2N1WA

Solution structure of human sumo2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
93
structure length
93
Chain Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human SUMO
rcsb
source organism Homo sapiens
molecule tags Structural genomics
molecule keywords Small ubiquitin-related modifier 2
total genus 18
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2015-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n1wA00
1V6EA 5C1ZA 4W9LA 3JVZX 1NI2A 1OEYA 2KMCA 3IG3A 3PSEB 3V61A 4AOFA 2C7HA 3VVWB 3RT3B 2KTRA 5AEKB 2NCNA 4W9EA 2CS4A 2FNJB 2KFKB 2Z0EB 1P9DU 2ZCBA 3EFUA 4YL8A 3NY5A 4ICUA 2FUHB 1IP9A 4G11A 1V81A 4CHKA 2DENB 2L00B 1D3ZA 1F9JA 2MP2B 1A5RA 1GC6A 1WM3A 4GU2A 4HPLB 2WYQA 2G4SA 2KX3A 2FCNA 4GSWA 2O6VB 1WGGA 2MCNB 3DDCB 3VHTC 3DBRI 2CHWA 2ZZPB 5AZFA 2LRWA 4E74A 3CF6E 3K9OB 3R66C 1V86A 3R7RA 1ZKHA 1SE9A 4RM9A 5EDSA 3EECA 2LVPA 2WX0A 3W1SC 2C7MB 2ZVOA 4PS7A 2V3SA 4RMAA 4AWJA 2W9NA 4BOSC 4URKA 3ML9A 1EF5A 1OEYJ 1Z2MA 2K6QA 4GMVA 3B0AA 3VTWA 2LVQA 4TQ1A 3ZRFA 2PE9A 3LJ3A 4ZYNA 1Y8RC 2V4LA 3ONSA 4WWNA 2PPHA 4DXAB 3ZKJC 4FJYA 3A33B 3JYUA 1E90A 3RZFA 1R4NI 2MX2A 2MBBB 3ZNID 3PRZA 4ANXA 1YJ1A 2XBBC 3ZDTA 5D7GA 2I1JA 2GBJA 1WR6E 5E6PA 1OGWA 4FA6A 2KQ7A 1OTRB 3AXCA 3ZIMA 1VD2A 4IM3A 3UGBB 3R7QA 1YD8U 2DAJA 2D10A 2REXA 3DVGY 2M8SA 2KDEB 2L05A 1P1AA 1WX8A 3L0WB 4FULA 3ENEA 5E6NA 1C3TA 2D07B 2R2OA 4BBNF 2AYOB 2D11A 4MELA 5BO4B 3S2AA 2LGYA 2CHZA 1GG3A 2NBVB 3ALBA 5JZEB 4KSLC 2AWTA 1UELA 4AP4C 4FHKA 3A9KA 2KTRB 3PGEA 4MGKE 2IO3B 2K8CA 4FJZA 2I1KA 3B08A 1WH3A 2ZPYA 3PHWB 4GDKA 4ZRKA 1E7UA 3L54A 1WF9A 2LJ5A 4FJVB 2PEAA 3APFA 1WMHA 3M63B 1WE6A 3CMMB 1P3QU 3N3KB 2NBUA 3ZVVA 4W9FA 2K8BA 4II2B 4XX5A 4WJNA 1I42A 3P2BA 2MW5A 4GXBA 3QX1A 3QJZA 1WRDB 2JY6A 1M94A 4MGZE 3HHMA 4JQWC 3H1UA 2BWFA 2LUEA 1Q0WB 1E7VA 4WAAA 3KW5B 1L7YA 1P0RA 3L08A 3PS6A 3A4SC 2O2VA 1BT0A 4TQ0A 3PLVA 2LXAA 4HDQA 4MSMB 2KFKA 2KJ6A 4HLEA 2V1YA 3N32A 5L95C 2D3GA 1TBEA 2L8JA 1P98A 2N7DA 1Z5SB 3NHEB 4TV3A 1PQSA 2G45B 1WE7A 2KO3A 4BBNC 5IA7A 4PS3A 4I6LB 4M8MA 2O6VA 4MJSA 2DHZA 2DYBA 1GNUA 3W1YA 1Q5WB 1AARA 5E6OA 3RUIB 5AZGA 1XQQA 4AJWA 2KWUB 1GC7A 1WJ4A 4IW0A 3QHTA 3T8MA 5KHQA 4GDLB 4BOZB 4W9HA 5CX3A 4EZJA 2N7EA 5JHAA 5D6JB 3T9LA 1OQYA 4G50A 2JRIB 3ZO5B 3MJWA 4WJPA 3I3TB 2LGDA 2C9WB 2ZNVB 2BYEA 4ANUA 1XT9B 3TCAA 5GMVA 3QC8B 4BKGA 5J17A 1S1QB 1WJNA 2GBKA 1E8YA 2DZKA 5CHVC 4KVGB 2R2QA 2M17A 3TL5A 2LZ6A 3SU8X 4IG7B 2GBMA 4PYZA 3ML8A 4HWIB 3QCAA 3QA8A 1WGDA 2K6DB 2MBEA 3HM3A 1WI0A 2ZPNA 4HCNB 2JF5A 1EO6A 4NQLB 3DVNV 4DHJB 3L10B 1FXTB 1GUAB 4K7UA 3APCA 3OAWA 1WJUA 3ZW3A 2YVCA 4W9JA 5G2NA 1WXAA 2M0XA 1YQBA 4IWPA 3U7DA 3ZNGC 3OLMD 4AUQC 1S3SG 4ICVA 3X0WA 3DOWA 4DHZB 2O2VB 4MH0E 2IZVB 1ZW7A 4EEWA 2Z59B 3A1QA 3PHXB 3NZUA 2IY0B 4FHJA 3IHPC 3DCGA 3MHSD 3NS8A 2FCSA 4K1RB 3VTVA 3H9DA 4EUTA 3HM6X 2IO2B 4K81A 1H8CA 3ECIA 2ZNVC 3HIZA 1WX9A 3BINA 2GOWA 2K1FA 3AU4A 2DZIA 4LCDE 2IBIB 4NJ7A 4WWPA 3RD2A 2BYFA 2MP2A 2BF8B 4JIOU 1LM8B 1Q1OA 3JW0X 4HCPB 2LVOA 3WALA 2DX5B 2N1WA 4HPMB 1WZ0A 3DPDA 4W9CA 3SD5A 4DK5A 2KFJA 2JZZA 3N30A 4MM3A 2ASQA 4W9IA 3H7SA 5LXIB 2KD0A 2MRPA 1TTNA 2FAZA 4W9DA 5CHFA 1UD7A 4XC2A 3VUWA 2KQSA 1LQBA 4ANWA 2XEWA 1WR1A 4F7ZA 4HDOA 1WYWB 2ZCCA 3QQ8B 4PS8A 3KUCB 3L13A 2LGXA 3V62A 3PZDA 5DPRA 2VRRB 1WX7A 5LXHA 2KC2A 3PPAA 3OJ3A 1WJ6A 2UYZB 3CSTA 3GOEA 4I6PA 4IM0A 2BYVE 2MLBA 5JH5C 2JWZA 5TR5A 2RGFA 2LXCA 3UF8A 3VFKA 1SIFA 2C7NB 3DBHI 4GDLA 4CYEA 3U30A 1WXMA 2KDIA 2L0FA 4P7IA 5D2MB 3VUYA 1LFDA 4F8CB 4B95A 5KHOA 2KDBA 1KJTA 3QARA 3AI5A 3KH0A 2MWSB 4FADA 2BWES 2GBRA 2KXJA 3A9KB 2KKCA 3VH3B 2IO1B 2HE7A 2MBOA 2N9PC 4DHZE 1WGYA 3TBLD 2KZRA 4HVBA 4E71A 3KVFB 2JZ3B 2FCMA 1I35A 1K8RB 3PTFC 2IY1B 2KK8A 1WMHB 2NBWB 2Y5BB 3L17A 4MEMA 5AZHA 4KSKC 3TIXA 2N1VA 4W9GA 4HJKA 4WJQA 5IAAC 4XZ4A 2K39A 1HE8A 1WGRA 2KANA 1LXDA 3UIPB 4G0NB 2K25A 2AEHA 4KV2A 3RYTA 3ZRCA 2G3QB 4GGQA 2HJ8A 4HK2A 3PVLA 4AJYB 5DPWA 3Q3FA 2WWZA 2L0TA 2JVCA 3M3JA 4FLHA 1KLVA 2EMTA 3WA0A 2NS5A 1J8CA 1UBIA 1V5OA 3IVFA 3VH4B 2QHOA 4G3XB 5J18A 3A1QB 4E3CA 2BGFA 3EHVA 4A3OA 4X57B 2A5UA 2KDFB 4OVVA 4FN2A 3AU5A 2BPSA 4GIVA 4LDTD 3PRPB 4WJOA 3WAMA 2DYOA 4BKSD 5HKHA 1H4RA 2DYMA 1V49A 5G55A 4EFOA 2CKHB 4CO7A 3AULA 5J2RA 1QZEA 3IFWB 1UH6A 3DVNU 1RLFA 1WXSA 4KZ0A 4WWOA 1J0GA 2EMSA 5JHBA 1C1YB 2DAFA 2IO0B 5DPSA 2KWCA 3C0RB 1ZGUB 3KUZA 1WIAA 4B6WA 2KJRA 2IYDB 2FIDA 2NPTA 4DDID 3PRMB 2JRHA 1U4AA 4I6NB 4IUMB 3SDLC 3IBEA 2KLCA 4GB9A 2GBNA 5DCNA 2DZJA 4MSQB 3R3MA 4LDTB 1MG8A 3X23A 3DVGX 4K7WA 3DBLI 2LWPA 2N9XA 3OJ4B 4IC7B 3BY4B 3U8ZA 2FIFA 1GJZA 1TGZB 2WDTB 2ZEQA 3QK0A 3VQIA 3EC8A 1WFYA 2XK5B 3QAQA 2RR9A 1RFAA 2XK5A 3A9JA 1V80A 1RAXA 3A9JB 2WX1A 2GMIC 4II3B 1R4MI 1UBQA 4GOCA 1EUVB 4IM2A 4NY0A 2UWQA 3UIOB 2KMAA 2O6VD 4ZDVA 1EF1A 2L7RA 1UGMA 2L76A 4M8NA 4W9KA 4MDKE 2M4NA 1J19A 2DZMA 3DQVA 4NAWA 2LI5A 5LLIA 3RZWC 2MBQA 2NVUI 1UZXB 3Q3JA 2EKEC 2RPQA 4KIKA 2J0MA 2MQJA 4KIKB 2J0JA 3ZTDA 2KJHB 2AL3A 1WGHA 1ISNA 2HTHA 2HD5B 3H7PA 1KM7A 3KYCD 4NPNA 3TJPA 5C23A 4DDGD 2M1MA 3TMPB 4FBJB 3D32A 1JRUA 3SHQA 3VAWA 4JGHB 2FCQA 2J7QB 2CU1A 2KNBA 3NOBA 2K8HA 2KLGA 4MGIE 4MGYE 4GDKB 2CR5A 4B9KA 4DHJD 4BVUC 3APDA 1V9JA 2J0KA 3HK0A 2N4FA 1VCBA 2RSUA 3ZNHB 3V6EB 4KDIC 5FR6A 1NDDA 4IWQA 3KUDB 3W1SA 4NQKE 2L3ZA 2NPTB 2JT4B 3PV1A 4TKNA 2KOXA 2MBHA 4K7SA 2G4DB 4ASWC 3PT2B 1NBFC 4KDLB 3ZTCA 4M0WB 2LD9A 2KX0A 2BKFA 1RRBA 4NNJB 1IPGA 3NZSA 2KN5A 3K9PB 4TUUA 5CHWA 2JXXA 4JL9A 2D2QA 4N9F4 1IYFA 2RD0A 4ZRJA 2LRUA 3ZUNA 4DWFA 2KTFA 3V6CB 3ZLZA 3QWZB 3A4RA 1V5TA 1E8ZA 3VUXA 3WANA 4KZCA 1E8XA 4WQOB 2NR2A 3MTNB 5D94A 4JLCA 3O65B 1TZ1A 2PJHA 4OVUA 2YLMA 2LASA 1E5WA 3WAPA 3WAOA 3RULA 4MJSB 3RCZA 3VDZA 2KVRA 4GN1A 1WY8A 2CHXA 4EKUA 1E8WA 1L2NA 3M62B 1WZ3A 4BKTA 4LJOB 1CMXB 3ZNZB 3PLUA 4NAWB 2JUOA 3V60A 4NJ6A 4A3PA 4BKSA 5L83A 4EZLA 2KC1A 3H7PB 3H6NA 2C60A 3JSVB 1YX5B 5DPTA 2PE6B 3JSVA 4A20A 2KHWB 2KWVB 3VTUA 2BKRB 2OJRA 3B1LX 4ANVA 2N9EB 2ZVNA 3GZNI 3KYDD 2ZJDA 4J6IA 3PREA 4IWOA 4ZRIA 1G6JA 1WXVA 1SGHA 1T0YA 3CSFA 5CTRC 2OOBB 3UQBA 4F1SA 2B3AA 3L16A 1X1MA 4PYUA 1V2YA 4RM8A 4HXDA 4EZKA 3UQAA 1KOTA 2Z0DB 4DBGA 3WIMA 2C5LC 3ZDMC 3DBSA 4BFRA 4EOYA 4LJPB 1WM2A 3M95A 2MA9B 2A4ZA 1XD3B 2AL6A 3VXWA 2MSED 3LDZE 3UINB 1YX6B 3QIJA 1YIWA 2JPHA
chains in the Genus database with same CATH superfamily
