2N2MA

Nmr structure of yersinia pestis ail (attachment invasion locus) in decylphosphocholine micelles
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
156
structure length
156
Chain Sequence
EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone structure of Yersinia pestis Ail determined in micelles by NMR-restrained simulated annealing with implicit membrane solvation.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Membrane protein
molecule keywords Outer membrane protein X
total genus 22
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2n2mA00
3G7GA 1G90A 2MNHA 1MM5A 2LHFA 2JMMA 1MM4A 4RLCA 1QJ9A 2M06A 1P4TA 1BXWA 2N2LA 3QRCA 1Q9FA 1QJPA 2MHLA 2F1TA 2ERVA 3GP6A 4PUXA 1QJ8A 2X27X 1THQA 2F1VA 1Q9GA 2N2MA 2K0LA 3QRAA 3C5OA 1ORMA 2GE4A 2M07A
chains in the Genus database with same CATH superfamily
2PORA 2FGRA 3V8UA 3PGRA 3AA7B 4GF4A 4G75A 4C4VB 2LHFA 2R8AA 4AKRA 2JMMA 5DL7A 4N75A 4RLCA 4RL9A 4D5UA 5B5EO 1QJ9A 2W80C 4N59A 3AA6A 3KZIO 5GTIO 2ZLDA 2XMXA 3WI5A 4LSIA 2R88A 5TISO 5KAIO 3AAAB 3BRYA 4AYEC 2R4PA 4RJWA 2XE5A 5G39A 2WVPA 3VE1A 2Y7SA 3DWNA 2ZFGA 1Q9FA 3PF1A 3AA0A 3O0EA 2MHLA 2F1TA 3GP6A 5D5DA 4LSHA 3UU2A 3POQA 3PRNA 4FRXA 2J4UP 3T20A 2XE2A 4QQ1A 4KRAA 3WU2O 1THQA 2R4NA 4E1TA 1IZNB 1ZHZA 4FRTA 3JTYA 1ORMA 3HW9A 3BRZA 2GE4A 2R4LA 1ZHWA 2X9KA 4FZMA 4GHBA 2MNHA 1BT9A 1T16A 2KZ7B 3AAEA 2JQYA 4O3XB 3BS0A 4FT6A 4GCQA 4AKRB 4AYID 4N74A 5B66O 4CTDA 3UPGA 2AXTO 1P4TA 1H6S1 2XTQA 4FMSA 4GCSA 2IWVA 4N58A 3LK42 4G76A 4D64A 1MPFA 2N2LA 1PHOA 2LFUA 2OMFA 3AAAA 3PORA 4K3BA 2XG6A 3JCUO 3RBHA 1GFPA 1OPFA 4FZNA 3T0SA 1ZHXA 1GFQA 5GV0A 2KXPB 3KVDD 2ERVA 2XTRA 3SY7A 3AA6B 2ODJA 4FESA 2F1CX 1HXTA 4O3ZA 2F1VA 4JCHA 4UB8O 3WI4A 5IYUA 1YS5A 3QRAA 4C69X 2Y0KA 3HOEA 1OSMA 5AFUK 1E54A 1ZHYA 3LK2A 5DL5A 4AFKA 4K3CA 2Y0HA 2WJRA 4XNKA 3G7GA 1GFOA 2XE1A 3AA1B 3UAQA 1G90A 3AA0B 4O3YA 2R4OA 1S5LO 3POXA 4O4XA 5DL6A 4B61A 2KZ7A 3PQUA 4C00A 4RJXA 1MM4A 4GCPA 5GTHO 2IWWA 4LSEA 3HWBA 2M06A 3LK41 4AUIA 3PQSA 