2N35A

Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
b'GTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Albumin binding protein
publication title Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 13
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2015-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2n35A00
2VDBB 2J5YA 1PRBA 1TF0B 1GJTA 2N35A 1GJSA 1GABA 2FS1A 2KDLA 2LHCA 2MH8A 2LHGA 2JWSA
chains in the Genus database with same CATH superfamily
2R0IA 1R7RA 3EIEA 2D7EA 3I51A 4NL4H 4CIZA 4IIWA 2LWXA 1R6BX 3T1YM 1N78A 4RF0A 3MJ5A 1V33A 1QDRA 1ZMVA 3FYDA 5DYIA 2MH8A 2EKFA 4ANRA 1QQWA 3KOXE 2F5QA 1GJTA 1IQPA 1L2DA 3M7GA 2JUJA 5ITYA 1ORYB 2GNOA 3DOAA 2XFTA 5ITXE 2M60A 2UXBM 3TWKA 1K82A 3GO8A 3HZJA 4MGIE 4NRVA 1RU3A 4GKKM 4LFAM 3BXWA 1W5TA 2R18A 1R4GA 4GMQA 3FYCA 1C1KA 2R44A 2KZUA 3GLHA 1PJJA 1GLNA 4IBFA 2CRUA 2DAGA 3U6OA 3QYBA 3IG8A 4JYAM 3FRHA 2WSEF 3HHWA 2LH0A 2QBYA 1QANA 1CUKA 3TL4X 2FH0A 2L7HA 2JY8A 3LW5F 2VF8A 1SXJD 1XB2B 2WZJA 3TQSA 5EQTA 1HR0M 4LF4M 2L2DA 4NSOB 2EO2A 3ZCBB 1IN4A 4LCBA 4RF1A 3I01M 2HHHM 4M9XA 4X64M 2D7HA 4EIWA 3FTCA 3GLIA 2R6FA 3GLHB 1QDTA 2JY5A 2QNJA 3PXGA 2XLJA 3CF6E 3HWSA 1DO0A 3AOEA 4IBCA 3OTOM 1PM5A 1V34A 2VF7A 1TH2A 2DAEA 3L28A 1SXJC 1H6UA 4DR5M 3CF0A 4K0KM 2OOAA 3GPXA 1V92A 3GRRA 4AZFA 3FD9A 4LJ4A 2KNAA 1NNJA 5FTNA 1J7KA 1T3TA 1Z6TA 1GL6A 1IFYA 3GQ5A 5LMUM 3GLIB 2CFOA 2A5YB 3DZDA 4RNAA 3AOGA 1NHGC 5IWAM 2CWBA 2DWLA 2CV2A 5KPRA 4LGMA 3KOWE 1KSFX 3H4JA 2I7NA 4QHTA 1E32A 4REZA 5C18A 5FLXS 3ZQJA 3J81S 2LHCA 2YQZA 4KHPM 3E9SA 1MU5A 1VDLA 5DYGA 4LZZA 1XC8A 4JI8M 4L8RC 5BR8M 2UUCM 2DVWB 3B7NA 1HNZM 4B3SM 1TF0B 3SFZA 4A3VB 1WIVA 3T38A 4NRWA 4BB9A 2BJWA 2CE7A 2XH9A 2F5SA 1DV0A 2DENA 3KS8A 2CHQA 3VK8A 2DXIA 4FW9A 3F92A 1IY1A 1L2BA 1PJQA 4AG5A 3WHKA 2EKKA 4GHLA 3KOYE 2RKOA 4B7HA 2FFJA 1D2NA 4JI0M 2JP7A 2ZAOA 1I94M 3R9XB 1D0LA 4G4QA 2EUCA 1NNUC 3U5ZA 3T1HM 3AL0C 1SG9A 1IN8A 2LNHC 2KXEA 1QVRA 2MJ5B 3HY5A 1D0MA 4KO8A 4AG6A 5H37D 1OFHA 3U61A 4OX9M 1GO5A 4M0DA 4WW0A 1GJSA 1S3SA 1XWIA 1TR8A 4LRSA 7CATA 5IT9S 1L2CA 1N34M 4FWHA 