2N35A

Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Albumin binding protein
publication title Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 13
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2015-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2n35A00
2J5YA 2VDBB 2LHGA 2KDLA 2LHCA 2MH8A 1GJSA 2FS1A 2JWSA 2N35A 1PRBA 1GJTA 1TF0B 1GABA
chains in the Genus database with same CATH superfamily
1N75A 2CE7A 3AFHA 2CFOA 4F2LA 1WJ7A 4G6ZA 2C99A 2I7PA 2J5YA 4FVMA 5BR8M 1JR3A 3L26A 1W5SA 2FE8A 2G3QA 5EXPA 1J7KA 3H4MA 5KPZA 1NV8A 2JY5A 3W0FA 2CRUA 1LTMA 3VLFB 3CF6E 4TUWA 4B3RM 4M9ZA 1QAOA 1R4GA 3HGIA 2QBYA 4JI8M 3HU1A 4X65M 3GLIA 2Y21A 3FUUA 4KLNA 3HHWA 4KO8A 4MGYE 4PDIA 4LF5M 3KS4A 3E4RA 5EXTA 1EFUB 4FD2A 2KXEA 4LF7M 3HHYA 4PDGA 2ZTCA 1YUBA 2L7HA 3IG8A 2DWNA 2D7GA 2DI0A 2EJSA 3UGJA 3IG5A 4X64M 3SARA 3FYCA 3U6QA 4JN6A 1HNWM 2DWZB 4G4NA 2DAGA 3U60B 1I4WA 4MGZE 3U6DA 4NC6A 3U6SA 3FD9A 5KQDA 1DO2A 2DVWB 5IZ7D 1T3TA 2JY8A 4DV3M 2K9DA 2H5XA 1VEGA 4LG2A 1XWIA 1Z5AA 5ITTA 4LF8M 4B7FA 2KNZA 4GH9A 1QUSA 4GKJM 5DNYA 1HNZM 2QSFX 1DGHB 2OPFA 3KDSE 3FUXA 1K3XA 3DZDA 2R46A 3E9SA 2CWBA 2R4EA 3FUTA 4II7A 1V92A 3RGPA 4B3SM 4NL4H 1QUTA 2LXEA 2HCBA 2LNHC 4LZZA 5BPVA 3UJNA 2JNHA 3JR5A 4GC9A 2DWLA 1KYIA 1LV7A 2AHMA 1MN3A 3K1JA 1IXZA 2Y20A 1GL6A 4XK8F 4AW4A 5E6JA 5A2QS 3A45A 2MR9A 3J7BA 4F1IA 4QNMA 1SXJB 4JI0M 3K92A 1DV0A 3HJSA 2DZLA 2Z3XA 3BOSA 3HY5A 5GKNA 2HKJA 3CGWA 4RNAA 4W5WA 3GPXA 1FNNA 1EIJA 1OAOC 2YR0A 2O25A 1ZAEA 1IY2A 1P3QQ 3GP1A 3AKZA 3HHZA 3K2LA 2DENA 2Z4RA 2WSCF 2ZAOA 1QYRA 2X4AA 2QHOB 5L8RF 4I5SA 2JWSA 3PXGA 5JI2E 2KA6B 4OVZA 3C58A 3D8BA 1E9RA 1L2CA 3T1HM 1JR3D 4LJ5A 3SC3A 3THGA 2CP8A 4RF0A 2N35A 2J7OA 4X62M 1IBMM 2KRUA 2JUJA 3UMMA 1IN4A 1I94M 4ZPXA 3EIEA 2F5QA 1Q3CA 2HWJA 3ILKA 3U6EA 2FFJA 3HJ8A 5FTJA 3GLGA 2H1RA 3KXEC 4MGKE 4JYAM 4DV6M 2LVNC 2DKLA 4OU7A 1V33A 4CJ6A 4EIWA 3HKPA 4IBBA 2DHYA 3GPPA 4LGMA 5IREB 1IXRC 1X37A 4LRSA 3GO8A 5IWAM 3VKHA 4DV2M 2LWXA 4L6V6 4Z8XA 3TWKA 2UU9M 1VDLA 3U6OA 2KDLA 1D2NA 1MJGM 2VQFM 2UUBM 1GKIA 1L8QA 4I4LA 1L1TA 2F4VM 