3NSGA 4E1SA 4BUMX 5G38A 4O3WA 1T1LA 3QRCA 5FVNA 4C4VA 2QTKA 4FOZA 2YNKA 4AYNA 1QJPA 4RLBA 5PRNA 3K19A 5ADXL 4UB6O 5AFUL 4AKMA 3A0BO 4JFBA 2K4TA 2Y2XA 2K0LA 2R89A 2KC0A 3C5OA 4AZLA 3LK3B 3SZVA 3NJTA 3VZUX 4O49A 3A0HO 2M07A 5G26A 4KR4A 5DL8A 3SYBA 3FYXA 2WJQA 2KXPA 3AA7A 3DA3A 5EE2A 1GFNA 1HXUA 1MM5A 2XE3A 4FSOA 3SY9A 3A2SX 3PGSA 4O4UA 3HOLA 3VE2A 7PRNA 4FUVA 2J1NA 4XNLA 3DWOX 5G3AA 2FGQX 4KR8A 4LSFA 1GFMA 3LK2B 5H2FO 4F4BA 1BXWA 1ZHTA 2YPVA 1IZNA 5KAFO 3DZMA 3SZDA 2O4VA 3AA1A 4PJ0O 2KDYA 8PRNA 5JDPA 2W81C 4FSPA 3T24A 4Z3TA 2Y0LA 3TZGA 4IL6O 3VZWX 4D65A 3AAEB 4AYMC 4FZLA 4PUXA 4AYDC 1QJ8A 3VY8X 2X27X 4PR7A 3VZTX 3SYSA 1HXXA 6PRNA 1Q9GA 2PRNA 2N2MA 4U9CA 1PRNA 5E79O 3DA4A 3EMNX 4FQEA 3VY9X 5ADXK 5T5FA 3PGUA 3LK3A 3POUA 1BH3A
chains in the Genus database with same CATH topology
2PORA 2FGRA 3V8UA 3AA7B 4GF4A 4G75A 2LHFA 4AKRA 2JMMA 5DL7A 4D5UA 4RLCA 4RL9A 1QJ9A 2W80C 4N59A 3AA6A 2ZLDA 2XMXA 3WI5A 4LSIA 3AAAB 4AYEC 4RJWA 2XE5A 3VE1A 2Y7SA 2ZFGA 1Q9FA 3AA0A 3O0EA 2MHLA 2F1TA 3GP6A 5D5DA 4LSHA 3UU2A 3POQA 3PRNA 4FRXA 2J4UP 3T20A 2XE2A 4QQ1A 4KRAA 1THQA 4E1TA 1IZNB 1ZHZA 4FRTA 3JTYA 1ORMA 3HW9A 2GE4A 1ZHWA 4GHBA 4FZMA 2MNHA 1BT9A 3AAEA 2KZ7B 4O3XB 4FT6A 4GCQA 4AKRB 4AYID 3UPGA 1P4TA 1H6S1 2XTQA 4FMSA 4GCSA 4N58A 3LK42 4G76A 4D64A 1MPFA 2N2LA 1PHOA 2LFUA 2OMFA 3AAAA 3PORA 3RBHA 2XG6A 1GFPA 1OPFA 4FZNA 3T0SA 1ZHXA 1GFQA 5GV0A 2KXPB 3KVDD 2ERVA 2XTRA 3SY7A 3AA6B 2ODJA 4FESA 1HXTA 4O3ZA 2F1VA 4JCHA 3WI4A 5IYUA 1YS5A 3QRAA 4C69X 2Y0KA 3HOEA 1OSMA 5AFUK 1E54A 1ZHYA 3LK2A 5DL5A 4AFKA 2Y0HA 4XNKA 3G7GA 1GFOA 2XE1A 3AA1B 3UAQA 1G90A 3AA0B 4O3YA 5DL6A 3POXA 4O4XA 2KZ7A 3PQUA 4RJXA 1MM4A 4GCPA 4LSEA 3HWBA 2M06A 3LK41 4AUIA 3PQSA 3NSGA 4E1SA 4BUMX 4O3WA 3QRCA 5FVNA 2QTKA 4FOZA 2YNKA 4AYNA 1QJPA 4RLBA 5PRNA 3K19A 5ADXL 5AFUL 4AKMA 4JFBA 2K4TA 2Y2XA 2K0LA 2KC0A 3C5OA 4AZLA 3LK3B 3SZVA 3VZUX 4O49A 5G26A 2M07A 4B61A 4KR4A 5DL8A 3SYBA 3FYXA 3AA7A 2KXPA 3DA3A 5EE2A 1GFNA 1HXUA 1MM5A 2XE3A 4FSOA 3SY9A 3A2SX 4O4UA 3HOLA 