2N2MA

Nmr structure of yersinia pestis ail (attachment invasion locus) in decylphosphocholine micelles
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title Backbone structure of Yersinia pestis Ail determined in micelles by NMR-restrained simulated annealing with implicit membrane solvation.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Membrane protein
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2n2mA00
3G7GA 3GP6A 4PUXA 3C5OA 1G90A 1ORMA 1QJPA 2N2LA 1BXWA 1MM4A 2X27X 3QRCA 2M07A 2MHLA 2ERVA 2MNHA 1P4TA 1Q9FA 1QJ9A 3QRAA 1Q9GA 2LHFA 2GE4A 1QJ8A 2JMMA 2F1TA 2N2MA 1MM5A 1THQA 2M06A 2F1VA 4RLCA 2K0LA
chains in the Genus database with same CATH superfamily
1ZHXA 4UB6O 4GCSA 4UB8O 3HW9A 3JCUO 5GTIO 1PHOA 2YNKA 3SY7A 1T1LA 3AA7A 4FZNA 3RBHA 3WU2O 5IYUA 1BH3A 5TISO 2KXPB 2WJRA 4PUXA 1S5LO 3UPGA 2IWVA 4GF4A 2N2LA 4D64A 8PRNA 3T0SA 4E1TA 3DWOX 4FSPA 4E1SA 4GCQA 2MHLA 3HWBA 5G38A 2XE2A 1P4TA 4N58A 5ADXL 4CTDA 4AUIA 3AA0A 4O4XA 4FOZA 4D65A 4U9CA 3PGRA 3HOLA 3VZWX 3UAQA 1ZHTA 1ZHZA 1YS5A 3LK3B 3AA1B 2J1NA 3LK2A 2R4OA 5EE2A 7PRNA 2OMFA 3EMNX 4FZMA 3UU2A 2Y0HA 2J4UP 4PR7A 4O3WA 3VE1A 1IZNA 5G3AA 4AFKA 2ZFGA 3PQSA 4LSFA 1THQA 3KVDD 3AA6A 4AYEC 2F1VA 3T24A 3SY9A 1HXTA 3SYSA 4RLCA 2WJQA 2QTKA 4RJXA 4RJWA 4LSEA 3PRNA 3SZVA 5ADXK 2R88A 3NJTA 2R4PA 5KAIO 1G90A 1ORMA 1GFPA 1T16A 4GHBA 4AYID 3PORA 2FGRA 1BXWA 2KC0A 1H6S1 2KZ7B 4F4BA 2ERVA 2MNHA 4GCPA 3VZTX 3HOEA 2O4VA 1QJ9A 3JTYA 4C4VA 4K3CA 4KRAA 3VZUX 3PGSA 3PF1A 2X9KA 4XNKA 1GFNA 2LFUA 3POUA 4AKMA 4AZLA 2GE4A 1QJ8A 3DWNA 3KZIO 3O0EA 4N74A 1ZHYA 2XG6A 3AAAA 2F1TA 4FQEA 3AA0B 2XTRA 3SYBA 3TZGA 4O49A 4C69X 1HXXA 5KAFO 3LK41 6PRNA 3PQUA 3LK2B 1E54A 3G7GA 4JCHA 3VE2A 1IZNB 4FESA 3AAEA 4RL9A 3LK3A 5DL8A 3BRZA 2W81C 3BS0A 3C5OA 2Y0KA 1HXUA 2XE1A 3LK42 2Y7SA 1OPFA 3V8UA 2XE3A 3AA6B 2F1CX 3FYXA 2X27X 4KR8A 4Z3TA 2YPVA 4FUVA 4N75A 4QQ1A 1BT9A 4C00A 3A2SX 4JFBA 3NSGA 5DL6A 2Y2XA 4AKRA 4G75A 3DA4A 3AA7B 4FRTA 3T20A 3POXA 