1Z5AA 4LF9M 2DHYA 2QSFX 4GH9A 2KA6B 3E21A 1XNRM 1NV9A 2HWJA 1YUBA 3KP1E 2HCBA 2RRUA 4CISA 2N35A 2JA2A 2Y20A 3RGSA 2JZ1A 4LJ8A 1VEJA 2Z4RA 5DNYA 1D0KA 3AJIB 3B9PA 1XXHE 5ITRA 3U5ZB 1HJPA 3C58A 4G4RA 3ZC7B 3U61B 2C99A 3PVSA 1NVMA 3KVWA 5FTKA 2DWNA 5FSWA 5ITUA 4FVMA 1TDHA 2K47A 2JZ0A 3SAVA 3MK6A 3J7BA 1G4AE 1DGHB 3C3EA 3LMMA 3M6AA 3A46A 4QOZC 2J7NA 2L4EA 3I04M 2UUAM 1AIPC 1K3WA 4JI1M 1HQYE 3HJQA 4AW4A 2JY6B 4IBKA 3FTDA 3HJSA 1QYRA 2ZTCA 2O25A 1SXJE 2O01F 3D8LA 1ZMUA 3GRUA 1HQCA 1XXHA 4DBGB 3SBJA 3SATA 2Z4SA 1I4WA 3AFHA 4NOOB 1N36M 2F4VM 2J7OA 1X37A 2L7IA 4XK8F 1G8PA 3UK6A 3VLFB 4LF8M 4B3RM 3U6EA 1DGBA 4LFBM 4GC9A 1Q3BA 2P5TA 3VKGA 2ZBKB 2R45A 3RFWA 2K9DA 2MR9A 4PT5A 2L09A 2DHRA 2QENA 4Y28F 1IXSA 1QZEA 4TUWA 4GITA 2VDBB 3THGA 1OQYA 3LQRA 4JV5M 3BOSA 3HKPA 3Q8GA 3SARA 1NV8A 4P16A 4B3TM 1XXHB 3U60B 3AV0A 3IHPA 2LVPC 1UM8A 3SHFA 4IBIA 4QHSA 1ZAEA 4QNMA 3U6PA 1A5TA 4II7A 5ITXA 4AQYM 4DV4M 1ZQ9A 1JR3D 2XZUA 1PRBA 1R5LA 3LCVB 2MGWA 3J27B 2BJVA 2RGHA 1LV7A 5E26A 8CATA 1J5EM 3KS4A 4R3DA 3GPPA 4M9SA 1Q3CA 5KQ8A 3W0LB 3MHVC 1R2YA 2DAIA 3E4RA 1G59A 2QBYB 3MMPA 2X49A 4LJ5A 5EXXA 4LJ9A 4XGIA 1PJTA 4JXJA 2R4JA 3BBZA 2KEBA 3KXEC 4Z8XA 2OQ4A 4RKUF 4AI6A 1TH3A 1AUAA 2M5ZA 3SAWA 2DAKA 4NXMM 1WGLA 2LXEA 3A98B 3Q8XA 5KPZA 4L78A 2F5NA 3TWLA 1QAQA 4G4OA 3H4MA 1TDZA 5EJCA 5EP3A 4LG2A 2FE8A 4DUYM 2EA0A 4S12A 1EE8A 2C96A 3FUWA 4MGKE 1HNWM 3J80S 4G3OA 4LY6A 4LJ6A 2XFSA 3UJNA 4FD2A 2QHOB 3SAUA 3LVVA 4MB7A 3EIHA 4Q7JA 1QUSA 1NO1A 4LGYA 5KO3A 4GKJM 1HT1E 2UXCM 1OKSA 4W5WA 2DAMA 1WR1B 1P3QQ 2XF3A 2QPAA 4BBAA 1DGGA 1OTRA 2CHGA 3LQQA 4IBGA 1LTMA 4IBEA 1N33M 2ERCA 1MX0A 3CGWA 1XHBA 4D81A 2LBCA 3ZH9B 2FOIC 3D8BA 4PD2A 3A42A 5FTMA 5A2QS 2K0BX 3NBXX 4OU7A 3QYEA 3A45A 5EXPA 2MROB 3B7QA 4LZJA 2LVQD 1MN3A 3K9OA 1F4IA 2CEAA 2KDLA 1QAMA 3JR4A 2K6BA 3HHXA 2LVOC 2NQ8C 2R62A 2LTUA 3PNVA 3C3DA 4KODA 5C1BA 3UMMA 4DV7M 1IN5A 1DGFA 2OOBA 4MM3B 2OO9A 2FNAA 4YHHM 3V76A 3K2LA 4IBDA 2R46A 1IY2A 3GPYA 3PNYA 4WP2A 5DFLA 4MGZE 4R7GA 3UGJA 2WSCF 4DR3M 2BWBA 3DA1A 2CV1A 1VDDA 2DNAA 1NSFA 3NBIA 2C9OA 3U6CA 1G71A 2L4FA 5IREB 