2N1WA

Solution structure of human sumo2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human SUMO
rcsb
molecule keywords Small ubiquitin-related modifier 2
molecule tags Structural genomics
source organism Homo sapiens
total genus 18
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n1wA00
2MP2A 2KFKA 4M8MA 3K9OB 4RM9A 3MJWA 4NY0A 5L83A 1Y8RC 2FNJB 4RMAA 5CX3A 4WJNA 2FCMA 2JUOA 3P2BA 1TTNA 5CHVC 4EZLA 4HVBA 3O65B 2FCNA 2FCQA 2M17A 2PPHA 4KDIC 4GOCA 2IO2B 1LQBA 2C7MB 4N9F4 2FCSA 4F8CB 2DYMA 3L17A 3X23A 3MHSD 4ANXA 4ICUA 1E7VA 2NS5A 3GOEA 4M0WB 1E5WA 4TQ0A 3A9JB 4ZRJA 3QK0A 4TV3A 3IFWB 1BT0A 1OQYA 5BO4B 3DOWA 4OVVA 4F7ZA 3RCZA 2KFJA 4B95A 2IYDB 2KQ7A 3VUXA 2MBEA 4FADA 1WZ0A 4IUMB 2BPSA 5DPSA 3ZRFA 4NQLB 2BKFA 4IM0A 4W9IA 1J19A 1E90A 1GC7A 3RULA 4E74A 3NS8A 2M1MA 3PRZA 4G3XB 3PVLA 4ASWC 1Q5WB 3PLVA 3VTUA 2KTRA 4ZRIA 2MA9B 2YLMA 1K8RB 4FULA 4ZRKA 4FA6A 4GXBA 4ZYNA 3A9JA 1KOTA 2L7RA 1J0GA 3EFUA 3A9KA 1GG3A 4II2B 4HXDA 4KVGB 1XQQA 2KWVB 3VH3B 4X57B 4W9DA 2L3ZA 3A1QB 3JYUA 1UH6A 2R2OA 5AZFA 2OJRA 2D11A 4W9HA 1XD3B 1WFYA 2PJHA 3RT3B 1OEYA 1ZW7A 3M63B 2K39A 1V9JA 1UBIA 2LGDA 3VTWA 4MSMB 4K7SA 2GBJA 2BGFA 4IW0A 4BKGA 4DXAB 3OJ3A 2NR2A 2NPTA 2K6QA 3N3KB 2KWCA 3NHEB 1J8CA 4II3B 1IYFA 2O6VB 1V6EA 4IWPA 1YJ1A 2J0JA 4EEWA 3PV1A 4KV2A 4BKSA 4W9EA 2N9PC 2AEHA 3RUIB 2J7QB 1GNUA 2KJ6A 2KXJA 2K8BA 3KUDB 1IPGA 2HJ8A 3QHTA 1ISNA 4GMVA 2V1YA 2V4LA 3A1QA 3QA8A 3R7QA 2KDFB 2VRRB 3H6NA 4K7UA 2AL6A 2C60A 2WX0A 3BY4B 4HPLB 3HHMA 5DPTA 4GGQA 2MWSB 4ANVA 1V2YA 3A4RA 2M4NA 4IWQA 4ANWA 4MM3A 2DX5B 3L13A 1WH3A 2XK5B 1V49A 3GZNI 4NAWA 4W9CA 1WI0A 2DZKA 4HDOA 2L76A 2XEWA 2MP2B 5EDSA 2O6VA 5G2NA 5D7GA 4KZCA 2ZNVC 1WR1A 1EF5A 2KFKB 2W9NA 4ANUA 1QZEA 2JWZA 2YVCA 1SIFA 2J0MA 1WM2A 2KWUB 1KM7A 2MBQA 2LASA 3R3MA 2CHXA 3V60A 3VTVA 1WGGA 3ZKJC 3PRMB 3CMMB 4MJSA 1WXSA 3ZNGC 1V81A 5J18A 1RFAA 3DBSA 3H7SA 4W9KA 3VDZA 1CMXB 3B0AA 3R66C 1R4MI 3ML9A 3APFA 2DAJA 3L0WB 2UWQA 2QHOA 2V3SA 2N9EB 3ZTDA 3KW5B 4JQWC 4LDTD 1G6JA 3QQ8B 4WQOB 1WE6A 3AU4A 4EUTA 2LWPA 3PHXB 3SHQA 4G50A 3VUYA 1LXDA 3QCAA 1SGHA 2EMSA 1V5TA 3K9PB 4IM2A 2D07B 2KVRA 3DVGX 2Y5BB 5CHFA 1WXMA 3VXWA 1OTRB 1VCBA 2GBKA 4LDTB 3H1UA 4HJKA 3W1SC 3WIMA 4HWIB 1WX8A 2NBUA 4A3OA 2IY1B 2LRWA 2LVQA 1E8ZA 1WMHB 3I3TB 3PPAA 4MELA 3VUWA 2L05A 1T0YA 3NOBA 4BBNC 5D2MB 3PRPB 1UBQA 2JRIB 3KYDD 4NJ7A 4P7IA 2BKRB 1D3ZA 2KTRB 1UD7A 4TUUA 5CHWA 3W1SA 2ZVNA 1UELA 4TQ1A 2LUEA 2N4FA 4EZJA 1OGWA 2MBBB 1S1QB 2ZCBA 5DPWA 2LXAA 4I6NB 4EFOA 3A9KB 2N9XA 2WDTB 1HE8A 1R4NI 2KKCA 3UF8A 3C0RB 2KJRA 2EKEC 2L8JA 1TGZB 3DVGY 3BINA 4IG7B 3T8MA 4JIOU 1SE9A 1WJ6A 1WYWB 1H8CA 2C7NB 2M8SA 4FBJB 1WMHA 3JSVB 1V80A 1VD2A 2MQJA 3IG3A 4IWOA 4M8NA 3L08A 4GSWA 1WE7A 4IM3A 1E8XA 1YIWA 4LJOB 1WR6E 4XX5A 4BKSD 3ZNHB 2NPTB 4WAAA 3X0WA 3N32A 1RRBA 2G4DB 2KN5A 4GB9A 2K25A 3R7RA 2G45B 2N7EA 3WAPA 1C1YB 3UIPB 3WA0A 2K8CA 4DWFA 1P0RA 2D10A 4FHKA 2RSUA 4GDKA 5IAAC 2CKHB 4ICVA 3SDLC 3ML8A 4J6IA 1TZ1A 2DYOA 3LDZE 1ZGUB 1RAXA 3LJ3A 4DHZE 2KTFA 4CHKA 4JGHB 3M62B 3QARA 3JSVA 3AI5A 1P1AA 3S2AA 1GC6A 2O6VD 4W9GA 2MRPA 2CS4A 3IVFA 1YX6B 3AXCA 2DHZA 2DZMA 2FIFA 5AZHA 1WZ3A 3PLUA 4NAWB 3PHWB 2C5LC 2N1WA 2UYZB 4GDLA 4WJOA 2DZIA 2FIDA 2K6DB 1WXAA 2GBRA 1UZXB 4KSKC 5LXIB 4GU2A 3ECIA 1XT9B 2PE6B 4WWNA 3DBRI 2KMAA 2JF5A 3L54A 2Z59B 3PTFC 2HD5B 2ZNVB 1FXTB 1KJTA 2LZ6A 2FAZA 4HK2A 4K81A 4MJSB 4W9JA 5KHOA 3HK0A 3TCAA 3V61A 3ZW3A 4FJZA 2ZCCA 4LJPB 2ZEQA 2JXXA 2JVCA 3QC8B 4WWPA 3UINB 3WANA 4BKTA 1WGYA 3DVNU 5JHAA 2MCNB 2K1FA 1UGMA 4G0NB 3UIOB 4F1SA 1A5RA 3Q3JA 2GOWA 2GBMA 3HM3A 2C9WB 3UQBA 1WX7A 2L00B 5LXHA 3VH4B 2HE7A 3ALBA 1E8WA 3ZUNA 2MW5A 3D32A 3EC8A 1NDDA 4GIVA 3WAMA 4K7WA 2WWZA 3DBLI 5D6JB 4KIKA 4MGYE 1LM8B 3IBEA 4KZ0A 3HIZA 3TJPA 2D2QA 4HDQA 4MEMA 4B6WA 4EZKA 4CYEA 3WAOA 5TR5A 2IZVB 3JW0X 5JZEB 5JHBA 3KUCB 4RM8A 3AU5A 3JVZX 3M95A 4AJYB 5DPRA 3KYCD 3PREA 2KHWB 2IO1B 3DCGA 3L10B 4A20A 2PEAA 2R2QA 4NPNA 3VVWB 2KDBA 4BVUC 3NZSA 3DQVA 3APCA 5KHQA 1IP9A 2JZZA 1YQBA 4ZDVA 3VAWA 3PGEA 2ZZPB 2G3QB 1P3QU 2NBVB 3KVFB 2BF8B 2CR5A 2IO3B 2DYBA 5C23A 3ZDMC 4CO7A 4E3CA 2CHWA 1EUVB 1WGDA 1WY8A 2RGFA 5DCNA 2LGXA 3QAQA 2ZPYA 1GJZA 2WX1A 3AULA 2J0KA 2K8HA 2REXA 5AEKB 3CF6E 1RLFA 2LD9A 2KLCA 1X1MA 2MLBA 1TBEA 5AZGA 4OVUA 3RYTA 4PS7A 2BYFA 4JLCA 1H4RA 2KX3A 2N1VA 1YX5B 4E71A 2GBNA 3PZDA 2KZRA 2KMCA 2Z0EB 2IY0B 1WJ4A 4HCNB 3ONSA 3ZLZA 3U8ZA 2BWES 2IO0B 4GDKB 2N7DA 3B08A 4WWOA 3TBLD 4DDID 5G55A 4MH0E 2KX0A 1WRDB 1WX9A 2AYOB 4KSLC 1MG8A 5CTRC 2GMIC 4AP4C 2AWTA 2KJHB 2KDIA 2KD0A 5JH5C 3ZVVA 3A33B 1S3SG 3RZWC 4B9KA 2ZPNA 2EMTA 2O2VA 1JRUA 4LCDE 3V6EB 2KLGA 2JZ3B 2A4ZA 3L16A 1KLVA 1GUAB 1AARA 4GDLB 4PYZA 4WJQA 2AL3A 4AOFA 1Z2MA 4XZ4A 5E6PA 1P9DU 3OJ4B 3DBHI 3CSFA 4FN2A 1WXVA 3NZUA 4AWJA 4WJPA 3N30A 4BFRA 2D3GA 2WYQA 3RD2A 4K1RB 1I42A 2KK8A 1WJUA 2Z0DB 2ZJDA 3CSTA 3ZIMA 2BYEA 4MGKE 4NQKE 1V86A 2B3AA 1NBFC 2LVOA 3ZRCA 1WM3A 4BOZB 1Q1OA 4DHJD 3V62A 4MGZE 3OAWA 2L0TA 3UQAA 4URKA 1EF1A 1L7YA 2OOBB 4PYUA 2JY6A 4NNJB 5E6OA 4HLEA 2KC2A 3A4SC 3ENEA 5D94A 4DHJB 2MSED 3H7PB 1YD8U 2XBBC 3TMPB 1OEYJ 3PS6A 4IC7B 1Q0WB 3VQIA 3QIJA 3NY5A 2LVPA 5HKHA 1ZKHA 2A5UA 3EHVA 4GN1A 2KANA 4KDLB 5IA7A 3ZNZB 1NI2A 2L0FA 3QWZB 4FLHA 1P98A 3V6CB 1C3TA 4KIKB 3U30A 4BOSC 3IHPC 2C7HA 3ZNID 1L2NA 2ZVOA 4DBGA 3HM6X 4DDGD 2KQSA 1WIAA 3T9LA 3WALA 2KDEB 4AJWA 2ASQA 5C1ZA 4FJYA 2G4SA 2I1JA 3H7PA 3PSEB 2JPHA 3VHTC 3SD5A 3DPDA 3ZO5B 2IBIB 2LGYA 2RPQA 4AUQC 3W1YA 2M0XA 4FHJA 2NCNA 2DAFA 3QJZA 3RZFA 1WGRA 2LRUA 4I6PA 5J17A 1M94A 2MX2A 4W9LA 2LXCA 2JT4B 3ZTCA 4HCPB 3SU8X 3APDA 2LJ5A 5E6NA 3B1LX 5J2RA 1Z5SB 4YL8A 3VFKA 3DVNV 3U7DA 1WF9A 2RD0A 2MBHA 4EKUA 3OLMD 3EECA 2JRHA 4JL9A 4MGIE 5GMVA 3H9DA 3KUZA 4TKNA 2RR9A 4I6LB 4W9FA 4A3PA 3KH0A 4HPMB 2I1KA 4PS3A 1E7UA 1WJNA 4DHZB 5L95C 1F9JA 4MDKE 3TIXA 1I35A 3M3JA 2FUHB 3PT2B 1EO6A 1WGHA 1U4AA 4FJVB 4G11A 5LLIA 1V5OA 1LFDA 2DZJA 1PQSA 2MBOA 3ZDTA 4MSQB 2BYVE 2KOXA 1E8YA 4XC2A 2HTHA 5FR6A 4DK5A 2PE9A 2NBWB 3UGBB 2KC1A 3Q3FA 4PS8A 4EOYA 3DDCB 2NVUI 2KO3A 2DENB 2O2VB 3QX1A 4NJ6A 2XK5A 3TL5A 2KNBA 2CU1A 3MTNB 4BBNF 2BWFA 2LI5A 2CHZA
chains in the Genus database with same CATH superfamily