3VE2A 7PRNA 4FUVA 2J1NA 4XNLA 2FGQX 4KR8A 4LSFA 1GFMA 3LK2B 4F4BA 1BXWA 1ZHTA 2YPVA 1IZNA 3SZDA 2O4VA 3AA1A 5JDPA 2KDYA 8PRNA 2W81C 4FSPA 3T24A 4Z3TA 2Y0LA 3TZGA 3VZWX 4D65A 3AAEB 4AYMC 4FZLA 4PUXA 4AYDC 1QJ8A 3VY8X 2X27X 3VZTX 3SYSA 1HXXA 6PRNA 1Q9GA 2PRNA 2N2MA 4U9CA 1PRNA 3VY9X 3DA4A 3EMNX 5ADXK 5T5FA 3LK3A 3POUA 1BH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7G A;  1G90 A;  2MNH A;  1MM5 A;  2LHF A;  2JMM A;  1MM4 A;  4RLC A;  1QJ9 A;  2M06 A;  1P4T A;  1BXW A;  2N2L A;  3QRC A;  1Q9F A;  1QJP A;  2MHL A;  2F1T A;  2ERV A;  3GP6 A;  4PUX A;  1QJ8 A;  2X27 X;  1THQ A;  2F1V A;  1Q9G A;  2N2M A;  2K0L A;  3QRA A;  3C5O A;  1ORM A;  2GE4 A;  2M07 A; 
#chains in the Genus database with same CATH topology
 2POR A;  2FGR A;  3V8U A;  3PGR A;  3AA7 B;  4GF4 A;  4G75 A;  4C4V B;  2LHF A;  2R8A A;  4AKR A;  2JMM A;  5DL7 A;  4N75 A;  4RLC A;  4RL9 A;  4D5U A;  5B5E O;  1QJ9 A;  2W80 C;  4N59 A;  3AA6 A;  3KZI O;  5GTI O;  2ZLD A;  2XMX A;  3WI5 A;  4LSI A;  2R88 A;  5TIS O;  5KAI O;  3AAA B;  3BRY A;  4AYE C;  2R4P A;  4RJW A;  2XE5 A;  5G39 A;  2WVP A;  3VE1 A;  2Y7S A;  3DWN A;  2ZFG A;  1Q9F A;  3PF1 A;  3AA0 A;  3O0E A;  2MHL A;  2F1T A;  3GP6 A;  5D5D A;  4LSH A;  3UU2 A;  3POQ A;  3PRN A;  4FRX A;  2J4U P;  3T20 A;  2XE2 A;  4QQ1 A;  4KRA A;  3WU2 O;  1THQ A;  2R4N A;  4E1T A;  1IZN B;  1ZHZ A;  4FRT A;  3JTY A;  1ORM A;  3HW9 A;  3BRZ A;  2GE4 A;  2R4L A;  1ZHW A;  2X9K A;  4FZM A;  4GHB A;  2MNH A;  1BT9 A;  1T16 A;  2KZ7 B;  3AAE A;  2JQY A;  4O3X B;  3BS0 A;  4FT6 A;  4GCQ A;  4AKR B;  4AYI D;  4N74 A;  5B66 O;  4CTD A;  3UPG A;  2AXT O;  1P4T A;  1H6S 1;  2XTQ A;  4FMS A;  4GCS A;  2IWV A;  4N58 A;  3LK4 2;  4G76 A;  4D64 A;  1MPF A;  2N2L A;  1PHO A;  2LFU A;  2OMF A;  3AAA A;  3POR A;  4K3B A;  2XG6 A;  3JCU O;  3RBH A;  1GFP A;  1OPF A;  4FZN A;  3T0S A;  1ZHX A;  1GFQ A;  5GV0 A;  2KXP B;  3KVD D;  2ERV A;  2XTR A;  3SY7 A;  3AA6 B;  2ODJ A;  4FES A;  2F1C X;  1HXT A;  