3VDUA 4DR7M 2C9CA 4JI2M 1IM2A 4IBJA 4HLQA 4DUZM 4DV0M 2UXDM 5KQDA 4MGHA 2I7PA 3LVWA 2V1UA 3FUTA 1WHCA 1Q39A 3RGPA 1VQ1A 2XSZA 5KPTA 1G41A 3QWLA 4JN6A 4GC5A 2V1CA 4LJAA 3VKHA 2RGOA 1WJ7A 2F5OA 5IZ7D 1IY0A 1PGYA 1NHWC 4HL4A 3HHYA 2DZNB 2BNKA 4B3MM 4AKGA 2KNZA 2UU9M 2C98A 4B08A 1IBLM 1R2ZA 4L15A 1Z5CA 3FKEA 4I81A 1NY6A 4CJ6A 4DV2M 2ZANA 4ITQA 1G3IA 1VG5A 2G8LA 2O5RA 1YSYA 2KHHA 4F2LA 4PDIA 1T6OA 2XZFA 4B7GA 4GRIA 3U6SA 1NY5A 2Q2EB 2KRKA 4I8OA 3VFDA 3FTFA 4LF5M 1OJLA 4IJEA 3GQ3A 1JR3E 5BPVA 3L27A 2AHMA 1PJSA 1FNNA 4WURA 4Z6YA 2ZM6M 3GLFE 1IN6A 3W68A 1HT2E 4NSRA 1OAOC 2XEPA 4LF6M 2KW0A 4IJFA 4NC6A 3L26A 2LVAA 1Y8GA 2JWSA 4GEWA 1J09A 2ZTDA 4L16A 3TE6A 1NJFA 1VEGA 4IBBA 4G6ZA 3J2PB 1TGUA 1KFVA 2D7GA 2ZAMA 1IXRC 1SXJA 3GLGE 4MH0E 3IG5A 1XMQM 4M9ZA 3SYLA 3GLIE 1JR3A 2KRUA 3B89A 3KW6A 4I5SA 4ZPXA 4DV6M 3J7AS 2CP8A 5L8RF 3GLFA 1GABA 2QP9X 3U6QA 4D80A 1IXSB 4MGYE 4NXNM 2DWMA 5FTLA 3HU2A 4F1IA 1OIPA 4QNRA 3L29A 5EXTA 2V6ZM 2YFQA 1K3XA 3L2AA 1QUTA 5EP1A 3DFZA 1WGNA 3C9PA 5EP2A 3GP1A 1Z59A 3GQ4A 3U6MA 4JI6M 1SXJB 2XGNA 4X66M 2UUBM 4G4NA 3GLGA 3LCUA 3QAUA 4GIPA 2YNMD 2HKJA 2VQEM 4DR4M 4JI3M 1HNXM 3K8ZA 2QQ8A 3KOZE 1IXZA 3GLFB 2CUZA 2J5YA 3KP0E 2R4EA 4X62M 2OPFA 4HEOA 1EIJA 4FWGA 1MJGM 1WXQA 1XMOM 4LJ7A 3ILKA 2X4AA 3K9PA 5EXSA 3CTWB 2Y0QA 3R8FA 2QCUA 4FWDA 2JXNA 3SC3A 1YE9A 2Z3XA 4GHAA 2CV0A 5E6JA 4AKIA 1T43A 4UN2B 1ZV1A 3KSJA 4CGYB 3HU1A 1N77A 1QZMA 3JR5A 3GLGB 1L8QA 4PDGA 3CF2A 5LMNM 2H5XA 1OAIA 3B74A 1IBKM 4AKHA 3B7ZA 2KZSA 3IECA 1BVSA 2DWZB 3FUUA 2YR0A 4JI5M 2DZOB 3K92A 2X8AA 4DR1M 3AOEC 3L25A 3E46A 3WHLA 3FRIA 3SMSA 3GRYA 2APLA 2LVNC 1IN7A 1DO2A 1E9SA 2FS1A 3KSXA 1FJGM 1N75A 4P17A 4M0WA 1N32M 3FUVA 4I4LA 1TTEA 2Y0TA 3W67A 2G5GX 4BLCA 2Z7JA 4DV3M 3U60A 3I4VA 4B7FA 3TWMA 2L6OA 4FCTA 2DKLA 1ZMWA 4PCZA 1XNQM 4OW0A 3RE8A 2GQFA 1OIZA 1Z5BA 3K1JA 4FCVA 4XBOA 3HGIA 3SHGB 5ITQA 4OVZA 3GPUA 3SASA 3VDPA 3HX3A 2VIIA 1VEKA 4L4UA 2HAKA 1Q02A 5JI2E 4JI7M 4QOSA 2DI0A 1UFZA 3SYKA 1W5SA 1EFUB 3FE3A 4LFCM 2Y21A 1NJGA 1OFIA 2BWEA 3GRVA 4X65M 3JAMS 2DZLA 1JB0F 1E94E 1GKIA 4KLNA 3HHZA 4DR2M 3VK7A 