5DL5A 3BRYA 5JDPA 5D5DA 4O3ZA 4N59A 1MPFA 1Q9GA 1GFOA 2LHFA 3VY9X 5FVNA 2IWWA 2Y0LA 5GTHO 2R4LA 4O3YA 2KXPA 4O3XB 3DZMA 4AYDC 1ZHWA 2K4TA 3A0HO 4LSHA 2R4NA 1GFQA 4O4UA 2FGQX 4RLBA 2ZLDA 2PORA 4FSOA 1OSMA 3K19A 2W80C 4KR4A 2K0LA 5E79O 5B5EO 4FRXA 5B66O 4IL6O 3SZDA 3AAAB 3GP6A 4PJ0O 2AXTO 3AA1A 1QJPA 4B61A 5AFUK 1GFMA 1MM4A 3QRCA 4G76A 4K3BA 3A0BO 4XNLA 2M07A 5G39A 5PRNA 1Q9FA 5T5FA 4LSIA 2JQYA 3WI4A 2R8AA 3AAEB 3PGUA 3WI5A 3QRAA 3VY8X 5AFUL 2ODJA 2XMXA 4BUMX 2PRNA 2XE5A 2JMMA 5G26A 4FT6A 5DL7A 2WVPA 2N2MA 1PRNA 1MM5A 4AKRB 2KDYA 5GV0A 3POQA 2R89A 4AYMC 4AYNA 2M06A 2KZ7A 4C4VB 3DA3A 4FZLA 5H2FO 4D5UA 4FMSA 2XTQA
chains in the Genus database with same CATH topology
1ZHXA 4GCSA 3HW9A 5IYUA 1PHOA 2YNKA 3SY7A 3RBHA 3AA7A 4FZNA 1BH3A 2KXPB 4PUXA 3UPGA 4GF4A 2N2LA 4D64A 8PRNA 3T0SA 4E1TA 4FSPA 4E1SA 4GCQA 2MHLA 3HWBA 2XE2A 1P4TA 4N58A 5ADXL 4AUIA 3AA0A 4O4XA 4FOZA 4D65A 4U9CA 3HOLA 3VZWX 3UAQA 1ZHTA 1ZHZA 1YS5A 3LK3B 3AA1B 2J1NA 3LK2A 5EE2A 7PRNA 2OMFA 3EMNX 4FZMA 3UU2A 2Y0HA 2J4UP 4O3WA 3VE1A 1IZNA 2ZFGA 3PQSA 4LSFA 1THQA 3KVDD 3AA6A 4AYEC 2F1VA 3T24A 3SY9A 1HXTA 3SYSA 4RLCA 2QTKA 4RJXA 4RJWA 4LSEA 3PRNA 3SZVA 5ADXK 1G90A 1ORMA 1GFPA 4GHBA 4AYID 3PORA 2FGRA 1BXWA 2KC0A 1H6S1 2KZ7B 4F4BA 2ERVA 2MNHA 4GCPA 3VZTX 3HOEA 2O4VA 1QJ9A 3JTYA 4KRAA 3VZUX 4XNKA 4AZLA 1GFNA 2LFUA 3POUA 4AKMA 2GE4A 1QJ8A 3O0EA 1ZHYA 2XG6A 3AAAA 2F1TA 3SYBA 3AA0B 2XTRA 3TZGA 4AFKA 4O49A 4C69X 1HXXA 3LK41 6PRNA 3PQUA 3LK2B 1E54A 3G7GA 4JCHA 3VE2A 1IZNB 4FESA 3AAEA 4RL9A 3LK3A 5DL8A 2W81C 3C5OA 2Y0KA 1HXUA 2XE1A 3LK42 2Y7SA 1OPFA 3V8UA 2XE3A 3AA6B 3FYXA 4KR8A 2X27X 4Z3TA 2YPVA 4FUVA 4QQ1A 1BT9A 3A2SX 4JFBA 3NSGA 5DL6A 2Y2XA 4AKRA 4G75A 3DA4A 3AA7B 4FRTA 3T20A 3POXA 5DL5A 5JDPA 5D5DA 4O3ZA 4N59A 1MPFA 1Q9GA 1GFOA 2LHFA 3VY9X 5FVNA 2Y0LA 4O3YA 2KXPA 4O3XB 4AYDC 1ZHWA 2K4TA 4LSHA 4RLBA 1GFQA 4O4UA 2FGQX 2ZLDA 2PORA 4FSOA 1OSMA 3K19A 2W80C 4KR4A 2K0LA 4FRXA 3SZDA 3AAAB 3GP6A 3AA1A 1QJPA 4B61A 5AFUK 1GFMA 