4RNAA 1FD6A 3IG3A 3VVWB 5AEKB 4W9EA 2FNJB 2CJNA 2KMMA 3EFUA 1K51A 2NTTA 2L00B 3N1ZC 1A5RA 3AE6B 1EM7A 1TIFA 2G4SA 5E6JA 5HI1A 2O6VB 3DBRI 2LRWA 3K9OB 1JWBD 3R66C 1ZKHA 1SE9A 4AWJA 3P1MA 1D6EC 2K6QA 1FFVA 4ZHPA 3DHHC 3ZRFA 4TQ1A 3LJ3A 4WWNA 5AUKA 1E6EB 4FJYA 3A33B 4CQNA 3RZFA 2X38A 1UGJA 1YJ1A 2XBBC 3ZDTA 2I1JA 1OTRB 4IM3A 4MH8A 3R7QA 1YD8U 4ZYSA 2DAJA 2D10A 2REXA 3DVGY 3I57A 4XWTA 1P1AA 4LNKA 1C3TA 4US8A 2AQ3B 2D11A 5BO4B 2BT6A 2CHZA 1JWSD 1GG3A 1KRHA 2LGSA 4D2KA 2AWTA 4AP4C 4FHKA 2J42A 1WH3A 2LUMA 1JMLA 2PEAA 1XLOA 1PGBA 4YWGG 4AS1A 1WE6A 3CMMB 2N0SB 2ON8A 4Q2JA 1CQVA 4USAA 1J7BA 1F2RI 2MW5A 3QJZA 3HHMA 2BWFA 1E7VA 1L7YA 3EUB2 3DBRB 1ZXHA 4OW0A 2Y5CA 5BYQA 3PLVA 4LTUA 4BZAA 2KJ6A 1T3QA 2EELA 2L8JA 2N7DA 4TV3A 4JX1C 4PS3A 2Y5PA 2DYBA 3MC0B 1GNUA 2MEKA 5E6OA 2WU2B 4L2YA 5KHQA 1AN8A 4W9HA 5CX3A 1QQRA 3ZO5B 4WJPA 2C9WB 3RNEC 5J17A 1S1QB 1E8YA 2DZKA 3TUOA 4KVGB 1E9MA 2MH7A 3E9SA 3ML8A 1WSPA 2ZPNA 4HCNB 2JF5A 1EO6A 3DVNV 4DHJB 4K7UA 2PVOD 1WJUA 3ZW3A 2DWQA 1YMHE 2V3PA 4W9JA 5G2NA 1YQBA 1YOVB 4RFBA 4OZBA 2O2VB 3PHXB 3MHSD 3VTVA 3H9DA 4RGTA 1WYGA 2BF8B 2J4XA 1D5XC 1HQRD 2LVOA 3SD5A 4DK5A 2JZZA 3N30A 2B76B 5LXIB 2MRPA 1TTNA 1UD7A 1T0RC 3VUWA 2KQSA 2LFIA 1WR1A 4F7ZA 1OFFA 2MHJA 2WLBA 3C8YA 3KUCB 3L13A 4FXCA 2L83A 2HDEA 2VRRB 1JROA 3CSTA 3N1XC 3GP7A 3P63A 4I6PA 4IM0A 2BYVE 2MLBA 5JH5C 2WXPA 3ZQ4A 5H92C 3DBHI 4C4VB 4CYEA 1WXMA 4P7IA 1N60A 3PZ7A 2WXJA 3AI5A 2RPVA 2KKCA 1VZ8A 2HE7A 1SSNA 2KZRA 1K8RB 3TIXA 5AZHA 1XXGA 1MG4A 2PVGC 5IAAC 4XZ4A 1FXIA 1HE8A 4LNNA 3ZRCA 1WXQA 3PVLA 4AJYB 5DPWA 2WWZA 3VRBB 1KLVA 1FRDA 2EMTA 4K3CA 3WA0A 1J8CA 1V5OA 3VR8B 2J52A 5H8YE 3A1QB 4E3CA 3FC4A 4OVVA 2BPSA 3BVGA 4LDTD 3WAMA 2DYOA 2DYMA 1V49A 4CO7A 3AULA 4TMAB 1KTKA 2BTEA 5EE3A 4ZRPA 3DVNU 4KZ0A 1L6UA 3Q8BA 3C0RB 1ZGUB 2NMQA 1WIAA 2IYDB 2FIDA 2NPTA 1F0ZA 2JRHA 4YSXB 4IUMB 3SDLC 1L0YB 3R3MA 5BYSA 1MG8A 1QLBB 3X23A 3AM9A 2LWPA 1SE3A 3AMZA 2MJ3A 2FIFA 3VQIA 2JWUA 1BMLC 1PYWD 3RNCC 1I4RA 1L5PA 3TSSA 2W55A 2O6VD 2L7RA 2CU3A 4W9KA 4MDKE 4RF1A 2M4NA 1ZDXA 2SEBD 4S0RA 3RZWC 3Q8FA 4KIKA 2J0MA 4KIKB 1NYRA 1WGHA 2HTHA 3H7PA 3TMPB 1YJIA 1ZE3D 4FBJB 3AE3B 1V1PB 4JGHB 2CU1A 3NOBA 4LNFA 2CR5A 4M00A 4DHJD 4BVUC 2J0KA 5IN7A 2RSUA 2WXHA 1TT5B 1R4MB 1NDDA 4NQKE 1LO5D 2L3ZA 2JT4B 2KOXA 4DQOC 4HKZE 1NBFC 3E56A 2IDYA 2N9KA 4M0WB 1RRBA 1IPGA 3NZSA 5MPOA 2WGSA 5CHWA 4JWUC 2JXXA 2D2QA 4ZRJA 2GI9A 1V5TA 4KZCA 2NR2A 4JLCA 1QOAA 3RULA 3RCZA 2HTME 1E8WA 4LJOB 1CMXB 2JUOA 3Q8EA 4NJ6A 4P1BC 5L83A 2EKIA 1CZPA 1UWXA 3MC8A 2C60A 4DXFA 1SF0A 1YX5B 5DPTA 4YTPB 2BKRB 2M19A 2N9EB 3KYDD 4RCOA 4IWOA 2AQ2B 1SGHA 2B3AA 3L16A 4RM8A 3P42A 3ZDMC 1WWTA 2GRIA 5EE1A 3RI7C 1FXAA 2MSED 3QIJA 1YIWA 3DWGC 1V6EA 1NI2A 2KMCA 3PSEB 4RGMA 2INCC 4AOFA 1K53A 2NCNA 2Z0EB 2LHEA 1IUEA 1ENFA 4ICUA 3DHIC 4YSZB 5BMIA 1D3ZA 2OHFA 1GC6A 5D3DA 1WM3A 4GU2A 4HPLB 2WYQA 3AEFB 3I63C 1WGGA 2MCNB 2BS2B 3DDCB 2CHWA 3EFCA 4IDIA 2JX5A 4RM9A 5EDSA 1C78A 1ZOYB 2WX0A 4RMAA 2W9NA 4URKA 1OEYJ 4GMVA 2KACA 2LVQA 3P4RB 4KKIA 4ZYNA 3AEDB 4DXAB 3WCQA 1KLUD 4MT5A 2WP9B 2MX2A 1CK1A 2JZPA 4H2AA 2GBJA 4FA6A 5JXVA 3ZIMA 1VD2A 3AB5A 3T3NA 1D5MC 4XE0A 1I4XA 4BBNF 2NBVB 3ALBA 4KSLC 1UELA 3A9KA 2KTRB 1ZDVA 4MGKE 3P4PB 3PHWB 4GDKA 4ZRKA 3AEAB 1TS3A 3BK1A 4WQMA 1N62A 4A9AA 1WMHA 3ZJVA 1L4DB 3DHGC 2K8BA 4II2B 4GXBA 4C7YA 3BWUD 4J3OD 4IKGA 2LUEA 1SEBD 3KW5B 3RNAC 3L08A 3A4SC 4TQ0A 3FAHA 4HDQA 3Q14C 1SBBB 2UU7A 3URYA 2AQ1B 1JWAD 1HTQA 4HLEA 3EA6A 1Z5SB 4I6LB 2O6VA 2G9HD 5GXGB 2KYWA 4AJWA 1R4NB 1GC7A 3QHTA 4AQ7A 4BOZB 2V9HA 3W9CB 4EZJA 4LNOA 3GS2A 4G50A 3MJWA 4S17A 1TJEA 2ZNVB 2BYTA 1FCLA 1XT9B 3TCAA 3QC8B 1WJNA 4JWSC 2GBKA 2ONQA 3RN9C 5CHVC 2LZ6A 1JCKB 2GBMA 3QCAA 1OQQA 1WGDA 1WI0A 3AE7B 3L10B 3OAWA 3OWEB 1ET6A 3ZNGC 3OLMD 1A70A 3X0WA 2K3UA 1FM0D 2TSSA 1QOBA 2IZVB 3A1QA 3NZUA 2KAJA 2L1AA 3IHPC 3DCGA 4K1RB 4EUTA 1K52A 1YJJA 1H8CA 4RGNA 4KGSA 2IGHA 2DZIA 4WWPA 2MP2A 3BYYB 2BQQA 3KLSX 1L0XB 1LM8B 4PT5A 4A6QA 2DX5B 4HJGE 1WZ0A 3DPDA 4W9CA 2QEJC 4MM3A 4W9IA 2KD0A 2OEDA 4W9DA 4XC2A 3KWVA 1WYWB 2ZCCA 2X8XX 4PS8A 4ZRQA 2LGIA 3P4SB 3GZNB 4RF0A 1HZ5A 5LXHA 3PPAA 1AYFA 3OJ3A 1SIJA 2BB5A 5G5GA 2RMMA 2INDC 3VFKA 1DGJA 4GDLA 3NVVA 2KDIA 2KVZA 5D2MB 2KT7A 4B95A 5KHOA 5TSSA 3QARA 2MWSB 4B0EA 2KXJA 3R2TA 3OG5A 1YNTE 2MBOA 3GB1A 4R3DA 1FO4A 2R61A 3NS1A 3FKYA 1VLBA 2KK8A 3L17A 4MEMA 4KSKC 4W9GA 2LHDA 1WGRA 1DOIA 2K25A 4KV2A 3Q3FA 3TEZA 2JVCA 2W3SA 3M3JA 1UBIA 2QHOA 3U7ZA 3Q8AA 2BGFA 3EHVA 4A3OA 3PO0A 3ETRA 4X57B 4FN2A 3AU5A 4GIVA 3I9V1 1V1PA 4YT0B 3Q69A 4EFOA 5J2RA 3IFWB 2ZW1A 1WXSA 5JHBA 2IO0B 5DPSA 1MVKA 2KWCA 4OZCA 3DWMA 2KJRA 1ZP0B 2QJLA 4DDID 1Q10A 1XF5L 3DVGX 1HEZE 3BY4B 3NG0A 1B1ZA 3HVZA 3QK0A 3NZ3A 3EC8A 3LB8C 2XK5A 3IAS1 3A9JA 1C76A 2WX1A 1TKYA 1R4MI 3R8BA 1UBQA 4GOCA 4N6EB 4IM2A 2WXKA 4C80A 4JPSA 4NY0A 3RMKC 4ZHOA 2KMAA 2WXFA 1EF1A 2JQRB 3MJ5A 4M8NA 1J19A 2LI5A 3B2FA 2NVUI 2EKEC 2N9LA 2MQJA 2MJDA 3ZTDA 2AL3A 3TJPA 3KYCD 1C9FA 4NPNA 4DDGD 1HTOA 3D32A 2FCQA 2KNBA 4MGYE 4B9KA 2IPKD 3HK0A 1VCBA 3ZNHB 3V6EB 5FR6A 4LK0M 2JSVX 1GB4A 1QKZA 2QIEB 1E7PB 1ET9A 4NNJB 4JL9A 4N9F4 2LRUA 3ZUNA 3A4RA 1E8ZA 3Q3OC 1ACCA 3VUXA 1E8XA 1HA5A 5D94A 2PJHA 1E5WA 1QT9A 3WAOA 2KN4A 2BW2A 3VDZA 4WH4A 1WY8A 1L2NA 1T0SC 3M62B 3ZNZB 3HUIA 3PLUA 4ARCA 4WWMA 3H6NA 1RWSA 1MI0A 1IBXA 3BYTB 4YXDB 2QDFA 1YN4A 4ANVA 2QCZA 1G6JA 3BVMA 5FK9C 3MHZA 4F1SA 1EWYC 1TZOA 2WU5B 1KOTA 1MFWA 4DBGA 2WXGA 4XYCA 4XWWA 3M95A 2MA9B 2PW9A 4HPPA 2D3CA 1DOXA 1UUPA 2JPHA 4KGRA 3V05A 1N5WA 5C1ZA 3V61A 1FRRA 2C7HA 1ZXIA 2KTRA 3IAM1 2CS4A 4YL8A 1P9DU 3ZXVA 3NY5A 3LXFA 1N63A 3NJTA 2VZKB 2DENB 5AUIA 3VHTC 2ZZPB 3CF6E 3EGRA 2LVPA 2PIAA 3BVZA 2ZVOA 2V3SA 2JU6X 4KX6B 4IOIE 1Z2MA 3B0AA 5HFYA 3VTWA 4GLSC 2PE9A 3AEGB 2PPHA 1DOYA 3ZKJC 1NENB 1E90A 2MBBB 3C19A 3ZNID 3PRZA 3DBLB 2H88B 1WR6E 5E6PA 2KQ7A 2W82A 3AXCA 3UGBB 2KDEB 1YQ4B 2DLBA 2NTSA 3L0WB 1WX8A 1EWCA 3ENEA 2D07B 1BUIC 4MELA 5JZEB 1FEHA 1WGKA 3PGEA 2IO3B 4FJZA 3B08A 2K5PA 2WXOA 1FFUA 5I4DA 5G5HA 3M63B 3W5UB 3N3KB 4XX5A 4NZLB 4WJNA 1I42A 3IT4B 4MGZE 4JQWC 2D3BA 4N58A 1IGCA 1Q0WB 4MM3B 1IGDA 4P16A 1P0RA 2PTLA 2WXNA 3NRZA 2JXTA 2LXAA 2IGDA 2KFKA 3N32A 5T8IA 1P98A 3NHEB 2K9XA 2VH1A 1WE7A 4BBNC 3AECB 4MJSA 1AARA 1XQQA 1C4PA 1VZ7A 3N9YC 1N5XA 1WJ4A 4IW0A 3T8MA 3U52E 4GDLB 2N7EA 1C4AA 2YEPF 2JRIB 3GE3C 1UWMA 3I3TB 2L52A 1QOFA 2BYEA 4ANUA 5GMVA 1PFDA 4BKGA 4YTMB 3AE4B 1JQ4A 4HKQA 3FILB 3LYYA 3SU8X 4PYZA 1TKEA 2MBEA 2K6DB 2RDGA 2WDQB 3HM3A 1GAQB 1M4VA 2D3AA 3APCA 3Q8CA 5BYRA 1WXAA 4HEA1 4IWPA 4ICVA 3IT6B 1D4BA 4MH0E 1ZW7A 3VRAB 1VDVA 2Z59B 1SE4A 2IO2B 3NVYA 3W5VB 2VH2A 1NVID 3HIZA 1KFYB 1WX9A 3AV8A 2GOWA 3AU4A 4LCDE 4NJ7A 4JIOU 2WQYB 3I5JC 4L23A 2WDVB 4ARIA 3JW0X 3WALA 2GLSA 2N1WA 4HRSA 1L0VB 1E10A 3L4PA 3BK2A 2L32A 2FAZA 1QOGA 1AWDA 3V62A 5DPRA 1WX7A 2E3TA 2KC2A 2UYZB 4XDCA 3AEBB 4C4VA 2C7NB 3NVZA 2L0FA 3VUYA 1LFDA 1KJTA 1R7SA 1LGRA 2GBRA 2QSDA 2IO1B 2I38A 4DHZE 3TBLD 4HVBA 1J7CA 2BVCA 3KVFB 2JZ3B 2FCMA 2J53A 2Y5BB 4XDDA 1VR9A 4HJKA 4A55A 2K39A 2KANA 5BMHA 2G3QB 5C3JB 4HK2A 3VR9B 2L0TA 1SJHD 1MHXA 1YQ3B 3BZDB 2NS5A 2XN9C 3VH4B 1ROEA 1UF0A 5FKAC 4BKSD 3PRPB 2AX5A 5C2TB 1H4RA 4A90A 5G55A 2CKHB 2WS3B 1QZEA 1C79A 4WWOA 2HJ1A 1V8CA 3BIID 1C1YB 1GOZA 4M02A 3KUZA 4QAYA 1MHHE 1TY2A 1QF6A 1U4AA 4I6NB 3IBEA 4GB9A 2GBNA 1XCQL 5DCNA 4MSQB 4LDTB 2GB1A 1V1OA 3OJ4B 4IC7B 1TGZB 1FNWA 1OQRA 3QAQA 2PLPA 1RFAA 2RR9A 5D3IB 1V80A 1FNUA 2GMIC 3ABVB 2UWQA 3N1YC 2V0GA 4ZDVA 3U2SC 1FMAD 2WXLA 1UGMA 3DQVA 4NAWA 5LLIA 2MBQA 1UZXB 2BS3B 3RPFC 2KJHB 1ISNA 1XLNA 2HD5B 1KM7A 1XO3A 1N61A 1NYQA 2XNAC 3VAWA 2KWDA 2K8HA 4MGIE 4GDKB 2W3RA 5BMGA 1TS4A 3APDA 1V9JA 1XEEA 2N4FA 1I4HA 3SEBA 3HVDA 3PV1A 2WXQA 2G4DB 3O13A 3PT2B 4KDLB 1F77A 3ZTCA 3TEYA 4TSSA 2LD9A 2KX0A 2BKFA 1FIQA 3K9PB 4ITKA 3MC9A 3B2GA 4DWFA 3AE2B 3V6CB 3QWZB 3Q2AC 2E6XA 2MJEA 2DBYA 4WQOB 3AE9B 3MTNB 3O65B 2N7JA 4OVUA 2YLMA 2LASA 3WAPA 1PGXA 3PZ8A 1C77A 4EKUA 2CHXA 4BKTA 4A3PA 3GE8C 1I4GA 5IOIA 3J9CA 3JSVB 2PE6B 3JSVA 2KHWB 3VTUA 2CJOA 2ZVNA 2KQ4X 2ZJDA 4K3BA 3CSFA 1T6BX 3UQBA 4PYUA 4HXDA 2Z0DB 3WIMA 2C5LC 4EOYA 4LJPB 4UDUC 