2H89B 3B2GA 2KFKA 3R2IA 4M8MA 3K9OB 3GB1A 2D3AA 3Q14C 1Y8RC 2FCMA 3P2BA 4HVBA 4XE0A 2J42A 2FCSA 1HXYD 2DYMA 1AYFA 4LNOA 2NS5A 5JXVA 2BS4B 2Y5PA 4TV3A 3BVZA 4M02A 1BT0A 1E7PB 4OVVA 5IKCM 4B95A 1WZ0A 4YSYB 1QILA 5DPSA 3ZRFA 2WNMA 1E90A 2TSSA 2MJ3A 2Y3AA 4ASWC 3AEBB 2WDQB 1K8RB 4ZRKA 1ROEA 4GXBA 2INPE 1I4PA 5IOIA 4C7YA 3EFUA 1GG3A 2ACZB 4HXDA 1JWSD 4KVGB 1QT9A 1XQQA 2GLSA 1EWCA 2WXOA 1K52A 4CQNA 1FCCC 3RT3B 2N0SB 4K7SA 4MSMB 3N3KB 2KWCA 3NHEB 1J8CA 4USAA 2O6VB 3P4RB 4RGNA 2RMMA 2J0JA 3AE3B 2VH1A 2K8BA 4Q2JA 4K7UA 4KGRA 3NJTA 4US8A 4GGQA 2MWSB 1V2YA 4IWQA 1FD6A 1SF0A 2DX5B 1TY0A 3KWVA 3VRBB 3GZNI 2PTLA 2O6VA 5G2NA 4ANUA 2ZNVC 2FBWB 1SIFA 2KWUB 1KM7A 1JW9D 2BB5A 5IN7A 1EU4A 2CHXA 3PRMB 3VR8B 5J18A 4W9KA 4LNFA 3VDZA 3BZDB 2UWQA 2QHOA 2N9EB 3KW5B 4JQWC 1G6JA 3AU4A 3PHXB 4G50A 4IM2A 2D07B 2WXNA 3PZ8A 3VXWA 1VCBA 1HQRD 1Q10A 1WX8A 2NBUA 4A3OA 2IY1B 3VUWA 5IO9A 3PRPB 1KTKA 1T0SC 2JRIB 4TSSA 1UD7A 3RNGC 1UELA 4TQ1A 2LUEA 1VJKA 1OGWA 3PO0A 2ZCBA 5DPWA 4EFOA 1D5ZC 2WDTB 2KKCA 3C8YA 3DVGY 3BINA 3T8MA 1WJ6A 4FBJB 4GLSC 3AMZA 1V80A 2MQJA 2PKOA 1WE7A 1E8XA 1YIWA 1PGXA 3Q8EA 1C9FA 2KN5A 4GB9A 2G45B 1XLOA 3AE8B 1C4AA 3BWUD 3WA0A 3FILB 1P0RA 2RSUA 4GDKA 4J6IA 3LDZE 4DHZE 2KTFA 1WGKA 4CHKA 3QARA 4K3BA 2WXIA 1GC6A 2MRPA 1L4ZB 1SB3C 2CS4A 1YX6B 2DHZA 1P7EA 4GDLA 1D4BA 1UZXB 4GU2A 3FILA 2RDBC 1C78A 2LUMA 4WWNA 4O1NA 3PTFC 1KJTA 4K81A 4MJSB 2ZEQA 2JXXA 3QC8B 5FK9C 1TKEA 2C9WB 3UQBA 1CJEA 2HE7A 1E8WA 2CJOA 1BXTA 2MW5A 3HVZA 3SFDB 5BMHA 1VZ8A 2LFIA 2IZVB 3JW0X 4RM8A 2ON8A 2WXHA 2DBYA 2OEDA 4AJYB 5DPRA 2KHWB 4BVUC 3DQVA 1R4NB 1L0XB 3MC8A 1IP9A 3RFZB 4KKIA 1MVKA 4E3CA 4ZHPA 2CHWA 3QAQA 2WX1A 3KWLA 1MHHE 5BYSA 1FNUA 1RLFA 3MJ5A 3AE5B 2MLBA 3N1XC 4OVUA 2WDVB 3MP9A 1KH0A 3AE4B 1DOYA 3Q3MC 2N1VA 4E71A 1TZOA 1N60A 2Z0EB 3U8ZA 4WWOA 4LNKA 4MH0E 3EUB2 1WRDB 2GMIC 4AP4C 2KJHB 1YJJA 4RF1A 3RZWC 2ZPNA 3V6EB 3L16A 3N1ZC 1GUAB 4A55A 1I4GA 1P9DU 3OJ4B 3DBHI 1SE3A 1K51A 2D3GA 3RD2A 2ZJDA 2BYEA 3NG0A 1JQ4A 4DHJD 1J7BA 4URKA 2JWUA 5E6OA 4HLEA 5D94A 4DHJB 4YT0B 3TMPB 1XCTL 5MPOA 1OEYJ 1NVID 1Q0WB 3VQIA 5HKHA 1T3QA 2KANA 2L52A 1KRHA 3IHPC 3B2FA 2I38A 4MACA 2V3PA 1ACCA 2KDEB 3VHTC 3SD5A 3DPDA 4NJCA 4DXGA 2LGYA 2AQ2B 3BYTB 4ZHOA 2JT4B 3APDA 3Q2AC 1Z5SB 4YL8A 3LYYA 2MHJA 1LGRA 3EECA 4W9FA 3KH0A 4OZBA 1F9JA 3PT2B 4G11A 1U4AA 2IGDA 1PUTA 5FR6A 2HTHA 3DDCB 1N62A 2O2VB 3WCQA 4NJ6A 3TL5A 1YOVB 2CU1A 2BWFA 2MP2A 3I5JC 2V9HA 4RM9A 3MJWA 3AECB 4RMAA 1V1OA 4EZLA 1TJEA 2FCQA 2M17A 2PPHA 4KDIC 4GOCA 2GRIA 2IO2B 2C7MB 1P7FA 2AQ1B 4F8CB 3X23A 3MHSD 4ANXA 4ICUA 4M0WB 4P1BC 1TS4A 1XLPA 1RWSA 3GE8C 3DOWA 2KFJA 2IYDB 3VUXA 4A8XC 2MBEA 2I2YA 1ZE3D 3NVZA 4IUMB 1T5XD 3RULA 4E74A 2X38A 4IDIA 3NRZA 2KYWA 3TUOA 3PLVA 4US9A 3ZGZA 3RMKC 2YLMA 3HRDD 4RCOA 2L7RA 4AQ7A 1JCKB 2KWVB 2K22A 4P1CC 2R2OA 2NTTA 1WFYA 4AS1A 1Y56A 2LGDA 3OJ3A 2NPTA 3NVYA 5H92C 1IYFA 1V6EA 1MPEA 4EEWA 3PV1A 2N9PC 2KXJA 1EM7A 1PGBA 1IPGA 2HJ8A 3H6NA 3U2SC 1V1PB 3BY4B 4C4VB 2MH7A 2M4NA 4MM3A 3AEEB 3RNAC 3L13A 1WH3A 1V49A 2L76A 2XEWA 4KZCA 2KFKB 3AE9B 2YVCA 5D3DA 2J0MA 4LK0M 3R3MA 1QF6A 3Q8CA 3ZKJC 5TSSA 1JWAD 1J7AA 1WXSA 3BYYB 4C4VA 1R4MI 3L0WB 3ZTDA 3LXFA 1ZP0B 4WQOB 1ESFA 2LWPA 1WSPA 3MC9A 3VUYA 5CHFA 2HTME 2GBKA 4YXDB 3UI3A 4HJKA 4HWIB 2BVCA 2QC8A 2LRWA 2LVQA 1WMHB 2L05A 3NOBA 1JROA 2KWDA 2OJWA 4NJ7A 2EELA 4RFBA 4TUUA 3W1SA 1I4HA 2ZVNA 3ZXRA 4KGTA 5HHDG 2N9XA 1HE8A 1FFVA 5AUKA 2RDGA 2KJRA 1TGZB 3C19A 1MG4A 1WYWB 2M8SA 1WMHA 3JSVB 3IG3A 3URYA 2WHIA 5T8IA 4ZYSA 2W55A 4IM3A 4XX5A 3ZNHB 1EWYC 3X0WA 3N32A 4C56C 1RRBA 2G4DB 2K25A 1CK1A 1PYWD 2N7EA 3UIPB 4DWFA 4FHKA 4WURA 1ZGUB 2PIAA 2LHDA 2QDFA 3M62B 3JSVA 2O6VD 2WU2B 2WDRB 3IVFA 2FIFA 3PHWB 2N1WA 4WJOA 2FIDA 2GBRA 4P16A 1TS3A 3DHIC 3DBRI 1SJHD 3L54A 1ZXIA 2BB6A 1FXTB 3AH7A 3WALA 1DGJA 3ZW3A 3HK0A 2ZCCA 4LJPB 3UINB 3WANA 1C4CA 3DVNU 1F1HA 4G0NB 2M19A 3Q3JA 2GOWA 1VDVA 4ZRPA 1OQRA 3ALBA 4QAYA 3ZUNA 3D32A 4KX6B 3EC8A 2J52A 4GIVA 3B9JA 2IGGA 4K7WA 4KIKA 2FUG1 4OZCA 3DHGC 3TJPA 3HIZA 2D2QA 4MEMA 4EZKA 4CYEA 3WAOA 1L4DB 1F0ZA 1MJDA 3AU5A 3IT4B 4N58A 1UWMA 3PREA 4JE3B 3DCGA 3L10B 3FAHA 2ZW1A 3NZSA 3EA6A 2G9HD 3SFEB 4NAMA 1ZPSA 5KHQA 1YQBA 2E6XA 1DOXA 3PGEA 2Z8LA 2ZZPB 4JX1C 4OHJA 2IO3B 5C23A 3TEZA 2DYBA 3AM9A 4A6QA 2IPKD 2RGFA 5DCNA 1XXGA 1GJZA 2QJLA 4REZA 1JWBD 2J0KA 2REXA 3U52E 3CF6E 3RNBC 4WIPA 2KLCA 1NYQA 5AZGA 3DBHB 3E9SA 2K0PA 1D6EC 3PZDA 2JU6X 1V8CA 2KMCA 1WJ4A 1NI3A 3ZLZA 4GDKB 2IO0B 5AUIA 4KSLC 5CTRC 3ZYYX 4LTUA 1HEZE 2EMTA 3RNFC 2WXJA 1JRUA 2KLGA 1YQ4B 4PYZA 1AARA 4GDLB 4WJQA 4XZ4A 1T0RC 2W3SA 3AN1A 2BBCA 3CSFA 4AWJA 1E9MA 4WJPA 4BFRA 2L32A 1UF0A 4MGKE 4NQKE 1V86A 1NBFC 5EE3A 3ZRCA 1WM3A 4BOZB 3V62A 2L0TA 1F2RC 4NNJB 3ENEA 3H7PB 1ZKHA 3EHVA 5IA7A 3DBLB 3ZNZB 2L0FA 3V6CB 1L6UA 3U30A 4BOSC 1C4PA 1FNWA 3ZNID 1NENB 5EE9A 2ZVOA 2D3BA 1FO4A 1K53A 2PW9A 4DBGA 4DDGD 1R7SA 1WIAA 4FJYA 2G4SA 2I1JA 3H7PA 3IAM1 2BS2B 1VLBA 3AEFB 1WGRA 2LRUA 1ET6A 1QOFA 5J17A 2MX2A 4W9LA 3ZTCA 4EE2A 3SU8X 2CJNA 2LJ5A 5E6NA 5J2RA 2GI9A 2V4IB 3VFKA 2BS3B 3U7DA 1WF9A 4KKJA 2SEBD 3TEYA 4ZRQA 4MGIE 3H9DA 3KUZA 2RR9A 4I6LB 1KFYB 2I1KA 1FCLA 1WJNA 1I35A 2WXLA 1WGHA 4FJVB 5LLIA 3T3OA 2KOXA 4XC2A 2LMCA 4LNNA 4DK5A 1FFUA 2KC1A 1WYGA 4EOYA 4FXCA 1SIJA 2KO3A 2QMTA 4BAXA 2XK5A 3ZJVA 3MTNB 1L7YA 2INDC 3L4PA 5IP4D 4S17A 4NY0A 5CX3A 1SSNA 2JUOA 2DNFA 2WQYB 3I57A 1LQBA 2VZKD 2DLBA 2N7JA 4K3CA 4WWMA 2J53A 4RGMA 3L17A 1E7VA 3GOEA 3OWEB 2VZKB 1D5XC 3P63A 3NS1A 4F7ZA 1ENFA 2ZW0A 2KQ7A 1M4VA 2NTSA 4FADA 2BPSA 2INCC 3Q8BA 3TEWA 2JX5A 5HG2A 1GC7A 3PRZA 2M1MA 3W5UB 3ZJTA 3PVLA 3VTUA 2BT6A 1C76A 2KTRA 1QOAA 4ZRIA 2MA9B 2NMQA 4MH8A 1KOTA 4ZYNA 4BZAA 3N1YC 3V3XA 3A9KA 4HROA 4X57B 4ACFA 1N5XA 4W9DA 3A1QB 3JYUA 1UH6A 2OJRA 1AWDA 4W9HA 2K39A 2XN9C 4DXAB 2K6QA 3P4SB 4II3B 2JSVX 4IWPA 2Y5CA 1YJ1A 1GPXA 4KV2A 4BKSA 1F52A 1SJED 2JZPA 1GNUA 4OW0A 4ARCA 3KUDB 2V4LA 3A1QA 4NZLB 2VRRB 2C60A 2LGSA 2WX0A 4HPLB 3HHMA 3A4RA 4ANWA 5E6JA 5BMIA 4NAWA 1WI0A 4HDOA 2MP2B 5D7GA 1WR1A 1EF5A 2W9NA 2JWZA 3VRAB 1WM2A 2PMVA 4KGSA 1KF6B 3V60A 3VTVA 3IT6B 1WGGA 1IBXB 3CMMB 5GXGB 2IJ0A 1V81A 1HA5A 1RFAA 4MT5A 3FC4A 4UDUC 3OG5A 3ZQ4A 3EGRA 2KN4A 1TKGA 5D3IB 1OQQA 4LDTD 4EUTA 1WE6A 3IXSA 1LXDA 3QCAA 2EMSA 2RPVA 5EE0A 3K9PB 3DVGX 1IGDA 1ZUD2 2KVRA 2Y5BB 1WXMA 1OTRB 4LDTB 1YNTE 4YTMB 3WIMA 1V97A 1UUPA 1E8ZA 4MELA 3PPAA 1IBXA 1T0YA 1DOIA 1WXQA 1UBQA 4P7IA 1D3ZA 2PVOD 5CHWA 2N4FA 1S1QB 4IKGA 1TS2A 2AQ3B 1R4NI 1XF5L 2BTEA 3R2TA 1GAQB 2BW2A 4JIOU 3BVGA 1H8CA 3Q8FA 4ZOHC 1VD2A 3DWGC 4IWOA 3L08A 3I63C 4GSWA 5HFYA 2NPTB 4WAAA 3AB5A 2M56B 3R7RA 4WH4A 4HEA1 1N61A 3WAPA 3AEAB 2D10A 1ZDXA 3SDLC 1YN4A 3ML8A 2MJDA 1GOZA 2LHEA 2QSDA 4RNAA 2V0GA 3AI5A 3S2AA 4W9GA 1QOGA 4MM3B 3GZNB 1L6VA 2WLBA 1WZ3A 3PLUA 3E56A 2UYZB 2INNE 2DZIA 5HI1A 1WXAA 4KSKC 3RI7C 5LXIB 2Q5WD 3ECIA 2PE6B 2LEKA 3I9V1 2KMAA 2JF5A 2LZ6A 5KHOA 4HK2A 1KLGD 4W9JA 2WXMA 3HUIA 4OZAA 1EU3A 1WGYA 2QILA 5JHAA 2MCNB 2K1FA 1UGMA 4F1SA 1A5RA 3R8BA 1SE2A 3HM3A 1WRIA 2B76B 4B0MA 5LXHA 4A9AA 3BVMA 3WAMA 2W54A 5D6JB 4MGYE 4KZ0A 2WXPA 2KACA 3M95A 2R61A 2HJ1A 2PEAA 4NPNA 4A20A 1CQVA 2KDBA 3T3NA 3V05A 2JZZA 4ZDVA 2YEPB 1P3QU 3HVDA 2NBVB 2BF8B 4CO7A 3ZDMC 2KAJA 1WY8A 2LGXA 4XYCA 3AULA 2N9KA 3KQ4A 5AEKB 2XNAC 4ITKA 2LD9A 3CIRB 3RYTA 2WXGA 4PS7A 2BYFA 1H4RA 2KX3A 2WXFA 1YX5B 2IDYA 2LGIA 1TY2A 1TIFA 1FRDA 4HCNB 3ONSA 1N5WA 1T0QC 1SE4A 4XWWA 2BWES 2K3UA 2KQ4X 3TBLD 4DDID 2PVGC 1MHXA 1FIQA 1WX9A 2AYOB 1MG8A 1PFDA 3O13A 4B9KA 1S3SG 4LCDE 2A4ZA 1KLVA 4AOFA 2AL3A 1Z2MA 5E6PA 1FEHA 3NZUA 3N30A 4N59A 1T6BX 4K1RB 3GS2A 1XLNA 3CSTA 3ZIMA 2Z0DB 2B3AA 2KVZA 5FKAC 3OAWA 1C79A 3AE7B 3NUHB 3UQAA 1EF1A 2OOBB 4RH6A 3A4SC 1YD8U 2XBBC 3PS6A 2QEJC 3QIJA 4FLHA 1C3TA 1F2RI 1HZ5A 4KIKB 1L2NA 1UGJA 3AE6B 2ASQA 3PSEB 4LNIA 2K9XA 3ZO5B 1STEA 1B1ZA 3P1MA 4L2YA 1GB4A 1CZPA 3QJZA 3RZFA 4HPPA 4HCPB 3U7ZA 5LNK1 2WXRA 1QQRA 2L83A 2MBHA 1UNSA 3OLMD 2JRHA 4M01A 4TKNA 5G5GA 4HKZE 4HPMB 2EKIA 1E7UA 4J3OD 5L95C 4MDKE 1L0YB 3MFGA 1QKZA 3Q3OC 1FRRA 4M00A 1LFDA 2DZJA 1MI0A 2MBOA 3ZDTA 4PT5A 2FE8A 1E8YA 4L23A 5EE1A 1NYRA 1ET9A 3DWMA 4DQOC 3QX1A 2DENB 4BBNF 2KNBA 1VZ7A 2WGSA 1XLQA 1I4RA 2YEPF 4YWGG 5L83A 2FNJB 3ZJUA 4WJNA 1TTNA 2JYEA 5CHVC 1JWUD 