1MM4A 3QRCA 4G76A 4XNLA 5PRNA 2M07A 1Q9FA 5T5FA 4LSIA 3WI4A 3AAEB 3WI5A 3QRAA 3VY8X 5AFUL 2ODJA 2XMXA 4BUMX 2PRNA 2XE5A 2JMMA 5G26A 4FT6A 5DL7A 2N2MA 1PRNA 1MM5A 4AKRB 2KDYA 5GV0A 3POQA 4AYMC 4AYNA 2M06A 2KZ7A 3DA3A 4FZLA 4D5UA 4FMSA 2XTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7G A;  3GP6 A;  4PUX A;  3C5O A;  1G90 A;  1ORM A;  1QJP A;  2N2L A;  1BXW A;  1MM4 A;  2X27 X;  3QRC A;  2M07 A;  2MHL A;  2ERV A;  2MNH A;  1P4T A;  1Q9F A;  1QJ9 A;  3QRA A;  1Q9G A;  2LHF A;  2GE4 A;  1QJ8 A;  2JMM A;  2F1T A;  2N2M A;  1MM5 A;  1THQ A;  2M06 A;  2F1V A;  4RLC A;  2K0L A; 
#chains in the Genus database with same CATH topology
 1ZHX A;  4UB6 O;  4GCS A;  4UB8 O;  3HW9 A;  3JCU O;  5GTI O;  1PHO A;  2YNK A;  3SY7 A;  1T1L A;  3AA7 A;  4FZN A;  3RBH A;  3WU2 O;  5IYU A;  1BH3 A;  5TIS O;  2KXP B;  2WJR A;  4PUX A;  1S5L O;  3UPG A;  2IWV A;  4GF4 A;  2N2L A;  4D64 A;  8PRN A;  3T0S A;  4E1T A;  3DWO X;  4FSP A;  4E1S A;  4GCQ A;  2MHL A;  3HWB A;  5G38 A;  2XE2 A;  1P4T A;  4N58 A;  5ADX L;  4CTD A;  4AUI A;  3AA0 A;  4O4X A;  4FOZ A;  4D65 A;  4U9C A;  3PGR A;  3HOL A;  3VZW X;  3UAQ A;  1ZHT A;  1ZHZ A;  1YS5 A;  3LK3 B;  3AA1 B;  2J1N A;  3LK2 A;  2R4O A;  5EE2 A;  7PRN A;  2OMF A;  3EMN X;  4FZM A;  3UU2 A;  2Y0H A;  2J4U P;  4PR7 A;  4O3W A;  3VE1 A;  1IZN A;  5G3A A;  4AFK A;  2ZFG A;  3PQS A;  4LSF A;  1THQ A;  3KVD D;  3AA6 A;  4AYE C;  2F1V A;  3T24 A;  3SY9 A;  1HXT A;  3SYS A;  4RLC A;  2WJQ A;  2QTK A;  4RJX A;  4RJW A;  4LSE A;  3PRN A;  3SZV A;  5ADX K;  2R88 A;  3NJT A;  2R4P A;  5KAI O;  1G90 A;  1ORM A;  1GFP A;  1T16 A;  4GHB A;  4AYI D;  3POR A;  2FGR A;  1BXW A;  2KC0 A;  1H6S 1;  2KZ7 B;  4F4B A;  2ERV A;  2MNH A;  4GCP A;  3VZT X;  3HOE A;  2O4V A;  1QJ9 A;  3JTY A;  4C4V A;  4K3C A;  4KRA A;  3VZU X;  3PGS A;  3PF1 A;  2X9K A;  4XNK A;  1GFN A;  2LFU A;  3POU A;  4AKM A;  4AZL A;  2GE4 A;  1QJ8 A;  3DWN A;  3KZI O;  3O0E A;  4N74 A;  1ZHY