1WM2A 4LLGM 1L4ZB 1JALA 4HROA 2A4ZA 2AL6A 4YSYB 3NVWA 1F2RC 3VXWA 3LDZE 1YX6B 3AN1A 1T0YA 4W9LA 3JVZX 1OEYA 2PKOA 4US9A 1RM6C 3SFEB 2Y3AA 3RT3B 1GB1A 3U8ZA 2KFKB 2G1EA 2ZCBA 2FUHB 1HZ6A 3AE1B 4G11A 1IP9A 1SXTA 1XLQA 1V81A 4CHKA 1F9JA 2MP2B 5EE0A 2KX3A 2ICIA 2FCNA 4GSWA 5FR3A 2BBCA 5AZFA 1EU4A 4E74A 1P7EA 1STEA 1V86A 3R7RA 2LMCA 4O1NA 3EECA 3W1SC 2C7MB 4PS7A 4BOSC 3ML9A 1EF5A 1CJEA 2JYTA 5HHDG 1Y8RC 2V4LA 3ONSA 3SR6A 3AE8B 4XGAB 1KLGD 3ZGZA 3JYUA 1R4NI 3ZJUA 4ANXA 1PGAA 5D7GA 3T3OA 1OGWA 1NI3A 3R2IA 2VZKD 2V4IB 2M8SA 2L05A 2IGGA 5IO9A 5E6NA 4FULA 3V3XA 2R2OA 2AYOB 3S2AA 3TEXA 2LGYA 3N20C 3ZYYX 4RGOS 1VZ6A 1JW9D 2K8CA 2WHIA 2I1KA 2ZPYA 1WRIA 1E7UA 3L54A 1WF9A 4NJCA 4ACFA 2LJ5A 2RDHA 3FILA 4FJVB 3U4EG 5IKCM 3APFA 1P3QU 1VJKA 2NBUA 3ZVVA 4W9FA 1P7FA 3P2BA 3QX1A 1WRDB 2JY6A 1M94A 1TS2A 2INPE 2LEKA 3H1UA 2K0PA 3AE5B 4WAAA 2DNFA 3PS6A 2O2VA 1BT0A 2FBWB 4MSMB 2V1YA 1ZUD2 5L95C 2D3GA 1TBEA 4OHJA 1PQSA 1I4QA 2G45B 2KO3A 1B9RA 1JWMD 4RH6A 2PMVA 4N59A 5IA7A 4M8MA 3W1YA 2DHZA 1Q5WB 3RUIB 5AZGA 2KWUB 1SE2A 1VRAB 5JHAA 5D6JB 3T9LA 1OQYA 1ZPSA 1QILA 4LNIA 2LGDA 2INNE 1BXTA 3P4QB 2IJ0A 4BAXA 2M0AA 2R2QA 2M17A 3TL5A 4IG7B 4HWIB 3QA8A 2SAKA 1K50A 4NQLB 1FXTB 1GUAB 1T5XD 2BS4B 3HRDD 2YVCA 1PDXA 2QC8A 2M0XA 2Z8LA 1PUTA 3U7DA 4C7ZA 4AUQC 1S3SG 4DHZB 3DOWA 4WAFA 4EEWA 5LNK1 2K22A 2IY0B 4FHJA 1L6VA 3NS8A 2FCSA 3UI3A 3HM6X 4K81A 3ECIA 2ZNVC 3BINA 2K1FA 2IBIB 1N6ZA 3RD2A 2BYFA 1V97A 1ESFA 4ZOHC 3CIRB 1Q1OA 4HCPB 2H89B 3MP9A 4HPMB 3CWIA 2KFJA 1XLPA 2FUG1 4OVZA 4M01A 2ASQA 3H7SA 1SJED 5CHFA 1KF6B 1LQBA 4ANWA 2XEWA 3Q3NC 4HDOA 3QQ8B 3MFGA 2LGXA 4A8XC 3PZDA 3ZXRA 1TYGB 1RYJA 1WJ6A 3GOEA 2JWZA 3RNGC 5TR5A 2RGFA 2LXCA 3UF8A 1SIFA 3U30A 3RNFC 4F8CB 1F1HA 2KDBA 3KH0A 4FADA 2ZW0A 2BWES 3A9KB 3VH3B 1YN5A 1RFKA 2N9PC 1JRPA 1WGYA 4E71A 1FNVA 1I35A 2RDBC 1SB3C 1TS5A 3PTFC 2IY1B 4B0MA 4JE3B 2NBWB 1WMHB 2W54A 4DXGA 2N1VA 4WJQA 4EE2A 3B9JA 1MJDA 4OZAA 4NAMA 1LXDA 3UIPB 4G0NB 2I2YA 3RYTA 2AEHA 2WDRB 4GGQA 2HJ8A 4FLHA 2WXMA 3Q6BA 3IVFA 2WXRA 3TEWA 4G3XB 5J18A 2YEPB 4M0WA 4WURA 3W2DA 1D5ZC 2A5UA 2KDFB 4WJOA 5HKHA 3Q3MC 1F52A 5HG2A 4KKJA 1UH6A 1J0GA 1RLFA 3KWLA 4WIPA 2EMSA 1DYQA 2DAFA 4B6WA 1I7HA 1J7AA 3RNBC 3PRMB 2KLCA 2DZJA 4K7WA 3DBLI 2D5GA 2N9XA 3NUHB 1TKGA 1GJZA 2WDTB 2ZEQA 4P1CC 1WFYA 2XK5B 3A9JB 1RAXA 4II3B 1NEKB 4REZA 1EUVB 5IP4D 3UIOB 2L76A 2DZMA 4MACA 3Q3JA 2RPQA 1EU3A 2J0JA 1I4PA 5C23A 2M1MA 1C4CA 1JRUA 3SHQA 2J7QB 1YN3A 2KLGA 2WXIA 1TY0A 3AEEB 4KDIC 1GPXA 4IWQA 2ACZB 2Q5WD 2M56B 3KUDB 3W1SA 2NPTB 4TKNA 4L1BA 2MBHA 4K7SA 3KQ4A 1KH0A 3DBHB 4ASWC 5EE9A 1E0ZA 4PK1A 2OJWA 3H8HA 2QILA 3IXSA 4YTNB 4TUUA 2JYEA 2KN5A 1IYFA 2RD0A 1Y56A 2KTFA 3ZLZA 1FPYA 3WANA 1FCCC 2V3NA 2QMTA 1TZ1A 1XCTL 4MJSB 4C00A 4KGTA 2KVRA 4GN1A 1HXYD 4C56C 1MPEA 1WZ3A 4P6VF 2FE8A 4NAWB 3V60A 4BKSA 2LJIA 4EZLA 2KC1A 3H7PB 4A20A 2KWVB 2OJRA 1IBXB 3AH7A 3B1LX 1T0QC 3GZNI 4J6IA 4ZRIA 3PREA 1WXVA 5CTRC 2OOBB 2KDMA 1X1MA 1V2YA 4EZKA 3UQAA 3DBSA 4BFRA 1AW7A 1XD3B 2WNMA 1UNSA 3UINB 3ZJTA 2BB6A 1JWUD 3SFDB 3RFZB
chains in the Genus database with same CATH topology
1V6EA 5C1ZA 4W9LA 3JVZX 1NI2A 1OEYA 2KMCA 3IG3A 3PSEB 3V61A 4AOFA 2C7HA 3VVWB 3RT3B 2KTRA 5AEKB 2NCNA 4W9EA 2CS4A 2FNJB 2KFKB 2Z0EB 1P9DU 2ZCBA 3EFUA 4YL8A 3NY5A 4ICUA 2FUHB 1IP9A 4G11A 1V81A 4CHKA 2DENB 2L00B 1D3ZA 1F9JA 2MP2B 1A5RA 1GC6A 1WM3A 4GU2A 4HPLB 2WYQA 2G4SA 2KX3A 2FCNA 4GSWA 2O6VB 1WGGA 2MCNB 3DDCB 3VHTC 3DBRI 2CHWA 2ZZPB 5AZFA 2LRWA 4E74A 3CF6E 3K9OB 3R66C 1V86A 3R7RA 1ZKHA 1SE9A 4RM9A 5EDSA 3EECA 2LVPA 2WX0A 3W1SC 2C7MB 2ZVOA 4PS7A 2V3SA 4RMAA 4AWJA 2W9NA 4BOSC 4URKA 3ML9A 1EF5A 1OEYJ 1Z2MA 2K6QA 4GMVA 3B0AA 3VTWA 2LVQA 4TQ1A 3ZRFA 2PE9A 3LJ3A 4ZYNA 1Y8RC 2V4LA 3ONSA 4WWNA 2PPHA 4DXAB 3ZKJC 4FJYA 3A33B 3JYUA 1E90A 3RZFA 1R4NI 2MX2A 2MBBB 3ZNID 3PRZA 4ANXA 1YJ1A 2XBBC 3ZDTA 5D7GA 2I1JA 2GBJA 1WR6E 5E6PA 1OGWA 4FA6A 2KQ7A 1OTRB 3AXCA 3ZIMA 1VD2A 4IM3A 3UGBB 3R7QA 1YD8U 2DAJA 2D10A 2REXA 3DVGY 2M8SA 2KDEB 2L05A 1P1AA 1WX8A 3L0WB 4FULA 3ENEA 5E6NA 1C3TA 2D07B 2R2OA 4BBNF 2AYOB 2D11A 4MELA 5BO4B 3S2AA 2LGYA 2CHZA 1GG3A 2NBVB 3ALBA 5JZEB 4KSLC 2AWTA 1UELA 4AP4C 4FHKA 3A9KA 2KTRB 3PGEA 4MGKE 2IO3B 2K8CA 4FJZA 2I1KA 3B08A 1WH3A 2ZPYA 3PHWB 4GDKA 4ZRKA 1E7UA 3L54A 1WF9A 2LJ5A 4FJVB 2PEAA 3APFA 1WMHA 3M63B 1WE6A 3CMMB 1P3QU 3N3KB 2NBUA 3ZVVA 4W9FA 2K8BA 4II2B 4XX5A 4WJNA 1I42A 3P2BA 2MW5A 4GXBA 3QX1A 3QJZA 1WRDB 2JY6A 1M94A 4MGZE 3HHMA 4JQWC 3H1UA 2BWFA 2LUEA 1Q0WB 1E7VA 4WAAA 3KW5B 1L7YA 1P0RA 3L08A 3PS6A 3A4SC 2O2VA 1BT0A 4TQ0A 3PLVA 2LXAA 4HDQA 4MSMB 2KFKA 2KJ6A 4HLEA 2V1YA 3N32A 5L95C 2D3GA 1TBEA 2L8JA 1P98A 2N7DA 1Z5SB 3NHEB 4TV3A 1PQSA 2G45B 1WE7A 2KO3A 4BBNC 5IA7A 4PS3A 4I6LB 4M8MA 2O6VA 4MJSA 2DHZA 2DYBA 1GNUA 3W1YA 1Q5WB 1AARA 5E6OA 3RUIB 5AZGA 1XQQA 4AJWA 2KWUB 1GC7A 1WJ4A 4IW0A 3QHTA 3T8MA 5KHQA 4GDLB 4BOZB 4W9HA 5CX3A 4EZJA 2N7EA 5JHAA 5D6JB 3T9LA 1OQYA 4G50A 2JRIB 3ZO5B 3MJWA 4WJPA 3I3TB 2LGDA 2C9WB 2ZNVB 2BYEA 4ANUA 1XT9B 3TCAA 5GMVA 3QC8B 4BKGA 5J17A 1S1QB 1WJNA 2GBKA 1E8YA 2DZKA 5CHVC 4KVGB 2R2QA 2M17A 3TL5A 2LZ6A 3SU8X 4IG7B 2GBMA 4PYZA 3ML8A 4HWIB 3QCAA 3QA8A 1WGDA 2K6DB 2MBEA 3HM3A 1WI0A 2ZPNA 4HCNB 2JF5A 1EO6A 4NQLB 3DVNV 4DHJB 3L10B 1FXTB 1GUAB 4K7UA 3APCA 3OAWA 1WJUA 3ZW3A 2YVCA 4W9JA 5G2NA 1WXAA 2M0XA 1YQBA 4IWPA 3U7DA 3ZNGC 3OLMD 4AUQC 1S3SG 4ICVA 3X0WA 3DOWA 4DHZB 2O2VB 4MH0E 2IZVB 1ZW7A 4EEWA 2Z59B 3A1QA 3PHXB 3NZUA 2IY0B 4FHJA 3IHPC 3DCGA 3MHSD 3NS8A 2FCSA 4K1RB 3VTVA 3H9DA 4EUTA 3HM6X 2IO2B 4K81A 1H8CA 3ECIA 2ZNVC 3HIZA 1WX9A 3BINA 2GOWA 2K1FA 3AU4A 2DZIA 4LCDE 2IBIB 4NJ7A 4WWPA 3RD2A 2BYFA 2MP2A 2BF8B 4JIOU 1LM8B 1Q1OA 3JW0X 4HCPB 2LVOA 3WALA 2DX5B 2N1WA 4HPMB 1WZ0A 3DPDA 4W9CA 3SD5A 4DK5A 2KFJA 2JZZA 3N30A 4MM3A 2ASQA 4W9IA 3H7SA 5LXIB 2KD0A 2MRPA 1TTNA 2FAZA 4W9DA 5CHFA 1UD7A 4XC2A 3VUWA 2KQSA 1LQBA 4ANWA 2XEWA 1WR1A 4F7ZA 4HDOA 1WYWB 2ZCCA 3QQ8B 4PS8A 3KUCB 3L13A 2LGXA 3V62A 3PZDA 5DPRA 2VRRB 1WX7A 5LXHA 2KC2A 3PPAA 3OJ3A 1WJ6A 2UYZB 3CSTA 3GOEA 4I6PA 4IM0A 2BYVE 2MLBA 5JH5C 2JWZA 5TR5A 2RGFA 2LXCA 3UF8A 3VFKA 1SIFA 2C7NB 3DBHI 4GDLA 4CYEA 3U30A 1WXMA 2KDIA 2L0FA 4P7IA 5D2MB 3VUYA 1LFDA 4F8CB 4B95A 5KHOA 2KDBA 1KJTA 3QARA 3AI5A 3KH0A 2MWSB 4FADA 2BWES 2GBRA 2KXJA 3A9KB 2KKCA 3VH3B 2IO1B 2HE7A 2MBOA 2N9PC 4DHZE 1WGYA 3TBLD 2KZRA 4HVBA 4E71A 3KVFB 2JZ3B 2FCMA 1I35A 1K8RB 3PTFC 2IY1B 2KK8A 1WMHB 2NBWB 2Y5BB 3L17A 4MEMA 5AZHA 4KSKC 3TIXA 2N1VA 4W9GA 4HJKA 4WJQA 5IAAC 4XZ4A 2K39A 1HE8A 1WGRA 2KANA 1LXDA 3UIPB 4G0NB 2K25A 2AEHA 4KV2A 3RYTA 3ZRCA 2G3QB 4GGQA 2HJ8A 4HK2A 3PVLA 4AJYB 5DPWA 3Q3FA 2WWZA 2L0TA 2JVCA 3M3JA 4FLHA 1KLVA 2EMTA 3WA0A 2NS5A 1J8CA 1UBIA 1V5OA 3IVFA 3VH4B 2QHOA 4G3XB 5J18A 3A1QB 4E3CA 2BGFA 3EHVA 4A3OA 4X57B 2A5UA 2KDFB 4OVVA 4FN2A 3AU5A 2BPSA 4GIVA 4LDTD 3PRPB 4WJOA 3WAMA 2DYOA 4BKSD 5HKHA 1H4RA 2DYMA 1V49A 5G55A 4EFOA 2CKHB 4CO7A 3AULA 5J2RA 1QZEA 3IFWB 1UH6A 3DVNU 1RLFA 1WXSA 4KZ0A 4WWOA 1J0GA 2EMSA 5JHBA 1C1YB 2DAFA 2IO0B 5DPSA 2KWCA 3C0RB 1ZGUB 3KUZA 1WIAA 4B6WA 2KJRA 2IYDB 2FIDA 2NPTA 4DDID 3PRMB 2JRHA 1U4AA 4I6NB 4IUMB 3SDLC 3IBEA 2KLCA 4GB9A 2GBNA 5DCNA 2DZJA 4MSQB 3R3MA 4LDTB 1MG8A 3X23A 3DVGX 4K7WA 3DBLI 2LWPA 2N9XA 3OJ4B 