2GB1A 3O65B 2FCNA 1E6EB 1VR9A 3RNEC 4N9F4 1D5MC 3Q8AA 2E3TA 4B0EA 1E5WA 4XDCA 4TQ0A 3A9JB 4ZRJA 3QK0A 3IFWB 1OQYA 2LJIA 5BO4B 1TS5A 3Q6BA 3RCZA 4LLGM 4TMAB 2M0AA 1TYGB 4NQLB 2BKFA 4IM0A 4W9IA 1J19A 3NS8A 4G3XB 1TKYA 1Q5WB 1F77A 4FULA 4FA6A 3A9JA 1IUEA 1RFKA 3AE2B 1J0GA 4II2B 3VH3B 2L3ZA 3AEGB 2AX5A 3U4EG 2BYTA 4XGAB 1HZ6A 5AZFA 2D11A 1L0VB 1XD3B 2PJHA 1RM6C 1OEYA 1ZW7A 3M63B 1V9JA 1UBIA 3VTWA 4BKGA 2GBJA 2BGFA 4IW0A 5BYRA 2NR2A 3W9CB 3FKYA 4JWSC 4C00A 4N6EB 4H2AA 3AV8A 3H8HA 4HRSA 1QLBB 2JXTA 4W9EA 2D5GA 3NZ3A 2AEHA 3RUIB 2J7QB 2KJ6A 4GMVA 3QHTA 1ISNA 2V1YA 3QA8A 3R7QA 2KDFB 2AL6A 5DPTA 2PLPA 4ANVA 4WQMA 3N20C 2G1EA 1VRAB 4W9CA 2XK5B 2DZKA 4DXFA 5EDSA 3BK1A 3W5VB 1QZEA 2WS3B 1LO5D 2MBQA 2LASA 3GP7A 2BQQA 4MJSA 1RYJA 3ZNGC 3DBSA 3H7SA 1CMXB 3B0AA 1N63A 3R66C 3VR9B 3ML9A 3APFA 2DAJA 2V3SA 3QQ8B 2N9LA 1BMLC 3SHQA 4P6VF 4JWUC 1YN5A 1SGHA 1UWXA 1V5TA 2JQRB 1IGCA 1AW7A 4YSXB 3H1UA 3W1SC 3SEBA 3I3TB 2WU5B 4BBNC 5D2MB 5BYQA 3KYDD 2BKRB 2KTRB 1A70A 4YTNB 4EZJA 2MBBB 5C2TB 2LXAA 4I6NB 1FXAA 3A9KB 1NEKB 2CU3A 1QOBA 5G5HA 3UF8A 3C0RB 2EKEC 2L8JA 4IG7B 1SE9A 2OHFA 2C7NB 3N9YC 3ZXVA 5FR3A 4M8NA 2UU7A 2KT7A 3AEDB 4LJOB 4BKSD 1WR6E 1XO3A 2WXKA 3MC0B 1C1YB 2K8CA 5IAAC 2CKHB 4ICVA 4A90A 2W82A 4C80A 1TZ1A 2DYOA 3AE1B 1RAXA 3LJ3A 1BUIC 4JGHB 2JYTA 1WWTA 2V3NA 1P1AA 4IOIE 4D2KA 2HDEA 3J9CA 3AXCA 3NVWA 2DZMA 5AZHA 4RGTA 4NAWB 2C5LC 1SXTA 2K6DB 3RNCC 1XCQL 4XDDA 1XT9B 2D3CA 1FPYA 2Z59B 2HD5B 2ZNVB 2FAZA 3MHZA 1AN8A 2K5PA 3BIID 4R3DA 3TCAA 3V61A 4FJZA 1R4MB 3EFCA 4WWPA 2JVCA 4WAFA 1L5PA 4BKTA 4YTPB 1E0ZA 3UIOB 4RGOS 2GBMA 1FNVA 1WX7A 3IAS1 2L00B 3VH4B 1NDDA 1JRPA 2WWZA 3DBLI 3LB8C 3BK2A 1LM8B 3IBEA 1HTQA 4HDQA 4B6WA 5TR5A 1FXIA 5JZEB 1YQ3B 5JHBA 3KUCB 3ABVB 1JMLA 3JVZX 3W2DA 3SR6A 3KYCD 2IO1B 1I4XA 4PK1A 1B9RA 2R2QA 1YN3A 3VVWB 2KMMA 3APCA 2QCZA 3VAWA 1HTOA 2G3QB 3KVFB 1N6ZA 2ONQA 2CR5A 4L1BA 1EUVB 1WGDA 1J7CA 1JALA 1VZ6A 2ZPYA 2X8XX 2K8HA 5I4DA 2SAKA 1X1MA 1TBEA 1XEEA 4JLCA 3DHHC 2H88B 2GBNA 2KZRA 2IY0B 1KLUD 2N7DA 3B08A 1ZOYB 5G55A 3ETRA 1TT5B 2KX0A 1I7HA 2AWTA 2VH2A 2KDIA 2KD0A 4S0RA 5JH5C 3ZVVA 3A33B 2O2VA 2ICIA 1C77A 1PGAA 1JWMD 2JZ3B 2J4XA 1PDXA 2KDMA 3Q3NC 5C3JB 2DWQA 4FN2A 1WXVA 5H8YE 4XWTA 2WYQA 1I42A 3DBRB 2KK8A 1WJUA 1SEBD 2LVOA 1Q1OA 3NVVA 4MGZE 4HJGE 3KLSX 4HKQA 4PYUA 2JY6A 3P4PB 2KC2A 3P4QB 4M0WA 2MSED 3RPFC 4IC7B 4RF0A 3NY5A 2LVPA 1K50A 2A5UA 4GN1A 4KDLB 1I4QA 4OVZA 1NI2A 3QWZB 1P98A 1YJIA 2QIEB 2C7HA 3P42A 2W3RA 1FM0D 1ZXHA 3HM6X 1FMAD 2KQSA 2RDHA 4YSZB 3T9LA 4AJWA 5C1ZA 2JPHA 4JPSA 2IBIB 2RPQA 4AUQC 3W1YA 2M0XA 4FHJA 2NCNA 2DAFA 3TEXA 4I6PA 5BMGA 1M94A 2LXCA 2MJEA 3GE3C 1E10A 2WXQA 3B1LX 1GB1A 3DVNV 2RD0A 4EKUA 1OFFA 4JL9A 2L1AA 5GMVA 2WP9B 4A3PA 4PS3A 4DHZB 2MEKA 1YMHE 1MFWA 4C7ZA 3TIXA 3M3JA 2FUHB 2IGHA 1EO6A 3RN9C 1V5OA 3CWIA 1PQSA 4MSQB 1V1PA 2BYVE 1ZDVA 3TSSA 2PE9A 2NBWB 3UGBB 3Q69A 3Q3FA 4PS8A 4ARIA 1DYQA 2NVUI 1SBBB 3PZ7A 2LI5A 2CHZA
chains in the Genus database with same CATH topology
2MP2A 2KFKA 4M8MA 3K9OB 4RM9A 3MJWA 4NY0A 5L83A 1Y8RC 2FNJB 4RMAA 5CX3A 4WJNA 2FCMA 2JUOA 3P2BA 1TTNA 5CHVC 4EZLA 4HVBA 3O65B 2FCNA 2FCQA 2M17A 2PPHA 4KDIC 4GOCA 2IO2B 1LQBA 2C7MB 4N9F4 2FCSA 4F8CB 2DYMA 3L17A 3X23A 3MHSD 4ANXA 4ICUA 1E7VA 2NS5A 3GOEA 4M0WB 1E5WA 4TQ0A 3A9JB 4ZRJA 3QK0A 4TV3A 3IFWB 1BT0A 1OQYA 5BO4B 3DOWA 4OVVA 4F7ZA 3RCZA 2KFJA 4B95A 2IYDB 2KQ7A 3VUXA 2MBEA 4FADA 1WZ0A 4IUMB 2BPSA 5DPSA 3ZRFA 4NQLB 2BKFA 4IM0A 4W9IA 1J19A 1E90A 1GC7A 3RULA 4E74A 3NS8A 2M1MA 3PRZA 4G3XB 3PVLA 4ASWC 1Q5WB 3PLVA 3VTUA 2KTRA 4ZRIA 2MA9B 2YLMA 1K8RB 4FULA 4ZRKA 4FA6A 4GXBA 4ZYNA 3A9JA 1KOTA 2L7RA 1J0GA 3EFUA 3A9KA 1GG3A 4II2B 4HXDA 4KVGB 1XQQA 2KWVB 3VH3B 4X57B 4W9DA 2L3ZA 3A1QB 3JYUA 1UH6A 2R2OA 5AZFA 2OJRA 2D11A 4W9HA 1XD3B 1WFYA 2PJHA 3RT3B 1OEYA 1ZW7A 3M63B 2K39A 1V9JA 1UBIA 2LGDA 3VTWA 4MSMB 4K7SA 2GBJA 2BGFA 4IW0A 4BKGA 4DXAB 3OJ3A 2NR2A 2NPTA 2K6QA 3N3KB 2KWCA 3NHEB 1J8CA 4II3B 1IYFA 2O6VB 1V6EA 4IWPA 1YJ1A 2J0JA 4EEWA 3PV1A 4KV2A 4BKSA 4W9EA 2N9PC 2AEHA 3RUIB 2J7QB 1GNUA 2KJ6A 2KXJA 2K8BA 3KUDB 1IPGA 2HJ8A 3QHTA 1ISNA 4GMVA 2V1YA 2V4LA 3A1QA 3QA8A 3R7QA 2KDFB 2VRRB 3H6NA 4K7UA 2AL6A 2C60A 2WX0A 3BY4B 4HPLB 3HHMA 5DPTA 4GGQA 2MWSB 4ANVA 1V2YA 3A4RA 2M4NA 4IWQA 4ANWA 4MM3A 2DX5B 3L13A 1WH3A 2XK5B 1V49A 3GZNI 4NAWA 4W9CA 1WI0A 2DZKA 4HDOA 2L76A 2XEWA 2MP2B 5EDSA 2O6VA 5G2NA 5D7GA 4KZCA 2ZNVC 1WR1A 1EF5A 2KFKB 2W9NA 4ANUA 1QZEA 2JWZA 2YVCA 1SIFA 2J0MA 1WM2A 2KWUB 1KM7A 2MBQA 2LASA 3R3MA 2CHXA 3V60A 3VTVA 1WGGA 3ZKJC 3PRMB 3CMMB 4MJSA 1WXSA 3ZNGC 1V81A 5J18A 1RFAA 3DBSA 3H7SA 4W9KA 3VDZA 1CMXB 3B0AA 3R66C 1R4MI 3ML9A 3APFA 2DAJA 3L0WB 2UWQA 2QHOA 2V3SA 2N9EB 3ZTDA 3KW5B 4JQWC 4LDTD 1G6JA 3QQ8B 4WQOB 1WE6A 3AU4A 4EUTA 2LWPA 3PHXB 3SHQA 4G50A 3VUYA 1LXDA 3QCAA 1SGHA 2EMSA 1V5TA 3K9PB 4IM2A 2D07B 2KVRA 3DVGX 2Y5BB 5CHFA 1WXMA 3VXWA 1OTRB 1VCBA 2GBKA 4LDTB 3H1UA 4HJKA 3W1SC 3WIMA 4HWIB 1WX8A 2NBUA 4A3OA 2IY1B 2LRWA 2LVQA 1E8ZA 1WMHB 3I3TB 3PPAA 4MELA 3VUWA 2L05A 1T0YA 3NOBA 4BBNC 5D2MB 3PRPB 1UBQA 2JRIB 3KYDD 4NJ7A 4P7IA 2BKRB 1D3ZA 2KTRB 1UD7A 4TUUA 5CHWA 3W1SA 2ZVNA 1UELA 4TQ1A 2LUEA 2N4FA 4EZJA 1OGWA 2MBBB 1S1QB 2ZCBA 5DPWA 2LXAA 4I6NB 4EFOA 3A9KB 2N9XA 2WDTB 1HE8A 1R4NI 2KKCA 3UF8A 3C0RB 2KJRA 2EKEC 2L8JA 1TGZB 3DVGY 3BINA 4IG7B 3T8MA 4JIOU 1SE9A 1WJ6A 1WYWB 1H8CA 2C7NB 2M8SA 4FBJB 1WMHA 3JSVB 1V80A 1VD2A 2MQJA 3IG3A 4IWOA 4M8NA 3L08A 4GSWA 1WE7A 4IM3A 1E8XA 1YIWA 4LJOB 1WR6E 4XX5A 4BKSD 3ZNHB 2NPTB 4WAAA 3X0WA 3N32A 1RRBA 2G4DB 2KN5A 4GB9A 2K25A 3R7RA 2G45B 2N7EA 3WAPA 1C1YB 3UIPB 3WA0A 2K8CA 4DWFA 1P0RA 2D10A 4FHKA 2RSUA 4GDKA 5IAAC 2CKHB 4ICVA 3SDLC 3ML8A 4J6IA 1TZ1A 2DYOA 3LDZE 1ZGUB 1RAXA 3LJ3A 4DHZE 2KTFA 4CHKA 4JGHB 3M62B 3QARA 3JSVA 3AI5A 1P1AA 3S2AA 1GC6A 2O6VD 4W9GA 2MRPA 2CS4A 3IVFA 1YX6B 3AXCA 2DHZA 2DZMA 2FIFA 5AZHA 1WZ3A 3PLUA 4NAWB 3PHWB 2C5LC 2N1WA 2UYZB 4GDLA 4WJOA 2DZIA 2FIDA 2K6DB 1WXAA 2GBRA 1UZXB 4KSKC 5LXIB 4GU2A 3ECIA 1XT9B 2PE6B 4WWNA 3DBRI 2KMAA 2JF5A 3L54A 2Z59B 3PTFC 2HD5B 2ZNVB 1FXTB 1KJTA 2LZ6A 2FAZA 4HK2A 4K81A 4MJSB 4W9JA 5KHOA 3HK0A 3TCAA 3V61A 3ZW3A 4FJZA 2ZCCA 4LJPB 2ZEQA 2JXXA 2JVCA 3QC8B 4WWPA 3UINB 3WANA 4BKTA 1WGYA 3DVNU 5JHAA 2MCNB 2K1FA 1UGMA 4G0NB 3UIOB 4F1SA 1A5RA 3Q3JA 2GOWA 2GBMA 3HM3A 2C9WB 3UQBA 1WX7A 2L00B 5LXHA 3VH4B 2HE7A 3ALBA 1E8WA 3ZUNA 2MW5A 3D32A 3EC8A 1NDDA 4GIVA 3WAMA 4K7WA 2WWZA 3DBLI 5D6JB 4KIKA 4MGYE 1LM8B 3IBEA 4KZ0A 3HIZA 3TJPA 2D2QA 4HDQA 4MEMA 4B6WA 4EZKA 4CYEA 3WAOA 5TR5A 2IZVB 3JW0X 5JZEB 5JHBA 3KUCB 4RM8A 3AU5A 3JVZX 3M95A 4AJYB 5DPRA 3KYCD 3PREA 2KHWB 2IO1B 3DCGA 3L10B 4A20A 2PEAA 2R2QA 4NPNA 3VVWB 2KDBA 4BVUC 3NZSA 3DQVA 3APCA 5KHQA 1IP9A 2JZZA 1YQBA 4ZDVA 3VAWA 3PGEA 2ZZPB 2G3QB 1P3QU 2NBVB 3KVFB 2BF8B 2CR5A 2IO3B 2DYBA 5C23A 3ZDMC 4CO7A 4E3CA 2CHWA 1EUVB 1WGDA 1WY8A 2RGFA 5DCNA 2LGXA 3QAQA 2ZPYA 1GJZA 2WX1A 3AULA 2J0KA 2K8HA 2REXA 5AEKB 3CF6E 1RLFA 2LD9A 2KLCA 1X1MA 2MLBA 1TBEA 5AZGA 4OVUA 3RYTA 4PS7A 2BYFA 4JLCA 1H4RA 2KX3A 2N1VA 1YX5B 4E71A 2GBNA 3PZDA 2KZRA 2KMCA 2Z0EB 2IY0B 1WJ4A 4HCNB 3ONSA 3ZLZA 3U8ZA 2BWES 2IO0B 4GDKB 2N7DA 3B08A 4WWOA 3TBLD 4DDID 5G55A 4MH0E 2KX0A 1WRDB 1WX9A 2AYOB 4KSLC 1MG8A 