2N35A

Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords Albumin binding protein
total genus 13
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2015-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2n35A00
2JWSA 2J5YA 2FS1A 2LHGA 2VDBB 2KDLA 1GJTA 2N35A 2MH8A 1GJSA 1PRBA 2LHCA 1GABA 1TF0B
chains in the Genus database with same CATH superfamily
2DZLA 1JR3A 4LRTA 3I4VA 3SAWA 3J7BA 1L1ZA 1WR1B 2OOBA 3HX3A 2KHHA 3AKZA 1V33A 2FOIC 3AV0A 2A5YB 4B3MM 3BOSA 1XXHE 2FFJA 7CATA 2XSZA 1VQ1A 3MK6A 4JV5M 4LCBA 4FWDA 1EIJA 4LJAA 3L2AA 3UK6A 4DV1M 2DAIA 1SXJC 2WSFF 3K9OA 1L2CA 2BNKA 4GKJM 3W0LB 4Z8XA 1NNJA 2JA2A 2KA6B 4JI2M 3UMMA 3GLGA 3FE3A 2Y0QA 5FLXS 1T6OA 3GPXA 2YR0A 1J5EM 3H4JA 3FTFA 2CWBA 3DFZA 4I81A 3SAUA 2KXEA 4I4LA 2ZAOA 5IZ7D 3GLHA 3THGA 4Q7JA 5KQDA 3PNVA 2VDBB 4NXMM 2JZ1A 1WIVA 2Z3XA 1QDRA 3KSXA 1OQYA 3I04M 3PVSA 2QENA 3A46A 1TH4A 4RNAA 3JR4A 2JWSA 5EP1A 4WP2A 5KPZA 1NY6A 3T38A 2QCUA 2XEPA 3T15A 4AKHA 1NVMA 1X37A 3SFZA 3KFUG 1PJIA 2G5GX 2DAGA 2GQFA 2WSCF 3GLHE 5GKNA 3QYBA 4JI8M 4DV4M 5FTMA 1IY0A 1KSFX 2JUJA 1DGHA 3QWLA 1L2BA 3LMMA 2BJWA 4JI0M 3T6PA 4GITA 1SXJE 2UXBM 3HHZA 2JY8A 2DHYA 2ZBKB 4JI4M 1PGYA 4P17A 4JI6M 3HWSA 4IBBA 1QVRA 3U6PA 4GIPA 1EE8A 1IN7A 1NJGA 3HHYA 4QHSA 2RGHA 1GKIA 1TF0B 4DR3M 4GKKM 5EXXA 4W5WA 3AL0C 2UXDM 2RKOA 4G3OA 3SMPA 2V1CA 3PNYA 4KLNA 4AG6A 4IJEA 3J7AS 1NV9A 3GRUA 4DR6M 1G8PA 1ORYB 5FTNA 4HEOA 2ZTDA 3DZDA 4IBEA 4L78A 2DWNA 2R4EA 1SXJD 3I51A 4MGZE 3U60B 3B7NA 1NSFA 4OVZB 2UUAM 1NY5A 2XF3A 2ZAMA 4JI5M 3U5ZB 1CUKA 1G59A 4GC5A 4L4UA 4MM3B 1Y8GA 1IN4A 2LTUA 2DAMA 2KEBA 3VK7A 3GLFE 5F3WA 2CV1A 3B9PA 3HGIA 1ZMUA 2JZ0A 4IBJA 2HCBA 4B7GA 4KT0F 3C58A 1N78A 4ANRA 2DAKA 4DUYM 3CTWB 5ITYA 1GL7A 4L16A 1E32A 4M9XA 1IN8A 2DWLA 4NL4H 2N35A 1IFYA 2YFQA 1DGGA 2C9CA 4IJFA 3BBZA 2VQEM 3TWLA 5ITQA 1TDHA 3TWMA 3HU1A 2R62A 3Q8GA 3RGPA 1I4WA 1Q02A 2K0BX 5FTLA 3A42A 5EXSA 1PJSA 3NWLA 3E46A 5KQ8A 1EFUB 3IECA 2BJVA 2KNAA 2JP7A 3B74A 3FUWA 5IWAM 2G8LA 4RKUF 1OFHA 3FYDA 4NXNM 5L8RF 3SMSA 1L1TA 4RF1A 2I7PA 8CATA 1NO1A 4FW9A 1QDTA 3B7ZA 4WW0A 