4IC7B 3BY4B 3U8ZA 2FIFA 1GJZA 1TGZB 2WDTB 2ZEQA 3QK0A 3VQIA 3EC8A 1WFYA 2XK5B 3QAQA 2RR9A 1RFAA 2XK5A 3A9JA 1V80A 1RAXA 3A9JB 2WX1A 2GMIC 4II3B 1R4MI 1UBQA 4GOCA 1EUVB 4IM2A 4NY0A 2UWQA 3UIOB 2KMAA 2O6VD 4ZDVA 1EF1A 2L7RA 1UGMA 2L76A 4M8NA 4W9KA 4MDKE 2M4NA 1J19A 2DZMA 3DQVA 4NAWA 2LI5A 5LLIA 3RZWC 2MBQA 2NVUI 1UZXB 3Q3JA 2EKEC 2RPQA 4KIKA 2J0MA 2MQJA 4KIKB 2J0JA 3ZTDA 2KJHB 2AL3A 1WGHA 1ISNA 2HTHA 2HD5B 3H7PA 1KM7A 3KYCD 4NPNA 3TJPA 5C23A 4DDGD 2M1MA 3TMPB 4FBJB 3D32A 1JRUA 3SHQA 3VAWA 4JGHB 2FCQA 2J7QB 2CU1A 2KNBA 3NOBA 2K8HA 2KLGA 4MGIE 4MGYE 4GDKB 2CR5A 4B9KA 4DHJD 4BVUC 3APDA 1V9JA 2J0KA 3HK0A 2N4FA 1VCBA 2RSUA 3ZNHB 3V6EB 4KDIC 5FR6A 1NDDA 4IWQA 3KUDB 3W1SA 4NQKE 2L3ZA 2NPTB 2JT4B 3PV1A 4TKNA 2KOXA 2MBHA 4K7SA 2G4DB 4ASWC 3PT2B 1NBFC 4KDLB 3ZTCA 4M0WB 2LD9A 2KX0A 2BKFA 1RRBA 4NNJB 1IPGA 3NZSA 2KN5A 3K9PB 4TUUA 5CHWA 2JXXA 4JL9A 2D2QA 4N9F4 1IYFA 2RD0A 4ZRJA 2LRUA 3ZUNA 4DWFA 2KTFA 3V6CB 3ZLZA 3QWZB 3A4RA 1V5TA 1E8ZA 3VUXA 3WANA 4KZCA 1E8XA 4WQOB 2NR2A 3MTNB 5D94A 4JLCA 3O65B 1TZ1A 2PJHA 4OVUA 2YLMA 2LASA 1E5WA 3WAPA 3WAOA 3RULA 4MJSB 3RCZA 3VDZA 2KVRA 4GN1A 1WY8A 2CHXA 4EKUA 1E8WA 1L2NA 3M62B 1WZ3A 4BKTA 4LJOB 1CMXB 3ZNZB 3PLUA 4NAWB 2JUOA 3V60A 4NJ6A 4A3PA 4BKSA 5L83A 4EZLA 2KC1A 3H7PB 3H6NA 2C60A 3JSVB 1YX5B 5DPTA 2PE6B 3JSVA 4A20A 2KHWB 2KWVB 3VTUA 2BKRB 2OJRA 3B1LX 4ANVA 2N9EB 2ZVNA 3GZNI 3KYDD 2ZJDA 4J6IA 3PREA 4IWOA 4ZRIA 1G6JA 1WXVA 1SGHA 1T0YA 3CSFA 5CTRC 2OOBB 3UQBA 4F1SA 2B3AA 3L16A 1X1MA 4PYUA 1V2YA 4RM8A 4HXDA 4EZKA 3UQAA 1KOTA 2Z0DB 4DBGA 3WIMA 2C5LC 3ZDMC 3DBSA 4BFRA 4EOYA 4LJPB 1WM2A 3M95A 2MA9B 2A4ZA 1XD3B 2AL6A 3VXWA 2MSED 3LDZE 3UINB 1YX6B 3QIJA 1YIWA 2JPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6E A;  5C1Z A;  4W9L A;  3JVZ X;  1NI2 A;  1OEY A;  2KMC A;  3IG3 A;  3PSE B;  3V61 A;  4AOF A;  2C7H A;  3VVW B;  3RT3 B;  2KTR A;  5AEK B;  2NCN A;  4W9E A;  2CS4 A;  2FNJ B;  2KFK B;  2Z0E B;  1P9D U;  2ZCB A;  3EFU A;  4YL8 A;  3NY5 A;  4ICU A;  2FUH B;  1IP9 A;  4G11 A;  1V81 A;  4CHK A;  2DEN B;  2L00 B;  1D3Z A;  1F9J A;  2MP2 B;  1A5R A;  1GC6 A;  1WM3 A;  4GU2 A;  4HPL B;  2WYQ A;  2G4S A;  2KX3 A;  2FCN A;  4GSW A;  2O6V B;  1WGG A;  2MCN B;  3DDC B;  3VHT C;  3DBR I;  2CHW A;  2ZZP B;  5AZF A;  2LRW A;  4E74 A;  3CF6 E;  3K9O B;  3R66 C;  1V86 A;  3R7R A;  1ZKH A;  1SE9 A;  4RM9 A;  5EDS A;  3EEC A;  2LVP A;  2WX0 A;  3W1S C;  2C7M B;  2ZVO A;  4PS7 A;  2V3S A;  4RMA A;  4AWJ A;  2W9N A;  4BOS C;  4URK A;  3ML9 A;  1EF5 A;  1OEY J;  1Z2M A;  2K6Q A;  4GMV A;  3B0A A;  3VTW A;  2LVQ A;  4TQ1 A;  3ZRF A;  2PE9 A;  3LJ3 A;  4ZYN A;  1Y8R C;  2V4L A;  3ONS A;  4WWN A;  2PPH A;  4DXA B;  3ZKJ C;  4FJY A;  3A33 B;  3JYU A;  1E90 A;  3RZF A;  1R4N I;  2MX2 A;  2MBB B;  3ZNI D;  3PRZ A;  4ANX A;  1YJ1 A;  2XBB C;  3ZDT A;  5D7G A;  2I1J A;  2GBJ A;  1WR6 E;  5E6P A;  1OGW A;  4FA6 A;  2KQ7 A;  1OTR B;  3AXC A;  3ZIM A;  1VD2 A;  4IM3 A;  3UGB B;  3R7Q A;  1YD8 U;  2DAJ A;  2D10 A;  2REX A;  3DVG Y;  2M8S A;  2KDE B;  2L05 A;  1P1A A;  1WX8 A;  3L0W B;  4FUL A;  3ENE A;  5E6N A;  1C3T A;  2D07 B;  2R2O A;  4BBN F;  2AYO B;  2D11 A;  4MEL A;  5BO4 B;  3S2A A;  2LGY A;  2CHZ A;  1GG3 A;  2NBV B;  3ALB A;  5JZE B;  4KSL C;  2AWT A;  1UEL A;  4AP4 C;  4FHK A;  3A9K A;  2KTR B;  3PGE A;  4MGK E;  2IO3 B;  2K8C A;  4FJZ A;  2I1K A;  3B08 A;  1WH3 A;  2ZPY A;  3PHW B;  4GDK A;  4ZRK A;  1E7U A;  3L54 A;  1WF9 A;  2LJ5 A;  4FJV B;  2PEA A;  3APF A;  1WMH A;  3M63 B;  1WE6 A;  3CMM B;  1P3Q U;  3N3K B;  2NBU A;  3ZVV A;  4W9F A;  2K8B A;  4II2 B;  4XX5 A;  4WJN A;  1I42 A;  3P2B A;  2MW5 A;  4GXB A;  3QX1 A;  3QJZ A;  1WRD B;  2JY6 A;  1M94 A;  4MGZ E;  3HHM A;  4JQW C;  3H1U A;  2BWF A;  2LUE A;  1Q0W B;  1E7V A;  4WAA A;  3KW5 B;  1L7Y A;  1P0R A;  3L08 A;  3PS6 A;  3A4S C;  2O2V A;  1BT0 A;  4TQ0 A;  3PLV A;  2LXA A;  4HDQ A;  4MSM B;  2KFK A;  2KJ6 A;  4HLE A;  2V1Y A;  3N32 A;  5L95 C;  2D3G A;  1TBE A;  2L8J A;  1P98 A;  2N7D A;  1Z5S B;  3NHE B;  4TV3 A;  1PQS A;  2G45 B;  1WE7 A;  2KO3 A;  4BBN C;  5IA7 A;  4PS3 A;  4I6L B;  4M8M A;  2O6V A;  4MJS A;  2DHZ A;  2DYB A;  1GNU A;  3W1Y A;  1Q5W B;  1AAR A;  5E6O A;  3RUI B;  5AZG A;  1XQQ A;  4AJW A;  2KWU B;  1GC7 A;  1WJ4 A;  4IW0 A;  3QHT A;  3T8M A;  5KHQ A;  4GDL B;  4BOZ B;  4W9H A;  5CX3 A;  4EZJ A;  2N7E A;  5JHA A;  5D6J B;  3T9L A;  1OQY A;  4G50 A;  2JRI B;  3ZO5 B;  3MJW A;  4WJP A;  3I3T B;  2LGD A;  2C9W B;  2ZNV B;  2BYE A;  4ANU A;  1XT9 B;  3TCA A;  5GMV A;  3QC8 B;  4BKG A;  5J17 A;  1S1Q B;  1WJN A;  2GBK A;  1E8Y A;  2DZK A;  5CHV C;  4KVG B;  2R2Q A;  2M17 A;  3TL5 A;  2LZ6 A;  3SU8 X;  4IG7 B;  2GBM A;  4PYZ A;  3ML8 A;  4HWI B;  3QCA A;  3QA8 A;  1WGD A;  2K6D B;  2MBE A;  3HM3 A;  1WI0 A;  2ZPN A;  4HCN B;  2JF5 A;  1EO6 A;  4NQL B;  3DVN V;  4DHJ B;  3L10 B;  1FXT B;  1GUA B;  4K7U A;  3APC A;  3OAW A;  1WJU A;  3ZW3 A;  2YVC A;  4W9J A;  5G2N A;  1WXA A;  2M0X A;  1YQB A;  4IWP A;  3U7D A;  3ZNG C;  3OLM D;  4AUQ C;  1S3S G;  4ICV A;  3X0W A;  3DOW A;  4DHZ B;  2O2V B;  4MH0 E;  2IZV B;  1ZW7 A;  4EEW A;  2Z59 B;  3A1Q A;  3PHX B;  3NZU A;  2IY0 B;  4FHJ A;  3IHP C;  3DCG A;  3MHS D;  3NS8 A;  2FCS A;  4K1R B;  3VTV A;  3H9D A;  4EUT A;  3HM6 X;  2IO2 B;  4K81 A;  1H8C A;  3ECI A;  2ZNV C;  3HIZ A;  1WX9 A;  3BIN A;  2GOW A;  2K1F A;  3AU4 A;  2DZI A;  4LCD E;  2IBI B;  4NJ7 A;  4WWP A;  3RD2 A;  2BYF A;  2MP2 A;  2BF8 B;  4JIO U;  1LM8 B;  1Q1O A;  3JW0 X;  4HCP B;  2LVO A;  3WAL A;  2DX5 B;  2N1W A;  4HPM B;  1WZ0 A;  3DPD A;  4W9C A;  3SD5 A;  4DK5 A;  2KFJ A;  2JZZ A;  3N30 A;  4MM3 A;  2ASQ A;  4W9I A;  3H7S A;  5LXI B;  2KD0 A;  2MRP A;  1TTN A;  2FAZ A;  4W9D A;  5CHF A;  1UD7 A;  4XC2 A;  3VUW A;  2KQS A;  1LQB A;  4ANW A;  2XEW A;  1WR1 A;  4F7Z A;  4HDO A;  1WYW B;  2ZCC A;  3QQ8 B;  4PS8 A;  3KUC B;  3L13 A;  2LGX A;  3V62 A;  3PZD A;  5DPR A;  2VRR B;  1WX7 A;  5LXH A;  2KC2 A;  3PPA A;  3OJ3 A;  1WJ6 A;  2UYZ B;  3CST A;  3GOE A;  4I6P A;  4IM0 A;  2BYV E;  2MLB A;  5JH5 C;  2JWZ A;  5TR5 A;  2RGF A;  2LXC A;  3UF8 A;  3VFK A;  1SIF A;  2C7N B;  3DBH I;  4GDL A;  4CYE A;  3U30 A;  1WXM A;  2KDI A;  2L0F A;  4P7I A;  5D2M B;  3VUY A;  1LFD A;  4F8C B;  4B95 A;  5KHO A;  2KDB A;  1KJT A;  3QAR A;  3AI5 A;  3KH0 A;  2MWS B;  4FAD A;  2BWE S;  2GBR A;  2KXJ A;  3A9K B;  2KKC A;  3VH3 B;  2IO1 B;  2HE7 A;  2MBO A;  2N9P C;  4DHZ E;  1WGY A;  3TBL D;  2KZR A;  4HVB A;  4E71 A;  3KVF B;  2JZ3 B;  2FCM A;  1I35 A;  1K8R B;  3PTF C;  2IY1 B;  2KK8 A;  1WMH B;  2NBW B;  2Y5B B;  3L17 A;  4MEM A;  5AZH A;  4KSK C;  3TIX A;  2N1V A;  4W9G A;  4HJK A;  4WJQ A;  5IAA C;  4XZ4 A;  2K39 A;  1HE8 A;  1WGR A;  2KAN A;  1LXD A;  3UIP B;  4G0N B;  2K25 A;  2AEH A;  4KV2 A;  3RYT A;  3ZRC A;  2G3Q B;  4GGQ A;  2HJ8 A;  4HK2 A;  3PVL A;  4AJY B;  5DPW A;  3Q3F A;  2WWZ A;  2L0T A;  2JVC A;  3M3J A;  4FLH A;  1KLV A;  2EMT A;  3WA0 A;  2NS5 A;  1J8C A;  1UBI A;  1V5O A;  3IVF A;  3VH4 B;  2QHO A;  4G3X B;  5J18 A;  3A1Q B;  4E3C A;  2BGF A;  3EHV A;  4A3O A;  4X57 B;  2A5U A;  2KDF