2EJSA 3TPZA 2G3QA 2VQFM 4LF7M 2Z8YM 3T6PA 4LRTA 1E9RA 3T15A 5FTJA 3U6LA 1PJIA 1YLAA 3U6DA 1DGHA 2F5PA 4OVZB 5GKNA 3HU3A 3W0FA 5ITTA 1QAOA 1JQJC 1TH4A 2B3TA 1C7YA 3FTEA 4JI4M 1GL7A 3M0EA 2W82A 3UZUA 5EP4A 3FUXA 1GVNA 1IBMM 2JY7A 2WSFF 4DV1M 2KNVA 4DV5M 2C5RA 4KT0F 5F3WA 4YY3M 4DR6M 1L1TA 2XSZD 3PFIA 1KYIA 4FCWA 3I4YA 2JNHA 3HJ8A 2R65A 4CHTB 4D82A 2HL7A 2CHVA 3AKZA 2LHGA 2QZ4A 1L1ZA 2E5LM 3SMPA 4R71A 3KFUG 3NWLA 4L6V6 5JI3E 3GLHE 2H1RA 3KDSE
chains in the Genus database with same CATH topology
2VDBB 2J5YA 1PRBA 1TF0B 1GJTA 2N35A 1GJSA 1GABA 2FS1A 2KDLA 2LHCA 2MH8A 2LHGA 2JWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDB B;  2J5Y A;  1PRB A;  1TF0 B;  1GJT A;  2N35 A;  1GJS A;  1GAB A;  2FS1 A;  2KDL A;  2LHC A;  2MH8 A;  2LHG A;  2JWS A; 
#chains in the Genus database with same CATH topology
 2R0I A;  1R7R A;  3EIE A;  2D7E A;  3I51 A;  4NL4 H;  4CIZ A;  4IIW A;  2LWX A;  1R6B X;  3T1Y M;  1N78 A;  4RF0 A;  3MJ5 A;  1V33 A;  1QDR A;  1ZMV A;  3FYD A;  5DYI A;  2MH8 A;  2EKF A;  4ANR A;  1QQW A;  3KOX E;  2F5Q A;  1GJT A;  1IQP A;  1L2D A;  3M7G A;  2JUJ A;  5ITY A;  1ORY B;  2GNO A;  3DOA A;  2XFT A;  5ITX E;  2M60 A;  2UXB M;  3TWK A;  1K82 A;  3GO8 A;  3HZJ A;  4MGI E;  4NRV A;  1RU3 A;  4GKK M;  4LFA M;  3BXW A;  1W5T A;  2R18 A;  1R4G A;  4GMQ A;  3FYC A;  1C1K A;  2R44 A;  2KZU A;  3GLH A;  1PJJ A;  1GLN A;  4IBF A;  2CRU A;  2DAG A;  3U6O A;  3QYB A;  3IG8 A;  4JYA M;  3FRH A;  2WSE F;  3HHW A;  2LH0 A;  2QBY A;  1QAN A;  1CUK A;  3TL4 X;  2FH0 A;  2L7H A;  2JY8 A;  3LW5 F;  2VF8 A;  1SXJ D;  1XB2 B;  2WZJ A;  3TQS A;  5EQT A;  1HR0 M;  4LF4 M;  2L2D A;  4NSO B;  2EO2 A;  3ZCB B;  1IN4 A;  4LCB A;  4RF1 A;  3I01 M;  2HHH M;  4M9X A;  4X64 M;  2D7H A;  4EIW A;  3FTC A;  3GLI A;  2R6F A;  3GLH B;  1QDT A;  2JY5 A;  2QNJ A;  3PXG A;  2XLJ A;  3CF6 E;  3HWS A;  1DO0 A;  3AOE A;  4IBC A;  3OTO M;  1PM5 A;  1V34 A;  2VF7 A;  1TH2 A;  2DAE A;  3L28 A;  1SXJ C;  1H6U A;  4DR5 M;  3CF0 A;  4K0K M;  2OOA A;  3GPX A;  1V92 A;  3GRR A;  4AZF A;  3FD9 A;  4LJ4 