4BB9A 3WHKA 4YY3M 2EUCA 2V1UA 1TTEA 4QHTA 5FTKA 4XGIA 3L25A 1DO0A 4XBOA 1QZEA 4BBAA 2O01F 3CF0A 4II7A 2CP8A 4JXJA 1OIZA 4FD2A 1IXSB 2JNHA 1LTMA 1R7RA 4LJ6A 1MX0A 2QBYB 4X65M 2C99A 4I8OA 4OX9M 3EIHA 2MJ5B 1ZMWA 1KYIA 3AOEA 3J2PB 3HJSA 4KODA 4MH0E 3KOWE 2FH0A 3AFHA 1T3TA 3RFWA 3FUXA 4FWGA 4QNRA 3B89A 2DI0A 4M0WA 2KNVA 2XFTA 1PJJA 1OTRA 1OKSA 3FD9A 3K1JA 1FJGM 1JB0F 4AQYM 2GNOA 3BXWA 1W5TA 2EKFA 1N36M 3TE6A 1H6UA 2NQ8C 3I01M 1P3QQ 4OU7A 1HQCA 2O5RA 2I7NA 2X8AA 4LF7M 1Z5BA 2F5PA 1R2ZA 3UZUA 2CRUA 2O25A 3T1HM 1UFZA 3KVWA 4GC9A 5DYIA 2R6FA 3KOXE 4X62M 2P5TA 1N33M 4B3TM 2LVPC 1R2YA 1G41A 2XGNA 3U6LA 2APLA 3GQ5A 2DKLA 1XC8A 4F1IA 3FYCA 2OPFA 1F4IA 4LFCM 2EKKA 2OOAA 3CF2A 3HZJA 1QAQA 1NNUC 1N32M 1LV7A 5EP4A 5EJCA 3U61A 4Z6YA 1Z59A 2Y21A 4DR1M 5KPRA 2C98A 2EJSA 3RE8A 4PD2A 3SC3A 4K0KM 4D80A 2MR9A 2R44A 2LHGA 1N34M 1XXHA 3U6DA 1IY2A 5LMNM 1NHWC 1HNXM 1QUSA 5ITUA 2ZTCA 3ILKA 4IBDA 2KW0A 2MROB 2QSFX 1QAOA 2L4EA 1XMOM 2L7IA 1QYRA 1SXJA 1VG5A 1WHCA 1XXHB 2LVNC 2XZFA 4ITQA 3GLHB 4DV7M 4M9ZA 4AG5A 3UJNA 3D8BA 3K2LA 4I5SA 2D7GA 3TQSA 3GLGE 1HT2E 3D8LA 4D82A 1E9RA 3M6AA 4DV5M 2R46A 3DOAA 3MJ5A 1MN3A 1OAIA 1NHGC 2C96A 3KS8A 1K3WA 3C9PA 4B3RM 4PDIA 2Z8YM 2YQZA 1OAOC 4S12A 1D0KA 1S3SA 1GABA 1J09A 4L8RC 4LY6A 2ZANA 1PM5A 3FUUA 4ZPXA 2CV0A 3UGJA 4G4OA 5EP3A 1ZQ9A 3LCVB 2OO9A 1NV8A 2Z4SA 4X66M 1TDZA 2LBCA 4FVMA 4R71A 1XMQM 1MJGM 4LZJA 2KRUA 1Q39A 2DWMA 1DGFA 2ZM6M 3K92A 2Q2EB 2KNZA 3NBIA 5FSWA 3LQRA 5ITXE 4LF9M 1VDLA 2L7HA 2LVAA 2ERCA 2VIIA 4LJ9A 2CHQA 4D81A 4JI3M 4FCWA 3L26A 4LZZA 3FTCA 1C7YA 2DVWB 1JR3D 1D0LA 1MU5A 1BVSA 4LJ5A 1QANA 3LQQA 2QHOB 4MB7A 2YNMD 4R3DA 5DFLA 2H5XA 5KO3A 3GO8A 1QAMA 2L2DA 1Z5CA 2LH0A 2V6ZM 1UM8A 1OIPA 2HWJA 4FCVA 4DR4M 5ITRA 4NSRA 5ITXA 2BWEA 1KFVA 5A2QS 2Z7JA 2DENA 1GJTA 1IXSA 3KW6A 3LVWA 2F5NA 3F92A 3KOYE 4A3VB 4DV2M 1AUAA 4AKIA 4DV3M 1HT1E 3VLFB 1G3IA 2UUCM 1Z6TA 1AIPC 4G6ZA 3PFIA 2K6BA 3Q8XA 4JI1M 1IQPA 2FE8A 3IG5A 2WZJA 4DV0M 2QNJA 3W67A 3TPZA 4IBGA 3GQ4A 1XHBA 3VDUA 3L28A 1L2DA 4TUWA 1W5SA 3SARA 1VDDA 4P16A 3JR5A 2CHGA 2HAKA 3FKEA 5BR8M 