B;  4OVV A;  4FN2 A;  3AU5 A;  2BPS A;  4GIV A;  4LDT D;  3PRP B;  4WJO A;  3WAM A;  2DYO A;  4BKS D;  5HKH A;  1H4R A;  2DYM A;  1V49 A;  5G55 A;  4EFO A;  2CKH B;  4CO7 A;  3AUL A;  5J2R A;  1QZE A;  3IFW B;  1UH6 A;  3DVN U;  1RLF A;  1WXS A;  4KZ0 A;  4WWO A;  1J0G A;  2EMS A;  5JHB A;  1C1Y B;  2DAF A;  2IO0 B;  5DPS A;  2KWC A;  3C0R B;  1ZGU B;  3KUZ A;  1WIA A;  4B6W A;  2KJR A;  2IYD B;  2FID A;  2NPT A;  4DDI D;  3PRM B;  2JRH A;  1U4A A;  4I6N B;  4IUM B;  3SDL C;  3IBE A;  2KLC A;  4GB9 A;  2GBN A;  5DCN A;  2DZJ A;  4MSQ B;  3R3M A;  4LDT B;  1MG8 A;  3X23 A;  3DVG X;  4K7W A;  3DBL I;  2LWP A;  2N9X A;  3OJ4 B;  4IC7 B;  3BY4 B;  3U8Z A;  2FIF A;  1GJZ A;  1TGZ B;  2WDT B;  2ZEQ A;  3QK0 A;  3VQI A;  3EC8 A;  1WFY A;  2XK5 B;  3QAQ A;  2RR9 A;  1RFA A;  2XK5 A;  3A9J A;  1V80 A;  1RAX A;  3A9J B;  2WX1 A;  2GMI C;  4II3 B;  1R4M I;  1UBQ A;  4GOC A;  1EUV B;  4IM2 A;  4NY0 A;  2UWQ A;  3UIO B;  2KMA A;  2O6V D;  4ZDV A;  1EF1 A;  2L7R A;  1UGM A;  2L76 A;  4M8N A;  4W9K A;  4MDK E;  2M4N A;  1J19 A;  2DZM A;  3DQV A;  4NAW A;  2LI5 A;  5LLI A;  3RZW C;  2MBQ A;  2NVU I;  1UZX B;  3Q3J A;  2EKE C;  2RPQ A;  4KIK A;  2J0M A;  2MQJ A;  4KIK B;  2J0J A;  3ZTD A;  2KJH B;  2AL3 A;  1WGH A;  1ISN A;  2HTH A;  2HD5 B;  3H7P A;  1KM7 A;  3KYC D;  4NPN A;  3TJP A;  5C23 A;  4DDG D;  2M1M A;  3TMP B;  4FBJ B;  3D32 A;  1JRU A;  3SHQ A;  3VAW A;  4JGH B;  2FCQ A;  2J7Q B;  2CU1 A;  2KNB A;  3NOB A;  2K8H A;  2KLG A;  4MGI E;  4MGY E;  4GDK B;  2CR5 A;  4B9K A;  4DHJ D;  4BVU C;  3APD A;  1V9J A;  2J0K A;  3HK0 A;  2N4F A;  1VCB A;  2RSU A;  3ZNH B;  3V6E B;  4KDI C;  5FR6 A;  1NDD A;  4IWQ A;  3KUD B;  3W1S A;  4NQK E;  2L3Z A;  2NPT B;  2JT4 B;  3PV1 A;  4TKN A;  2KOX A;  2MBH A;  4K7S A;  2G4D B;  4ASW C;  3PT2 B;  1NBF C;  4KDL B;  3ZTC A;  4M0W B;  2LD9 A;  2KX0 A;  2BKF A;  1RRB A;  4NNJ B;  1IPG A;  3NZS A;  2KN5 A;  3K9P B;  4TUU A;  5CHW A;  2JXX A;  4JL9 A;  2D2Q A;  4N9F 4;  1IYF A;  2RD0 A;  4ZRJ A;  2LRU A;  3ZUN A;  4DWF A;  2KTF A;  3V6C B;  3ZLZ A;  3QWZ B;  3A4R A;  1V5T A;  1E8Z A;  3VUX A;  3WAN A;  4KZC A;  1E8X A;  4WQO B;  2NR2 A;  3MTN B;  5D94 A;  4JLC A;  3O65 B;  1TZ1 A;  2PJH A;  4OVU A;  2YLM A;  2LAS A;  1E5W A;  3WAP A;  3WAO A;  3RUL A;  4MJS B;  3RCZ A;  3VDZ A;  2KVR A;  4GN1 A;  1WY8 A;  2CHX A;  4EKU A;  1E8W A;  1L2N A;  3M62 B;  1WZ3 A;  4BKT A;  4LJO B;  1CMX B;  3ZNZ B;  3PLU A;  4NAW B;  2JUO A;  3V60 A;  4NJ6 A;  4A3P A;  4BKS A;  5L83 A;  4EZL A;  2KC1 A;  3H7P B;  3H6N A;  2C60 A;  3JSV B;  1YX5 B;  5DPT A;  2PE6 B;  3JSV A;  4A20 A;  2KHW B;  2KWV B;  3VTU A;  2BKR B;  2OJR A;  3B1L X;  4ANV A;  2N9E B;  2ZVN A;  3GZN I;  3KYD D;  2ZJD A;  4J6I A;  3PRE A;  4IWO A;  4ZRI A;  1G6J A;  1WXV A;  1SGH A;  1T0Y A;  3CSF A;  5CTR C;  2OOB B;  3UQB A;  4F1S A;  2B3A A;  3L16 A;  1X1M A;  4PYU A;  1V2Y A;  4RM8 A;  4HXD A;  4EZK A;  3UQA A;  1KOT A;  2Z0D B;  4DBG A;  3WIM A;  2C5L C;  3ZDM C;  3DBS A;  4BFR A;  4EOY A;  4LJP B;  1WM2 A;  3M95 A;  2MA9 B;  2A4Z A;  1XD3 B;  2AL6 A;  3VXW A;  2MSE D;  3LDZ E;  3UIN B;  1YX6 B;  3QIJ A;  1YIW A;  2JPH A; 
#chains in the Genus database with same CATH topology
 4RNA A;  1FD6 A;  3IG3 A;  3VVW B;  5AEK B;  4W9E A;  2FNJ B;  2CJN A;  2KMM A;  3EFU A;  1K51 A;  2NTT A;  2L00 B;  3N1Z C;  1A5R A;  3AE6 B;  1EM7 A;  1TIF A;  2G4S A;  5E6J A;  5HI1 A;  2O6V B;  3DBR I;  2LRW A;  3K9O B;  1JWB D;  3R66 C;  1ZKH A;  1SE9 A;  4AWJ A;  3P1M A;  1D6E C;  2K6Q A;  1FFV A;  4ZHP A;  3DHH C;  3ZRF A;  4TQ1 A;  3LJ3 A;  4WWN A;  5AUK A;  1E6E B;  4FJY A;  3A33 B;  4CQN A;  3RZF A;  2X38 A;  1UGJ A;  1YJ1 A;  2XBB C;  3ZDT A;  2I1J A;  1OTR B;  4IM3 A;  4MH8 A;  3R7Q A;  1YD8 U;  4ZYS A;  2DAJ A;  2D10 A;  2REX A;  3DVG Y;  3I57 A;  4XWT A;  1P1A A;  4LNK A;  1C3T A;  4US8 A;  2AQ3 B;  2D11 A;  5BO4 B;  2BT6 A;  2CHZ A;  1JWS D;  1GG3 A;  1KRH A;  2LGS A;  4D2K A;  2AWT A;  4AP4 C;  4FHK A;  2J42 A;  1WH3 A;  2LUM A;  1JML A;  2PEA A;  1XLO A;  1PGB A;  4YWG G;  4AS1 A;  1WE6 A;  3CMM B;  2N0S B;  2ON8 A;  4Q2J A;  1CQV A;  4USA A;  1J7B A;  1F2R I;  2MW5 A;  3QJZ A;  3HHM A;  2BWF A;  1E7V A;  1L7Y A;  3EUB 2;  3DBR B;  1ZXH A;  4OW0 A;  2Y5C A;  5BYQ A;  3PLV A;  4LTU A;  4BZA A;  2KJ6 A;  1T3Q A;  2EEL A;  2L8J A;  2N7D A;  4TV3 A;  4JX1 C;  4PS3 A;  2Y5P A;  2DYB A;  3MC0 B;  1GNU A;  2MEK A;  5E6O A;  2WU2 B;  4L2Y A;  5KHQ A;  1AN8 A;  4W9H A;  5CX3 A;  1QQR A;  3ZO5 B;  4WJP A;  2C9W B;  3RNE C;  5J17 A;  1S1Q B;  1E8Y A;  2DZK A;  3TUO A;  4KVG B;  1E9M A;  2MH7 A;  3E9S A;  3ML8 A;  1WSP A;  2ZPN A;  4HCN B;  2JF5 A;  1EO6 A;  3DVN V;  4DHJ B;  4K7U A;  2PVO D;  1WJU A;  3ZW3 A;  2DWQ A;  1YMH E;  2V3P A;  4W9J A;  5G2N A;  1YQB A;  1YOV B;  4RFB A;  4OZB A;  2O2V B;  3PHX B;  3MHS D;  3VTV A;  3H9D A;  4RGT A;  1WYG A;  2BF8 B;  2J4X A;  1D5X C;  1HQR D;  2LVO A;  3SD5 A;  4DK5 A;  2JZZ A;  3N30 A;  2B76 B;  5LXI B;  2MRP A;  1TTN A;  1UD7 A;  1T0R C;  3VUW A;  2KQS A;  2LFI A;  1WR1 A;  4F7Z A;  1OFF A;  2MHJ A;  2WLB A;  3C8Y A;  3KUC B;  3L13 A;  4FXC A;  2L83 A;  2HDE A;  2VRR B;  1JRO A;  3CST A;  3N1X C;  3GP7 A;  3P63 A;  4I6P A;  4IM0 A;  2BYV E;  2MLB A;  5JH5 C;  2WXP A;  3ZQ4 A;  5H92 C;  3DBH I;  4C4V B;  4CYE A;  1WXM A;  4P7I A;  1N60 A;  3PZ7 A;  2WXJ A;  3AI5 A;  2RPV A;  2KKC A;  1VZ8 A;  2HE7 A;  1SSN A;  2KZR A;  1K8R B;  3TIX A;  5AZH A;  1XXG A;  1MG4 A;  2PVG C;  5IAA C;  4XZ4 A;  1FXI A;  1HE8 A;  4LNN A;  3ZRC A;  1WXQ A;  3PVL A;  4AJY B;  5DPW A;  2WWZ A;  3VRB B;  1KLV A;  1FRD A;  2EMT A;  4K3C A;  3WA0 A;  1J8C A;  1V5O A;  3VR8 B;  2J52 A;  5H8Y E;  3A1Q B;  4E3C A;  3FC4 A;  4OVV A;  2BPS A;  3BVG A;  4LDT D;  3WAM A;  2DYO A;  2DYM A;  1V49 A;  4CO7 A;  3AUL A;  4TMA B;  1KTK A;  2BTE A;  5EE3 A;  4ZRP A;  3DVN U;  4KZ0 A;  1L6U A;  3Q8B A;  3C0R B;  1ZGU B;  2NMQ A;  1WIA A;  2IYD B;  2FID A;  2NPT A;  1F0Z A;  2JRH A;  4YSX B;  4IUM B;  3SDL C;  1L0Y B;  3R3M A;  5BYS A;  1MG8 A;  1QLB B;  3X23 A;  3AM9 A;  2LWP A;  1SE3 A;  3AMZ A;  2MJ3 A;  2FIF A;  3VQI A;  2JWU A;  1BML C;  1PYW D;  3RNC C;  1I4R A;  1L5P A;  3TSS A;  2W55 A;  2O6V D;  2L7R A;  2CU3 A;  4W9K A;  4MDK E;  4RF1 A;  2M4N A;  1ZDX A;  2SEB D;  4S0R A;  3RZW C;  3Q8F A;  4KIK A;  2J0M A;  4KIK B;  1NYR A;  1WGH A;  2HTH A;  3H7P A;  3TMP B;  1YJI A;  1ZE3 D;  4FBJ B;  3AE3 B;  1V1P B;  4JGH B;  2CU1 A;  3NOB A;  4LNF A;  2CR5 A;  4M00 A;  4DHJ D;  4BVU C;  2J0K A;  5IN7 A;  2RSU A;  2WXH A;  1TT5 B;  1R4M B;  1NDD A;  4NQK E;  1LO5 D;  2L3Z A;  2JT4 B;  2KOX A;  4DQO C;  4HKZ E;  1NBF C;  3E56 A;  2IDY A;  2N9K A;  4M0W B;  1RRB A;  1IPG A;  3NZS A;  5MPO A;  2WGS A;  5CHW A;  4JWU C;  2JXX A;  2D2Q A;  4ZRJ A;  2GI9 A;  1V5T A;  4KZC A;  2NR2 A;  4JLC A;  1QOA A;  3RUL A;  3RCZ A;  2HTM E;  1E8W A;  4LJO B;  1CMX B;  2JUO A;  3Q8E A;  4NJ6 A;  4P1B C;  5L83 A;  2EKI A;  1CZP A;  1UWX A;  3MC8 A;  2C60 A;  4DXF A;  1SF0 A;  1YX5 B;  5DPT A;  4YTP B;  2BKR B;  2M19 A;  2N9E B;  3KYD D;  4RCO