A;  2XG6 A;  3AAA A;  2F1T A;  4FQE A;  3AA0 B;  2XTR A;  3SYB A;  3TZG A;  4O49 A;  4C69 X;  1HXX A;  5KAF O;  3LK4 1;  6PRN A;  3PQU A;  3LK2 B;  1E54 A;  3G7G A;  4JCH A;  3VE2 A;  1IZN B;  4FES A;  3AAE A;  4RL9 A;  3LK3 A;  5DL8 A;  3BRZ A;  2W81 C;  3BS0 A;  3C5O A;  2Y0K A;  1HXU A;  2XE1 A;  3LK4 2;  2Y7S A;  1OPF A;  3V8U A;  2XE3 A;  3AA6 B;  2F1C X;  3FYX A;  2X27 X;  4KR8 A;  4Z3T A;  2YPV A;  4FUV A;  4N75 A;  4QQ1 A;  1BT9 A;  4C00 A;  3A2S X;  4JFB A;  3NSG A;  5DL6 A;  2Y2X A;  4AKR A;  4G75 A;  3DA4 A;  3AA7 B;  4FRT A;  3T20 A;  3POX A;  5DL5 A;  3BRY A;  5JDP A;  5D5D A;  4O3Z A;  4N59 A;  1MPF A;  1Q9G A;  1GFO A;  2LHF A;  3VY9 X;  5FVN A;  2IWW A;  2Y0L A;  5GTH O;  2R4L A;  4O3Y A;  2KXP A;  4O3X B;  3DZM A;  4AYD C;  1ZHW A;  2K4T A;  3A0H O;  4LSH A;  2R4N A;  1GFQ A;  4O4U A;  2FGQ X;  4RLB A;  2ZLD A;  2POR A;  4FSO A;  1OSM A;  3K19 A;  2W80 C;  4KR4 A;  2K0L A;  5E79 O;  5B5E O;  4FRX A;  5B66 O;  4IL6 O;  3SZD A;  3AAA B;  3GP6 A;  4PJ0 O;  2AXT O;  3AA1 A;  1QJP A;  4B61 A;  5AFU K;  1GFM A;  1MM4 A;  3QRC A;  4G76 A;  4K3B A;  3A0B O;  4XNL A;  2M07 A;  5G39 A;  5PRN A;  1Q9F A;  5T5F A;  4LSI A;  2JQY A;  3WI4 A;  2R8A A;  3AAE B;  3PGU A;  3WI5 A;  3QRA A;  3VY8 X;  5AFU L;  2ODJ A;  2XMX A;  4BUM X;  2PRN A;  2XE5 A;  2JMM A;  5G26 A;  4FT6 A;  5DL7 A;  2WVP A;  2N2M A;  1PRN A;  1MM5 A;  4AKR B;  2KDY A;  5GV0 A;  3POQ A;  2R89 A;  4AYM C;  4AYN A;  2M06 A;  2KZ7 A;  4C4V B;  3DA3 A;  4FZL A;  5H2F O;  4D5U A;  4FMS A;  2XTQ A; 
#chains in the Genus database with same CATH homology
 1ZHX A;  4GCS A;  3HW9 A;  5IYU A;  1PHO A;  2YNK A;  3SY7 A;  3RBH A;  3AA7 A;  4FZN A;  1BH3 A;  2KXP B;  4PUX A;  3UPG A;  4GF4 A;  2N2L A;  4D64 A;  8PRN A;  3T0S A;  4E1T A;  4FSP A;  4E1S A;  4GCQ A;  2MHL A;  3HWB A;  2XE2 A;  1P4T A;  4N58 A;  5ADX L;  4AUI A;  3AA0 A;  4O4X A;  4FOZ A;  4D65 A;  4U9C A;  3HOL A;  3VZW X;  3UAQ A;  1ZHT A;  