2UXCM 3IG8A 2RGOA 4GEWA 4GRIA 4CIZA 4GH9A 2CUZA 5JI2E 1E9SA 5EXTA 1E94E 3U6OA 1L8QA 4Y28F 4FCTA 1PRBA 4UN2B 3U6QA 1A5TA 4FWHA 3CGWA 3ZC7B 3EIEA 4RF0A 2Y0TA 2G3QA 2UUBM 4MGKE 3LW5F 1VEKA 3HY5A 2KZSA 1YE9A 2L09A 4GHAA 3KXEC 2BWBA 1C1KA 1WGLA 2DNAA 1YUBA 1YSYA 2W82A 1HQYE 2R0IA 2VQFM 3H4MA 2F5SA 3SATA 2M60A 1PJQA 1ZAEA 3T1YM 3GP1A 1VEJA 4AKGA 1ZV1A 2CHVA 1OJLA 1J7KA 3GQ3A 2QQ8A 2B3TA 3I4YA 5C18A 3GLIA 3FUVA 3J27B 2JY5A 3L29A 3MMPA 2JY7A 3J81S 2HL7A 4YHHM 1QQWA 4LGMA 1I94M 1N77A 1N75A 5IREB 5DNYA 2RRUA 2HHHM 3U6MA 2QBYA 5FTJA 4IIWA 4QOZC 3LCUA 1OFIA 4LFBM 3GLFA 3GPYA 2X4AA 1IBKM 1HJPA 3K9PA 4OVZA 3VK8A 1YLAA 3SYLA 3FUTA 3MHVC 4L15A 3U6CA 3U5ZA 3HJ8A 4BLCA 3ZCBB 4AW4A 2D7EA 4GHLA 3QYEA 5EP2A 1TR8A 1GVNA 4CGYB 5BPVA 4DR2M 3KSJA 4HL4A 2Y20A 2LVOC 4F2LA 4JN6A 4M0DA 4IBKA 1IN5A 3HJQA 3GLIB 3AJIB 4LF5M 1WGNA 1TH3A 3KOZE 4NRVA 4AI6A 4IBFA 1TH2A 2R65A 3PXGA 3W0FA 5LMUM 4KHPM 1HR0M 1QZMA 3A98B 1GLNA 1DGBA 1QUTA 1TGUA 3M0EA 3QAUA 1G71A 3LVVA 1IBLM 2H1RA 2KZUA 4LJ7A 3ZH9B 3AOEC 4WURA 4R7GA 3C3EA 3R8FA 3VKGA 4QOSA 4DR5M 3KP0E 4KO8A 4M9SA 4B7FA 4B3SM 3SASA 4LRSA 1DGHB 3VDPA 2FNAA 4NSOB 2VF7A 3GPPA 2KRKA 2LXEA 5EQTA 4G4NA 2QZ4A 1FNNA 4PT5A 4B08A 4DV6M 1R6BX 1WXQA 2DZNB 2UU9M 1GO5A 2KDLA 4DR7M 1RU3A 5EXPA 2L4FA 2LHCA 4EIWA 2K9DA 4CJ6A 4PCZA 4X64M 4OW0A 3SHFA 2CE7A 2JXNA 3E4RA 3SBJA 2LVQD 2JY6B 3TWKA 3GRYA 3OTOM 2XH9A 2QP9X 3M7GA 4MGHA 3IHPA 3JAMS 2J5YA 4AZFA 2M5ZA 3A45A 3RGSA 3CF6E 3W68A 1IN6A 1GL6A 2Z4RA 2DXIA 2F4VM 5E26A 4LG2A 3GLGB 1JQJC 2QPAA 3KS4A 3U61B 3U60A 3J80S 1V92A 2FS1A 2DZOB 4JYAM 2OQ4A 5IT9S 1V34A 2WSEF 3KDSE 3U6EA 2VF8A 3HHWA 1IXZA 2DHRA 4GMQA 4MGYE 4CISA 4QNMA 3TL4X 2CEAA 3HHXA 3HKPA 4MGIE 2C5RA 4NC6A 1ZMVA 3FRHA 3C3DA 2E5LM 3GLIE 4B7HA 3WHLA 1IXRC 3GRVA 1HNWM 2C9OA 3SHGB 2F5OA 2CFOA 3K8ZA 1SG9A 2J7NA 2J7OA 1IBMM 4LF4M 1XNRM 3GRRA 3U6SA 5JI3E 2R45A 1XB2B 2EA0A 1D0MA 2MGWA 2XLJA 1PJTA 2L6OA 4IBIA 4PDGA 1Q3CA 1NJFA 2K47A 3V76A 4G4RA 4IBCA 1Q3BA 5E6JA 5KPTA 3SYKA 4G4QA 2CV2A 3SAVA 1IY1A 2LNHC 3FRIA 2MH8A 3L27A 2XSZD 2AHMA 2EO2A 1K82A 3VKHA 1GJSA 4XK8F 