4O3Z A;  2F1V A;  4JCH A;  4UB8 O;  3WI4 A;  5IYU A;  1YS5 A;  3QRA A;  4C69 X;  2Y0K A;  3HOE A;  1OSM A;  5AFU K;  1E54 A;  1ZHY A;  3LK2 A;  5DL5 A;  4AFK A;  4K3C A;  2Y0H A;  2WJR A;  4XNK A;  3G7G A;  1GFO A;  2XE1 A;  3AA1 B;  3UAQ A;  1G90 A;  3AA0 B;  4O3Y A;  2R4O A;  1S5L O;  3POX A;  4O4X A;  5DL6 A;  4B61 A;  2KZ7 A;  3PQU A;  4C00 A;  4RJX A;  1MM4 A;  4GCP A;  5GTH O;  2IWW A;  4LSE A;  3HWB A;  2M06 A;  3LK4 1;  4AUI A;  3PQS A;  3NSG A;  4E1S A;  4BUM X;  5G38 A;  4O3W A;  1T1L A;  3QRC A;  5FVN A;  4C4V A;  2QTK A;  4FOZ A;  2YNK A;  4AYN A;  1QJP A;  4RLB A;  5PRN A;  3K19 A;  5ADX L;  4UB6 O;  5AFU L;  4AKM A;  3A0B O;  4JFB A;  2K4T A;  2Y2X A;  2K0L A;  2R89 A;  2KC0 A;  3C5O A;  4AZL A;  3LK3 B;  3SZV A;  3NJT A;  3VZU X;  4O49 A;  3A0H O;  2M07 A;  5G26 A;  4KR4 A;  5DL8 A;  3SYB A;  3FYX A;  2WJQ A;  2KXP A;  3AA7 A;  3DA3 A;  5EE2 A;  1GFN A;  1HXU A;  1MM5 A;  2XE3 A;  4FSO A;  3SY9 A;  3A2S X;  3PGS A;  4O4U A;  3HOL A;  3VE2 A;  7PRN A;  4FUV A;  2J1N A;  4XNL A;  3DWO X;  5G3A A;  2FGQ X;  4KR8 A;  4LSF A;  1GFM A;  3LK2 B;  5H2F O;  4F4B A;  1BXW A;  1ZHT A;  2YPV A;  1IZN A;  5KAF O;  3DZM A;  3SZD A;  2O4V A;  3AA1 A;  4PJ0 O;  2KDY A;  8PRN A;  5JDP A;  2W81 C;  4FSP A;  3T24 A;  4Z3T A;  2Y0L A;  3TZG A;  4IL6 O;  3VZW X;  4D65 A;  3AAE B;  4AYM C;  4FZL A;  4PUX A;  4AYD C;  1QJ8 A;  3VY8 X;  2X27 X;  4PR7 A;  3VZT X;  3SYS A;  1HXX A;  6PRN A;  1Q9G A;  2PRN A;  2N2M A;  4U9C A;  1PRN A;  5E79 O;  3DA4 A;  3EMN X;  4FQE A;  3VY9 X;  5ADX K;  5T5F A;  3PGU A;  3LK3 A;  3POU A;  1BH3 A; 
#chains in the Genus database with same CATH homology
 2POR A;  2FGR A;  3V8U A;  3AA7 B;  4GF4 A;  4G75 A;  2LHF A;  4AKR A;  2JMM A;  5DL7 A;  4D5U A;  4RLC A;  4RL9 A;  1QJ9 A;  2W80 C;  4N59 A;  3AA6 A;  2ZLD A;  2XMX A;  3WI5 A;  4LSI A;  3AAA B;  4AYE C;  4RJW A;  2XE5 A;  3VE1 A;  2Y7S A;  2ZFG A;  1Q9F A;  3AA0 A;  3O0E A;  2MHL A;  2F1T A;  3GP6 A;  5D5D A;  4LSH A;  