1ZHZ A;  1YS5 A;  3LK3 B;  3AA1 B;  2J1N A;  3LK2 A;  5EE2 A;  7PRN A;  2OMF A;  3EMN X;  4FZM A;  3UU2 A;  2Y0H A;  2J4U P;  4O3W A;  3VE1 A;  1IZN A;  2ZFG A;  3PQS A;  4LSF A;  1THQ A;  3KVD D;  3AA6 A;  4AYE C;  2F1V A;  3T24 A;  3SY9 A;  1HXT A;  3SYS A;  4RLC A;  2QTK A;  4RJX A;  4RJW A;  4LSE A;  3PRN A;  3SZV A;  5ADX K;  1G90 A;  1ORM A;  1GFP A;  4GHB A;  4AYI D;  3POR A;  2FGR A;  1BXW A;  2KC0 A;  1H6S 1;  2KZ7 B;  4F4B A;  2ERV A;  2MNH A;  4GCP A;  3VZT X;  3HOE A;  2O4V A;  1QJ9 A;  3JTY A;  4KRA A;  3VZU X;  4XNK A;  4AZL A;  1GFN A;  2LFU A;  3POU A;  4AKM A;  2GE4 A;  1QJ8 A;  3O0E A;  1ZHY A;  2XG6 A;  3AAA A;  2F1T A;  3SYB A;  3AA0 B;  2XTR A;  3TZG A;  4AFK A;  4O49 A;  4C69 X;  1HXX A;  3LK4 1;  6PRN A;  3PQU A;  3LK2 B;  1E54 A;  3G7G A;  4JCH A;  3VE2 A;  1IZN B;  4FES A;  3AAE A;  4RL9 A;  3LK3 A;  5DL8 A;  2W81 C;  3C5O A;  2Y0K A;  1HXU A;  2XE1 A;  3LK4 2;  2Y7S A;  1OPF A;  3V8U A;  2XE3 A;  3AA6 B;  3FYX A;  4KR8 A;  2X27 X;  4Z3T A;  2YPV A;  4FUV A;  4QQ1 A;  1BT9 A;  3A2S X;  4JFB A;  3NSG A;  5DL6 A;  2Y2X A;  4AKR A;  4G75 A;  3DA4 A;  3AA7 B;  4FRT A;  3T20 A;  3POX A;  5DL5 A;  5JDP A;  5D5D A;  4O3Z A;  4N59 A;  1MPF A;  1Q9G A;  1GFO A;  2LHF A;  3VY9 X;  5FVN A;  2Y0L A;  4O3Y A;  2KXP A;  4O3X B;  4AYD C;  1ZHW A;  2K4T A;  4LSH A;  4RLB A;  1GFQ A;  4O4U A;  2FGQ X;  2ZLD A;  2POR A;  4FSO A;  1OSM A;  3K19 A;  2W80 C;  4KR4 A;  2K0L A;  4FRX A;  3SZD A;  3AAA B;  3GP6 A;  3AA1 A;  1QJP A;  4B61 A;  5AFU K;  1GFM A;  1MM4 A;  3QRC A;  4G76 A;  4XNL A;  5PRN A;  2M07 A;  1Q9F A;  5T5F A;  4LSI A;  3WI4 A;  3AAE B;  3WI5 A;  3QRA A;  3VY8 X;  5AFU L;  2ODJ A;  2XMX A;  4BUM X;  2PRN A;  2XE5 A;  2JMM A;  5G26 A;  4FT6 A;  5DL7 A;  2N2M A;  1PRN A;  1MM5 A;  4AKR B;  2KDY A;  5GV0 A;  3POQ A;  4AYM C;  4AYN A;  2M06 A;  2KZ7 A;  3DA3 A;  4FZL A;  4D5U A;  4FMS A;  2XTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...