2N3KA

Human brd4 et domain in complex with mlv integrase c-term
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
ESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 4
publication title Structure of the Brd4 ET domain bound to a C-terminal motif from gamma-retroviral integrases reveals a conserved mechanism of interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17035 BET Bromodomain extra-terminal - transcription regulation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.220 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2n3kA01
2N3KA 2JNSA 2ND0A 2ND1A 2NCZA
chains in the Genus database with same CATH superfamily
2D4CA 3I39X 4EZSA 4WPCA 2O0I1 3QE6A 4NQIA 3KAVA 4R5LA 3D51A 3CVRA 4EZXA 2N3KA 4NPHA 4DYLA 1QWNA 3EJTA 1TQWA 3SYVA 4DCNC 4B9QA 1QWUA 2YI9A 4AZHA 3BUPA 3HAJA 4AZBA 3QWEA 2JNSA 3A98A 4FZSA 4R5IA 4EZUA 2V0OA 3UITA 4H6IA 3D50A 5KBPA 1GNTA 2Q12A 2ND0A 1URUA 4JL9A 4UDXX 3D2FA 2F7QA 3CZNA 2F1AA 1TQVA 2EWFA 3EJSA 3O3NB 1SU7A 3HAIA 3T46A 1HWWA 3BUQA 3D52A 1I4DA 3RV0A 4JWDA 4AZ7A 3OK8A 2OO2A 3HAHA 3VEBA 3BUBA 4EZZA 2QKWA 4EZYA 3DPPA 2PY6A 1R34A 2JNKA 2X3WA 4PO2A 4EZPA 3T48A 3DPOA 2C08A 4E3CA 3O3OB 3KDRA 4FZPA 2Z8YA 4IW0A 3D4ZA 4AKVA 1HTYA 3SOGA 1GN9A 1UPXA 2YL5A 2WINM 3ERCC 2ND1A 3OHXM 2YKTA 2RAIA 3GI7A 4R5JA 2Q13A 2NCZA 1X04A 4JNFA 2FYVA 1ZWWA 1U00A 2X3VA 2GF4A 2X3XA 3RPMA 2D1LA 3EJPA 3DX2A 1X03A 4I1QA 3EJQA 2KHOA 1OAOA 3BLBA 4IWOA 4EZNA 2YLLA 4HR1B 2YI8A 4HR1A 3BVVA 2FICA 4JWIA 2MI7A 2YL9A 4JNEA 4EZWA 3VKHA 3B52X 2OZNB 3F7WA 3DDFA 4FZOA 1R5EA 2F7OA 1E1DA 3DDGA 3RV1A 4EZTA 1SUFA 4EZOA 4EZVA 3B51X 3DX4A 3DPQA 2F1BA 2OBLA 1SU6A 4UDYX 5TKYA 1PS3A 3T49A 3C7NA 3ER8C 3BUIA 2YIBA 1MJGA 1I49A 4ATMA 3M3WA 2GAFD 4BNEA 3B53X 3VEAA 1I4TA 4AZ5A 3G9GA 4HYBA 3BVWA 2LM0A 4R5GA 4E81A 3ZEDA 1GNLA 2QXLA 3I04A 2Z0OA 3DYTA 4M0MA 2F7PA 4AZ6A 4F01A 1TQUA 1HXKA 4IWQA 1WDZA 4R5KA 1W9MA 3L3PA 2EFKA 2YL6A 2RAKA 2F7RA 2Z0VA 4D8JA 4AZCB 3DX1A 3T47A 2LXYA 3DX0A 2OBMA 3ABHA 1TQSA 3FD9A 4JN4A 1ZYLA 2WYIA 1O7DB 3QA8A 2GA9D 4HY9A 1R33A 5C5BB 