1WHCA 1TGUA 4Y28F 4JI1M 1N77A 1IN6A 1Z59A 4GIPA 4R3DA 5DFLA 2OQ4A 3CTWB 3U61A 3J80S 1CUKA 1QQWA 3LQQA 3T6PA 1HT2E 4BBAA 2Z4SA 1OFHA 1OJLA 3PNVA 2DXIA 1R5LA 2LVOC 1N36M 2UXDM 2F5OA 4NXMM 2KNVA 4LF6M 3AJIB 2XZUA 4JI6M 1VG5A 2M5ZA 3HX3A 3KSJA 3KP0E 1R2ZA 1R2YA 3LQRA 4S12A 3KOWE 3KSXA 4L15A 2OO9A 4WURA 1V34A 1NNUC 2MGWA 3I04M 5EP1A 1SXJE 3TWMA 5EXSA 3H4JA 3TE6A 2LH0A 2C96A 4FW9A 5H37D 4B3TM 4DR5M 3C9PA 4Z6YA 4FWHA 3I51A 5EQTA 4HEOA 3QWLA 2QNJA 4JI3M 3HU2A 1J09A 1R6BX 1TH3A 3FUWA 3KOXE 3K9OA 3LMMA 4IJFA 2UXBM 4M9XA 3LCVB 1Z5BA 5KO3A 2C9OA 1HT1E 2OOAA 3VFDA 3FTDA 4DUYM 1Q3BA 2LVPC 3MJ5A 3PFIA 2L7IA 4XGIA 3K8ZA 1XC8A 2JXNA 2F5NA 2VDBB 3I4YA 5F3WA 1UM8A 3AOGA 5KQ8A 1XNRM 2V1CA 5LMUM 1NY6A 1GVNA 2FS1A 2RRUA 2ZTDA 4B7GA 1G3IA 3W0LB 4JXJA 1QAQA 4X66M 1ZV1A 4IBGA 3F92A 1W5TA 2QCUA 4LJ8A 4QOZC 3V76A 1VEKA 4I81A 4A3VB 2KZUA 2QP9X 3FKEA 2JA2A 4LFAM 3ZH9B 3K9PA 1NSFA 1HQCA 2C98A 3B7ZA 1WR1B 1SG9A 4PD2A 1PRBA 2DAEA 4BLCA 3MMPA 1HR0M 1L2DA 1TDHA 4CGYB 3KS8A 4KT0F 3GPYA 4FWDA 3CF0A 4LY6A 3FYDA 1G8PA 1IY1A 2YQZA 1GABA 2R6FA 3SMPA 4D80A 4DV0M 3E46A 4NRWA 3HU3A 1IBKM 4CIZA 4NRVA 3GRRA 4IBJA 3T38A 3TQSA 1TTEA 1RU3A 2QZ4A 3EIHA 2L4EA 1F4IA 4G4QA 3LVVA 3KVWA 4JI7M 1IN7A 1G41A 2XFSA 2XFTA 2Y0QA 3VDPA 4DR1M 2J7NA 2E5LM 2LVAA 4AKIA 5EP3A 3VK8A 4MH0E 4MGIE 3M7GA 2BWBA 2ZANA 1XXHB 3SHFA 3U5ZA 3B89A 1NVMA 1KFVA 5ITQA 4LF4M 2R45A 2BJWA 3GLFB 8CATA 2MH8A 1IXSB 1XHBA 1PJSA 1BVSA 1JQJC 2C5RA 1OQYA 2XGNA 4GEWA 4AG5A 2HHHM 4QHSA 3GLHB 1XMQM 4MB7A 5JI3E 1YLAA 3ZCBB 3W68A 4M9SA 4DV4M 1E94E 1K82A 1IN5A 2LHCA 4LGYA 2JY6B 5C18A 2R44A 5ITUA 3TL4X 2CEAA 4YHHM 5FTKA 4KHPM 4QHTA 3D8LA 2XLJA 1TF0B 3IHPA 1QDRA 3W67A 3J27B 4XBOA 4GHAA 3FTCA 2XZFA 3FRIA 3AOEA 4OX9M 1NV9A 2OOBA 1AIPC 3FE3A 3MK6A 1D0MA 3VDUA 3UK6A 4HLQA 1DO0A 5FTMA 3QYEA 3T15A 3U60A 1C7YA 3SAUA 2B3TA 1TR8A 2QBYB 4OW0A 3GLIB 4IBCA 2WSEF 1NNJA 1E9SA 3M6AA 3LCUA 4DR6M 4DBGB 4ITQA 4AI6A 4LJ6A 1DGHA 2CV1A 1Q02A 2R62A 2ZBKB 1OKSA 2EKKA 1D0KA 4AQYM 1C1KA 2DHRA 2P5TA 4YY3M 1JB0F 1OFIA 2XSZA 1DGBA 5ITXE 2NQ8C 3SYLA 4DUZM 3GRYA 3SASA 1ZMWA 2I7NA 