4NRWA 3GPUA 3B7QA 1G4AE 2F5QA 4LF8M 2XFSA 4HLQA 4LFAM 1Z5AA 2R18A 2R4JA 3E21A 4LF6M 4LJ4A 3NBXX 2HKJA 4DBGB 1VEGA 1SXJB 4JI7M 1IM2A 1WJ7A 3HU3A 5H37D 4DUZM 3FTEA 3E9SA 3GLFB 2D7HA 4NOOB 1D2NA 1JR3E 2XZUA 3VFDA 5DYGA 3KP1E 1XWIA 4LJ8A 2DWZB 2X49A 2DAEA 1HNZM 4REZA 4CHTB 1XNQM 4LGYA 3DA1A 5C1BA 1R4GA 1T43A 4L6V6 3HU2A 3R9XB 3ZQJA 1DV0A 2LWXA 5ITTA 3FTDA 1R5LA 1DO2A 3AOGA 1K3XA
chains in the Genus database with same CATH topology
2JWSA 2J5YA 2FS1A 2LHGA 2VDBB 2KDLA 1GJTA 2N35A 2MH8A 1GJSA 1PRBA 2LHCA 1GABA 1TF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWS A;  2J5Y A;  2FS1 A;  2LHG A;  2VDB B;  2KDL A;  1GJT A;  2N35 A;  2MH8 A;  1GJS A;  1PRB A;  2LHC A;  1GAB A;  1TF0 B; 
#chains in the Genus database with same CATH topology
 2DZL A;  1JR3 A;  4LRT A;  3I4V A;  3SAW A;  3J7B A;  1L1Z A;  1WR1 B;  2OOB A;  3HX3 A;  2KHH A;  3AKZ A;  1V33 A;  2FOI C;  3AV0 A;  2A5Y B;  4B3M M;  3BOS A;  1XXH E;  2FFJ A;  7CAT A;  2XSZ A;  1VQ1 A;  3MK6 A;  4JV5 M;  4LCB A;  4FWD A;  1EIJ A;  4LJA A;  3L2A A;  3UK6 A;  4DV1 M;  2DAI A;  1SXJ C;  2WSF F;  3K9O A;  1L2C A;  2BNK A;  4GKJ M;  3W0L B;  4Z8X A;  1NNJ A;  2JA2 A;  2KA6 B;  4JI2 M;  3UMM A;  3GLG A;  3FE3 A;  2Y0Q A;  5FLX S;  1T6O A;  3GPX A;  2YR0 A;  1J5E M;  3H4J A;  3FTF A;  2CWB A;  3DFZ A;  4I81 A;  3SAU A;  2KXE A;  4I4L A;  2ZAO A;  5IZ7 D;  3GLH A;  3THG A;  4Q7J A;  5KQD A;  3PNV A;  2VDB B;  4NXM M;  2JZ1 A;  1WIV A;  2Z3X A;  1QDR A;  3KSX A;  1OQY A;  3I04 M;  3PVS A;  2QEN A;  3A46 A;  1TH4 A;  4RNA A;  3JR4 A;  2JWS A;  5EP1 A;  4WP2 A;  5KPZ A;  1NY6 A;  3T38 A;  2QCU A;  2XEP A;  3T15 A;  4AKH A;  1NVM A;  1X37 A;  3SFZ A;  3KFU G;  1PJI A;  2G5G X;  2DAG A;  2GQF A;  2WSC F;  3GLH E;  5GKN A;  3QYB A;  4JI8 M;  4DV4 M;  5FTM A;  1IY0 A;  1KSF X;  2JUJ A;  1DGH A;  3QWL A;  1L2B A;  3LMM A;  2BJW A;  4JI0 M;  3T6P A;  4GIT A;  1SXJ E;  2UXB M;  3HHZ A;  2JY8 A;  2DHY A;  2ZBK B;  4JI4 M;  1PGY A;  4P17 A;  4JI6 M;  3HWS A;  4IBB A;  1QVR A;  3U6P A;  4GIP A;  1EE8 A;  1IN7 A;  1NJG A;  