5CTRC 2GMIC 4AP4C 2AWTA 2KJHB 2KDIA 2KD0A 5JH5C 3ZVVA 3A33B 1S3SG 3RZWC 4B9KA 2ZPNA 2EMTA 2O2VA 1JRUA 4LCDE 3V6EB 2KLGA 2JZ3B 2A4ZA 3L16A 1KLVA 1GUAB 1AARA 4GDLB 4PYZA 4WJQA 2AL3A 4AOFA 1Z2MA 4XZ4A 5E6PA 1P9DU 3OJ4B 3DBHI 3CSFA 4FN2A 1WXVA 3NZUA 4AWJA 4WJPA 3N30A 4BFRA 2D3GA 2WYQA 3RD2A 4K1RB 1I42A 2KK8A 1WJUA 2Z0DB 2ZJDA 3CSTA 3ZIMA 2BYEA 4MGKE 4NQKE 1V86A 2B3AA 1NBFC 2LVOA 3ZRCA 1WM3A 4BOZB 1Q1OA 4DHJD 3V62A 4MGZE 3OAWA 2L0TA 3UQAA 4URKA 1EF1A 1L7YA 2OOBB 4PYUA 2JY6A 4NNJB 5E6OA 4HLEA 2KC2A 3A4SC 3ENEA 5D94A 4DHJB 2MSED 3H7PB 1YD8U 2XBBC 3TMPB 1OEYJ 3PS6A 4IC7B 1Q0WB 3VQIA 3QIJA 3NY5A 2LVPA 5HKHA 1ZKHA 2A5UA 3EHVA 4GN1A 2KANA 4KDLB 5IA7A 3ZNZB 1NI2A 2L0FA 3QWZB 4FLHA 1P98A 3V6CB 1C3TA 4KIKB 3U30A 4BOSC 3IHPC 2C7HA 3ZNID 1L2NA 2ZVOA 4DBGA 3HM6X 4DDGD 2KQSA 1WIAA 3T9LA 3WALA 2KDEB 4AJWA 2ASQA 5C1ZA 4FJYA 2G4SA 2I1JA 3H7PA 3PSEB 2JPHA 3VHTC 3SD5A 3DPDA 3ZO5B 2IBIB 2LGYA 2RPQA 4AUQC 3W1YA 2M0XA 4FHJA 2NCNA 2DAFA 3QJZA 3RZFA 1WGRA 2LRUA 4I6PA 5J17A 1M94A 2MX2A 4W9LA 2LXCA 2JT4B 3ZTCA 4HCPB 3SU8X 3APDA 2LJ5A 5E6NA 3B1LX 5J2RA 1Z5SB 4YL8A 3VFKA 3DVNV 3U7DA 1WF9A 2RD0A 2MBHA 4EKUA 3OLMD 3EECA 2JRHA 4JL9A 4MGIE 5GMVA 3H9DA 3KUZA 4TKNA 2RR9A 4I6LB 4W9FA 4A3PA 3KH0A 4HPMB 2I1KA 4PS3A 1E7UA 1WJNA 4DHZB 5L95C 1F9JA 4MDKE 3TIXA 1I35A 3M3JA 2FUHB 3PT2B 1EO6A 1WGHA 1U4AA 4FJVB 4G11A 5LLIA 1V5OA 1LFDA 2DZJA 1PQSA 2MBOA 3ZDTA 4MSQB 2BYVE 2KOXA 1E8YA 4XC2A 2HTHA 5FR6A 4DK5A 2PE9A 2NBWB 3UGBB 2KC1A 3Q3FA 4PS8A 4EOYA 3DDCB 2NVUI 2KO3A 2DENB 2O2VB 3QX1A 4NJ6A 2XK5A 3TL5A 2KNBA 2CU1A 3MTNB 4BBNF 2BWFA 2LI5A 2CHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MP2 A;  2KFK A;  4M8M A;  3K9O B;  4RM9 A;  3MJW A;  4NY0 A;  5L83 A;  1Y8R C;  2FNJ B;  4RMA A;  5CX3 A;  4WJN A;  2FCM A;  2JUO A;  3P2B A;  1TTN A;  5CHV C;  4EZL A;  4HVB A;  3O65 B;  2FCN A;  2FCQ A;  2M17 A;  2PPH A;  4KDI C;  4GOC A;  2IO2 B;  1LQB A;  2C7M B;  4N9F 4;  2FCS A;  4F8C B;  2DYM A;  3L17 A;  3X23 A;  3MHS D;  4ANX A;  4ICU A;  1E7V A;  2NS5 A;  3GOE A;  4M0W B;  1E5W A;  4TQ0 A;  3A9J B;  4ZRJ A;  3QK0 A;  4TV3 A;  3IFW B;  1BT0 A;  1OQY A;  5BO4 B;  3DOW A;  4OVV A;  4F7Z A;  3RCZ A;  2KFJ A;  4B95 A;  2IYD B;  2KQ7 A;  3VUX A;  2MBE A;  4FAD A;  1WZ0 A;  4IUM B;  2BPS A;  5DPS A;  3ZRF A;  4NQL B;  2BKF A;  4IM0 A;  4W9I A;  1J19 A;  1E90 A;  1GC7 A;  3RUL A;  4E74 A;  3NS8 A;  2M1M A;  3PRZ A;  4G3X B;  3PVL A;  4ASW C;  1Q5W B;  3PLV A;  3VTU A;  2KTR A;  4ZRI A;  2MA9 B;  2YLM A;  1K8R B;  4FUL A;  4ZRK A;  4FA6 A;  4GXB A;  4ZYN A;  3A9J A;  1KOT A;  2L7R A;  1J0G A;  3EFU A;  3A9K A;  1GG3 A;  4II2 B;  4HXD A;  4KVG B;  1XQQ A;  2KWV B;  3VH3 B;  4X57 B;  4W9D A;  2L3Z A;  3A1Q B;  3JYU A;  1UH6 A;  2R2O A;  5AZF A;  2OJR A;  2D11 A;  4W9H A;  1XD3 B;  1WFY A;  2PJH A;  3RT3 B;  1OEY A;  1ZW7 A;  3M63 B;  2K39 A;  1V9J A;  1UBI A;  2LGD A;  3VTW A;  4MSM B;  4K7S A;  2GBJ A;  2BGF A;  4IW0 A;  4BKG A;  4DXA B;  3OJ3 A;  2NR2 A;  2NPT A;  2K6Q A;  3N3K B;  2KWC A;  3NHE B;  1J8C A;  4II3 B;  1IYF A;  2O6V B;  1V6E A;  4IWP A;  1YJ1 A;  2J0J A;  4EEW A;  3PV1 A;  4KV2 A;  4BKS A;  4W9E A;  2N9P C;  2AEH A;  3RUI B;  2J7Q B;  1GNU A;  2KJ6 A;  2KXJ A;  2K8B A;  3KUD B;  1IPG A;  2HJ8 A;  3QHT A;  1ISN A;  4GMV A;  2V1Y A;  2V4L A;  3A1Q A;  3QA8 A;  3R7Q A;  2KDF B;  2VRR B;  3H6N A;  4K7U A;  2AL6 A;  2C60 A;  2WX0 A;  3BY4 B;  4HPL B;  3HHM A;  5DPT A;  4GGQ A;  2MWS B;  4ANV A;  1V2Y A;  3A4R A;  2M4N A;  4IWQ A;  4ANW A;  4MM3 A;  2DX5 B;  3L13 A;  1WH3 A;  2XK5 B;  1V49 A;  3GZN I;  4NAW A;  4W9C A;  1WI0 A;  2DZK A;  4HDO A;  2L76 A;  2XEW A;  2MP2 B;  5EDS A;  2O6V A;  5G2N A;  5D7G A;  4KZC A;  2ZNV C;  1WR1 A;  1EF5 A;  2KFK B;  2W9N A;  4ANU A;  1QZE A;  2JWZ A;  2YVC A;  1SIF A;  2J0M A;  1WM2 A;  2KWU B;  1KM7 A;  2MBQ A;  2LAS A;  3R3M A;  2CHX A;  3V60 A;  3VTV A;  1WGG A;  3ZKJ C;  3PRM B;  3CMM B;  4MJS A;  1WXS A;  3ZNG C;  1V81 A;  5J18 A;  1RFA A;  3DBS A;  3H7S A;  4W9K A;  3VDZ A;  1CMX B;  3B0A A;  3R66 C;  1R4M I;  3ML9 A;  3APF A;  2DAJ A;  3L0W B;  2UWQ A;  2QHO A;  2V3S A;  2N9E B;  3ZTD A;  3KW5 B;  4JQW C;  4LDT D;  1G6J A;  3QQ8 B;  4WQO B;  1WE6 A;  3AU4 A;  4EUT A;  2LWP A;  3PHX B;  3SHQ A;  4G50 A;  3VUY A;  1LXD A;  3QCA A;  1SGH A;  2EMS A;  1V5T A;  3K9P B;  4IM2 A;  2D07 B;  2KVR A;  3DVG X;  2Y5B B;  5CHF A;  1WXM A;  3VXW A;  1OTR B;  1VCB A;  2GBK A;  4LDT B;  3H1U A;  4HJK A;  3W1S C;  3WIM A;  4HWI B;  1WX8 A;  2NBU A;  4A3O A;  2IY1 B;  2LRW A;  2LVQ A;  1E8Z A;  1WMH B;  3I3T B;  3PPA A;  4MEL A;  3VUW A;  2L05 A;  1T0Y A;  3NOB A;  4BBN C;  5D2M B;  3PRP B;  1UBQ A;  2JRI B;  3KYD D;  4NJ7 A;  4P7I A;  2BKR B;  1D3Z A;  2KTR B;  1UD7 A;  4TUU A;  5CHW A;  3W1S A;  2ZVN A;  1UEL A;  4TQ1 A;  2LUE A;  2N4F A;  4EZJ A;  1OGW A;  2MBB B;  1S1Q B;  2ZCB A;  5DPW A;  2LXA A;  4I6N B;  4EFO A;  3A9K B;  2N9X A;  2WDT B;  1HE8 A;  1R4N I;  2KKC A;  3UF8 A;  3C0R B;  2KJR A;  2EKE C;  2L8J A;  1TGZ B;  3DVG Y;  3BIN A;  4IG7 B;  3T8M A;  4JIO U;  1SE9 A;  1WJ6 A;  1WYW B;  1H8C A;  2C7N B;  2M8S A;  4FBJ B;  1WMH A;  3JSV B;  1V80 A;  1VD2 A;  2MQJ A;  3IG3 A;  4IWO A;  4M8N A;  3L08 A;  4GSW A;  1WE7 A;  4IM3 A;  1E8X A;  1YIW A;  4LJO B;  1WR6 E;  4XX5 A;  4BKS D;  3ZNH B;  2NPT B;  4WAA A;  3X0W A;  3N32 A;  1RRB A;  2G4D B;  2KN5 A;  4GB9 A;  2K25 A;  3R7R A;  2G45 B;  2N7E A;  3WAP A;  1C1Y B;  3UIP B;  3WA0 A;  2K8C A;  4DWF A;  1P0R A;  2D10 A;  4FHK A;  2RSU A;  4GDK A;  5IAA C;  2CKH B;  4ICV A;  3SDL C;  3ML8 A;  4J6I A;  1TZ1 A;  2DYO A;  3LDZ E;  1ZGU B;  1RAX A;  3LJ3 A;  4DHZ E;  2KTF A;  4CHK A;  4JGH B;  3M62 B;  3QAR A;  3JSV A;  3AI5 A;  1P1A A;  3S2A A;  1GC6 A;  2O6V D;  4W9G A;  2MRP A;  2CS4 A;  3IVF A;  1YX6 B;  3AXC A;  2DHZ A;  2DZM A;  2FIF A;  5AZH A;  1WZ3 A;  3PLU A;  4NAW B;  3PHW B;  2C5L C;  2N1W A;  2UYZ B;  4GDL A;  4WJO A;  2DZI A;  2FID A;  2K6D B;  1WXA A;  2GBR A;  1UZX B;  4KSK C;  5LXI B;  4GU2 A;  3ECI A;  1XT9 B;  2PE6 B;  4WWN A;  3DBR I;  2KMA A;  2JF5 A;  3L54 A;  2Z59 B;  3PTF C;  2HD5 B;  2ZNV B;  1FXT B;  1KJT A;  2LZ6 A;  2FAZ A;  4HK2 A;  4K81 A;  4MJS B;  4W9J A;  5KHO A;  3HK0 A;  3TCA A;  3V61 A;  3ZW3 A;  4FJZ A;  2ZCC A;  4LJP B;  2ZEQ A;  2JXX A;  2JVC A;  3QC8 B;  4WWP A;  3UIN B;  3WAN A;  4BKT A;  1WGY A;  3DVN U;  5JHA A;  2MCN B;  2K1F A;  1UGM A;  4G0N B;  3UIO B;  4F1S A;  1A5R A;  3Q3J A;  2GOW A;  2GBM A;  3HM3 A;  2C9W B;  3UQB A;  1WX7 A;  2L00 B;  5LXH A;  3VH4 B;  2HE7 A;  3ALB A;  1E8W A;  3ZUN A;  2MW5 A;  3D32 A;  3EC8 A;  1NDD A;  4GIV A;  3WAM A;  4K7W A;  2WWZ A;  3DBL I;  5D6J B;  4KIK A;  4MGY E;  1LM8 B;  3IBE A;  4KZ0 A;  3HIZ A;  3TJP A;  2D2Q A;  4HDQ A;  4MEM A;  4B6W A;  4EZK A;  4CYE A;  3WAO A;  5TR5 A;  2IZV B;  3JW0 X;  5JZE B;  5JHB A;  3KUC B;  4RM8 A;  3AU5 A;  3JVZ X;  3M95 A;  4AJY B;  5DPR A;  3KYC D;  3PRE A;  2KHW B;  2IO1 B;  3DCG A;  3L10 B;  4A20 A;  2PEA A;  2R2Q A;  4NPN A;  3VVW B;  2KDB A;  4BVU C;  3NZS A;  3DQV A;  3APC A;  5KHQ A;  1IP9 A;  2JZZ A;  