1XB2B 4FCVA 1NHWC 1T6OA 3T1YM 1Y8GA 1TDZA 2EUCA 1IN8A 2EKFA 2MROB 1VDDA 2VF7A 1ZMUA 3LW5F 3GQ3A 2R65A 4QNRA 3VK7A 2DNAA 1L1ZA 3NWLA 1XXHE 1SXJA 5EP4A 1OTRA 3DOAA 3MHVC 1UFZA 5EJCA 2RGHA 3SMSA 2R0IA 3GLFE 4LFCM 4AZFA 3L2AA 1J5EM 4NSOB 3FUVA 2L4FA 3KOZE 3VKGA 1VQ1A 3GLHE 1WXQA 1QDTA 1WIVA 2RGOA 4MM3B 3Q8XA 5FSWA 2JZ0A 4MGHA 2LTUA 2VF8A 2KW0A 4FCTA 2W82A 2JZ1A 4WP2A 3A46A 2G8LA 4AKGA 1A5TA 1S3SA 3U6PA 3NBIA 3TWLA 2L09A 3I01M 1HQYE 2X49A 3R8FA 1G59A 2R18A 1AUAA 2D7EA 2YFQA 3HHXA 4LJ9A 4LFBM 4IBDA 1JR3E 1GL7A 1HNXM 1N34M 1FJGM 2ZM6M 4K0KM 1L2BA 2GQFA 4DV1M 2DWMA 1IY0A 4OVZB 4CISA 3J2PB 1N33M 3I4VA 4AG6A 4P17A 2UUCM 4L4UA 1G4AE 2QPAA 4DR2M 1WGNA 4FWGA 4D81A 1PJIA 3GLIE 1QZMA 4GRIA 1NJFA 3AOEC 4JI5M 3GLGB 3KFUG 1HJPA 2QQ8A 1IQPA 3KW6A 2O5RA 4B7HA 2V1UA 4L8RC 2F5SA 1N78A 5FTLA 4LCBA 2JP7A 1XNQM 1MU5A 3GPUA 2WZJA 4DR4M 3WHLA 2F5PA 4NOOB 4LJ7A 2KHHA 3HJQA 2LHGA 4AKHA 4DR7M 1K3WA 2GNOA 3R9XB 4GMQA 5EXXA 1Q39A 4GHLA 2XH9A 3L28A 4HL4A 3L29A 4CHTB 1MX0A 2XSZD 3RE8A 2CUZA 4R7GA 3TPZA 2Z8YM 4IBKA 1NHGC 4B08A 3IECA 3ZC7B 4G4RA 3A42A 4LJ4A 3U61B 3DFZA 3B74A 4DR3M 1TH2A 1WGLA 4Q7JA 1YSYA 3U6LA 2EA0A 2VQEM 3B7NA 3NBXX 4WW0A 2C9CA 1TH4A 2FNAA 3M0EA 4L78A 1SXJD 1D0LA 4GC5A 1PJTA 3SATA 2O01F 3DA1A 2EO2A 4UN2B 4R71A 4NXNM 2WSFF 2VIIA 2BNKA 3PNYA 1ZMVA 1GJTA 2Z7JA 1SXJC 4RF1A 7CATA 5FTNA 2KZSA 3AV0A 4G3OA 1ORYB 4PT5A 4FCWA 3RGSA 1G71A 5KPTA 1H6UA 2DZOB 5ITYA 3SBJA 3OTOM 4DV5M 1OIPA 4GITA 5ITRA 1VEJA 2FOIC 2XEPA 3KP1E 1QVRA 3U6CA 1Z6TA 1YE9A 1KSFX 5EP2A 3CF2A 1DGFA 3RFWA 1PJJA 1NJGA 2CHQA 2V6ZM 1IM2A 2MJ5B 3BBZA 1QAMA 4JI2M 2X8AA 2DAIA 2D7HA 3B9PA 1NY5A 3WHKA 4DV7M 1N32M 3B7QA 3FTFA 1GO5A 1XMOM 1PM5A 3JR4A 2G5GX 1E32A 5KPRA 3QYBA 3LVWA 5LMNM 5IT9S 2APLA 4L16A 5C1BA 2HL7A 3SAWA 3SHGB 2L6OA 4QOSA 3GLGE 4LF9M 2LBCA 4ANRA 4I8OA 2K6BA 4LZJA 1DGGA 1QZEA 5E26A 2Q2EB 2ERCA 5DYGA 3JAMS 2QENA 3E21A 3SFZA 3L27A 3GRUA 3UZUA 2UXCM 4KODA 1PGYA 2XF3A 3J81S 2KRKA 2K47A 4BB9A 1NO1A 4P16A 2CHVA 4IBIA 3KOYE 4M0WA 4LJAA 4REZA 5ITXA 3BXWA 2CV2A 2RKOA 3L25A 1Z5CA 3SAVA 4IIWA 2DAMA 3QAUA 3C3DA 4IJEA 2ZAMA 