2N3LA

Solution structure of rna recognition motif-1 of plasmodium falciparum serine/arginine-rich protein 1.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
89
Chain Sequence
GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDVKKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine/arginine-rich protein 1, PfSR1-RRM1
publication title The N-terminal RNA Recognition Motif of PfSR1 Confers Semi-specificity for Pyrimidines during RNA Recognition.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Rna binding protein
total genus 10
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n3lA00
3DLLQ 1PGZA 3P6YC 1RKJA 3P3DA 1X4BA 2BOPA 4LJMA 2CQIA 4IOAQ 3PIPQ 2KH9A 3S6EA 3V4MA 5JVHQ 1VQ4S 1ZZFA 2CQGA 1U1PA 2QA4S 3SMZA 5CA5A 1YI2S 4Y0FA 2VOPA 1YHQS 5D78A 2MZRA 3CCQS 1WWHA 3CC4S 1N8RT 4C4WA 2AYEA 2U2FA 2E44A 4BS2A 1O0PA 5IFMA 1VBYA 3FEXB 4V19X 1NO8A 1KOHA 2FY1A 1SJ3P 1K73T 2F9JA 2MZ1A 4UQTA 3US5A 3VAKA 1SJ4P 1F9FA 3R1HA 2KRRA 2WBRA 4FXWA 2MZSA 3I56S 3G8TA 1VC5A 2VOOA 1X4AA 1NU4A 3MD1A 1B7FA 1WG5A 1VQMS 2DGVA 3H2UB 3ULHA 1U6FA 1YJWS 3P5TL 2E5JA 4WFAQ 2MKSA 3CTRA 1XN9A 3PIOQ 3UE2A 2HGMA 4TU7A 3K0JA 1U1RA 2CQBA 2KXFA 2JVRA 1K9MT 3TO8A 2X1FA 4QU7A 3EX7B 3NS5A 3UD4P 1A9NB 1VQ7S 3RW7A 2MKHA 1FJCA 2MB0B 3NNAA 2MYFA 3MOJB 2FC8A 2DHGA 2MZJA 1VC6A 4IO9Q 2CPXA 3S01A 3CCVS 1P27B 4CH1A 2OSQA 2DHAA 3UCGA 3NNHA 2QFJA 3SDEB 2E5IA 5JVGQ 2RVJA 4ZKAA 1X4DA 1WF2A 3CCES 4ERDA 1W2BR 2CQCA 5GAEU 2DH7A 4EGLA 2M2BA 5HO4A 2OIHA 2ZJRQ 2RRBA 3MUVP 2MKJA 2DGUA 4WF9Q 1OO0B 5D77A 4YB1P 1OPIA 2ZJQQ 2MJUA 3Q2SC 5DDPC 3CCUS 5DM7Q 5EN1A 3FEYB 1M1KT 2CQ2A 2EK6A 4M5DB 1H2TZ 1YTYA 1U1QA 1A7GE 4U67Q 1YJNS 1N88A 5DDOC 3MURP 3VAIA 2J8AA 1X5SA 2GO9A 1WEXA 3MXHP 2DHSA 3J7YU 5IM0A 3ZZYA 4PKDB 3G96A 3CC2S 1VQPS 5BJRA 3S8SA 2LKZA 2LXIA 3JB9k 4ED5A 1WEZA 3CCMS 2FHOB 1S72S 4QU6A 1VQOS 1YITS 2OJ3A 1FHTA 1N54B 4A8XA 1L3KA 1UW4A 2DGTA 2CQPA 4Y00A 2L08A 2LQ5A 1YWXA 2D3OR 2CJKA 1FNXH 3S7RA 3NMRA 4OZ1A 2XNQA 2LMIA 3G6ES 1IQTA 5MLCV 1WF0A 5CYJA 2KXHA 3U1LA 4C0OC 4TU8A 2RS8A 1D8ZA 2FPHX 5LSLA 2KM8C 1YJ9S 2J0SD 2YH1A 4CH0S 2V94A 3CF5Q 1OIAA 4Z2XA 2K3KA 3HHNB 2J76E 1URNA 1X4CA 2LECA 5LXRA 2DNQA 3MUMP 1M5OC 1M5VC 1VQ9S 1QVFR 2HYIB 1X4FA 4PR6A 4J5OA 2M9KA 2M7SA 2MGZB 4P6QA 3EGZA 2I2YA 2LXUA 2M52A 3LQVA 3B4DA 2DGSA 4LIRA 2LCWA 1DZ5A 2X1BA 2ADCA 2DNZA 2KG1A 5DM6Q 5IQQA 3UWTA 2CPFA 3R27A 2OTLS 2MXYA 1QVGR 1DHMA 1P1TA 1VQLS 2N7CA 3MUTP 4W90B 1WELA 3CXCR 4QPTA 3H2VE 4RU2A 2DNHA 2CPIA 4F25A 2MHNA 1SJRA 2F9DA 3VF0B 3D2WA 1VQ6S 2RQ4A 2X1AA 2KT5A 1SJQA 1X5OA 2KU7A 1R8HA 2CPHA 1U1LA 1VC0A 3MD3A 2M8DB 3CCSS 3CMES 