1YQB A;  4ZDV A;  3VAW A;  3PGE A;  2ZZP B;  2G3Q B;  1P3Q U;  2NBV B;  3KVF B;  2BF8 B;  2CR5 A;  2IO3 B;  2DYB A;  5C23 A;  3ZDM C;  4CO7 A;  4E3C A;  2CHW A;  1EUV B;  1WGD A;  1WY8 A;  2RGF A;  5DCN A;  2LGX A;  3QAQ A;  2ZPY A;  1GJZ A;  2WX1 A;  3AUL A;  2J0K A;  2K8H A;  2REX A;  5AEK B;  3CF6 E;  1RLF A;  2LD9 A;  2KLC A;  1X1M A;  2MLB A;  1TBE A;  5AZG A;  4OVU A;  3RYT A;  4PS7 A;  2BYF A;  4JLC A;  1H4R A;  2KX3 A;  2N1V A;  1YX5 B;  4E71 A;  2GBN A;  3PZD A;  2KZR A;  2KMC A;  2Z0E B;  2IY0 B;  1WJ4 A;  4HCN B;  3ONS A;  3ZLZ A;  3U8Z A;  2BWE S;  2IO0 B;  4GDK B;  2N7D A;  3B08 A;  4WWO A;  3TBL D;  4DDI D;  5G55 A;  4MH0 E;  2KX0 A;  1WRD B;  1WX9 A;  2AYO B;  4KSL C;  1MG8 A;  5CTR C;  2GMI C;  4AP4 C;  2AWT A;  2KJH B;  2KDI A;  2KD0 A;  5JH5 C;  3ZVV A;  3A33 B;  1S3S G;  3RZW C;  4B9K A;  2ZPN A;  2EMT A;  2O2V A;  1JRU A;  4LCD E;  3V6E B;  2KLG A;  2JZ3 B;  2A4Z A;  3L16 A;  1KLV A;  1GUA B;  1AAR A;  4GDL B;  4PYZ A;  4WJQ A;  2AL3 A;  4AOF A;  1Z2M A;  4XZ4 A;  5E6P A;  1P9D U;  3OJ4 B;  3DBH I;  3CSF A;  4FN2 A;  1WXV A;  3NZU A;  4AWJ A;  4WJP A;  3N30 A;  4BFR A;  2D3G A;  2WYQ A;  3RD2 A;  4K1R B;  1I42 A;  2KK8 A;  1WJU A;  2Z0D B;  2ZJD A;  3CST A;  3ZIM A;  2BYE A;  4MGK E;  4NQK E;  1V86 A;  2B3A A;  1NBF C;  2LVO A;  3ZRC A;  1WM3 A;  4BOZ B;  1Q1O A;  4DHJ D;  3V62 A;  4MGZ E;  3OAW A;  2L0T A;  3UQA A;  4URK A;  1EF1 A;  1L7Y A;  2OOB B;  4PYU A;  2JY6 A;  4NNJ B;  5E6O A;  4HLE A;  2KC2 A;  3A4S C;  3ENE A;  5D94 A;  4DHJ B;  2MSE D;  3H7P B;  1YD8 U;  2XBB C;  3TMP B;  1OEY J;  3PS6 A;  4IC7 B;  1Q0W B;  3VQI A;  3QIJ A;  3NY5 A;  2LVP A;  5HKH A;  1ZKH A;  2A5U A;  3EHV A;  4GN1 A;  2KAN A;  4KDL B;  5IA7 A;  3ZNZ B;  1NI2 A;  2L0F A;  3QWZ B;  4FLH A;  1P98 A;  3V6C B;  1C3T A;  4KIK B;  3U30 A;  4BOS C;  3IHP C;  2C7H A;  3ZNI D;  1L2N A;  2ZVO A;  4DBG A;  3HM6 X;  4DDG D;  2KQS A;  1WIA A;  3T9L A;  3WAL A;  2KDE B;  4AJW A;  2ASQ A;  5C1Z A;  4FJY A;  2G4S A;  2I1J A;  3H7P A;  3PSE B;  2JPH A;  3VHT C;  3SD5 A;  3DPD A;  3ZO5 B;  2IBI B;  2LGY A;  2RPQ A;  4AUQ C;  3W1Y A;  2M0X A;  4FHJ A;  2NCN A;  2DAF A;  3QJZ A;  3RZF A;  1WGR A;  2LRU A;  4I6P A;  5J17 A;  1M94 A;  2MX2 A;  4W9L A;  2LXC A;  2JT4 B;  3ZTC A;  4HCP B;  3SU8 X;  3APD A;  2LJ5 A;  5E6N A;  3B1L X;  5J2R A;  1Z5S B;  4YL8 A;  3VFK A;  3DVN V;  3U7D A;  1WF9 A;  2RD0 A;  2MBH A;  4EKU A;  3OLM D;  3EEC A;  2JRH A;  4JL9 A;  4MGI E;  5GMV A;  3H9D A;  3KUZ A;  4TKN A;  2RR9 A;  4I6L B;  4W9F A;  4A3P A;  3KH0 A;  4HPM B;  2I1K A;  4PS3 A;  1E7U A;  1WJN A;  4DHZ B;  5L95 C;  1F9J A;  4MDK E;  3TIX A;  1I35 A;  3M3J A;  2FUH B;  3PT2 B;  1EO6 A;  1WGH A;  1U4A A;  4FJV B;  4G11 A;  5LLI A;  1V5O A;  1LFD A;  2DZJ A;  1PQS A;  2MBO A;  3ZDT A;  4MSQ B;  2BYV E;  2KOX A;  1E8Y A;  4XC2 A;  2HTH A;  5FR6 A;  4DK5 A;  2PE9 A;  2NBW B;  3UGB B;  2KC1 A;  3Q3F A;  4PS8 A;  4EOY A;  3DDC B;  2NVU I;  2KO3 A;  2DEN B;  2O2V B;  3QX1 A;  4NJ6 A;  2XK5 A;  3TL5 A;  2KNB A;  2CU1 A;  3MTN B;  4BBN F;  2BWF A;  2LI5 A;  2CHZ A; 
#chains in the Genus database with same CATH topology
 2H89 B;  3B2G A;  2KFK A;  3R2I A;  4M8M A;  3K9O B;  3GB1 A;  2D3A A;  3Q14 C;  1Y8R C;  2FCM A;  3P2B A;  4HVB A;  4XE0 A;  2J42 A;  2FCS A;  1HXY D;  2DYM A;  1AYF A;  4LNO A;  2NS5 A;  5JXV A;  2BS4 B;  2Y5P A;  4TV3 A;  3BVZ A;  4M02 A;  1BT0 A;  1E7P B;  4OVV A;  5IKC M;  4B95 A;  1WZ0 A;  4YSY B;  1QIL A;  5DPS A;  3ZRF A;  2WNM A;  1E90 A;  2TSS A;  2MJ3 A;  2Y3A A;  4ASW C;  3AEB B;  2WDQ B;  1K8R B;  4ZRK A;  1ROE A;  4GXB A;  2INP E;  1I4P A;  5IOI A;  4C7Y A;  3EFU A;  1GG3 A;  2ACZ B;  4HXD A;  1JWS D;  4KVG B;  1QT9 A;  1XQQ A;  2GLS A;  1EWC A;  2WXO A;  1K52 A;  4CQN A;  1FCC C;  3RT3 B;  2N0S B;  4K7S A;  4MSM B;  3N3K B;  2KWC A;  3NHE B;  1J8C A;  4USA A;  2O6V B;  3P4R B;  4RGN A;  2RMM A;  2J0J A;  3AE3 B;  2VH1 A;  2K8B A;  4Q2J A;  4K7U A;  4KGR A;  3NJT A;  4US8 A;  4GGQ A;  2MWS B;  1V2Y A;  4IWQ A;  1FD6 A;  1SF0 A;  2DX5 B;  1TY0 A;  3KWV A;  3VRB B;  3GZN I;  2PTL A;  2O6V A;  5G2N A;  4ANU A;  2ZNV C;  2FBW B;  1SIF A;  2KWU B;  1KM7 A;  1JW9 D;  2BB5 A;  5IN7 A;  1EU4 A;  2CHX A;  3PRM B;  3VR8 B;  5J18 A;  4W9K A;  4LNF A;  3VDZ A;  3BZD B;  2UWQ A;  2QHO A;  2N9E B;  3KW5 B;  4JQW C;  1G6J A;  3AU4 A;  3PHX B;  4G50 A;  4IM2 A;  2D07 B;  2WXN A;  3PZ8 A;  3VXW A;  1VCB A;  1HQR D;  1Q10 A;  1WX8 A;  2NBU A;  4A3O A;  2IY1 B;  3VUW A;  5IO9 A;  3PRP B;  1KTK A;  1T0S C;  2JRI B;  4TSS A;  1UD7 A;  3RNG C;  1UEL A;  4TQ1 A;  2LUE A;  1VJK A;  1OGW A;  3PO0 A;  2ZCB A;  5DPW A;  4EFO A;  1D5Z C;  2WDT B;  2KKC A;  3C8Y A;  3DVG Y;  3BIN A;  3T8M A;  1WJ6 A;  4FBJ B;  4GLS C;  3AMZ A;  1V80 A;  2MQJ A;  2PKO A;  1WE7 A;  1E8X A;  1YIW A;  1PGX A;  3Q8E A;  1C9F A;  2KN5 A;  4GB9 A;  2G45 B;  1XLO A;  3AE8 B;  1C4A A;  3BWU D;  3WA0 A;  3FIL B;  1P0R A;  2RSU A;  4GDK A;  4J6I A;  3LDZ E;  4DHZ E;  2KTF A;  1WGK A;  4CHK A;  3QAR A;  4K3B A;  2WXI A;  1GC6 A;  2MRP A;  1L4Z B;  1SB3 C;  2CS4 A;  1YX6 B;  2DHZ A;  1P7E A;  4GDL A;  1D4B A;  1UZX B;  4GU2 A;  3FIL A;  2RDB C;  1C78 A;  2LUM A;  4WWN A;  4O1N A;  3PTF C;  1KJT A;  4K81 A;  4MJS B;  2ZEQ A;  2JXX A;  3QC8 B;  5FK9 C;  1TKE A;  2C9W B;  3UQB A;  1CJE A;  2HE7 A;  1E8W A;  2CJO A;  1BXT A;  2MW5 A;  3HVZ A;  3SFD B;  5BMH A;  1VZ8 A;  2LFI A;  2IZV B;  3JW0 X;  4RM8 A;  2ON8 A;  2WXH A;  2DBY A;  2OED A;  4AJY B;  5DPR A;  2KHW B;  4BVU C;  3DQV A;  1R4N B;  1L0X B;  3MC8 A;  1IP9 A;  3RFZ B;  4KKI A;  1MVK A;  4E3C A;  4ZHP A;  2CHW A;  3QAQ A;  2WX1 A;  3KWL A;  1MHH E;  5BYS A;  1FNU A;  1RLF A;  3MJ5 A;  3AE5 B;  2MLB A;  3N1X C;  4OVU A;  2WDV B;  3MP9 A;  1KH0 A;  3AE4 B;  1DOY A;  3Q3M C;  2N1V A;  4E71 A;  1TZO A;  1N60 A;  2Z0E B;  3U8Z A;  4WWO A;  4LNK A;  4MH0 E;  3EUB 2;  1WRD B;  2GMI C;  4AP4 C;  2KJH B;  1YJJ A;  4RF1 A;  3RZW C;  2ZPN A;  3V6E B;  3L16 A;  3N1Z C;  1GUA B;  4A55 A;  1I4G A;  1P9D U;  3OJ4 B;  3DBH I;  1SE3 A;  1K51 A;  2D3G A;  3RD2 A;  2ZJD A;  2BYE A;  3NG0 A;  1JQ4 A;  4DHJ D;  1J7B A;  4URK A;  2JWU A;  5E6O A;  4HLE A;  5D94 A;  4DHJ B;  4YT0 B;  3TMP B;  1XCT L;  5MPO A;  1OEY J;  1NVI D;  1Q0W B;  3VQI A;  5HKH A;  1T3Q A;  2KAN A;  2L52 A;  1KRH A;  3IHP C;  3B2F A;  2I38 A;  4MAC A;  2V3P A;  1ACC A;  2KDE B;  3VHT C;  3SD5 A;  3DPD A;  4NJC A;  4DXG A;  2LGY A;  2AQ2 B;  3BYT B;  4ZHO A;  2JT4 B;  3APD A;  3Q2A C;  1Z5S B;  4YL8 A;  3LYY A;  2MHJ A;  1LGR A;  3EEC A;  4W9F A;  3KH0 A;  4OZB A;  1F9J A;  3PT2 B;  4G11 A;  1U4A A;  2IGD A;  1PUT A;  5FR6 A;  2HTH A;  3DDC B;  1N62 A;  2O2V B;  3WCQ A;  4NJ6 A;  3TL5 A;  1YOV B;  2CU1 A;  2BWF A;  2MP2 A;  3I5J C;  2V9H A;  4RM9 A;  3MJW A;  3AEC B;  4RMA A;  1V1O A;  4EZL A;  1TJE A;  2FCQ A;  2M17 A;  2PPH A;  4KDI C;  4GOC A;  2GRI A;  2IO2 B;  2C7M B;  1P7F A;  2AQ1 B;  4F8C B;  3X23 A;  3MHS D;  4ANX A;  4ICU A;  4M0W B;  4P1B C;  1TS4 A;  1XLP A;  1RWS A;  3GE8 C;  3DOW A;  2KFJ A;  2IYD B;  