1GLNA 2DAKA 4LRTA 3HWSA 2UUAM 4RKUF 1GJSA 2JY7A 1OIZA 5DYIA 4PCZA 1ZQ9A 3SYKA 2BJVA 1XXHA 2LVQD 1OAIA 2BWEA 2KEBA 2R4JA 3A98B 2YNMD 3FRHA 4NSRA 3GQ5A 1IBLM 4GKKM 4IBEA 3GLFA 3ZQJA 2Y0TA 2KNAA 3PVSA 4IBFA 3FTEA 1IXSA 3GRVA 4B3MM 2L2DA 4M0DA 1PJQA 3AL0C 1R7RA 2A5YB 2FH0A 3C3EA 3GLHA 3Q8GA 2CV0A 4D82A 5FLXS 3U6MA 3J7AS 1IFYA 3HZJA 1EE8A 4JV5M 4JI4M 2DZNB 3U5ZB 1T43A 2CHGA 2HAKA 3GQ4A 4G4OA 2M60A 1QANA 2K0BX
chains in the Genus database with same CATH topology
2J5YA 2VDBB 2LHGA 2KDLA 2LHCA 2MH8A 1GJSA 2FS1A 2JWSA 2N35A 1PRBA 1GJTA 1TF0B 1GABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5Y A;  2VDB B;  2LHG A;  2KDL A;  2LHC A;  2MH8 A;  1GJS A;  2FS1 A;  2JWS A;  2N35 A;  1PRB A;  1GJT A;  1TF0 B;  1GAB A; 
#chains in the Genus database with same CATH topology
 1N75 A;  2CE7 A;  3AFH A;  2CFO A;  4F2L A;  1WJ7 A;  4G6Z A;  2C99 A;  2I7P A;  2J5Y A;  4FVM A;  5BR8 M;  1JR3 A;  3L26 A;  1W5S A;  2FE8 A;  2G3Q A;  5EXP A;  1J7K A;  3H4M A;  5KPZ A;  1NV8 A;  2JY5 A;  3W0F A;  2CRU A;  1LTM A;  3VLF B;  3CF6 E;  4TUW A;  4B3R M;  4M9Z A;  1QAO A;  1R4G A;  3HGI A;  2QBY A;  4JI8 M;  3HU1 A;  4X65 M;  3GLI A;  2Y21 A;  3FUU A;  4KLN A;  3HHW A;  4KO8 A;  4MGY E;  4PDI A;  4LF5 M;  3KS4 A;  3E4R A;  5EXT A;  1EFU B;  4FD2 A;  2KXE A;  4LF7 M;  3HHY A;  4PDG A;  2ZTC A;  1YUB A;  2L7H A;  3IG8 A;  2DWN A;  2D7G A;  2DI0 A;  2EJS A;  3UGJ A;  3IG5 A;  4X64 M;  3SAR A;  3FYC A;  3U6Q A;  4JN6 A;  1HNW M;  2DWZ B;  4G4N A;  2DAG A;  3U60 B;  1I4W A;  4MGZ E;  3U6D A;  4NC6 A;  3U6S A;  3FD9 A;  5KQD A;  1DO2 A;  2DVW B;  5IZ7 D;  1T3T A;  2JY8 A;  4DV3 M;  2K9D A;  2H5X A;  1VEG A;  4LG2 A;  1XWI A;  1Z5A A;  5ITT A;  4LF8 M;  4B7F A;  2KNZ A;  4GH9 A;  1QUS A;  4GKJ M;  5DNY A;  1HNZ M;  2QSF X;  1DGH B;  2OPF A;  3KDS E;  3FUX A;  1K3X A;  3DZD A;  2R46 A;  3E9S A;  2CWB A;  2R4E A;  3FUT A;  4II7 A;  1V92 A;  3RGP A;  4B3S M;  4NL4 H;  1QUT A;  2LXE A;  2HCB A;  2LNH C;  4LZZ A;  5BPV A;  3UJN A;  2JNH A;  3JR5 A;  4GC9 A;  2DWL A;  1KYI A;  1LV7 A;  2AHM