A;  4IWO A;  2AQ2 B;  1SGH A;  2B3A A;  3L16 A;  4RM8 A;  3P42 A;  3ZDM C;  1WWT A;  2GRI A;  5EE1 A;  3RI7 C;  1FXA A;  2MSE D;  3QIJ A;  1YIW A;  3DWG C;  1V6E A;  1NI2 A;  2KMC A;  3PSE B;  4RGM A;  2INC C;  4AOF A;  1K53 A;  2NCN A;  2Z0E B;  2LHE A;  1IUE A;  1ENF A;  4ICU A;  3DHI C;  4YSZ B;  5BMI A;  1D3Z A;  2OHF A;  1GC6 A;  5D3D A;  1WM3 A;  4GU2 A;  4HPL B;  2WYQ A;  3AEF B;  3I63 C;  1WGG A;  2MCN B;  2BS2 B;  3DDC B;  2CHW A;  3EFC A;  4IDI A;  2JX5 A;  4RM9 A;  5EDS A;  1C78 A;  1ZOY B;  2WX0 A;  4RMA A;  2W9N A;  4URK A;  1OEY J;  4GMV A;  2KAC A;  2LVQ A;  3P4R B;  4KKI A;  4ZYN A;  3AED B;  4DXA B;  3WCQ A;  1KLU D;  4MT5 A;  2WP9 B;  2MX2 A;  1CK1 A;  2JZP A;  4H2A A;  2GBJ A;  4FA6 A;  5JXV A;  3ZIM A;  1VD2 A;  3AB5 A;  3T3N A;  1D5M C;  4XE0 A;  1I4X A;  4BBN F;  2NBV B;  3ALB A;  4KSL C;  1UEL A;  3A9K A;  2KTR B;  1ZDV A;  4MGK E;  3P4P B;  3PHW B;  4GDK A;  4ZRK A;  3AEA B;  1TS3 A;  3BK1 A;  4WQM A;  1N62 A;  4A9A A;  1WMH A;  3ZJV A;  1L4D B;  3DHG C;  2K8B A;  4II2 B;  4GXB A;  4C7Y A;  3BWU D;  4J3O D;  4IKG A;  2LUE A;  1SEB D;  3KW5 B;  3RNA C;  3L08 A;  3A4S C;  4TQ0 A;  3FAH A;  4HDQ A;  3Q14 C;  1SBB B;  2UU7 A;  3URY A;  2AQ1 B;  1JWA D;  1HTQ A;  4HLE A;  3EA6 A;  1Z5S B;  4I6L B;  2O6V A;  2G9H D;  5GXG B;  2KYW A;  4AJW A;  1R4N B;  1GC7 A;  3QHT A;  4AQ7 A;  4BOZ B;  2V9H A;  3W9C B;  4EZJ A;  4LNO A;  3GS2 A;  4G50 A;  3MJW A;  4S17 A;  1TJE A;  2ZNV B;  2BYT A;  1FCL A;  1XT9 B;  3TCA A;  3QC8 B;  1WJN A;  4JWS C;  2GBK A;  2ONQ A;  3RN9 C;  5CHV C;  2LZ6 A;  1JCK B;  2GBM A;  3QCA A;  1OQQ A;  1WGD A;  1WI0 A;  3AE7 B;  3L10 B;  3OAW A;  3OWE B;  1ET6 A;  3ZNG C;  3OLM D;  1A70 A;  3X0W A;  2K3U A;  1FM0 D;  2TSS A;  1QOB A;  2IZV B;  3A1Q A;  3NZU A;  2KAJ A;  2L1A A;  3IHP C;  3DCG A;  4K1R B;  4EUT A;  1K52 A;  1YJJ A;  1H8C A;  4RGN A;  4KGS A;  2IGH A;  2DZI A;  4WWP A;  2MP2 A;  3BYY B;  2BQQ A;  3KLS X;  1L0X B;  1LM8 B;  4PT5 A;  4A6Q A;  2DX5 B;  4HJG E;  1WZ0 A;  3DPD A;  4W9C A;  2QEJ C;  4MM3 A;  4W9I A;  2KD0 A;  2OED A;  4W9D A;  4XC2 A;  3KWV A;  1WYW B;  2ZCC A;  2X8X X;  4PS8 A;  4ZRQ A;  2LGI A;  3P4S B;  3GZN B;  4RF0 A;  1HZ5 A;  5LXH A;  3PPA A;  1AYF A;  3OJ3 A;  1SIJ A;  2BB5 A;  5G5G A;  2RMM A;  2IND C;  3VFK A;  1DGJ A;  4GDL A;  3NVV A;  2KDI A;  2KVZ A;  5D2M B;  2KT7 A;  4B95 A;  5KHO A;  5TSS A;  3QAR A;  2MWS B;  4B0E A;  2KXJ A;  3R2T A;  3OG5 A;  1YNT E;  2MBO A;  3GB1 A;  4R3D A;  1FO4 A;  2R61 A;  3NS1 A;  3FKY A;  1VLB A;  2KK8 A;  3L17 A;  4MEM A;  4KSK C;  4W9G A;  2LHD A;  1WGR A;  1DOI A;  2K25 A;  4KV2 A;  3Q3F A;  3TEZ A;  2JVC A;  2W3S A;  3M3J A;  1UBI A;  2QHO A;  3U7Z A;  3Q8A A;  2BGF A;  3EHV A;  4A3O A;  3PO0 A;  3ETR A;  4X57 B;  4FN2 A;  3AU5 A;  4GIV A;  3I9V 1;  1V1P A;  4YT0 B;  3Q69 A;  4EFO A;  5J2R A;  3IFW B;  2ZW1 A;  1WXS A;  5JHB A;  2IO0 B;  5DPS A;  1MVK A;  2KWC A;  4OZC A;  3DWM A;  2KJR A;  1ZP0 B;  2QJL A;  4DDI D;  1Q10 A;  1XF5 L;  3DVG X;  1HEZ E;  3BY4 B;  3NG0 A;  1B1Z A;  3HVZ A;  3QK0 A;  3NZ3 A;  3EC8 A;  3LB8 C;  2XK5 A;  3IAS 1;  3A9J A;  1C76 A;  2WX1 A;  1TKY A;  1R4M I;  3R8B A;  1UBQ A;  4GOC A;  4N6E B;  4IM2 A;  2WXK A;  4C80 A;  4JPS A;  4NY0 A;  3RMK C;  4ZHO A;  2KMA A;  2WXF A;  1EF1 A;  2JQR B;  3MJ5 A;  4M8N A;  1J19 A;  2LI5 A;  3B2F A;  2NVU I;  2EKE C;  2N9L A;  2MQJ A;  2MJD A;  3ZTD A;  2AL3 A;  3TJP A;  3KYC D;  1C9F A;  4NPN A;  4DDG D;  1HTO A;  3D32 A;  2FCQ A;  2KNB A;  4MGY E;  4B9K A;  2IPK D;  3HK0 A;  1VCB A;  3ZNH B;  3V6E B;  5FR6 A;  4LK0 M;  2JSV X;  1GB4 A;  1QKZ A;  2QIE B;  1E7P B;  1ET9 A;  4NNJ B;  4JL9 A;  4N9F 4;  2LRU A;  3ZUN A;  3A4R A;  1E8Z A;  3Q3O C;  1ACC A;  3VUX A;  1E8X A;  1HA5 A;  5D94 A;  2PJH A;  1E5W A;  1QT9 A;  3WAO A;  2KN4 A;  2BW2 A;  3VDZ A;  4WH4 A;  1WY8 A;  1L2N A;  1T0S C;  3M62 B;  3ZNZ B;  3HUI A;  3PLU A;  4ARC A;  4WWM A;  3H6N A;  1RWS A;  1MI0 A;  1IBX A;  3BYT B;  4YXD B;  2QDF A;  1YN4 A;  4ANV A;  2QCZ A;  1G6J A;  3BVM A;  5FK9 C;  3MHZ A;  4F1S A;  1EWY C;  1TZO A;  2WU5 B;  1KOT A;  1MFW A;  4DBG A;  2WXG A;  4XYC A;  4XWW A;  3M95 A;  2MA9 B;  2PW9 A;  4HPP A;  2D3C A;  1DOX A;  1UUP A;  2JPH A;  4KGR A;  3V05 A;  1N5W A;  5C1Z A;  3V61 A;  1FRR A;  2C7H A;  1ZXI A;  2KTR A;  3IAM 1;  2CS4 A;  4YL8 A;  1P9D U;  3ZXV A;  3NY5 A;  3LXF A;  1N63 A;  3NJT A;  2VZK B;  2DEN B;  5AUI A;  3VHT C;  2ZZP B;  3CF6 E;  3EGR A;  2LVP A;  2PIA A;  3BVZ A;  2ZVO A;  2V3S A;  2JU6 X;  4KX6 B;  4IOI E;  1Z2M A;  3B0A A;  5HFY A;  3VTW A;  4GLS C;  2PE9 A;  3AEG B;  2PPH A;  1DOY A;  3ZKJ C;  1NEN B;  1E90 A;  2MBB B;  3C19 A;  3ZNI D;  3PRZ A;  3DBL B;  2H88 B;  1WR6 E;  5E6P A;  2KQ7 A;  2W82 A;  3AXC A;  3UGB B;  2KDE B;  1YQ4 B;  2DLB A;  2NTS A;  3L0W B;  1WX8 A;  1EWC A;  3ENE A;  2D07 B;  1BUI C;  4MEL A;  5JZE B;  1FEH A;  1WGK A;  3PGE A;  2IO3 B;  4FJZ A;  3B08 A;  2K5P A;  2WXO A;  1FFU A;  5I4D A;  5G5H A;  3M63 B;  3W5U B;  3N3K B;  4XX5 A;  4NZL B;  4WJN A;  1I42 A;  3IT4 B;  4MGZ E;  4JQW C;  2D3B A;  4N58 A;  1IGC A;  1Q0W B;  4MM3 B;  1IGD A;  4P16 A;  1P0R A;  2PTL A;  2WXN A;  3NRZ A;  2JXT A;  2LXA A;  2IGD A;  2KFK A;  3N32 A;  5T8I A;  1P98 A;  3NHE B;  2K9X A;  2VH1 A;  1WE7 A;  4BBN C;  3AEC B;  4MJS A;  1AAR A;  1XQQ A;  1C4P A;  1VZ7 A;  3N9Y C;  1N5X A;  1WJ4 A;  4IW0 A;  3T8M A;  3U52 E;  4GDL B;  2N7E A;  1C4A A;  2YEP F;  2JRI B;  3GE3 C;  1UWM A;  3I3T B;  2L52 A;  1QOF A;  2BYE A;  4ANU A;  5GMV A;  1PFD A;  4BKG A;  4YTM B;  3AE4 B;  1JQ4 A;  4HKQ A;  3FIL B;  3LYY A;  3SU8 X;  4PYZ A;  1TKE A;  2MBE A;  2K6D B;  2RDG A;  2WDQ B;  3HM3 A;  1GAQ B;  1M4V A;  2D3A A;  3APC A;  3Q8C A;  5BYR A;  1WXA A;  4HEA 1;  4IWP A;  4ICV A;  3IT6 B;  1D4B A;  4MH0 E;  1ZW7 A;  3VRA B;  1VDV A;  2Z59 B;  1SE4 A;  2IO2 B;  3NVY A;  3W5V B;  2VH2 A;  1NVI D;  3HIZ A;  1KFY B;  1WX9 A;  3AV8 A;  2GOW A;  3AU4 A;  4LCD E;  4NJ7 A;  4JIO U;  2WQY B;  3I5J C;  4L23 A;  2WDV B;  4ARI A;  3JW0 X;  3WAL A;  2GLS A;  2N1W A;  4HRS A;  1L0V B;  1E10 A;  3L4P A;  3BK2 A;  2L32 A;  2FAZ A;  1QOG A;  1AWD A;  3V62 A;  5DPR A;  1WX7 A;  2E3T A;  2KC2 A;  2UYZ B;  4XDC A;  3AEB B;  4C4V A;  2C7N B;  3NVZ A;  2L0F A;  3VUY A;  1LFD A;  1KJT A;  1R7S A;  1LGR A;  2GBR A;  2QSD A;  2IO1 B;  2I38 A;  4DHZ E;  3TBL D;  4HVB A;  1J7C A;  2BVC A;  3KVF B;  2JZ3 B;  2FCM A;  2J53 A;  2Y5B B;  4XDD A;  1VR9 A;  4HJK A;  4A55 A;  2K39 A;  2KAN A;  5BMH A;  2G3Q B;  5C3J B;  4HK2 A;  3VR9 B;  2L0T A;  1SJH D;  1MHX A;  1YQ3 B;  3BZD B;  2NS5 A;  2XN9 C;  3VH4 B;  1ROE A;  1UF0 A;  5FKA C;  4BKS D;  3PRP B;  2AX5 A;  5C2T B;  1H4R A;  4A90 A;  5G55 A;  2CKH B;  2WS3 B;  1QZE A;  1C79 A;  4WWO A;  2HJ1 A;  1V8C A;  3BII D;  1C1Y B;  1GOZ A;  4M02 A;  3KUZ A;  4QAY A;  1MHH E;  1TY2 A;  1QF6 A;  1U4A A;  4I6N B;  3IBE A;  4GB9 A;  2GBN A;  1XCQ L;  5DCN A;  4MSQ B;  4LDT B;  2GB1 A;  1V1O A;  3OJ4 B;  4IC7 B;  1TGZ B;  1FNW A;  1OQR A;  3QAQ A;  2PLP A;  1RFA A;  2RR9 A;  5D3I B;  1V80 A;  1FNU A;  2GMI