3VUX A;  4A8X C;  2MBE A;  2I2Y A;  1ZE3 D;  3NVZ A;  4IUM B;  1T5X D;  3RUL A;  4E74 A;  2X38 A;  4IDI A;  3NRZ A;  2KYW A;  3TUO A;  3PLV A;  4US9 A;  3ZGZ A;  3RMK C;  2YLM A;  3HRD D;  4RCO A;  2L7R A;  4AQ7 A;  1JCK B;  2KWV B;  2K22 A;  4P1C C;  2R2O A;  2NTT A;  1WFY A;  4AS1 A;  1Y56 A;  2LGD A;  3OJ3 A;  2NPT A;  3NVY A;  5H92 C;  1IYF A;  1V6E A;  1MPE A;  4EEW A;  3PV1 A;  2N9P C;  2KXJ A;  1EM7 A;  1PGB A;  1IPG A;  2HJ8 A;  3H6N A;  3U2S C;  1V1P B;  3BY4 B;  4C4V B;  2MH7 A;  2M4N A;  4MM3 A;  3AEE B;  3RNA C;  3L13 A;  1WH3 A;  1V49 A;  2L76 A;  2XEW A;  4KZC A;  2KFK B;  3AE9 B;  2YVC A;  5D3D A;  2J0M A;  4LK0 M;  3R3M A;  1QF6 A;  3Q8C A;  3ZKJ C;  5TSS A;  1JWA D;  1J7A A;  1WXS A;  3BYY B;  4C4V A;  1R4M I;  3L0W B;  3ZTD A;  3LXF A;  1ZP0 B;  4WQO B;  1ESF A;  2LWP A;  1WSP A;  3MC9 A;  3VUY A;  5CHF A;  2HTM E;  2GBK A;  4YXD B;  3UI3 A;  4HJK A;  4HWI B;  2BVC A;  2QC8 A;  2LRW A;  2LVQ A;  1WMH B;  2L05 A;  3NOB A;  1JRO A;  2KWD A;  2OJW A;  4NJ7 A;  2EEL A;  4RFB A;  4TUU A;  3W1S A;  1I4H A;  2ZVN A;  3ZXR A;  4KGT A;  5HHD G;  2N9X A;  1HE8 A;  1FFV A;  5AUK A;  2RDG A;  2KJR A;  1TGZ B;  3C19 A;  1MG4 A;  1WYW B;  2M8S A;  1WMH A;  3JSV B;  3IG3 A;  3URY A;  2WHI A;  5T8I A;  4ZYS A;  2W55 A;  4IM3 A;  4XX5 A;  3ZNH B;  1EWY C;  3X0W A;  3N32 A;  4C56 C;  1RRB A;  2G4D B;  2K25 A;  1CK1 A;  1PYW D;  2N7E A;  3UIP B;  4DWF A;  4FHK A;  4WUR A;  1ZGU B;  2PIA A;  2LHD A;  2QDF A;  3M62 B;  3JSV A;  2O6V D;  2WU2 B;  2WDR B;  3IVF A;  2FIF A;  3PHW B;  2N1W A;  4WJO A;  2FID A;  2GBR A;  4P16 A;  1TS3 A;  3DHI C;  3DBR I;  1SJH D;  3L54 A;  1ZXI A;  2BB6 A;  1FXT B;  3AH7 A;  3WAL A;  1DGJ A;  3ZW3 A;  3HK0 A;  2ZCC A;  4LJP B;  3UIN B;  3WAN A;  1C4C A;  3DVN U;  1F1H A;  4G0N B;  2M19 A;  3Q3J A;  2GOW A;  1VDV A;  4ZRP A;  1OQR A;  3ALB A;  4QAY A;  3ZUN A;  3D32 A;  4KX6 B;  3EC8 A;  2J52 A;  4GIV A;  3B9J A;  2IGG A;  4K7W A;  4KIK A;  2FUG 1;  4OZC A;  3DHG C;  3TJP A;  3HIZ A;  2D2Q A;  4MEM A;  4EZK A;  4CYE A;  3WAO A;  1L4D B;  1F0Z A;  1MJD A;  3AU5 A;  3IT4 B;  4N58 A;  1UWM A;  3PRE A;  4JE3 B;  3DCG A;  3L10 B;  3FAH A;  2ZW1 A;  3NZS A;  3EA6 A;  2G9H D;  3SFE B;  4NAM A;  1ZPS A;  5KHQ A;  1YQB A;  2E6X A;  1DOX A;  3PGE A;  2Z8L A;  2ZZP B;  4JX1 C;  4OHJ A;  2IO3 B;  5C23 A;  3TEZ A;  2DYB A;  3AM9 A;  4A6Q A;  2IPK D;  2RGF A;  5DCN A;  1XXG A;  1GJZ A;  2QJL A;  4REZ A;  1JWB D;  2J0K A;  2REX A;  3U52 E;  3CF6 E;  3RNB C;  4WIP A;  2KLC A;  1NYQ A;  5AZG A;  3DBH B;  3E9S A;  2K0P A;  1D6E C;  3PZD A;  2JU6 X;  1V8C A;  2KMC A;  1WJ4 A;  1NI3 A;  3ZLZ A;  4GDK B;  2IO0 B;  5AUI A;  4KSL C;  5CTR C;  3ZYY X;  4LTU A;  1HEZ E;  2EMT A;  3RNF C;  2WXJ A;  1JRU A;  2KLG A;  1YQ4 B;  4PYZ A;  1AAR A;  4GDL B;  4WJQ A;  4XZ4 A;  1T0R C;  2W3S A;  3AN1 A;  2BBC A;  3CSF A;  4AWJ A;  1E9M A;  4WJP A;  4BFR A;  2L32 A;  1UF0 A;  4MGK E;  4NQK E;  1V86 A;  1NBF C;  5EE3 A;  3ZRC A;  1WM3 A;  4BOZ B;  3V62 A;  2L0T A;  1F2R C;  4NNJ B;  3ENE A;  3H7P B;  1ZKH A;  3EHV A;  5IA7 A;  3DBL B;  3ZNZ B;  2L0F A;  3V6C B;  1L6U A;  3U30 A;  4BOS C;  1C4P A;  1FNW A;  3ZNI D;  1NEN B;  5EE9 A;  2ZVO A;  2D3B A;  1FO4 A;  1K53 A;  2PW9 A;  4DBG A;  4DDG D;  1R7S A;  1WIA A;  4FJY A;  2G4S A;  2I1J A;  3H7P A;  3IAM 1;  2BS2 B;  1VLB A;  3AEF B;  1WGR A;  2LRU A;  1ET6 A;  1QOF A;  5J17 A;  2MX2 A;  4W9L A;  3ZTC A;  4EE2 A;  3SU8 X;  2CJN A;  2LJ5 A;  5E6N A;  5J2R A;  2GI9 A;  2V4I B;  3VFK A;  2BS3 B;  3U7D A;  1WF9 A;  4KKJ A;  2SEB D;  3TEY A;  4ZRQ A;  4MGI E;  3H9D A;  3KUZ A;  2RR9 A;  4I6L B;  1KFY B;  2I1K A;  1FCL A;  1WJN A;  1I35 A;  2WXL A;  1WGH A;  4FJV B;  5LLI A;  3T3O A;  2KOX A;  4XC2 A;  2LMC A;  4LNN A;  4DK5 A;  1FFU A;  2KC1 A;  1WYG A;  4EOY A;  4FXC A;  1SIJ A;  2KO3 A;  2QMT A;  4BAX A;  2XK5 A;  3ZJV A;  3MTN B;  1L7Y A;  2IND C;  3L4P A;  5IP4 D;  4S17 A;  4NY0 A;  5CX3 A;  1SSN A;  2JUO A;  2DNF A;  2WQY B;  3I57 A;  1LQB A;  2VZK D;  2DLB A;  2N7J A;  4K3C A;  4WWM A;  2J53 A;  4RGM A;  3L17 A;  1E7V A;  3GOE A;  3OWE B;  2VZK B;  1D5X C;  3P63 A;  3NS1 A;  4F7Z A;  1ENF A;  2ZW0 A;  2KQ7 A;  1M4V A;  2NTS A;  4FAD A;  2BPS A;  2INC C;  3Q8B A;  3TEW A;  2JX5 A;  5HG2 A;  1GC7 A;  3PRZ A;  2M1M A;  3W5U B;  3ZJT A;  3PVL A;  3VTU A;  2BT6 A;  1C76 A;  2KTR A;  1QOA A;  4ZRI A;  2MA9 B;  2NMQ A;  4MH8 A;  1KOT A;  4ZYN A;  4BZA A;  3N1Y C;  3V3X A;  3A9K A;  4HRO A;  4X57 B;  4ACF A;  1N5X A;  4W9D A;  3A1Q B;  3JYU A;  1UH6 A;  2OJR A;  1AWD A;  4W9H A;  2K39 A;  2XN9 C;  4DXA B;  2K6Q A;  3P4S B;  4II3 B;  2JSV X;  4IWP A;  2Y5C A;  1YJ1 A;  1GPX A;  4KV2 A;  4BKS A;  1F52 A;  1SJE D;  2JZP A;  1GNU A;  4OW0 A;  4ARC A;  3KUD B;  2V4L A;  3A1Q A;  4NZL B;  2VRR B;  2C60 A;  2LGS A;  2WX0 A;  4HPL B;  3HHM A;  3A4R A;  4ANW A;  5E6J A;  5BMI A;  4NAW A;  1WI0 A;  4HDO A;  2MP2 B;  5D7G A;  1WR1 A;  1EF5 A;  2W9N A;  2JWZ A;  3VRA B;  1WM2 A;  2PMV A;  4KGS A;  1KF6 B;  3V60 A;  3VTV A;  3IT6 B;  1WGG A;  1IBX B;  3CMM B;  5GXG B;  2IJ0 A;  1V81 A;  1HA5 A;  1RFA A;  4MT5 A;  3FC4 A;  4UDU C;  3OG5 A;  3ZQ4 A;  3EGR A;  2KN4 A;  1TKG A;  5D3I B;  1OQQ A;  4LDT D;  4EUT A;  1WE6 A;  3IXS A;  1LXD A;  3QCA A;  2EMS A;  2RPV A;  5EE0 A;  3K9P B;  3DVG X;  1IGD A;  1ZUD 2;  2KVR A;  2Y5B B;  1WXM A;  1OTR B;  4LDT B;  1YNT E;  4YTM B;  3WIM A;  1V97 A;  1UUP A;  1E8Z A;  4MEL A;  3PPA A;  1IBX A;  1T0Y A;  1DOI A;  1WXQ A;  1UBQ A;  4P7I A;  1D3Z A;  2PVO D;  5CHW A;  2N4F A;  1S1Q B;  4IKG A;  1TS2 A;  2AQ3 B;  1R4N I;  1XF5 L;  2BTE A;  3R2T A;  1GAQ B;  2BW2 A;  4JIO U;  3BVG A;  1H8C A;  3Q8F A;  4ZOH C;  1VD2 A;  3DWG C;  4IWO A;  3L08 A;  3I63 C;  4GSW A;  5HFY A;  2NPT B;  4WAA A;  3AB5 A;  2M56 B;  3R7R A;  4WH4 A;  4HEA 1;  1N61 A;  3WAP A;  3AEA B;  2D10 A;  1ZDX A;  3SDL C;  1YN4 A;  3ML8 A;  2MJD A;  1GOZ A;  2LHE A;  2QSD A;  4RNA A;  2V0G A;  3AI5 A;  3S2A A;  4W9G A;  1QOG A;  4MM3 B;  3GZN B;  1L6V A;  2WLB A;  1WZ3 A;  3PLU A;  3E56 A;  2UYZ B;  2INN E;  2DZI A;  5HI1 A;  1WXA A;  4KSK C;  3RI7 C;  5LXI B;  2Q5W D;  3ECI A;  2PE6 B;  2LEK A;  3I9V 1;  2KMA A;  2JF5 A;  2LZ6 A;  5KHO A;  4HK2 A;  1KLG D;  4W9J A;  2WXM A;  3HUI A;  4OZA A;  1EU3 A;  1WGY A;  2QIL A;  5JHA A;  2MCN B;  2K1F A;  1UGM A;  4F1S A;  1A5R A;  3R8B A;  1SE2 A;  3HM3 A;  1WRI A;  2B76 B;  4B0M A;  5LXH A;  4A9A A;  3BVM A;  3WAM A;  2W54 A;  5D6J B;  4MGY E;  4KZ0 A;  2WXP A;  2KAC A;  3M95 A;  2R61 A;  2HJ1 A;  2PEA A;  4NPN A;  4A20 A;  1CQV A;  2KDB A;  3T3N A;  3V05 A;  2JZZ A;  4ZDV A;  2YEP B;  1P3Q U;  3HVD A;  2NBV B;  2BF8 B;  4CO7 A;  3ZDM C;  2KAJ A;  1WY8 A;  2LGX A;  4XYC A;  3AUL A;  2N9K A;  3KQ4 A;  5AEK B;  2XNA C;  4ITK A;  2LD9 A;  3CIR B;  3RYT A;  2WXG A;  4PS7 A;  2BYF A;  1H4R A;  2KX3 A;  2WXF A;  1YX5 B;  2IDY A;  2LGI A;  1TY2 A;  1TIF A;  1FRD A;  4HCN B;  3ONS A;  1N5W A;  1T0Q C;  1SE4 A;  4XWW A;  2BWE S;  2K3U A;  2KQ4 X;  3TBL D;  4DDI D;  2PVG C;  1MHX A;  1FIQ A;  1WX9 A;  2AYO