A;  2KNA A;  1NNJ A;  5FTN A;  1J7K A;  1T3T A;  1Z6T A;  1GL6 A;  1IFY A;  3GQ5 A;  5LMU M;  3GLI B;  2CFO A;  2A5Y B;  3DZD A;  4RNA A;  3AOG A;  1NHG C;  5IWA M;  2CWB A;  2DWL A;  2CV2 A;  5KPR A;  4LGM A;  3KOW E;  1KSF X;  3H4J A;  2I7N A;  4QHT A;  1E32 A;  4REZ A;  5C18 A;  5FLX S;  3ZQJ A;  3J81 S;  2LHC A;  2YQZ A;  4KHP M;  3E9S A;  1MU5 A;  1VDL A;  5DYG A;  4LZZ A;  1XC8 A;  4JI8 M;  4L8R C;  5BR8 M;  2UUC M;  2DVW B;  3B7N A;  1HNZ M;  4B3S M;  1TF0 B;  3SFZ A;  4A3V B;  1WIV A;  3T38 A;  4NRW A;  4BB9 A;  2BJW A;  2CE7 A;  2XH9 A;  2F5S A;  1DV0 A;  2DEN A;  3KS8 A;  2CHQ A;  3VK8 A;  2DXI A;  4FW9 A;  3F92 A;  1IY1 A;  1L2B A;  1PJQ A;  4AG5 A;  3WHK A;  2EKK A;  4GHL A;  3KOY E;  2RKO A;  4B7H A;  2FFJ A;  1D2N A;  4JI0 M;  2JP7 A;  2ZAO A;  1I94 M;  3R9X B;  1D0L A;  4G4Q A;  2EUC A;  1NNU C;  3U5Z A;  3T1H M;  3AL0 C;  1SG9 A;  1IN8 A;  2LNH C;  2KXE A;  1QVR A;  2MJ5 B;  3HY5 A;  1D0M A;  4KO8 A;  4AG6 A;  5H37 D;  1OFH A;  3U61 A;  4OX9 M;  1GO5 A;  4M0D A;  4WW0 A;  1GJS A;  1S3S A;  1XWI A;  1TR8 A;  4LRS A;  7CAT A;  5IT9 S;  1L2C A;  1N34 M;  4FWH A;  1Z5A A;  4LF9 M;  2DHY A;  2QSF X;  4GH9 A;  2KA6 B;  3E21 A;  1XNR M;  1NV9 A;  2HWJ A;  1YUB A;  3KP1 E;  2HCB A;  2RRU A;  4CIS A;  2N35 A;  2JA2 A;  2Y20 A;  3RGS A;  2JZ1 A;  4LJ8 A;  1VEJ A;  2Z4R A;  5DNY A;  1D0K A;  3AJI B;  3B9P A;  1XXH E;  5ITR A;  3U5Z B;  1HJP A;  3C58 A;  4G4R A;  3ZC7 B;  3U61 B;  2C99 A;  3PVS A;  1NVM A;  3KVW A;  5FTK A;  2DWN A;  5FSW A;  5ITU A;  4FVM A;  1TDH A;  2K47 A;  2JZ0 A;  3SAV A;  3MK6 A;  3J7B A;  1G4A E;  1DGH B;  3C3E A;  3LMM A;  3M6A A;  3A46 A;  4QOZ C;  2J7N A;  2L4E A;  3I04 M;  2UUA M;  1AIP C;  1K3W A;  4JI1 M;  1HQY E;  3HJQ A;  4AW4 A;  2JY6 B;  4IBK A;  3FTD A;  3HJS A;  1QYR A;  2ZTC A;  2O25 A;  1SXJ E;  2O01 F;  3D8L A;  1ZMU A;  3GRU A;  1HQC A;  1XXH A;  4DBG B;  3SBJ A;  3SAT A;  2Z4S A;  1I4W A;  3AFH A;  4NOO B;  1N36 M;  2F4V M;  2J7O A;  1X37 A;  2L7I A;  4XK8 F;  1G8P A;  3UK6 A;  3VLF B;  4LF8 M;  4B3R M;  3U6E A;  1DGB