3HHY A;  4QHS A;  2RGH A;  1GKI A;  1TF0 B;  4DR3 M;  4GKK M;  5EXX A;  4W5W A;  3AL0 C;  2UXD M;  2RKO A;  4G3O A;  3SMP A;  2V1C A;  3PNY A;  4KLN A;  4AG6 A;  4IJE A;  3J7A S;  1NV9 A;  3GRU A;  4DR6 M;  1G8P A;  1ORY B;  5FTN A;  4HEO A;  2ZTD A;  3DZD A;  4IBE A;  4L78 A;  2DWN A;  2R4E A;  1SXJ D;  3I51 A;  4MGZ E;  3U60 B;  3B7N A;  1NSF A;  4OVZ B;  2UUA M;  1NY5 A;  2XF3 A;  2ZAM A;  4JI5 M;  3U5Z B;  1CUK A;  1G59 A;  4GC5 A;  4L4U A;  4MM3 B;  1Y8G A;  1IN4 A;  2LTU A;  2DAM A;  2KEB A;  3VK7 A;  3GLF E;  5F3W A;  2CV1 A;  3B9P A;  3HGI A;  1ZMU A;  2JZ0 A;  4IBJ A;  2HCB A;  4B7G A;  4KT0 F;  3C58 A;  1N78 A;  4ANR A;  2DAK A;  4DUY M;  3CTW B;  5ITY A;  1GL7 A;  4L16 A;  1E32 A;  4M9X A;  1IN8 A;  2DWL A;  4NL4 H;  2N35 A;  1IFY A;  2YFQ A;  1DGG A;  2C9C A;  4IJF A;  3BBZ A;  2VQE M;  3TWL A;  5ITQ A;  1TDH A;  3TWM A;  3HU1 A;  2R62 A;  3Q8G A;  3RGP A;  1I4W A;  1Q02 A;  2K0B X;  5FTL A;  3A42 A;  5EXS A;  1PJS A;  3NWL A;  3E46 A;  5KQ8 A;  1EFU B;  3IEC A;  2BJV A;  2KNA A;  2JP7 A;  3B74 A;  3FUW A;  5IWA M;  2G8L A;  4RKU F;  1OFH A;  3FYD A;  4NXN M;  5L8R F;  3SMS A;  1L1T A;  4RF1 A;  2I7P A;  8CAT A;  1NO1 A;  4FW9 A;  1QDT A;  3B7Z A;  4WW0 A;  4BB9 A;  3WHK A;  4YY3 M;  2EUC A;  2V1U A;  1TTE A;  4QHT A;  5FTK A;  4XGI A;  3L25 A;  1DO0 A;  4XBO A;  1QZE A;  4BBA A;  2O01 F;  3CF0 A;  4II7 A;  2CP8 A;  4JXJ A;  1OIZ A;  4FD2 A;  1IXS B;  2JNH A;  1LTM A;  1R7R A;  4LJ6 A;  1MX0 A;  2QBY B;  4X65 M;  2C99 A;  4I8O A;  4OX9 M;  3EIH A;  2MJ5 B;  1ZMW A;  1KYI A;  3AOE A;  3J2P B;  3HJS A;  4KOD A;  4MH0 E;  3KOW E;  2FH0 A;  3AFH A;  1T3T A;  3RFW A;  3FUX A;  4FWG A;  4QNR A;  3B89 A;  2DI0 A;  4M0W A;  2KNV A;  2XFT A;  1PJJ A;  1OTR A;  1OKS A;  3FD9 A;  3K1J A;  1FJG M;  1JB0 F;  4AQY M;  2GNO A;  3BXW A;  1W5T A;  2EKF A;  1N36 M;  3TE6 A;  1H6U A;  2NQ8 C;  3I01 M;  1P3Q Q;  4OU7 A;  1HQC A;  2O5R A;  2I7N A;  2X8A A;  4LF7 M;  1Z5B A;  2F5P A;  1R2Z A;  3UZU A;  2CRU A;  2O25 A;  3T1H M;  1UFZ A;  3KVW A;  4GC9 A;  