4EZRA 5C5BA 2YIAA 1Y2OA 4AVMA 3O3MB 4WPEA 3OWGA 1TQTA 2ELBA 3T4AG 1O7DC 3ACOA 3CZSA 2X5CA 3BVUA 3PLTA 4JWEA 4KIKB 4KIKA 1OA1A 2F18A 1DKYA 3BUDA 4AZGA 1JQKA 2WYHA 3LLLA 3CKDA 1I4LA 2YIVX 2YLAA 3I2WA 4IM3A 4H6HA 3I01A 4AZIA 4F00A 3KAWA 3LVTA 3EJRA 3DX3A 4NSWA 2EFLA 2RAJA 3QNJA 2PMRA 1LQ7A 1SU8A 4IM0A 2ALWA 2ZXQA 4JWCA 3QNIA 2Z0NA 5FLEX 5FIGA 4FM3A 2EX3B 3ER9B 3BVTA 1DKZA 4IM2A 1YWMA 2QFFA 3CAZA 1OA0A 4H8SA 1DKXA 4EZQA 3Q84A 2YL8A 3Q0KA 3D4YA 5E84A 4JLCA 2RT6A 3CV5A 3BVXA 3EJUA 3D2EA 1E9VA 1E2UA 3LMFA 2OW6A 4G6QA 1QX1A 4IWPA 4AZCA 3L3OM 2OW7A
chains in the Genus database with same CATH topology
3DPQA 4PO2A 4EZPA 3T48A 3DPOA 2OBLA 1SU6A 2X5CA 4UDYX 5TKYA 3T49A 3I39X 4EZSA 4E3CA 3C7NA 3ER8C 4JWEA 2YIBA 4KIKB 3O3OB 3KDRA 3KAVA 2Z8YA 4IW0A 4R5LA 4KIKA 1OA1A 4EZXA 1GN9A 1MJGA 1UPXA 1DKYA 2WINM 2N3KA 3ERCC 2GAFD 2ND1A 3B53X 4NPHA 3VEAA 1JQKA 3OHXM 4HYBA 4B9QA 2YIVX 2YI9A 3GI7A 4R5JA 4IM3A 4H6HA 3I01A 2LM0A 4F00A 2NCZA 3KAWA 4R5GA 4JNFA 4E81A 1U00A 2JNSA 3A98A 3ZEDA 1GNLA 2QXLA 3I04A 3QNJA 4M0MA 4R5IA 1SU8A 4EZUA 4F01A 4IM0A 3UITA 4H6IA 4JWCA 2KHOA 4IWQA 1GNTA 1OAOA 4R5KA 1W9MA 4IWOA 5FLEX 5FIGA 2ND0A 2EX3B 4FM3A 4JL9A 4EZNA 4HR1B 2YI8A 4HR1A 4UDXX 3ER9B 3D2FA 4JWIA 4JNEA 4EZWA 1DKZA 3VKHA 2EWFA 3O3NB 4IM2A 4D8JA 3B52X 1SU7A 2QFFA 3T47A 3F7WA 1OA0A 3T46A 1DKXA 2OBMA 4EZQA 3FD9A 4JN4A 3RV0A 1E1DA 1ZYLA 4JWDA 3RV1A 3QA8A 2GA9D 4EZTA 4HY9A 5E84A 4JLCA 1SUFA 2RT6A 4EZRA 4EZOA 4EZVA 3VEBA 2YIAA 3D2EA 1E9VA 4EZZA 1E2UA 4EZYA 3DPPA 3O3MB 3B51X 3OWGA 2PY6A 3LMFA 4G6QA 4IWPA 3L3OM 3T4AG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3K A;  2JNS A;  2ND0 A;  2ND1 A;  2NCZ A; 
#chains in the Genus database with same CATH topology
 2D4C A;  3I39 X;  4EZS A;  4WPC A;  2O0I 1;  3QE6 A;  4NQI A;  3KAV A;  4R5L A;  3D51 A;  3CVR A;  4EZX A;  2N3K A;  4NPH A;  4DYL A;  1QWN A;  3EJT A;  1TQW A;  3SYV A;  4DCN C;  4B9Q A;  1QWU A;  2YI9 A;  4AZH A;  3BUP A;  3HAJ A;  4AZB A;  3QWE A;  2JNS A;  3A98 A;  4FZS A;  4R5I A;  4EZU A;  2V0O A;  3UIT A;  4H6I