A;  1MN3 A;  3K1J A;  1IXZ A;  2Y20 A;  1GL6 A;  4XK8 F;  4AW4 A;  5E6J A;  5A2Q S;  3A45 A;  2MR9 A;  3J7B A;  4F1I A;  4QNM A;  1SXJ B;  4JI0 M;  3K92 A;  1DV0 A;  3HJS A;  2DZL A;  2Z3X A;  3BOS A;  3HY5 A;  5GKN A;  2HKJ A;  3CGW A;  4RNA A;  4W5W A;  3GPX A;  1FNN A;  1EIJ A;  1OAO C;  2YR0 A;  2O25 A;  1ZAE A;  1IY2 A;  1P3Q Q;  3GP1 A;  3AKZ A;  3HHZ A;  3K2L A;  2DEN A;  2Z4R A;  2WSC F;  2ZAO A;  1QYR A;  2X4A A;  2QHO B;  5L8R F;  4I5S A;  2JWS A;  3PXG A;  5JI2 E;  2KA6 B;  4OVZ A;  3C58 A;  3D8B A;  1E9R A;  1L2C A;  3T1H M;  1JR3 D;  4LJ5 A;  3SC3 A;  3THG A;  2CP8 A;  4RF0 A;  2N35 A;  2J7O A;  4X62 M;  1IBM M;  2KRU A;  2JUJ A;  3UMM A;  1IN4 A;  1I94 M;  4ZPX A;  3EIE A;  2F5Q A;  1Q3C A;  2HWJ A;  3ILK A;  3U6E A;  2FFJ A;  3HJ8 A;  5FTJ A;  3GLG A;  2H1R A;  3KXE C;  4MGK E;  4JYA M;  4DV6 M;  2LVN C;  2DKL A;  4OU7 A;  1V33 A;  4CJ6 A;  4EIW A;  3HKP A;  4IBB A;  2DHY A;  3GPP A;  4LGM A;  5IRE B;  1IXR C;  1X37 A;  4LRS A;  3GO8 A;  5IWA M;  3VKH A;  4DV2 M;  2LWX A;  4L6V 6;  4Z8X A;  3TWK A;  2UU9 M;  1VDL A;  3U6O A;  2KDL A;  1D2N A;  1MJG M;  2VQF M;  2UUB M;  1GKI A;  1L8Q A;  4I4L A;  1L1T A;  2F4V M;  1WHC A;  1TGU A;  4Y28 F;  4JI1 M;  1N77 A;  1IN6 A;  1Z59 A;  4GIP A;  4R3D A;  5DFL A;  2OQ4 A;  3CTW B;  3U61 A;  3J80 S;  1CUK A;  1QQW A;  3LQQ A;  3T6P A;  1HT2 E;  4BBA A;  2Z4S A;  1OFH A;  1OJL A;  3PNV A;  2DXI A;  1R5L A;  2LVO C;  1N36 M;  2UXD M;  2F5O A;  4NXM M;  2KNV A;  4LF6 M;  3AJI B;  2XZU A;  4JI6 M;  1VG5 A;  2M5Z A;  3HX3 A;  3KSJ A;  3KP0 E;  1R2Z A;  1R2Y A;  3LQR A;  4S12 A;  3KOW E;  3KSX A;  4L15 A;  2OO9 A;  4WUR A;  1V34 A;  1NNU C;  2MGW A;  3I04 M;  5EP1 A;  1SXJ E;  3TWM A;  5EXS A;  3H4J A;  3TE6 A;  2LH0 A;  2C96 A;  4FW9 A;  5H37 D;  4B3T M;  4DR5 M;  3C9P A;  4Z6Y A;  4FWH A;  3I51 A;  5EQT A;  4HEO A;  3QWL A;  2QNJ A;  4JI3 M;  3HU2 A;  1J09 A;  1R6B X;  1TH3 A;  3FUW A;  3KOX E;  3K9O A;  3LMM A;  4IJF A;  2UXB M;  4M9X A;  3LCV B;  1Z5B A;  5KO3 A;  2C9O A;  1HT1 E;  2OOA A;  3VFD A;  3FTD