3UU2 A;  3POQ A;  3PRN A;  4FRX A;  2J4U P;  3T20 A;  2XE2 A;  4QQ1 A;  4KRA A;  1THQ A;  4E1T A;  1IZN B;  1ZHZ A;  4FRT A;  3JTY A;  1ORM A;  3HW9 A;  2GE4 A;  1ZHW A;  4GHB A;  4FZM A;  2MNH A;  1BT9 A;  3AAE A;  2KZ7 B;  4O3X B;  4FT6 A;  4GCQ A;  4AKR B;  4AYI D;  3UPG A;  1P4T A;  1H6S 1;  2XTQ A;  4FMS A;  4GCS A;  4N58 A;  3LK4 2;  4G76 A;  4D64 A;  1MPF A;  2N2L A;  1PHO A;  2LFU A;  2OMF A;  3AAA A;  3POR A;  3RBH A;  2XG6 A;  1GFP A;  1OPF A;  4FZN A;  3T0S A;  1ZHX A;  1GFQ A;  5GV0 A;  2KXP B;  3KVD D;  2ERV A;  2XTR A;  3SY7 A;  3AA6 B;  2ODJ A;  4FES A;  1HXT A;  4O3Z A;  2F1V A;  4JCH A;  3WI4 A;  5IYU A;  1YS5 A;  3QRA A;  4C69 X;  2Y0K A;  3HOE A;  1OSM A;  5AFU K;  1E54 A;  1ZHY A;  3LK2 A;  5DL5 A;  4AFK A;  2Y0H A;  4XNK A;  3G7G A;  1GFO A;  2XE1 A;  3AA1 B;  3UAQ A;  1G90 A;  3AA0 B;  4O3Y A;  5DL6 A;  3POX A;  4O4X A;  2KZ7 A;  3PQU A;  4RJX A;  1MM4 A;  4GCP A;  4LSE A;  3HWB A;  2M06 A;  3LK4 1;  4AUI A;  3PQS A;  3NSG A;  4E1S A;  4BUM X;  4O3W A;  3QRC A;  5FVN A;  2QTK A;  4FOZ A;  2YNK A;  4AYN A;  1QJP A;  4RLB A;  5PRN A;  3K19 A;  5ADX L;  5AFU L;  4AKM A;  4JFB A;  2K4T A;  2Y2X A;  2K0L A;  2KC0 A;  3C5O A;  4AZL A;  3LK3 B;  3SZV A;  3VZU X;  4O49 A;  5G26 A;  2M07 A;  4B61 A;  4KR4 A;  5DL8 A;  3SYB A;  3FYX A;  3AA7 A;  2KXP A;  3DA3 A;  5EE2 A;  1GFN A;  1HXU A;  1MM5 A;  2XE3 A;  4FSO A;  3SY9 A;  3A2S X;  4O4U A;  3HOL A;  3VE2 A;  7PRN A;  4FUV A;  2J1N A;  4XNL A;  2FGQ X;  4KR8 A;  4LSF A;  1GFM A;  3LK2 B;  4F4B A;  1BXW A;  1ZHT A;  2YPV A;  1IZN A;  3SZD A;  2O4V A;  3AA1 A;  5JDP A;  2KDY A;  8PRN A;  2W81 C;  4FSP A;  3T24 A;  4Z3T A;  2Y0L A;  3TZG A;  3VZW X;  4D65 A;  3AAE B;  4AYM C;  4FZL A;  4PUX A;  4AYD C;  1QJ8 A;  3VY8 X;  2X27 X;  3VZT X;  3SYS A;  1HXX A;  6PRN A;  1Q9G A;  2PRN A;  2N2M A;  4U9C A;  1PRN A;  3VY9 X;  3DA4 A;  3EMN X;  5ADX K;  5T5F A;  3LK3 A;  3POU A;  1BH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...