A;  3D50 A;  5KBP A;  1GNT A;  2Q12 A;  2ND0 A;  1URU A;  4JL9 A;  4UDX X;  3D2F A;  2F7Q A;  3CZN A;  2F1A A;  1TQV A;  2EWF A;  3EJS A;  3O3N B;  1SU7 A;  3HAI A;  3T46 A;  1HWW A;  3BUQ A;  3D52 A;  1I4D A;  3RV0 A;  4JWD A;  4AZ7 A;  3OK8 A;  2OO2 A;  3HAH A;  3VEB A;  3BUB A;  4EZZ A;  2QKW A;  4EZY A;  3DPP A;  2PY6 A;  1R34 A;  2JNK A;  2X3W A;  4PO2 A;  4EZP A;  3T48 A;  3DPO A;  2C08 A;  4E3C A;  3O3O B;  3KDR A;  4FZP A;  2Z8Y A;  4IW0 A;  3D4Z A;  4AKV A;  1HTY A;  3SOG A;  1GN9 A;  1UPX A;  2YL5 A;  2WIN M;  3ERC C;  2ND1 A;  3OHX M;  2YKT A;  2RAI A;  3GI7 A;  4R5J A;  2Q13 A;  2NCZ A;  1X04 A;  4JNF A;  2FYV A;  1ZWW A;  1U00 A;  2X3V A;  2GF4 A;  2X3X A;  3RPM A;  2D1L A;  3EJP A;  3DX2 A;  1X03 A;  4I1Q A;  3EJQ A;  2KHO A;  1OAO A;  3BLB A;  4IWO A;  4EZN A;  2YLL A;  4HR1 B;  2YI8 A;  4HR1 A;  3BVV A;  2FIC A;  4JWI A;  2MI7 A;  2YL9 A;  4JNE A;  4EZW A;  3VKH A;  3B52 X;  2OZN B;  3F7W A;  3DDF A;  4FZO A;  1R5E A;  2F7O A;  1E1D A;  3DDG A;  3RV1 A;  4EZT A;  1SUF A;  4EZO A;  4EZV A;  3B51 X;  3DX4 A;  3DPQ A;  2F1B A;  2OBL A;  1SU6 A;  4UDY X;  5TKY A;  1PS3 A;  3T49 A;  3C7N A;  3ER8 C;  3BUI A;  2YIB A;  1MJG A;  1I49 A;  4ATM A;  3M3W A;  2GAF D;  4BNE A;  3B53 X;  3VEA A;  1I4T A;  4AZ5 A;  3G9G A;  4HYB A;  3BVW A;  2LM0 A;  4R5G A;  4E81 A;  3ZED A;  1GNL A;  2QXL A;  3I04 A;  2Z0O A;  3DYT A;  4M0M A;  2F7P A;  4AZ6 A;  4F01 A;  1TQU A;  1HXK A;  4IWQ A;  1WDZ A;  4R5K A;  1W9M A;  3L3P A;  2EFK A;  2YL6 A;  2RAK A;  2F7R A;  2Z0V A;  4D8J A;  4AZC B;  3DX1 A;  3T47 A;  2LXY A;  3DX0 A;  2OBM A;  3ABH A;  1TQS A;  3FD9 A;  4JN4 A;  1ZYL A;  2WYI A;  1O7D B;  3QA8 A;  2GA9 D;  4HY9 A;  1R33 A;  5C5B B;  4EZR A;  5C5B A;  2YIA A;  1Y2O A;  4AVM A;  3O3M B;  4WPE A;  3OWG A;  1TQT A;  2ELB A;  3T4A G;  1O7D C;  3ACO A;  3CZS A;  2X5C A;  3BVU A;  3PLT A;  4JWE A;  4KIK B;  4KIK A;  1OA1 A;  2F18 A;  1DKY A;  3BUD A;  4AZG A;  1JQK A;  2WYH A;  3LLL A;  3CKD A;  1I4L A;  2YIV X;  2YLA A;  3I2W A;  4IM3 