C;  3ABV B;  2UWQ A;  3N1Y C;  2V0G A;  4ZDV A;  3U2S C;  1FMA D;  2WXL A;  1UGM A;  3DQV A;  4NAW A;  5LLI A;  2MBQ A;  1UZX B;  2BS3 B;  3RPF C;  2KJH B;  1ISN A;  1XLN A;  2HD5 B;  1KM7 A;  1XO3 A;  1N61 A;  1NYQ A;  2XNA C;  3VAW A;  2KWD A;  2K8H A;  4MGI E;  4GDK B;  2W3R A;  5BMG A;  1TS4 A;  3APD A;  1V9J A;  1XEE A;  2N4F A;  1I4H A;  3SEB A;  3HVD A;  3PV1 A;  2WXQ A;  2G4D B;  3O13 A;  3PT2 B;  4KDL B;  1F77 A;  3ZTC A;  3TEY A;  4TSS A;  2LD9 A;  2KX0 A;  2BKF A;  1FIQ A;  3K9P B;  4ITK A;  3MC9 A;  3B2G A;  4DWF A;  3AE2 B;  3V6C B;  3QWZ B;  3Q2A C;  2E6X A;  2MJE A;  2DBY A;  4WQO B;  3AE9 B;  3MTN B;  3O65 B;  2N7J A;  4OVU A;  2YLM A;  2LAS A;  3WAP A;  1PGX A;  3PZ8 A;  1C77 A;  4EKU A;  2CHX A;  4BKT A;  4A3P A;  3GE8 C;  1I4G A;  5IOI A;  3J9C A;  3JSV B;  2PE6 B;  3JSV A;  2KHW B;  3VTU A;  2CJO A;  2ZVN A;  2KQ4 X;  2ZJD A;  4K3B A;  3CSF A;  1T6B X;  3UQB A;  4PYU A;  4HXD A;  2Z0D B;  3WIM A;  2C5L C;  4EOY A;  4LJP B;  4UDU C;  1WM2 A;  4LLG M;  1L4Z B;  1JAL A;  4HRO A;  2A4Z A;  2AL6 A;  4YSY B;  3NVW A;  1F2R C;  3VXW A;  3LDZ E;  1YX6 B;  3AN1 A;  1T0Y A;  4W9L A;  3JVZ X;  1OEY A;  2PKO A;  4US9 A;  1RM6 C;  3SFE B;  2Y3A A;  3RT3 B;  1GB1 A;  3U8Z A;  2KFK B;  2G1E A;  2ZCB A;  2FUH B;  1HZ6 A;  3AE1 B;  4G11 A;  1IP9 A;  1SXT A;  1XLQ A;  1V81 A;  4CHK A;  1F9J A;  2MP2 B;  5EE0 A;  2KX3 A;  2ICI A;  2FCN A;  4GSW A;  5FR3 A;  2BBC A;  5AZF A;  1EU4 A;  4E74 A;  1P7E A;  1STE A;  1V86 A;  3R7R A;  2LMC A;  4O1N A;  3EEC A;  3W1S C;  2C7M B;  4PS7 A;  4BOS C;  3ML9 A;  1EF5 A;  1CJE A;  2JYT A;  5HHD G;  1Y8R C;  2V4L A;  3ONS A;  3SR6 A;  3AE8 B;  4XGA B;  1KLG D;  3ZGZ A;  3JYU A;  1R4N I;  3ZJU A;  4ANX A;  1PGA A;  5D7G A;  3T3O A;  1OGW A;  1NI3 A;  3R2I A;  2VZK D;  2V4I B;  2M8S A;  2L05 A;  2IGG A;  5IO9 A;  5E6N A;  4FUL A;  3V3X A;  2R2O A;  2AYO B;  3S2A A;  3TEX A;  2LGY A;  3N20 C;  3ZYY X;  4RGO S;  1VZ6 A;  1JW9 D;  2K8C A;  2WHI A;  2I1K A;  2ZPY A;  1WRI A;  1E7U A;  3L54 A;  1WF9 A;  4NJC A;  4ACF A;  2LJ5 A;  2RDH A;  3FIL A;  4FJV B;  3U4E G;  5IKC M;  3APF A;  1P3Q U;  1VJK A;  2NBU A;  3ZVV A;  4W9F A;  1P7F A;  3P2B A;  3QX1 A;  1WRD B;  2JY6 A;  1M94 A;  1TS2 A;  2INP E;  2LEK A;  3H1U A;  2K0P A;  3AE5 B;  4WAA A;  2DNF A;  3PS6 A;  2O2V A;  1BT0 A;  2FBW B;  4MSM B;  2V1Y A;  1ZUD 2;  5L95 C;  2D3G A;  1TBE A;  4OHJ A;  1PQS A;  1I4Q A;  2G45 B;  2KO3 A;  1B9R A;  1JWM D;  4RH6 A;  2PMV A;  4N59 A;  5IA7 A;  4M8M A;  3W1Y A;  2DHZ A;  1Q5W B;  3RUI B;  5AZG A;  2KWU B;  1SE2 A;  1VRA B;  5JHA A;  5D6J B;  3T9L A;  1OQY A;  1ZPS A;  1QIL A;  4LNI A;  2LGD A;  2INN E;  1BXT A;  3P4Q B;  2IJ0 A;  4BAX A;  2M0A A;  2R2Q A;  2M17 A;  3TL5 A;  4IG7 B;  4HWI B;  3QA8 A;  2SAK A;  1K50 A;  4NQL B;  1FXT B;  1GUA B;  1T5X D;  2BS4 B;  3HRD D;  2YVC A;  1PDX A;  2QC8 A;  2M0X A;  2Z8L A;  1PUT A;  3U7D A;  4C7Z A;  4AUQ C;  1S3S G;  4DHZ B;  3DOW A;  4WAF A;  4EEW A;  5LNK 1;  2K22 A;  2IY0 B;  4FHJ A;  1L6V A;  3NS8 A;  2FCS A;  3UI3 A;  3HM6 X;  4K81 A;  3ECI A;  2ZNV C;  3BIN A;  2K1F A;  2IBI B;  1N6Z A;  3RD2 A;  2BYF A;  1V97 A;  1ESF A;  4ZOH C;  3CIR B;  1Q1O A;  4HCP B;  2H89 B;  3MP9 A;  4HPM B;  3CWI A;  2KFJ A;  1XLP A;  2FUG 1;  4OVZ A;  4M01 A;  2ASQ A;  3H7S A;  1SJE D;  5CHF A;  1KF6 B;  1LQB A;  4ANW A;  2XEW A;  3Q3N C;  4HDO A;  3QQ8 B;  3MFG A;  2LGX A;  4A8X C;  3PZD A;  3ZXR A;  1TYG B;  1RYJ A;  1WJ6 A;  3GOE A;  2JWZ A;  3RNG C;  5TR5 A;  2RGF A;  2LXC A;  3UF8 A;  1SIF A;  3U30 A;  3RNF C;  4F8C B;  1F1H A;  2KDB A;  3KH0 A;  4FAD A;  2ZW0 A;  2BWE S;  3A9K B;  3VH3 B;  1YN5 A;  1RFK A;  2N9P C;  1JRP A;  1WGY A;  4E71 A;  1FNV A;  1I35 A;  2RDB C;  1SB3 C;  1TS5 A;  3PTF C;  2IY1 B;  4B0M A;  4JE3 B;  2NBW B;  1WMH B;  2W54 A;  4DXG A;  2N1V A;  4WJQ A;  4EE2 A;  3B9J A;  1MJD A;  4OZA A;  4NAM A;  1LXD A;  3UIP B;  4G0N B;  2I2Y A;  3RYT A;  2AEH A;  2WDR B;  4GGQ A;  2HJ8 A;  4FLH A;  2WXM A;  3Q6B A;  3IVF A;  2WXR A;  3TEW A;  4G3X B;  5J18 A;  2YEP B;  4M0W A;  4WUR A;  3W2D A;  1D5Z C;  2A5U A;  2KDF B;  4WJO A;  5HKH A;  3Q3M C;  1F52 A;  5HG2 A;  4KKJ A;  1UH6 A;  1J0G A;  1RLF A;  3KWL A;  4WIP A;  2EMS A;  1DYQ A;  2DAF A;  4B6W A;  1I7H A;  1J7A A;  3RNB C;  3PRM B;  2KLC A;  2DZJ A;  4K7W A;  3DBL I;  2D5G A;  2N9X A;  3NUH B;  1TKG A;  1GJZ A;  2WDT B;  2ZEQ A;  4P1C C;  1WFY A;  2XK5 B;  3A9J B;  1RAX A;  4II3 B;  1NEK B;  4REZ A;  1EUV B;  5IP4 D;  3UIO B;  2L76 A;  2DZM A;  4MAC A;  3Q3J A;  2RPQ A;  1EU3 A;  2J0J A;  1I4P A;  5C23 A;  2M1M A;  1C4C A;  1JRU A;  3SHQ A;  2J7Q B;  1YN3 A;  2KLG A;  2WXI A;  1TY0 A;  3AEE B;  4KDI C;  1GPX A;  4IWQ A;  2ACZ B;  2Q5W D;  2M56 B;  3KUD B;  3W1S A;  2NPT B;  4TKN A;  4L1B A;  2MBH A;  4K7S A;  3KQ4 A;  1KH0 A;  3DBH B;  4ASW C;  5EE9 A;  1E0Z A;  4PK1 A;  2OJW A;  3H8H A;  2QIL A;  3IXS A;  4YTN B;  4TUU A;  2JYE A;  2KN5 A;  1IYF A;  2RD0 A;  1Y56 A;  2KTF A;  3ZLZ A;  1FPY A;  3WAN A;  1FCC C;  2V3N A;  2QMT A;  1TZ1 A;  1XCT L;  4MJS B;  4C00 A;  4KGT A;  2KVR A;  4GN1 A;  1HXY D;  4C56 C;  1MPE A;  1WZ3 A;  4P6V F;  2FE8 A;  4NAW B;  3V60 A;  4BKS A;  2LJI A;  4EZL A;  2KC1 A;  3H7P B;  4A20 A;  2KWV B;  2OJR A;  1IBX B;  3AH7 A;  3B1L X;  1T0Q C;  3GZN I;  4J6I A;  4ZRI A;  3PRE A;  1WXV A;  5CTR C;  2OOB B;  2KDM A;  1X1M A;  1V2Y A;  4EZK A;  3UQA A;  3DBS A;  4BFR A;  1AW7 A;  1XD3 B;  2WNM A;  1UNS A;  3UIN B;  3ZJT A;  2BB6 A;  1JWU D;  3SFD B;  3RFZ B; 
#chains in the Genus database with same CATH homology
 1V6E A;  5C1Z A;  4W9L A;  3JVZ X;  1NI2 A;  1OEY A;  2KMC A;  3IG3 A;  3PSE B;  3V61 A;  4AOF A;  2C7H A;  3VVW B;  3RT3 B;  2KTR A;  5AEK B;  2NCN A;  4W9E A;  2CS4 A;  2FNJ B;  2KFK B;  2Z0E B;  1P9D U;  2ZCB A;  3EFU A;  4YL8 A;  3NY5 A;  4ICU A;  2FUH B;  1IP9 A;  4G11 A;  1V81 A;  4CHK A;  2DEN B;  2L00 B;  1D3Z A;  1F9J A;  2MP2 B;  1A5R A;  1GC6 A;  1WM3 A;  4GU2 A;  4HPL B;  2WYQ A;  2G4S A;  2KX3 A;  2FCN A;  4GSW A;  2O6V B;  1WGG A;  2MCN B;  3DDC B;  3VHT C;  3DBR I;  2CHW A;  2ZZP B;  5AZF A;  2LRW A;  4E74 A;  3CF6 E;  3K9O B;  3R66 C;  1V86 A;  3R7R A;  1ZKH A;  1SE9 A;  4RM9 A;  5EDS A;  3EEC A;  2LVP A;  2WX0 A;  3W1S C;  2C7M B;  2ZVO A;  4PS7 A;  2V3S A;  4RMA A;  4AWJ A;  2W9N A;  4BOS C;  4URK A;  3ML9 A;  1EF5 A;  1OEY J;  1Z2M A;  2K6Q A;  4GMV A;  3B0A A;  3VTW A;  2LVQ A;  4TQ1 A;  3ZRF A;  2PE9 A;  3LJ3 A;  4ZYN A;  1Y8R C;  2V4L A;  3ONS A;  4WWN A;  2PPH A;  4DXA B;  3ZKJ C;  4FJY A;  3A33 B;  3JYU A;  1E90 A;  3RZF A;  1R4N I;  2MX2 A;  2MBB B;  3ZNI D;  3PRZ A;  4ANX A;  1YJ1 A;  2XBB C;  3ZDT A;  5D7G A;  2I1J A;  2GBJ A;  1WR6 E;  5E6P A;  1OGW A;  4FA6 A;  2KQ7 A;  1OTR B;  3AXC A;  3ZIM A;  1VD2 A;  4IM3 A;  3UGB B;  3R7Q A;  1YD8 U;  2DAJ A;  2D10 A;  2REX A;  3DVG Y;  2M8S A;  2KDE B;  2L05 A;  1P1A A;  1WX8 A;  3L0W B;  4FUL A;  3ENE A;  5E6N A;  1C3T A;  2D07 B;  2R2O A;  4BBN F;  2AYO B;  2D11 A;  4MEL A;  5BO4 B;  3S2A A;  2LGY A;  2CHZ A;  1GG3 A;  2NBV B;  3ALB A;  5JZE B;  4KSL