5DYI A;  2R6F A;  3KOX E;  4X62 M;  2P5T A;  1N33 M;  4B3T M;  2LVP C;  1R2Y A;  1G41 A;  2XGN A;  3U6L A;  2APL A;  3GQ5 A;  2DKL A;  1XC8 A;  4F1I A;  3FYC A;  2OPF A;  1F4I A;  4LFC M;  2EKK A;  2OOA A;  3CF2 A;  3HZJ A;  1QAQ A;  1NNU C;  1N32 M;  1LV7 A;  5EP4 A;  5EJC A;  3U61 A;  4Z6Y A;  1Z59 A;  2Y21 A;  4DR1 M;  5KPR A;  2C98 A;  2EJS A;  3RE8 A;  4PD2 A;  3SC3 A;  4K0K M;  4D80 A;  2MR9 A;  2R44 A;  2LHG A;  1N34 M;  1XXH A;  3U6D A;  1IY2 A;  5LMN M;  1NHW C;  1HNX M;  1QUS A;  5ITU A;  2ZTC A;  3ILK A;  4IBD A;  2KW0 A;  2MRO B;  2QSF X;  1QAO A;  2L4E A;  1XMO M;  2L7I A;  1QYR A;  1SXJ A;  1VG5 A;  1WHC A;  1XXH B;  2LVN C;  2XZF A;  4ITQ A;  3GLH B;  4DV7 M;  4M9Z A;  4AG5 A;  3UJN A;  3D8B A;  3K2L A;  4I5S A;  2D7G A;  3TQS A;  3GLG E;  1HT2 E;  3D8L A;  4D82 A;  1E9R A;  3M6A A;  4DV5 M;  2R46 A;  3DOA A;  3MJ5 A;  1MN3 A;  1OAI A;  1NHG C;  2C96 A;  3KS8 A;  1K3W A;  3C9P A;  4B3R M;  4PDI A;  2Z8Y M;  2YQZ A;  1OAO C;  4S12 A;  1D0K A;  1S3S A;  1GAB A;  1J09 A;  4L8R C;  4LY6 A;  2ZAN A;  1PM5 A;  3FUU A;  4ZPX A;  2CV0 A;  3UGJ A;  4G4O A;  5EP3 A;  1ZQ9 A;  3LCV B;  2OO9 A;  1NV8 A;  2Z4S A;  4X66 M;  1TDZ A;  2LBC A;  4FVM A;  4R71 A;  1XMQ M;  1MJG M;  4LZJ A;  2KRU A;  1Q39 A;  2DWM A;  1DGF A;  2ZM6 M;  3K92 A;  2Q2E B;  2KNZ A;  3NBI A;  5FSW A;  3LQR A;  5ITX E;  4LF9 M;  1VDL A;  2L7H A;  2LVA A;  2ERC A;  2VII A;  4LJ9 A;  2CHQ A;  4D81 A;  4JI3 M;  4FCW A;  3L26 A;  4LZZ A;  3FTC A;  1C7Y A;  2DVW B;  1JR3 D;  1D0L A;  1MU5 A;  1BVS A;  4LJ5 A;  1QAN A;  3LQQ A;  2QHO B;  4MB7 A;  2YNM D;  4R3D A;  5DFL A;  2H5X A;  5KO3 A;  3GO8 A;  1QAM A;  2L2D A;  1Z5C A;  2LH0 A;  2V6Z M;  1UM8 A;  1OIP A;  2HWJ A;  4FCV A;  4DR4 M;  5ITR A;  4NSR A;  5ITX A;  2BWE A;  1KFV A;  5A2Q S;  2Z7J A;  2DEN A;  1GJT A;  1IXS A;  3KW6 A;  3LVW A;  2F5N A;  3F92 A;  3KOY E;  4A3V B;  4DV2 M;  1AUA A;  4AKI A;  4DV3 M;  1HT1 E;  3VLF B;  1G3I A;  2UUC M;  1Z6T A;  1AIP C;  4G6Z A;  3PFI A;  2K6B A;  3Q8X A;  4JI1 M;  1IQP A;  2FE8 A;  