A;  4H6H A;  3I01 A;  4AZI A;  4F00 A;  3KAW A;  3LVT A;  3EJR A;  3DX3 A;  4NSW A;  2EFL A;  2RAJ A;  3QNJ A;  2PMR A;  1LQ7 A;  1SU8 A;  4IM0 A;  2ALW A;  2ZXQ A;  4JWC A;  3QNI A;  2Z0N A;  5FLE X;  5FIG A;  4FM3 A;  2EX3 B;  3ER9 B;  3BVT A;  1DKZ A;  4IM2 A;  1YWM A;  2QFF A;  3CAZ A;  1OA0 A;  4H8S A;  1DKX A;  4EZQ A;  3Q84 A;  2YL8 A;  3Q0K A;  3D4Y A;  5E84 A;  4JLC A;  2RT6 A;  3CV5 A;  3BVX A;  3EJU A;  3D2E A;  1E9V A;  1E2U A;  3LMF A;  2OW6 A;  4G6Q A;  1QX1 A;  4IWP A;  4AZC A;  3L3O M;  2OW7 A; 
#chains in the Genus database with same CATH homology
 3DPQ A;  4PO2 A;  4EZP A;  3T48 A;  3DPO A;  2OBL A;  1SU6 A;  2X5C A;  4UDY X;  5TKY A;  3T49 A;  3I39 X;  4EZS A;  4E3C A;  3C7N A;  3ER8 C;  4JWE A;  2YIB A;  4KIK B;  3O3O B;  3KDR A;  3KAV A;  2Z8Y A;  4IW0 A;  4R5L A;  4KIK A;  1OA1 A;  4EZX A;  1GN9 A;  1MJG A;  1UPX A;  1DKY A;  2WIN M;  2N3K A;  3ERC C;  2GAF D;  2ND1 A;  3B53 X;  4NPH A;  3VEA A;  1JQK A;  3OHX M;  4HYB A;  4B9Q A;  2YIV X;  2YI9 A;  3GI7 A;  4R5J A;  4IM3 A;  4H6H A;  3I01 A;  2LM0 A;  4F00 A;  2NCZ A;  3KAW A;  4R5G A;  4JNF A;  4E81 A;  1U00 A;  2JNS A;  3A98 A;  3ZED A;  1GNL A;  2QXL A;  3I04 A;  3QNJ A;  4M0M A;  4R5I A;  1SU8 A;  4EZU A;  4F01 A;  4IM0 A;  3UIT A;  4H6I A;  4JWC A;  2KHO A;  4IWQ A;  1GNT A;  1OAO A;  4R5K A;  1W9M A;  4IWO A;  5FLE X;  5FIG A;  2ND0 A;  2EX3 B;  4FM3 A;  4JL9 A;  4EZN A;  4HR1 B;  2YI8 A;  4HR1 A;  4UDX X;  3ER9 B;  3D2F A;  4JWI A;  4JNE A;  4EZW A;  1DKZ A;  3VKH A;  2EWF A;  3O3N B;  4IM2 A;  4D8J A;  3B52 X;  1SU7 A;  2QFF A;  3T47 A;  3F7W A;  1OA0 A;  3T46 A;  1DKX A;  2OBM A;  4EZQ A;  3FD9 A;  4JN4 A;  3RV0 A;  1E1D A;  1ZYL A;  4JWD A;  3RV1 A;  3QA8 A;  2GA9 D;  4EZT A;  4HY9 A;  5E84 A;  4JLC A;  1SUF A;  2RT6 A;  4EZR A;  4EZO A;  4EZV A;  3VEB A;  2YIA A;  3D2E A;  1E9V A;  4EZZ A;  1E2U A;  4EZY A;  3DPP A;  3O3M B;  3B51 X;  3OWG A;  2PY6 A;  3LMF A;  4G6Q A;  4IWP A;  3L3O M;  3T4A G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...