A;  4DUY M;  1Q3B A;  2LVP C;  3MJ5 A;  3PFI A;  2L7I A;  4XGI A;  3K8Z A;  1XC8 A;  2JXN A;  2F5N A;  2VDB B;  3I4Y A;  5F3W A;  1UM8 A;  3AOG A;  5KQ8 A;  1XNR M;  2V1C A;  5LMU M;  1NY6 A;  1GVN A;  2FS1 A;  2RRU A;  2ZTD A;  4B7G A;  1G3I A;  3W0L B;  4JXJ A;  1QAQ A;  4X66 M;  1ZV1 A;  4IBG A;  3F92 A;  1W5T A;  2QCU A;  4LJ8 A;  4QOZ C;  3V76 A;  1VEK A;  4I81 A;  4A3V B;  2KZU A;  2QP9 X;  3FKE A;  2JA2 A;  4LFA M;  3ZH9 B;  3K9P A;  1NSF A;  1HQC A;  2C98 A;  3B7Z A;  1WR1 B;  1SG9 A;  4PD2 A;  1PRB A;  2DAE A;  4BLC A;  3MMP A;  1HR0 M;  1L2D A;  1TDH A;  4CGY B;  3KS8 A;  4KT0 F;  3GPY A;  4FWD A;  3CF0 A;  4LY6 A;  3FYD A;  1G8P A;  1IY1 A;  2YQZ A;  1GAB A;  2R6F A;  3SMP A;  4D80 A;  4DV0 M;  3E46 A;  4NRW A;  3HU3 A;  1IBK M;  4CIZ A;  4NRV A;  3GRR A;  4IBJ A;  3T38 A;  3TQS A;  1TTE A;  1RU3 A;  2QZ4 A;  3EIH A;  2L4E A;  1F4I A;  4G4Q A;  3LVV A;  3KVW A;  4JI7 M;  1IN7 A;  1G41 A;  2XFS A;  2XFT A;  2Y0Q A;  3VDP A;  4DR1 M;  2J7N A;  2E5L M;  2LVA A;  4AKI A;  5EP3 A;  3VK8 A;  4MH0 E;  4MGI E;  3M7G A;  2BWB A;  2ZAN A;  1XXH B;  3SHF A;  3U5Z A;  3B89 A;  1NVM A;  1KFV A;  5ITQ A;  4LF4 M;  2R45 A;  2BJW A;  3GLF B;  8CAT A;  2MH8 A;  1IXS B;  1XHB A;  1PJS A;  1BVS A;  1JQJ C;  2C5R A;  1OQY A;  2XGN A;  4GEW A;  4AG5 A;  2HHH M;  4QHS A;  3GLH B;  1XMQ M;  4MB7 A;  5JI3 E;  1YLA A;  3ZCB B;  3W68 A;  4M9S A;  4DV4 M;  1E94 E;  1K82 A;  1IN5 A;  2LHC A;  4LGY A;  2JY6 B;  5C18 A;  2R44 A;  5ITU A;  3TL4 X;  2CEA A;  4YHH M;  5FTK A;  4KHP M;  4QHT A;  3D8L A;  2XLJ A;  1TF0 B;  3IHP A;  1QDR A;  3W67 A;  3J27 B;  4XBO A;  4GHA A;  3FTC A;  2XZF A;  3FRI A;  3AOE A;  4OX9 M;  1NV9 A;  2OOB A;  1AIP C;  3FE3 A;  3MK6 A;  1D0M A;  3VDU A;  3UK6 A;  4HLQ A;  1DO0 A;  5FTM A;  3QYE A;  3T15 A;  3U60 A;  1C7Y A;  3SAU A;  2B3T A;  1TR8 A;  2QBY B;  4OW0 A;  3GLI B;  4IBC A;  2WSE F;  1NNJ A;  1E9S A;  3M6A A;  3LCU A;  4DR6 M;  4DBG B;  4ITQ A;  4AI6 A;  4LJ6 A;  1DGH A;  2CV1 A;  1Q02 A;  2R62 A;  2ZBK B;  1OKS A;  2EKK A;  1D0K A;  4AQY