3IG5 A;  2WZJ A;  4DV0 M;  2QNJ A;  3W67 A;  3TPZ A;  4IBG A;  3GQ4 A;  1XHB A;  3VDU A;  3L28 A;  1L2D A;  4TUW A;  1W5S A;  3SAR A;  1VDD A;  4P16 A;  3JR5 A;  2CHG A;  2HAK A;  3FKE A;  5BR8 M;  2UXC M;  3IG8 A;  2RGO A;  4GEW A;  4GRI A;  4CIZ A;  4GH9 A;  2CUZ A;  5JI2 E;  1E9S A;  5EXT A;  1E94 E;  3U6O A;  1L8Q A;  4Y28 F;  4FCT A;  1PRB A;  4UN2 B;  3U6Q A;  1A5T A;  4FWH A;  3CGW A;  3ZC7 B;  3EIE A;  4RF0 A;  2Y0T A;  2G3Q A;  2UUB M;  4MGK E;  3LW5 F;  1VEK A;  3HY5 A;  2KZS A;  1YE9 A;  2L09 A;  4GHA A;  3KXE C;  2BWB A;  1C1K A;  1WGL A;  2DNA A;  1YUB A;  1YSY A;  2W82 A;  1HQY E;  2R0I A;  2VQF M;  3H4M A;  2F5S A;  3SAT A;  2M60 A;  1PJQ A;  1ZAE A;  3T1Y M;  3GP1 A;  1VEJ A;  4AKG A;  1ZV1 A;  2CHV A;  1OJL A;  1J7K A;  3GQ3 A;  2QQ8 A;  2B3T A;  3I4Y A;  5C18 A;  3GLI A;  3FUV A;  3J27 B;  2JY5 A;  3L29 A;  3MMP A;  2JY7 A;  3J81 S;  2HL7 A;  4YHH M;  1QQW A;  4LGM A;  1I94 M;  1N77 A;  1N75 A;  5IRE B;  5DNY A;  2RRU A;  2HHH M;  3U6M A;  2QBY A;  5FTJ A;  4IIW A;  4QOZ C;  3LCU A;  1OFI A;  4LFB M;  3GLF A;  3GPY A;  2X4A A;  1IBK M;  1HJP A;  3K9P A;  4OVZ A;  3VK8 A;  1YLA A;  3SYL A;  3FUT A;  3MHV C;  4L15 A;  3U6C A;  3U5Z A;  3HJ8 A;  4BLC A;  3ZCB B;  4AW4 A;  2D7E A;  4GHL A;  3QYE A;  5EP2 A;  1TR8 A;  1GVN A;  4CGY B;  5BPV A;  4DR2 M;  3KSJ A;  4HL4 A;  2Y20 A;  2LVO C;  4F2L A;  4JN6 A;  4M0D A;  4IBK A;  1IN5 A;  3HJQ A;  3GLI B;  3AJI B;  4LF5 M;  1WGN A;  1TH3 A;  3KOZ E;  4NRV A;  4AI6 A;  4IBF A;  1TH2 A;  2R65 A;  3PXG A;  3W0F A;  5LMU M;  4KHP M;  1HR0 M;  1QZM A;  3A98 B;  1GLN A;  1DGB A;  1QUT A;  1TGU A;  3M0E A;  3QAU A;  1G71 A;  3LVV A;  1IBL M;  2H1R A;  2KZU A;  4LJ7 A;  3ZH9 B;  3AOE C;  4WUR A;  4R7G A;  3C3E A;  3R8F A;  3VKG A;  4QOS A;  4DR5 M;  3KP0 E;  4KO8 A;  4M9S A;  4B7F A;  4B3S M;  3SAS A;  4LRS A;  1DGH B;  3VDP A;  2FNA A;  4NSO B;  2VF7 A;  3GPP A;  2KRK A;  2LXE A;  5EQT A;  4G4N A;  2QZ4 A;  1FNN A;  4PT5 A;  4B08 A;  4DV6 M;  1R6B X;  1WXQ A;  2DZN B;  2UU9 M;  1GO5 A;  2KDL A;  4DR7 