B;  1MG8 A;  1PFD A;  3O13 A;  4B9K A;  1S3S G;  4LCD E;  2A4Z A;  1KLV A;  4AOF A;  2AL3 A;  1Z2M A;  5E6P A;  1FEH A;  3NZU A;  3N30 A;  4N59 A;  1T6B X;  4K1R B;  3GS2 A;  1XLN A;  3CST A;  3ZIM A;  2Z0D B;  2B3A A;  2KVZ A;  5FKA C;  3OAW A;  1C79 A;  3AE7 B;  3NUH B;  3UQA A;  1EF1 A;  2OOB B;  4RH6 A;  3A4S C;  1YD8 U;  2XBB C;  3PS6 A;  2QEJ C;  3QIJ A;  4FLH A;  1C3T A;  1F2R I;  1HZ5 A;  4KIK B;  1L2N A;  1UGJ A;  3AE6 B;  2ASQ A;  3PSE B;  4LNI A;  2K9X A;  3ZO5 B;  1STE A;  1B1Z A;  3P1M A;  4L2Y A;  1GB4 A;  1CZP A;  3QJZ A;  3RZF A;  4HPP A;  4HCP B;  3U7Z A;  5LNK 1;  2WXR A;  1QQR A;  2L83 A;  2MBH A;  1UNS A;  3OLM D;  2JRH A;  4M01 A;  4TKN A;  5G5G A;  4HKZ E;  4HPM B;  2EKI A;  1E7U A;  4J3O D;  5L95 C;  4MDK E;  1L0Y B;  3MFG A;  1QKZ A;  3Q3O C;  1FRR A;  4M00 A;  1LFD A;  2DZJ A;  1MI0 A;  2MBO A;  3ZDT A;  4PT5 A;  2FE8 A;  1E8Y A;  4L23 A;  5EE1 A;  1NYR A;  1ET9 A;  3DWM A;  4DQO C;  3QX1 A;  2DEN B;  4BBN F;  2KNB A;  1VZ7 A;  2WGS A;  1XLQ A;  1I4R A;  2YEP F;  4YWG G;  5L83 A;  2FNJ B;  3ZJU A;  4WJN A;  1TTN A;  2JYE A;  5CHV C;  1JWU D;  2GB1 A;  3O65 B;  2FCN A;  1E6E B;  1VR9 A;  3RNE C;  4N9F 4;  1D5M C;  3Q8A A;  2E3T A;  4B0E A;  1E5W A;  4XDC A;  4TQ0 A;  3A9J B;  4ZRJ A;  3QK0 A;  3IFW B;  1OQY A;  2LJI A;  5BO4 B;  1TS5 A;  3Q6B A;  3RCZ A;  4LLG M;  4TMA B;  2M0A A;  1TYG B;  4NQL B;  2BKF A;  4IM0 A;  4W9I A;  1J19 A;  3NS8 A;  4G3X B;  1TKY A;  1Q5W B;  1F77 A;  4FUL A;  4FA6 A;  3A9J A;  1IUE A;  1RFK A;  3AE2 B;  1J0G A;  4II2 B;  3VH3 B;  2L3Z A;  3AEG B;  2AX5 A;  3U4E G;  2BYT A;  4XGA B;  1HZ6 A;  5AZF A;  2D11 A;  1L0V B;  1XD3 B;  2PJH A;  1RM6 C;  1OEY A;  1ZW7 A;  3M63 B;  1V9J A;  1UBI A;  3VTW A;  4BKG A;  2GBJ A;  2BGF A;  4IW0 A;  5BYR A;  2NR2 A;  3W9C B;  3FKY A;  4JWS C;  4C00 A;  4N6E B;  4H2A A;  3AV8 A;  3H8H A;  4HRS A;  1QLB B;  2JXT A;  4W9E A;  2D5G A;  3NZ3 A;  2AEH A;  3RUI B;  2J7Q B;  2KJ6 A;  4GMV A;  3QHT A;  1ISN A;  2V1Y A;  3QA8 A;  3R7Q A;  2KDF B;  2AL6 A;  5DPT A;  2PLP A;  4ANV A;  4WQM A;  3N20 C;  2G1E A;  1VRA B;  4W9C A;  2XK5 B;  2DZK A;  4DXF A;  5EDS A;  3BK1 A;  3W5V B;  1QZE A;  2WS3 B;  1LO5 D;  2MBQ A;  2LAS A;  3GP7 A;  2BQQ A;  4MJS A;  1RYJ A;  3ZNG C;  3DBS A;  3H7S A;  1CMX B;  3B0A A;  1N63 A;  3R66 C;  3VR9 B;  3ML9 A;  3APF A;  2DAJ A;  2V3S A;  3QQ8 B;  2N9L A;  1BML C;  3SHQ A;  4P6V F;  4JWU C;  1YN5 A;  1SGH A;  1UWX A;  1V5T A;  2JQR B;  1IGC A;  1AW7 A;  4YSX B;  3H1U A;  3W1S C;  3SEB A;  3I3T B;  2WU5 B;  4BBN C;  5D2M B;  5BYQ A;  3KYD D;  2BKR B;  2KTR B;  1A70 A;  4YTN B;  4EZJ A;  2MBB B;  5C2T B;  2LXA A;  4I6N B;  1FXA A;  3A9K B;  1NEK B;  2CU3 A;  1QOB A;  5G5H A;  3UF8 A;  3C0R B;  2EKE C;  2L8J A;  4IG7 B;  1SE9 A;  2OHF A;  2C7N B;  3N9Y C;  3ZXV A;  5FR3 A;  4M8N A;  2UU7 A;  2KT7 A;  3AED B;  4LJO B;  4BKS D;  1WR6 E;  1XO3 A;  2WXK A;  3MC0 B;  1C1Y B;  2K8C A;  5IAA C;  2CKH B;  4ICV A;  4A90 A;  2W82 A;  4C80 A;  1TZ1 A;  2DYO A;  3AE1 B;  1RAX A;  3LJ3 A;  1BUI C;  4JGH B;  2JYT A;  1WWT A;  2V3N A;  1P1A A;  4IOI E;  4D2K A;  2HDE A;  3J9C A;  3AXC A;  3NVW A;  2DZM A;  5AZH A;  4RGT A;  4NAW B;  2C5L C;  1SXT A;  2K6D B;  3RNC C;  1XCQ L;  4XDD A;  1XT9 B;  2D3C A;  1FPY A;  2Z59 B;  2HD5 B;  2ZNV B;  2FAZ A;  3MHZ A;  1AN8 A;  2K5P A;  3BII D;  4R3D A;  3TCA A;  3V61 A;  4FJZ A;  1R4M B;  3EFC A;  4WWP A;  2JVC A;  4WAF A;  1L5P A;  4BKT A;  4YTP B;  1E0Z A;  3UIO B;  4RGO S;  2GBM A;  1FNV A;  1WX7 A;  3IAS 1;  2L00 B;  3VH4 B;  1NDD A;  1JRP A;  2WWZ A;  3DBL I;  3LB8 C;  3BK2 A;  1LM8 B;  3IBE A;  1HTQ A;  4HDQ A;  4B6W A;  5TR5 A;  1FXI A;  5JZE B;  1YQ3 B;  5JHB A;  3KUC B;  3ABV B;  1JML A;  3JVZ X;  3W2D A;  3SR6 A;  3KYC D;  2IO1 B;  1I4X A;  4PK1 A;  1B9R A;  2R2Q A;  1YN3 A;  3VVW B;  2KMM A;  3APC A;  2QCZ A;  3VAW A;  1HTO A;  2G3Q B;  3KVF B;  1N6Z A;  2ONQ A;  2CR5 A;  4L1B A;  1EUV B;  1WGD A;  1J7C A;  1JAL A;  1VZ6 A;  2ZPY A;  2X8X X;  2K8H A;  5I4D A;  2SAK A;  1X1M A;  1TBE A;  1XEE A;  4JLC A;  3DHH C;  2H88 B;  2GBN A;  2KZR A;  2IY0 B;  1KLU D;  2N7D A;  3B08 A;  1ZOY B;  5G55 A;  3ETR A;  1TT5 B;  2KX0 A;  1I7H A;  2AWT A;  2VH2 A;  2KDI A;  2KD0 A;  4S0R A;  5JH5 C;  3ZVV A;  3A33 B;  2O2V A;  2ICI A;  1C77 A;  1PGA A;  1JWM D;  2JZ3 B;  2J4X A;  1PDX A;  2KDM A;  3Q3N C;  5C3J B;  2DWQ A;  4FN2 A;  1WXV A;  5H8Y E;  4XWT A;  2WYQ A;  1I42 A;  3DBR B;  2KK8 A;  1WJU A;  1SEB D;  2LVO A;  1Q1O A;  3NVV A;  4MGZ E;  4HJG E;  3KLS X;  4HKQ A;  4PYU A;  2JY6 A;  3P4P B;  2KC2 A;  3P4Q B;  4M0W A;  2MSE D;  3RPF C;  4IC7 B;  4RF0 A;  3NY5 A;  2LVP A;  1K50 A;  2A5U A;  4GN1 A;  4KDL B;  1I4Q A;  4OVZ A;  1NI2 A;  3QWZ B;  1P98 A;  1YJI A;  2QIE B;  2C7H A;  3P42 A;  2W3R A;  1FM0 D;  1ZXH A;  3HM6 X;  1FMA D;  2KQS A;  2RDH A;  4YSZ B;  3T9L A;  4AJW A;  5C1Z A;  2JPH A;  4JPS A;  2IBI B;  2RPQ A;  4AUQ C;  3W1Y A;  2M0X A;  4FHJ A;  2NCN A;  2DAF A;  3TEX A;  4I6P A;  5BMG A;  1M94 A;  2LXC A;  2MJE A;  3GE3 C;  1E10 A;  2WXQ A;  3B1L X;  1GB1 A;  3DVN V;  2RD0 A;  4EKU A;  1OFF A;  4JL9 A;  2L1A A;  5GMV A;  2WP9 B;  4A3P A;  4PS3 A;  4DHZ B;  2MEK A;  1YMH E;  1MFW A;  4C7Z A;  3TIX A;  3M3J A;  2FUH B;  2IGH A;  1EO6 A;  3RN9 C;  1V5O A;  3CWI A;  1PQS A;  4MSQ B;  1V1P A;  2BYV E;  1ZDV A;  3TSS A;  2PE9 A;  2NBW B;  3UGB B;  3Q69 A;  3Q3F A;  4PS8 A;  4ARI A;  1DYQ A;  2NVU I;  1SBB B;  3PZ7 A;  2LI5 A;  2CHZ A; 
#chains in the Genus database with same CATH homology
 2MP2 A;  2KFK A;  4M8M A;  3K9O B;  4RM9 A;  3MJW A;  4NY0 A;  5L83 A;  1Y8R C;  2FNJ B;  4RMA A;  5CX3 A;  4WJN A;  2FCM A;  2JUO A;  3P2B A;  1TTN A;  5CHV C;  4EZL A;  4HVB A;  3O65 B;  2FCN A;  2FCQ A;  2M17 A;  2PPH A;  4KDI C;  4GOC A;  2IO2 B;  1LQB A;  2C7M B;  4N9F 4;  2FCS A;  4F8C B;  2DYM A;  3L17 A;  3X23 A;  3MHS D;  4ANX A;  4ICU A;  1E7V A;  2NS5 A;  3GOE A;  4M0W B;  1E5W A;  4TQ0 A;  3A9J B;  4ZRJ A;  3QK0 A;  4TV3 A;  3IFW B;  1BT0 A;  1OQY A;  5BO4 B;  3DOW A;  4OVV A;  4F7Z A;  3RCZ A;  2KFJ A;  4B95 A;  2IYD B;  2KQ7 A;  3VUX A;  2MBE A;  4FAD A;  1WZ0 A;  4IUM B;  2BPS A;  5DPS A;  3ZRF A;  4NQL B;  2BKF A;  4IM0 A;  4W9I A;  1J19 A;  1E90 A;  1GC7 A;  3RUL A;  4E74 A;  3NS8 A;  2M1M A;  3PRZ A;  4G3X B;  3PVL A;  4ASW C;  1Q5W B;  3PLV A;  3VTU A;  2KTR A;  4ZRI A;  2MA9 B;  2YLM A;  1K8R B;  4FUL A;  4ZRK A;  4FA6 A;  4GXB A;  4ZYN A;  3A9J A;  1KOT A;  2L7R A;  1J0G A;  3EFU A;  3A9K A;  1GG3 A;  4II2 B;  4HXD A;  4KVG B;  1XQQ A;  2KWV B;  3VH3 B;  4X57 B;  4W9D A;  2L3Z A;  3A1Q B;  3JYU A;  1UH6 A;  2R2O A;  5AZF A;  2OJR A;  2D11 A;  4W9H A;  1XD3 B;  1WFY A;  2PJH A;  3RT3 B;  1OEY A;  1ZW7 A;  3M63 B;  2K39 A;  1V9J A;  1UBI A;  2LGD A;  3VTW A;  4MSM B;  4K7S A;  2GBJ A;  2BGF A;  4IW0 A;  4BKG A;  4DXA B;  3OJ3 A;  2NR2 A;  2NPT A;  2K6Q A;  3N3K B;  2KWC A;  3NHE B;  1J8C A;  4II3 B;  1IYF A;  2O6V B;  1V6E A;  4IWP A;  1YJ1 A;  2J0J A;  4EEW A;  3PV1 A;  4KV2 A;  4BKS A;  4W9E A;  2N9P C;  2AEH A;  3RUI