M;  1C1K A;  2DHR A;  2P5T A;  4YY3 M;  1JB0 F;  1OFI A;  2XSZ A;  1DGB A;  5ITX E;  2NQ8 C;  3SYL A;  4DUZ M;  3GRY A;  3SAS A;  1ZMW A;  2I7N A;  1XB2 B;  4FCV A;  1NHW C;  1T6O A;  3T1Y M;  1Y8G A;  1TDZ A;  2EUC A;  1IN8 A;  2EKF A;  2MRO B;  1VDD A;  2VF7 A;  1ZMU A;  3LW5 F;  3GQ3 A;  2R65 A;  4QNR A;  3VK7 A;  2DNA A;  1L1Z A;  3NWL A;  1XXH E;  1SXJ A;  5EP4 A;  1OTR A;  3DOA A;  3MHV C;  1UFZ A;  5EJC A;  2RGH A;  3SMS A;  2R0I A;  3GLF E;  4LFC M;  4AZF A;  3L2A A;  1J5E M;  4NSO B;  3FUV A;  2L4F A;  3KOZ E;  3VKG A;  1VQ1 A;  3GLH E;  1WXQ A;  1QDT A;  1WIV A;  2RGO A;  4MM3 B;  3Q8X A;  5FSW A;  2JZ0 A;  4MGH A;  2LTU A;  2VF8 A;  2KW0 A;  4FCT A;  2W82 A;  2JZ1 A;  4WP2 A;  3A46 A;  2G8L A;  4AKG A;  1A5T A;  1S3S A;  3U6P A;  3NBI A;  3TWL A;  2L09 A;  3I01 M;  1HQY E;  2X49 A;  3R8F A;  1G59 A;  2R18 A;  1AUA A;  2D7E A;  2YFQ A;  3HHX A;  4LJ9 A;  4LFB M;  4IBD A;  1JR3 E;  1GL7 A;  1HNX M;  1N34 M;  1FJG M;  2ZM6 M;  4K0K M;  1L2B A;  2GQF A;  4DV1 M;  2DWM A;  1IY0 A;  4OVZ B;  4CIS A;  3J2P B;  1N33 M;  3I4V A;  4AG6 A;  4P17 A;  2UUC M;  4L4U A;  1G4A E;  2QPA A;  4DR2 M;  1WGN A;  4FWG A;  4D81 A;  1PJI A;  3GLI E;  1QZM A;  4GRI A;  1NJF A;  3AOE C;  4JI5 M;  3GLG B;  3KFU G;  1HJP A;  2QQ8 A;  1IQP A;  3KW6 A;  2O5R A;  4B7H A;  2V1U A;  4L8R C;  2F5S A;  1N78 A;  5FTL A;  4LCB A;  2JP7 A;  1XNQ M;  1MU5 A;  3GPU A;  2WZJ A;  4DR4 M;  3WHL A;  2F5P A;  4NOO B;  4LJ7 A;  2KHH A;  3HJQ A;  2LHG A;  4AKH A;  4DR7 M;  1K3W A;  2GNO A;  3R9X B;  4GMQ A;  5EXX A;  1Q39 A;  4GHL A;  2XH9 A;  3L28 A;  4HL4 A;  3L29 A;  4CHT B;  1MX0 A;  2XSZ D;  3RE8 A;  2CUZ A;  4R7G A;  3TPZ A;  2Z8Y M;  4IBK A;  1NHG C;  4B08 A;  3IEC A;  3ZC7 B;  4G4R A;  3A42 A;  4LJ4 A;  3U61 B;  3DFZ A;  3B74 A;  4DR3 M;  1TH2 A;  1WGL A;  4Q7J A;  1YSY A;  3U6L A;  2EA0 A;  2VQE M;  3B7N A;  3NBX X;  4WW0 A;  2C9C A;  1TH4 A;  2FNA A;  3M0E A;  4L78 A;  1SXJ D;  1D0L A;  4GC5 A;  1PJT A;  3SAT A;  2O01 F;  3DA1 A;  2EO2 A;  4UN2 B;  4R71 A;  4NXN M;  2WSF F;  2VII