M;  1RU3 A;  5EXP A;  2L4F A;  2LHC A;  4EIW A;  2K9D A;  4CJ6 A;  4PCZ A;  4X64 M;  4OW0 A;  3SHF A;  2CE7 A;  2JXN A;  3E4R A;  3SBJ A;  2LVQ D;  2JY6 B;  3TWK A;  3GRY A;  3OTO M;  2XH9 A;  2QP9 X;  3M7G A;  4MGH A;  3IHP A;  3JAM S;  2J5Y A;  4AZF A;  2M5Z A;  3A45 A;  3RGS A;  3CF6 E;  3W68 A;  1IN6 A;  1GL6 A;  2Z4R A;  2DXI A;  2F4V M;  5E26 A;  4LG2 A;  3GLG B;  1JQJ C;  2QPA A;  3KS4 A;  3U61 B;  3U60 A;  3J80 S;  1V92 A;  2FS1 A;  2DZO B;  4JYA M;  2OQ4 A;  5IT9 S;  1V34 A;  2WSE F;  3KDS E;  3U6E A;  2VF8 A;  3HHW A;  1IXZ A;  2DHR A;  4GMQ A;  4MGY E;  4CIS A;  4QNM A;  3TL4 X;  2CEA A;  3HHX A;  3HKP A;  4MGI E;  2C5R A;  4NC6 A;  1ZMV A;  3FRH A;  3C3D A;  2E5L M;  3GLI E;  4B7H A;  3WHL A;  1IXR C;  3GRV A;  1HNW M;  2C9O A;  3SHG B;  2F5O A;  2CFO A;  3K8Z A;  1SG9 A;  2J7N A;  2J7O A;  1IBM M;  4LF4 M;  1XNR M;  3GRR A;  3U6S A;  5JI3 E;  2R45 A;  1XB2 B;  2EA0 A;  1D0M A;  2MGW A;  2XLJ A;  1PJT A;  2L6O A;  4IBI A;  4PDG A;  1Q3C A;  1NJF A;  2K47 A;  3V76 A;  4G4R A;  4IBC A;  1Q3B A;  5E6J A;  5KPT A;  3SYK A;  4G4Q A;  2CV2 A;  3SAV A;  1IY1 A;  2LNH C;  3FRI A;  2MH8 A;  3L27 A;  2XSZ D;  2AHM A;  2EO2 A;  1K82 A;  3VKH A;  1GJS A;  4XK8 F;  4NRW A;  3GPU A;  3B7Q A;  1G4A E;  2F5Q A;  4LF8 M;  2XFS A;  4HLQ A;  4LFA M;  1Z5A A;  2R18 A;  2R4J A;  3E21 A;  4LF6 M;  4LJ4 A;  3NBX X;  2HKJ A;  4DBG B;  1VEG A;  1SXJ B;  4JI7 M;  1IM2 A;  1WJ7 A;  3HU3 A;  5H37 D;  4DUZ M;  3FTE A;  3E9S A;  3GLF B;  2D7H A;  4NOO B;  1D2N A;  1JR3 E;  2XZU A;  3VFD A;  5DYG A;  3KP1 E;  1XWI A;  4LJ8 A;  2DWZ B;  2X49 A;  2DAE A;  1HNZ M;  4REZ A;  4CHT B;  1XNQ M;  4LGY A;  3DA1 A;  5C1B A;  1R4G A;  1T43 A;  4L6V 6;  3HU2 A;  3R9X B;  3ZQJ A;  1DV0 A;  2LWX A;  5ITT A;  3FTD A;  1R5L A;  1DO2 A;  3AOG A;  1K3X A; 
#chains in the Genus database with same CATH homology
 2JWS A;  2J5Y A;  2FS1 A;  2LHG A;  2VDB B;  2KDL A;  1GJT A;  2N35 A;  2MH8 A;  1GJS A;  1PRB A;  2LHC A;  1GAB A;  1TF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...