A;  4LFB M;  4GC9 A;  1Q3B A;  2P5T A;  3VKG A;  2ZBK B;  2R45 A;  3RFW A;  2K9D A;  2MR9 A;  4PT5 A;  2L09 A;  2DHR A;  2QEN A;  4Y28 F;  1IXS A;  1QZE A;  4TUW A;  4GIT A;  2VDB B;  3THG A;  1OQY A;  3LQR A;  4JV5 M;  3BOS A;  3HKP A;  3Q8G A;  3SAR A;  1NV8 A;  4P16 A;  4B3T M;  1XXH B;  3U60 B;  3AV0 A;  3IHP A;  2LVP C;  1UM8 A;  3SHF A;  4IBI A;  4QHS A;  1ZAE A;  4QNM A;  3U6P A;  1A5T A;  4II7 A;  5ITX A;  4AQY M;  4DV4 M;  1ZQ9 A;  1JR3 D;  2XZU A;  1PRB A;  1R5L A;  3LCV B;  2MGW A;  3J27 B;  2BJV A;  2RGH A;  1LV7 A;  5E26 A;  8CAT A;  1J5E M;  3KS4 A;  4R3D A;  3GPP A;  4M9S A;  1Q3C A;  5KQ8 A;  3W0L B;  3MHV C;  1R2Y A;  2DAI A;  3E4R A;  1G59 A;  2QBY B;  3MMP A;  2X49 A;  4LJ5 A;  5EXX A;  4LJ9 A;  4XGI A;  1PJT A;  4JXJ A;  2R4J A;  3BBZ A;  2KEB A;  3KXE C;  4Z8X A;  2OQ4 A;  4RKU F;  4AI6 A;  1TH3 A;  1AUA A;  2M5Z A;  3SAW A;  2DAK A;  4NXM M;  1WGL A;  2LXE A;  3A98 B;  3Q8X A;  5KPZ A;  4L78 A;  2F5N A;  3TWL A;  1QAQ A;  4G4O A;  3H4M A;  1TDZ A;  5EJC A;  5EP3 A;  4LG2 A;  2FE8 A;  4DUY M;  2EA0 A;  4S12 A;  1EE8 A;  2C96 A;  3FUW A;  4MGK E;  1HNW M;  3J80 S;  4G3O A;  4LY6 A;  4LJ6 A;  2XFS A;  3UJN A;  4FD2 A;  2QHO B;  3SAU A;  3LVV A;  4MB7 A;  3EIH A;  4Q7J A;  1QUS A;  1NO1 A;  4LGY A;  5KO3 A;  4GKJ M;  1HT1 E;  2UXC M;  1OKS A;  4W5W A;  2DAM A;  1WR1 B;  1P3Q Q;  2XF3 A;  2QPA A;  4BBA A;  1DGG A;  1OTR A;  2CHG A;  3LQQ A;  4IBG A;  1LTM A;  4IBE A;  1N33 M;  2ERC A;  1MX0 A;  3CGW A;  1XHB A;  4D81 A;  2LBC A;  3ZH9 B;  2FOI C;  3D8B A;  4PD2 A;  3A42 A;  5FTM A;  5A2Q S;  2K0B X;  3NBX X;  4OU7 A;  3QYE A;  3A45 A;  5EXP A;  2MRO B;  3B7Q A;  4LZJ A;  2LVQ D;  1MN3 A;  3K9O A;  1F4I A;  2CEA A;  2KDL A;  1QAM A;  3JR4 A;  2K6B A;  3HHX A;  2LVO C;  2NQ8 C;  2R62 A;  2LTU A;  3PNV A;  3C3D A;  4KOD A;  5C1B A;  3UMM A;  4DV7 M;  1IN5 A;  1DGF A;  2OOB A;  4MM3 B;  2OO9 A;  2FNA A;  4YHH M;  3V76 A;  3K2L A;  4IBD A;  2R46 A;  1IY2 A;  3GPY A;  3PNY A;  4WP2 A;  5DFL A;  4MGZ E;  4R7G A;  3UGJ A;  2WSC F;  4DR3 M;  2BWB A;  