A;  2BNK A;  3PNY A;  1ZMV A;  1GJT A;  2Z7J A;  1SXJ C;  4RF1 A;  7CAT A;  5FTN A;  2KZS A;  3AV0 A;  4G3O A;  1ORY B;  4PT5 A;  4FCW A;  3RGS A;  1G71 A;  5KPT A;  1H6U A;  2DZO B;  5ITY A;  3SBJ A;  3OTO M;  4DV5 M;  1OIP A;  4GIT A;  5ITR A;  1VEJ A;  2FOI C;  2XEP A;  3KP1 E;  1QVR A;  3U6C A;  1Z6T A;  1YE9 A;  1KSF X;  5EP2 A;  3CF2 A;  1DGF A;  3RFW A;  1PJJ A;  1NJG A;  2CHQ A;  2V6Z M;  1IM2 A;  2MJ5 B;  3BBZ A;  1QAM A;  4JI2 M;  2X8A A;  2DAI A;  2D7H A;  3B9P A;  1NY5 A;  3WHK A;  4DV7 M;  1N32 M;  3B7Q A;  3FTF A;  1GO5 A;  1XMO M;  1PM5 A;  3JR4 A;  2G5G X;  1E32 A;  5KPR A;  3QYB A;  3LVW A;  5LMN M;  5IT9 S;  2APL A;  4L16 A;  5C1B A;  2HL7 A;  3SAW A;  3SHG B;  2L6O A;  4QOS A;  3GLG E;  4LF9 M;  2LBC A;  4ANR A;  4I8O A;  2K6B A;  4LZJ A;  1DGG A;  1QZE A;  5E26 A;  2Q2E B;  2ERC A;  5DYG A;  3JAM S;  2QEN A;  3E21 A;  3SFZ A;  3L27 A;  3GRU A;  3UZU A;  2UXC M;  4KOD A;  1PGY A;  2XF3 A;  3J81 S;  2KRK A;  2K47 A;  4BB9 A;  1NO1 A;  4P16 A;  2CHV A;  4IBI A;  3KOY E;  4M0W A;  4LJA A;  4REZ A;  5ITX A;  3BXW A;  2CV2 A;  2RKO A;  3L25 A;  1Z5C A;  3SAV A;  4IIW A;  2DAM A;  3QAU A;  3C3D A;  4IJE A;  2ZAM A;  1GLN A;  2DAK A;  4LRT A;  3HWS A;  2UUA M;  4RKU F;  1GJS A;  2JY7 A;  1OIZ A;  5DYI A;  4PCZ A;  1ZQ9 A;  3SYK A;  2BJV A;  1XXH A;  2LVQ D;  1OAI A;  2BWE A;  2KEB A;  2R4J A;  3A98 B;  2YNM D;  3FRH A;  4NSR A;  3GQ5 A;  1IBL M;  4GKK M;  4IBE A;  3GLF A;  3ZQJ A;  2Y0T A;  2KNA A;  3PVS A;  4IBF A;  3FTE A;  1IXS A;  3GRV A;  4B3M M;  2L2D A;  4M0D A;  1PJQ A;  3AL0 C;  1R7R A;  2A5Y B;  2FH0 A;  3C3E A;  3GLH A;  3Q8G A;  2CV0 A;  4D82 A;  5FLX S;  3U6M A;  3J7A S;  1IFY A;  3HZJ A;  1EE8 A;  4JV5 M;  4JI4 M;  2DZN B;  3U5Z B;  1T43 A;  2CHG A;  2HAK A;  3GQ4 A;  4G4O A;  2M60 A;  1QAN A;  2K0B X; 
#chains in the Genus database with same CATH homology
 2J5Y A;  2VDB B;  2LHG A;  2KDL A;  2LHC A;  2MH8 A;  1GJS A;  2FS1 A;  2JWS A;  2N35 A;  1PRB A;  1GJT A;  1TF0 B;  1GAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...