C;  2AWT A;  1UEL A;  4AP4 C;  4FHK A;  3A9K A;  2KTR B;  3PGE A;  4MGK E;  2IO3 B;  2K8C A;  4FJZ A;  2I1K A;  3B08 A;  1WH3 A;  2ZPY A;  3PHW B;  4GDK A;  4ZRK A;  1E7U A;  3L54 A;  1WF9 A;  2LJ5 A;  4FJV B;  2PEA A;  3APF A;  1WMH A;  3M63 B;  1WE6 A;  3CMM B;  1P3Q U;  3N3K B;  2NBU A;  3ZVV A;  4W9F A;  2K8B A;  4II2 B;  4XX5 A;  4WJN A;  1I42 A;  3P2B A;  2MW5 A;  4GXB A;  3QX1 A;  3QJZ A;  1WRD B;  2JY6 A;  1M94 A;  4MGZ E;  3HHM A;  4JQW C;  3H1U A;  2BWF A;  2LUE A;  1Q0W B;  1E7V A;  4WAA A;  3KW5 B;  1L7Y A;  1P0R A;  3L08 A;  3PS6 A;  3A4S C;  2O2V A;  1BT0 A;  4TQ0 A;  3PLV A;  2LXA A;  4HDQ A;  4MSM B;  2KFK A;  2KJ6 A;  4HLE A;  2V1Y A;  3N32 A;  5L95 C;  2D3G A;  1TBE A;  2L8J A;  1P98 A;  2N7D A;  1Z5S B;  3NHE B;  4TV3 A;  1PQS A;  2G45 B;  1WE7 A;  2KO3 A;  4BBN C;  5IA7 A;  4PS3 A;  4I6L B;  4M8M A;  2O6V A;  4MJS A;  2DHZ A;  2DYB A;  1GNU A;  3W1Y A;  1Q5W B;  1AAR A;  5E6O A;  3RUI B;  5AZG A;  1XQQ A;  4AJW A;  2KWU B;  1GC7 A;  1WJ4 A;  4IW0 A;  3QHT A;  3T8M A;  5KHQ A;  4GDL B;  4BOZ B;  4W9H A;  5CX3 A;  4EZJ A;  2N7E A;  5JHA A;  5D6J B;  3T9L A;  1OQY A;  4G50 A;  2JRI B;  3ZO5 B;  3MJW A;  4WJP A;  3I3T B;  2LGD A;  2C9W B;  2ZNV B;  2BYE A;  4ANU A;  1XT9 B;  3TCA A;  5GMV A;  3QC8 B;  4BKG A;  5J17 A;  1S1Q B;  1WJN A;  2GBK A;  1E8Y A;  2DZK A;  5CHV C;  4KVG B;  2R2Q A;  2M17 A;  3TL5 A;  2LZ6 A;  3SU8 X;  4IG7 B;  2GBM A;  4PYZ A;  3ML8 A;  4HWI B;  3QCA A;  3QA8 A;  1WGD A;  2K6D B;  2MBE A;  3HM3 A;  1WI0 A;  2ZPN A;  4HCN B;  2JF5 A;  1EO6 A;  4NQL B;  3DVN V;  4DHJ B;  3L10 B;  1FXT B;  1GUA B;  4K7U A;  3APC A;  3OAW A;  1WJU A;  3ZW3 A;  2YVC A;  4W9J A;  5G2N A;  1WXA A;  2M0X A;  1YQB A;  4IWP A;  3U7D A;  3ZNG C;  3OLM D;  4AUQ C;  1S3S G;  4ICV A;  3X0W A;  3DOW A;  4DHZ B;  2O2V B;  4MH0 E;  2IZV B;  1ZW7 A;  4EEW A;  2Z59 B;  3A1Q A;  3PHX B;  3NZU A;  2IY0 B;  4FHJ A;  3IHP C;  3DCG A;  3MHS D;  3NS8 A;  2FCS A;  4K1R B;  3VTV A;  3H9D A;  4EUT A;  3HM6 X;  2IO2 B;  4K81 A;  1H8C A;  3ECI A;  2ZNV C;  3HIZ A;  1WX9 A;  3BIN A;  2GOW A;  2K1F A;  3AU4 A;  2DZI A;  4LCD E;  2IBI B;  4NJ7 A;  4WWP A;  3RD2 A;  2BYF A;  2MP2 A;  2BF8 B;  4JIO U;  1LM8 B;  1Q1O A;  3JW0 X;  4HCP B;  2LVO A;  3WAL A;  2DX5 B;  2N1W A;  4HPM B;  1WZ0 A;  3DPD A;  4W9C A;  3SD5 A;  4DK5 A;  2KFJ A;  2JZZ A;  3N30 A;  4MM3 A;  2ASQ A;  4W9I A;  3H7S A;  5LXI B;  2KD0 A;  2MRP A;  1TTN A;  2FAZ A;  4W9D A;  5CHF A;  1UD7 A;  4XC2 A;  3VUW A;  2KQS A;  1LQB A;  4ANW A;  2XEW A;  1WR1 A;  4F7Z A;  4HDO A;  1WYW B;  2ZCC A;  3QQ8 B;  4PS8 A;  3KUC B;  3L13 A;  2LGX A;  3V62 A;  3PZD A;  5DPR A;  2VRR B;  1WX7 A;  5LXH A;  2KC2 A;  3PPA A;  3OJ3 A;  1WJ6 A;  2UYZ B;  3CST A;  3GOE A;  4I6P A;  4IM0 A;  2BYV E;  2MLB A;  5JH5 C;  2JWZ A;  5TR5 A;  2RGF A;  2LXC A;  3UF8 A;  3VFK A;  1SIF A;  2C7N B;  3DBH I;  4GDL A;  4CYE A;  3U30 A;  1WXM A;  2KDI A;  2L0F A;  4P7I A;  5D2M B;  3VUY A;  1LFD A;  4F8C B;  4B95 A;  5KHO A;  2KDB A;  1KJT A;  3QAR A;  3AI5 A;  3KH0 A;  2MWS B;  4FAD A;  2BWE S;  2GBR A;  2KXJ A;  3A9K B;  2KKC A;  3VH3 B;  2IO1 B;  2HE7 A;  2MBO A;  2N9P C;  4DHZ E;  1WGY A;  3TBL D;  2KZR A;  4HVB A;  4E71 A;  3KVF B;  2JZ3 B;  2FCM A;  1I35 A;  1K8R B;  3PTF C;  2IY1 B;  2KK8 A;  1WMH B;  2NBW B;  2Y5B B;  3L17 A;  4MEM A;  5AZH A;  4KSK C;  3TIX A;  2N1V A;  4W9G A;  4HJK A;  4WJQ A;  5IAA C;  4XZ4 A;  2K39 A;  1HE8 A;  1WGR A;  2KAN A;  1LXD A;  3UIP B;  4G0N B;  2K25 A;  2AEH A;  4KV2 A;  3RYT A;  3ZRC A;  2G3Q B;  4GGQ A;  2HJ8 A;  4HK2 A;  3PVL A;  4AJY B;  5DPW A;  3Q3F A;  2WWZ A;  2L0T A;  2JVC A;  3M3J A;  4FLH A;  1KLV A;  2EMT A;  3WA0 A;  2NS5 A;  1J8C A;  1UBI A;  1V5O A;  3IVF A;  3VH4 B;  2QHO A;  4G3X B;  5J18 A;  3A1Q B;  4E3C A;  2BGF A;  3EHV A;  4A3O A;  4X57 B;  2A5U A;  2KDF B;  4OVV A;  4FN2 A;  3AU5 A;  2BPS A;  4GIV A;  4LDT D;  3PRP B;  4WJO A;  3WAM A;  2DYO A;  4BKS D;  5HKH A;  1H4R A;  2DYM A;  1V49 A;  5G55 A;  4EFO A;  2CKH B;  4CO7 A;  3AUL A;  5J2R A;  1QZE A;  3IFW B;  1UH6 A;  3DVN U;  1RLF A;  1WXS A;  4KZ0 A;  4WWO A;  1J0G A;  2EMS A;  5JHB A;  1C1Y B;  2DAF A;  2IO0 B;  5DPS A;  2KWC A;  3C0R B;  1ZGU B;  3KUZ A;  1WIA A;  4B6W A;  2KJR A;  2IYD B;  2FID A;  2NPT A;  4DDI D;  3PRM B;  2JRH A;  1U4A A;  4I6N B;  4IUM B;  3SDL C;  3IBE A;  2KLC A;  4GB9 A;  2GBN A;  5DCN A;  2DZJ A;  4MSQ B;  3R3M A;  4LDT B;  1MG8 A;  3X23 A;  3DVG X;  4K7W A;  3DBL I;  2LWP A;  2N9X A;  3OJ4 B;  4IC7 B;  3BY4 B;  3U8Z A;  2FIF A;  1GJZ A;  1TGZ B;  2WDT B;  2ZEQ A;  3QK0 A;  3VQI A;  3EC8 A;  1WFY A;  2XK5 B;  3QAQ A;  2RR9 A;  1RFA A;  2XK5 A;  3A9J A;  1V80 A;  1RAX A;  3A9J B;  2WX1 A;  2GMI C;  4II3 B;  1R4M I;  1UBQ A;  4GOC A;  1EUV B;  4IM2 A;  4NY0 A;  2UWQ A;  3UIO B;  2KMA A;  2O6V D;  4ZDV A;  1EF1 A;  2L7R A;  1UGM A;  2L76 A;  4M8N A;  4W9K A;  4MDK E;  2M4N A;  1J19 A;  2DZM A;  3DQV A;  4NAW A;  2LI5 A;  5LLI A;  3RZW C;  2MBQ A;  2NVU I;  1UZX B;  3Q3J A;  2EKE C;  2RPQ A;  4KIK A;  2J0M A;  2MQJ A;  4KIK B;  2J0J A;  3ZTD A;  2KJH B;  2AL3 A;  1WGH A;  1ISN A;  2HTH A;  2HD5 B;  3H7P A;  1KM7 A;  3KYC D;  4NPN A;  3TJP A;  5C23 A;  4DDG D;  2M1M A;  3TMP B;  4FBJ B;  3D32 A;  1JRU A;  3SHQ A;  3VAW A;  4JGH B;  2FCQ A;  2J7Q B;  2CU1 A;  2KNB A;  3NOB A;  2K8H A;  2KLG A;  4MGI E;  4MGY E;  4GDK B;  2CR5 A;  4B9K A;  4DHJ D;  4BVU C;  3APD A;  1V9J A;  2J0K A;  3HK0 A;  2N4F A;  1VCB A;  2RSU A;  3ZNH B;  3V6E B;  4KDI C;  5FR6 A;  1NDD A;  4IWQ A;  3KUD B;  3W1S A;  4NQK E;  2L3Z A;  2NPT B;  2JT4 B;  3PV1 A;  4TKN A;  2KOX A;  2MBH A;  4K7S A;  2G4D B;  4ASW C;  3PT2 B;  1NBF C;  4KDL B;  3ZTC A;  4M0W B;  2LD9 A;  2KX0 A;  2BKF A;  1RRB A;  4NNJ B;  1IPG A;  3NZS A;  2KN5 A;  3K9P B;  4TUU A;  5CHW A;  2JXX A;  4JL9 A;  2D2Q A;  4N9F 4;  1IYF A;  2RD0 A;  4ZRJ A;  2LRU A;  3ZUN A;  4DWF A;  2KTF A;  3V6C B;  3ZLZ A;  3QWZ B;  3A4R A;  1V5T A;  1E8Z A;  3VUX A;  3WAN A;  4KZC A;  1E8X A;  4WQO B;  2NR2 A;  3MTN B;  5D94 A;  4JLC A;  3O65 B;  1TZ1 A;  2PJH A;  4OVU A;  2YLM A;  2LAS A;  1E5W A;  3WAP A;  3WAO A;  3RUL A;  4MJS B;  3RCZ A;  3VDZ A;  2KVR A;  4GN1 A;  1WY8 A;  2CHX A;  4EKU A;  1E8W A;  1L2N A;  3M62 B;  1WZ3 A;  4BKT A;  4LJO B;  1CMX B;  3ZNZ B;  3PLU A;  4NAW B;  2JUO A;  3V60 A;  4NJ6 A;  4A3P A;  4BKS A;  5L83 A;  4EZL A;  2KC1 A;  3H7P B;  3H6N A;  2C60 A;  3JSV B;  1YX5 B;  5DPT A;  2PE6 B;  3JSV A;  4A20 A;  2KHW B;  2KWV B;  3VTU A;  2BKR B;  2OJR A;  3B1L X;  4ANV A;  2N9E B;  2ZVN A;  3GZN I;  3KYD D;  2ZJD A;  4J6I A;  3PRE A;  4IWO A;  4ZRI A;  1G6J A;  1WXV A;  1SGH A;  1T0Y A;  3CSF A;  5CTR C;  2OOB B;  3UQB A;  4F1S A;  2B3A A;  3L16 A;  1X1M A;  4PYU A;  1V2Y A;  4RM8 A;  4HXD A;  4EZK A;  3UQA A;  1KOT A;  2Z0D B;  4DBG A;  3WIM A;  2C5L C;  3ZDM C;  3DBS A;  4BFR A;  4EOY A;  4LJP B;  1WM2 A;  3M95 A;  2MA9 B;  2A4Z A;  1XD3 B;  2AL6 A;  3VXW A;  2MSE D;  3LDZ E;  3UIN B;  1YX6 B;  3QIJ A;  1YIW A;  2JPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...