3DA1 A;  2CV1 A;  1VDD A;  2DNA A;  1NSF A;  3NBI A;  2C9O A;  3U6C A;  1G71 A;  2L4F A;  5IRE B;  3VDU A;  4DR7 M;  2C9C A;  4JI2 M;  1IM2 A;  4IBJ A;  4HLQ A;  4DUZ M;  4DV0 M;  2UXD M;  5KQD A;  4MGH A;  2I7P A;  3LVW A;  2V1U A;  3FUT A;  1WHC A;  1Q39 A;  3RGP A;  1VQ1 A;  2XSZ A;  5KPT A;  1G41 A;  3QWL A;  4JN6 A;  4GC5 A;  2V1C A;  4LJA A;  3VKH A;  2RGO A;  1WJ7 A;  2F5O A;  5IZ7 D;  1IY0 A;  1PGY A;  1NHW C;  4HL4 A;  3HHY A;  2DZN B;  2BNK A;  4B3M M;  4AKG A;  2KNZ A;  2UU9 M;  2C98 A;  4B08 A;  1IBL M;  1R2Z A;  4L15 A;  1Z5C A;  3FKE A;  4I81 A;  1NY6 A;  4CJ6 A;  4DV2 M;  2ZAN A;  4ITQ A;  1G3I A;  1VG5 A;  2G8L A;  2O5R A;  1YSY A;  2KHH A;  4F2L A;  4PDI A;  1T6O A;  2XZF A;  4B7G A;  4GRI A;  3U6S A;  1NY5 A;  2Q2E B;  2KRK A;  4I8O A;  3VFD A;  3FTF A;  4LF5 M;  1OJL A;  4IJE A;  3GQ3 A;  1JR3 E;  5BPV A;  3L27 A;  2AHM A;  1PJS A;  1FNN A;  4WUR A;  4Z6Y A;  2ZM6 M;  3GLF E;  1IN6 A;  3W68 A;  1HT2 E;  4NSR A;  1OAO C;  2XEP A;  4LF6 M;  2KW0 A;  4IJF A;  4NC6 A;  3L26 A;  2LVA A;  1Y8G A;  2JWS A;  4GEW A;  1J09 A;  2ZTD A;  4L16 A;  3TE6 A;  1NJF A;  1VEG A;  4IBB A;  4G6Z A;  3J2P B;  1TGU A;  1KFV A;  2D7G A;  2ZAM A;  1IXR C;  1SXJ A;  3GLG E;  4MH0 E;  3IG5 A;  1XMQ M;  4M9Z A;  3SYL A;  3GLI E;  1JR3 A;  2KRU A;  3B89 A;  3KW6 A;  4I5S A;  4ZPX A;  4DV6 M;  3J7A S;  2CP8 A;  5L8R F;  3GLF A;  1GAB A;  2QP9 X;  3U6Q A;  4D80 A;  1IXS B;  4MGY E;  4NXN M;  2DWM A;  5FTL A;  3HU2 A;  4F1I A;  1OIP A;  4QNR A;  3L29 A;  5EXT A;  2V6Z M;  2YFQ A;  1K3X A;  3L2A A;  1QUT A;  5EP1 A;  3DFZ A;  1WGN A;  3C9P A;  5EP2 A;  3GP1 A;  1Z59 A;  3GQ4 A;  3U6M A;  4JI6 M;  1SXJ B;  2XGN A;  4X66 M;  2UUB M;  4G4N A;  3GLG A;  3LCU A;  3QAU A;  4GIP A;  2YNM D;  2HKJ A;  2VQE M;  4DR4 M;  4JI3 M;  1HNX M;  3K8Z A;  2QQ8 A;  3KOZ E;  1IXZ A;  3GLF B;  2CUZ A;  2J5Y A;  3KP0 E;  2R4E A;  4X62 M;  2OPF A;  4HEO A;  1EIJ A;  4FWG A;  1MJG M;  1WXQ A;  1XMO M;  4LJ7 A;  3ILK A;  2X4A A;  3K9P A;  5EXS A;  3CTW B;  2Y0Q A;  3R8F A;  2QCU A;  4FWD A;  2JXN A;  