B;  2J7Q B;  1GNU A;  2KJ6 A;  2KXJ A;  2K8B A;  3KUD B;  1IPG A;  2HJ8 A;  3QHT A;  1ISN A;  4GMV A;  2V1Y A;  2V4L A;  3A1Q A;  3QA8 A;  3R7Q A;  2KDF B;  2VRR B;  3H6N A;  4K7U A;  2AL6 A;  2C60 A;  2WX0 A;  3BY4 B;  4HPL B;  3HHM A;  5DPT A;  4GGQ A;  2MWS B;  4ANV A;  1V2Y A;  3A4R A;  2M4N A;  4IWQ A;  4ANW A;  4MM3 A;  2DX5 B;  3L13 A;  1WH3 A;  2XK5 B;  1V49 A;  3GZN I;  4NAW A;  4W9C A;  1WI0 A;  2DZK A;  4HDO A;  2L76 A;  2XEW A;  2MP2 B;  5EDS A;  2O6V A;  5G2N A;  5D7G A;  4KZC A;  2ZNV C;  1WR1 A;  1EF5 A;  2KFK B;  2W9N A;  4ANU A;  1QZE A;  2JWZ A;  2YVC A;  1SIF A;  2J0M A;  1WM2 A;  2KWU B;  1KM7 A;  2MBQ A;  2LAS A;  3R3M A;  2CHX A;  3V60 A;  3VTV A;  1WGG A;  3ZKJ C;  3PRM B;  3CMM B;  4MJS A;  1WXS A;  3ZNG C;  1V81 A;  5J18 A;  1RFA A;  3DBS A;  3H7S A;  4W9K A;  3VDZ A;  1CMX B;  3B0A A;  3R66 C;  1R4M I;  3ML9 A;  3APF A;  2DAJ A;  3L0W B;  2UWQ A;  2QHO A;  2V3S A;  2N9E B;  3ZTD A;  3KW5 B;  4JQW C;  4LDT D;  1G6J A;  3QQ8 B;  4WQO B;  1WE6 A;  3AU4 A;  4EUT A;  2LWP A;  3PHX B;  3SHQ A;  4G50 A;  3VUY A;  1LXD A;  3QCA A;  1SGH A;  2EMS A;  1V5T A;  3K9P B;  4IM2 A;  2D07 B;  2KVR A;  3DVG X;  2Y5B B;  5CHF A;  1WXM A;  3VXW A;  1OTR B;  1VCB A;  2GBK A;  4LDT B;  3H1U A;  4HJK A;  3W1S C;  3WIM A;  4HWI B;  1WX8 A;  2NBU A;  4A3O A;  2IY1 B;  2LRW A;  2LVQ A;  1E8Z A;  1WMH B;  3I3T B;  3PPA A;  4MEL A;  3VUW A;  2L05 A;  1T0Y A;  3NOB A;  4BBN C;  5D2M B;  3PRP B;  1UBQ A;  2JRI B;  3KYD D;  4NJ7 A;  4P7I A;  2BKR B;  1D3Z A;  2KTR B;  1UD7 A;  4TUU A;  5CHW A;  3W1S A;  2ZVN A;  1UEL A;  4TQ1 A;  2LUE A;  2N4F A;  4EZJ A;  1OGW A;  2MBB B;  1S1Q B;  2ZCB A;  5DPW A;  2LXA A;  4I6N B;  4EFO A;  3A9K B;  2N9X A;  2WDT B;  1HE8 A;  1R4N I;  2KKC A;  3UF8 A;  3C0R B;  2KJR A;  2EKE C;  2L8J A;  1TGZ B;  3DVG Y;  3BIN A;  4IG7 B;  3T8M A;  4JIO U;  1SE9 A;  1WJ6 A;  1WYW B;  1H8C A;  2C7N B;  2M8S A;  4FBJ B;  1WMH A;  3JSV B;  1V80 A;  1VD2 A;  2MQJ A;  3IG3 A;  4IWO A;  4M8N A;  3L08 A;  4GSW A;  1WE7 A;  4IM3 A;  1E8X A;  1YIW A;  4LJO B;  1WR6 E;  4XX5 A;  4BKS D;  3ZNH B;  2NPT B;  4WAA A;  3X0W A;  3N32 A;  1RRB A;  2G4D B;  2KN5 A;  4GB9 A;  2K25 A;  3R7R A;  2G45 B;  2N7E A;  3WAP A;  1C1Y B;  3UIP B;  3WA0 A;  2K8C A;  4DWF A;  1P0R A;  2D10 A;  4FHK A;  2RSU A;  4GDK A;  5IAA C;  2CKH B;  4ICV A;  3SDL C;  3ML8 A;  4J6I A;  1TZ1 A;  2DYO A;  3LDZ E;  1ZGU B;  1RAX A;  3LJ3 A;  4DHZ E;  2KTF A;  4CHK A;  4JGH B;  3M62 B;  3QAR A;  3JSV A;  3AI5 A;  1P1A A;  3S2A A;  1GC6 A;  2O6V D;  4W9G A;  2MRP A;  2CS4 A;  3IVF A;  1YX6 B;  3AXC A;  2DHZ A;  2DZM A;  2FIF A;  5AZH A;  1WZ3 A;  3PLU A;  4NAW B;  3PHW B;  2C5L C;  2N1W A;  2UYZ B;  4GDL A;  4WJO A;  2DZI A;  2FID A;  2K6D B;  1WXA A;  2GBR A;  1UZX B;  4KSK C;  5LXI B;  4GU2 A;  3ECI A;  1XT9 B;  2PE6 B;  4WWN A;  3DBR I;  2KMA A;  2JF5 A;  3L54 A;  2Z59 B;  3PTF C;  2HD5 B;  2ZNV B;  1FXT B;  1KJT A;  2LZ6 A;  2FAZ A;  4HK2 A;  4K81 A;  4MJS B;  4W9J A;  5KHO A;  3HK0 A;  3TCA A;  3V61 A;  3ZW3 A;  4FJZ A;  2ZCC A;  4LJP B;  2ZEQ A;  2JXX A;  2JVC A;  3QC8 B;  4WWP A;  3UIN B;  3WAN A;  4BKT A;  1WGY A;  3DVN U;  5JHA A;  2MCN B;  2K1F A;  1UGM A;  4G0N B;  3UIO B;  4F1S A;  1A5R A;  3Q3J A;  2GOW A;  2GBM A;  3HM3 A;  2C9W B;  3UQB A;  1WX7 A;  2L00 B;  5LXH A;  3VH4 B;  2HE7 A;  3ALB A;  1E8W A;  3ZUN A;  2MW5 A;  3D32 A;  3EC8 A;  1NDD A;  4GIV A;  3WAM A;  4K7W A;  2WWZ A;  3DBL I;  5D6J B;  4KIK A;  4MGY E;  1LM8 B;  3IBE A;  4KZ0 A;  3HIZ A;  3TJP A;  2D2Q A;  4HDQ A;  4MEM A;  4B6W A;  4EZK A;  4CYE A;  3WAO A;  5TR5 A;  2IZV B;  3JW0 X;  5JZE B;  5JHB A;  3KUC B;  4RM8 A;  3AU5 A;  3JVZ X;  3M95 A;  4AJY B;  5DPR A;  3KYC D;  3PRE A;  2KHW B;  2IO1 B;  3DCG A;  3L10 B;  4A20 A;  2PEA A;  2R2Q A;  4NPN A;  3VVW B;  2KDB A;  4BVU C;  3NZS A;  3DQV A;  3APC A;  5KHQ A;  1IP9 A;  2JZZ A;  1YQB A;  4ZDV A;  3VAW A;  3PGE A;  2ZZP B;  2G3Q B;  1P3Q U;  2NBV B;  3KVF B;  2BF8 B;  2CR5 A;  2IO3 B;  2DYB A;  5C23 A;  3ZDM C;  4CO7 A;  4E3C A;  2CHW A;  1EUV B;  1WGD A;  1WY8 A;  2RGF A;  5DCN A;  2LGX A;  3QAQ A;  2ZPY A;  1GJZ A;  2WX1 A;  3AUL A;  2J0K A;  2K8H A;  2REX A;  5AEK B;  3CF6 E;  1RLF A;  2LD9 A;  2KLC A;  1X1M A;  2MLB A;  1TBE A;  5AZG A;  4OVU A;  3RYT A;  4PS7 A;  2BYF A;  4JLC A;  1H4R A;  2KX3 A;  2N1V A;  1YX5 B;  4E71 A;  2GBN A;  3PZD A;  2KZR A;  2KMC A;  2Z0E B;  2IY0 B;  1WJ4 A;  4HCN B;  3ONS A;  3ZLZ A;  3U8Z A;  2BWE S;  2IO0 B;  4GDK B;  2N7D A;  3B08 A;  4WWO A;  3TBL D;  4DDI D;  5G55 A;  4MH0 E;  2KX0 A;  1WRD B;  1WX9 A;  2AYO B;  4KSL C;  1MG8 A;  5CTR C;  2GMI C;  4AP4 C;  2AWT A;  2KJH B;  2KDI A;  2KD0 A;  5JH5 C;  3ZVV A;  3A33 B;  1S3S G;  3RZW C;  4B9K A;  2ZPN A;  2EMT A;  2O2V A;  1JRU A;  4LCD E;  3V6E B;  2KLG A;  2JZ3 B;  2A4Z A;  3L16 A;  1KLV A;  1GUA B;  1AAR A;  4GDL B;  4PYZ A;  4WJQ A;  2AL3 A;  4AOF A;  1Z2M A;  4XZ4 A;  5E6P A;  1P9D U;  3OJ4 B;  3DBH I;  3CSF A;  4FN2 A;  1WXV A;  3NZU A;  4AWJ A;  4WJP A;  3N30 A;  4BFR A;  2D3G A;  2WYQ A;  3RD2 A;  4K1R B;  1I42 A;  2KK8 A;  1WJU A;  2Z0D B;  2ZJD A;  3CST A;  3ZIM A;  2BYE A;  4MGK E;  4NQK E;  1V86 A;  2B3A A;  1NBF C;  2LVO A;  3ZRC A;  1WM3 A;  4BOZ B;  1Q1O A;  4DHJ D;  3V62 A;  4MGZ E;  3OAW A;  2L0T A;  3UQA A;  4URK A;  1EF1 A;  1L7Y A;  2OOB B;  4PYU A;  2JY6 A;  4NNJ B;  5E6O A;  4HLE A;  2KC2 A;  3A4S C;  3ENE A;  5D94 A;  4DHJ B;  2MSE D;  3H7P B;  1YD8 U;  2XBB C;  3TMP B;  1OEY J;  3PS6 A;  4IC7 B;  1Q0W B;  3VQI A;  3QIJ A;  3NY5 A;  2LVP A;  5HKH A;  1ZKH A;  2A5U A;  3EHV A;  4GN1 A;  2KAN A;  4KDL B;  5IA7 A;  3ZNZ B;  1NI2 A;  2L0F A;  3QWZ B;  4FLH A;  1P98 A;  3V6C B;  1C3T A;  4KIK B;  3U30 A;  4BOS C;  3IHP C;  2C7H A;  3ZNI D;  1L2N A;  2ZVO A;  4DBG A;  3HM6 X;  4DDG D;  2KQS A;  1WIA A;  3T9L A;  3WAL A;  2KDE B;  4AJW A;  2ASQ A;  5C1Z A;  4FJY A;  2G4S A;  2I1J A;  3H7P A;  3PSE B;  2JPH A;  3VHT C;  3SD5 A;  3DPD A;  3ZO5 B;  2IBI B;  2LGY A;  2RPQ A;  4AUQ C;  3W1Y A;  2M0X A;  4FHJ A;  2NCN A;  2DAF A;  3QJZ A;  3RZF A;  1WGR A;  2LRU A;  4I6P A;  5J17 A;  1M94 A;  2MX2 A;  4W9L A;  2LXC A;  2JT4 B;  3ZTC A;  4HCP B;  3SU8 X;  3APD A;  2LJ5 A;  5E6N A;  3B1L X;  5J2R A;  1Z5S B;  4YL8 A;  3VFK A;  3DVN V;  3U7D A;  1WF9 A;  2RD0 A;  2MBH A;  4EKU A;  3OLM D;  3EEC A;  2JRH A;  4JL9 A;  4MGI E;  5GMV A;  3H9D A;  3KUZ A;  4TKN A;  2RR9 A;  4I6L B;  4W9F A;  4A3P A;  3KH0 A;  4HPM B;  2I1K A;  4PS3 A;  1E7U A;  1WJN A;  4DHZ B;  5L95 C;  1F9J A;  4MDK E;  3TIX A;  1I35 A;  3M3J A;  2FUH B;  3PT2 B;  1EO6 A;  1WGH A;  1U4A A;  4FJV B;  4G11 A;  5LLI A;  1V5O A;  1LFD A;  2DZJ A;  1PQS A;  2MBO A;  3ZDT A;  4MSQ B;  2BYV E;  2KOX A;  1E8Y A;  4XC2 A;  2HTH A;  5FR6 A;  4DK5 A;  2PE9 A;  2NBW B;  3UGB B;  2KC1 A;  3Q3F A;  4PS8 A;  4EOY A;  3DDC B;  2NVU I;  2KO3 A;  2DEN B;  2O2V B;  3QX1 A;  4NJ6 A;  2XK5 A;  3TL5 A;  2KNB A;  2CU1 A;  3MTN B;  4BBN F;  2BWF A;  2LI5 A;  2CHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...