N A;  2H7H A;  1NTM K;  1FU1 A;  1CI6 A;  4XA4 A;  1MUU A;  2HFE D;  3VP9 A;  2N1T C;  3O8Z A;  5AW3 B;  1URQ C;  5AVT B;  3P7K A;  1GZL A;  3VN0 A;  1FZE A;  1LTJ C;  1RF0 A;  3HD7 A;  3L36 A;  5CCH C;  1VDF A;  1SQB K;  5AVU B;  1SVF A;  5CCG D;  2M3B A;  3BAS A;  5CJ4 A;  2W6B A;  2JJL A;  4I2L C;  5KJ7 D;  3B5N B;  1IFJ A;  1L4A C;  1NKN A;  2PP6 A;  1T3U A;  1J1D B;  2KSJ A;  3NMD A;  5AVR B;  1KFN A;  1QL2 A;  1GW4 A;  1GD2 E;  3HUS B;  4C46 A;  1RF0 C;  1OWA A;  1KFM A;  1X9V A;  3TK1 A;  5APQ A;  5AW7 B;  4WY4 A;  4ZKP A;  3B8E B;  1G2C B;  1LTS C;  3RL0 B;  3L37 A;  4W7Z A;  2XU6 A;  4WB4 A;  3B5N C;  1GL2 D;  3P8M C;  1OXZ A;  1YYC A;  4I1L A;  1N7S A;  3BRV B;  2Z5H A;  1CZQ A;  1N7L A;  1ZR2 A;  1RF1 B;  4JYC A;  4RES B;  4DZO A;  3VMX A;  2W27 A;  5AVZ B;  1KQL A;  3E1I A;  2KYV A;  1HVV A;  1HGV A;  2A45 H;  1LGH B;  2M8R A;  1RE3 A;  2NPS D;  4WBA A;  4W80 A;  1S9K E;  2A45 G;  1FZG A;  3RL0 C;  1SQP K;  1SQQ K;  1IFD A;  1N7S C;  3M06 A;  4XE5 B;  1KIL D;  1W2E A;  1LTI C;  2WPR A;  2C9L Y;  1RE4 A;  1DEB A;  2WWW A;  3RK2 C;  3LW5 H;  4KHX A;  1S9K D;  1RE3 C;  5AW1 B;  5CMZ A;  3V2P A;  5KTB A;  2Q7C A;  1LT9 B;  5BU5 A;  1SQX K;  1IC2 A;  2Z5I A;  3HTK B;  1FZC A;  3V4Q A;  1JUN A;  3M0D C;  3U1C A;  1LWU B;  5AW6 B;  2GUV A;  1M1J A;  2IFM A;  2WSC H;  3R2P A;  1LTT C;  3TNU B;  3P8C D;  1RE4 C;  1JTH B;  2R3C A;  1MZ9 A;  2I1J A;  2HLO A;  3HRN A;  1MFZ A;  1H8A A;  2PAJ A;  4JYB A;  1IFN A;  1JY2 P;  2OYI B;  4I6M C;  3VMZ A;  1FOS F;  1SQV K;  5CJ0 A;  1IO4 A;  5CCG C;  1YTZ I;  3MUD A;  5CCH A;  1T2K D;  1N73 A;  1AQ5 A;  1SFC D;  2L5G B;  3UIA A;  5KJ7 C;  1LWU C;  1XTG B;  1L4A A;  1GL2 A;  5AW5 B;  2CPB A;  4M3L A;  3U1A A;  3A2A A;  1GK4 A;  3NXS A;  1JY3 P;  1FOS E;  2HG5 D;  2OYI C;  3MD0 A;  4EIJ A;  2NPS B;  1NHL A;  5AW4 B;  2KB7 P;  1GK6 A;  1JCC A;  1N73 C;  2IX7 C;  3OJA B;  3WMM 0;  2HYN A;  3A7O A;  3GHG B;  1GL2 C;  3L4F A;  3N4X A;  3V2R A;  4AQR D;  3B5N A;  5AVX B;  3GHG A;  2R32 A;  1KIL B;  5APW A;  1T3J A;  3I5C A;  3IFM A;  1GU4 A;  1KIL A;  5AW2 B;  3A5T A;  3NFQ A;  1L0N K;  3SWF A;  1FZB A;  2YMY A;  2P7J A;  2E42 A;  3HUS A;  2XZR A;  2XDJ A;  3RK3 D;  2NPS C;  4B86 A;  4N78 E;  2ZXE B;  1CW5 A;  3H6P A;  2YO3 A;  4O9B A;  2GM4 A;  1G2C A;  1SLQ A;  3GHG C;  2H43 A;  1LTA C;  1J1D C;  1IFM A;  2C0X A;  4ZKU A;  3V2N A;  1JCD A;  1KIL C;  2W6A A;  2R5B A;  2Q5U A;  3H32 B;  1RF1 A;  4IFM A;  3H32 A;  4N78 D;  3HUS C;  1N86 A;  3LID A;  2QM7 A;  1GW3 A;  1NH4 A;  1J1E B;  2POH A;  5BU8 B;  1FAV A;  1SFC B;  2O1J A;  1N2D C;  1L0L K;  1LTB C;  3M0D A;  3A3Y B;  2OYH B;  3M91 A;  1HGZ A;  3BVH A;  1RF1 C;  3V4W A;  3M9H A;  1DH3 A;  3HD7 D;  2WT7 B;  2FYU K;  3V2Q A;  3CLQ A;  3VTP C;  1DX7 A;  1FJP A;  1RY3 A;  4HYT B;  4LGD E;  1WRG A;  3HE5 B;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...