3SC3 A;  1YE9 A;  2Z3X A;  4GHA A;  2CV0 A;  5E6J A;  4AKI A;  1T43 A;  4UN2 B;  1ZV1 A;  3KSJ A;  4CGY B;  3HU1 A;  1N77 A;  1QZM A;  3JR5 A;  3GLG B;  1L8Q A;  4PDG A;  3CF2 A;  5LMN M;  2H5X A;  1OAI A;  3B74 A;  1IBK M;  4AKH A;  3B7Z A;  2KZS A;  3IEC A;  1BVS A;  2DWZ B;  3FUU A;  2YR0 A;  4JI5 M;  2DZO B;  3K92 A;  2X8A A;  4DR1 M;  3AOE C;  3L25 A;  3E46 A;  3WHL A;  3FRI A;  3SMS A;  3GRY A;  2APL A;  2LVN C;  1IN7 A;  1DO2 A;  1E9S A;  2FS1 A;  3KSX A;  1FJG M;  1N75 A;  4P17 A;  4M0W A;  1N32 M;  3FUV A;  4I4L A;  1TTE A;  2Y0T A;  3W67 A;  2G5G X;  4BLC A;  2Z7J A;  4DV3 M;  3U60 A;  3I4V A;  4B7F A;  3TWM A;  2L6O A;  4FCT A;  2DKL A;  1ZMW A;  4PCZ A;  1XNQ M;  4OW0 A;  3RE8 A;  2GQF A;  1OIZ A;  1Z5B A;  3K1J A;  4FCV A;  4XBO A;  3HGI A;  3SHG B;  5ITQ A;  4OVZ A;  3GPU A;  3SAS A;  3VDP A;  3HX3 A;  2VII A;  1VEK A;  4L4U A;  2HAK A;  1Q02 A;  5JI2 E;  4JI7 M;  4QOS A;  2DI0 A;  1UFZ A;  3SYK A;  1W5S A;  1EFU B;  3FE3 A;  4LFC M;  2Y21 A;  1NJG A;  1OFI A;  2BWE A;  3GRV A;  4X65 M;  3JAM S;  2DZL A;  1JB0 F;  1E94 E;  1GKI A;  4KLN A;  3HHZ A;  4DR2 M;  3VK7 A;  2EJS A;  3TPZ A;  2G3Q A;  2VQF M;  4LF7 M;  2Z8Y M;  3T6P A;  4LRT A;  1E9R A;  3T15 A;  5FTJ A;  3U6L A;  1PJI A;  1YLA A;  3U6D A;  1DGH A;  2F5P A;  4OVZ B;  5GKN A;  3HU3 A;  3W0F A;  5ITT A;  1QAO A;  1JQJ C;  1TH4 A;  2B3T A;  1C7Y A;  3FTE A;  4JI4 M;  1GL7 A;  3M0E A;  2W82 A;  3UZU A;  5EP4 A;  3FUX A;  1GVN A;  1IBM M;  2JY7 A;  2WSF F;  4DV1 M;  2KNV A;  4DV5 M;  2C5R A;  4KT0 F;  5F3W A;  4YY3 M;  4DR6 M;  1L1T A;  2XSZ D;  3PFI A;  1KYI A;  4FCW A;  3I4Y A;  2JNH A;  3HJ8 A;  2R65 A;  4CHT B;  4D82 A;  2HL7 A;  2CHV A;  3AKZ A;  2LHG A;  2QZ4 A;  1L1Z A;  2E5L M;  3SMP A;  4R71 A;  3KFU G;  3NWL A;  4L6V 6;  5JI3 E;  3GLH E;  2H1R A;  3KDS E; 
#chains in the Genus database with same CATH homology
 2VDB B;  2J5Y A;  1PRB A;  1TF0 B;  1GJT A;  2N35 A;  1GJS A;  1GAB A;  2FS1 A;  2KDL A;  2LHC A;  2MH8 A;  2LHG A;  2JWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...