1DRZA 1VBZA 1Q7YT 1WHXA 2KG0A 4WFBQ 3BS9A 2KYXA 2L9WA 2DB1A 1X5TA 2E5GA 3VAMA 2M8HA 2RQCA 1HD0A 3I55S 3MDFA 1S79A 2ZJPQ 1UAWA 2DIUA 3RW6A 1WHWA 2LYVA 3CPWR 2KI2A 3L3CA 1M5PC 3THTA 2XS2A 2LA4A 3BO3A 5GVQA 4LMZA 2HVZA 5LJ3Y 2G0CA 2MQPA 2DNNA 2KFYA 3VAHA 2DGXA 1VQKS 3J7ZT 3SDEA 2MQOA 2OTJS 2GHPA 2YWKA 2DNYA 2MMYA 3P49B 2DK2A 4F02A 2HGLA 3G9CA 2CQ3A 2VONA 2XS7A 3IRWP 2DNGA 1FO1A 3CUNA 3CC7S 1ZZNA 1KQSR 3CCRS 2CPEA 1FJ7A 2DNLA 1RK8A 1VQ8S 2JWNA 2MKIA 2EK1A 1DBDA 2PEHA 4WIIA 1Q81T 2AYBA 1X4HA 2DGQA 4CIOA 1WG1A 2DGWA 1H2VZ 3Q2TC 2AYMA 2CPDA 2DNKA 2RT3A 2JVOA 2MKKA 5H1SV 4UY8T 5DDQC 2G4BA 2RU3A 1N52B 2DH8A 2SXLA 4QQBA 2MPUA 2ERRA 2DISA 1SJFA 2CQ1A 1VQNS 1WEYA 1X0FA 4CQ1A 2ADBA 3DXBA 4WKRA 2KRBA 4YUDA 2EVZA 2MY7A 2MZQA 2KN4A 2DIVA 2VODA 2YH0A 2DNRA 2CPYA 5LXYA 4OZ0A 2MQNA 2YTCA 5ITHA 3UD3P 1NJIT 2HZCA 1JJHA 1R8PA 1FJEB 2XS5A 3CCLS 3IWNC 2KM8B 2X1GA 1G2EA 2A3JA 2LEBA 4IOCQ 5GMKa 4IUFA 2RNEA 2YKAA 2CQHA 1KC8T 1UP1A 2KXNB 2CPZA 2M0GB 2N3LA 2F3JA 1U1KA 3TYTA 2DNMA 3G4SS 2DO0A 5HL7Q 5CXTA 1WI8A 1U1MA 2M88A 3THPA 4YOEA 3BEGB 1ZH5A 5LSOA 5GADU 2DITA 2DO4A 1HA1A 4PRFA 1U1NA 1WTBA 2Q79A 3VALA 2NZ4A 1CVJA 1WF1A 4F26A 1JMTA 2N3OA 2DNPA 1KD1T 2OSRA 2UP1A 2CQ4A 2MQLA 4TU9A 1WI6A 1WG4A 3SXLA 2MGZA 1Q82T 2G1DA 3NS6A 3CULA 2MSSA 1X4GA 2E5HA 2JX2A 3MI7X 2RRAA 2D9OA 4WFNQ 1KOOA 3HI9A 3UCZP 2LA6A 2DNOA 3G8SA 3N9UC 4WCEQ 2QEXS 2AYGA 2MQQA 3VAFA 2HGNA 2DH9A 2M70A 3VAGA 2KVIA 1U6BA 3B4MA 2NLWA 2K8GA 1U1OA 2CQDA 2MKCA 1H2UX 3OW2R 1BY9A 3ZZZA 1HL6A 2U1AA 1M90T 1QM9A 1X5PA 3BO4A 3TP2A 2MSTA 2CPJA 2L41A 1AUDA 2DGOA 2MZTA 2MQMA 2RUGA 5IM0B 2D9PA 1SXLA 3EGNA 1M5KC 1K8AT 2XSFA 2XB2D 2CQ0A 2O3DA 2MJNA 1WHVA 4FXVA 2LEAA 2M4MA 3UCUP 4C7QA 1D9AA 4TLQA 4W92B 3NNCA 2I38A 3R1LA 3G71S 5DDRC 2XNRA 3U1MA 5GAGU 3CD6S 3VAJA 2JRSA 3LPYA 1FT8A 1X4EA 1HD1A 5LJ5Y 1UFWA 1H6KX 1VBXA 1JJ4A 1JJ2R 5GAHU 2AD9A 1FXLA 3BO2A 1WHYA 2J0QD 2RS2A 2MY8A 5DETA 3CCJS 1PO6A 3CMAS 2B0GA 2PE8A 1Q86T 1YIJS 2FC9A 2BZ2A 2KHCA 5FJ4A 1U2FA 2DHXA 1OWXA 2N82B 1VQ5S
chains in the Genus database with same CATH superfamily
3DLLQ 1TTHB 1FKOB 3V4MA 4B9MA 2HPUA 3NGKA 4DFMA 4ZK7M 4YHHF 5CCMA 4A8SA 2AYEA 3RUBL 2AGQA 3FEXB 1HMVA 2QG9B 2L9NA 1VJWA 4DL7A 1KONA 5KTQA 2ZH6A 2P2CB 5E2QA 3PRDA 2QLXA 4PZVA 1HPZB 3DKDA 3PEHA 4I1TA 5M2RA 4WFAQ 4DPWA 3LP1A 3N6LA 5E0OA 4HTJA 2ZC4A 4HH0A 4B3OB 4IRCA 3NS5A 1CLFA 2WVFA 1FJCA 2BQRA 1PKUA 3MOJB 3BDPA 2R7OA 1AXQA 4L3NA 1GK8A 1NM2A 2YNGB 4LF9J 4ZLPA 2EWHA 1CC8A 4QWEA 3VGSA 1OPIA 5F8IA 1VIXA 4RW4B 3CVKA 3FEYB 2R2SA 3D3BJ 3PY8A 1RXOB 4OLPA 4B9UA 3TEHB 3TEGA 1SB6A 2XI3A 2BA9A 3DCAA 5L38A 1MW7A 4PYAA 4JV0A 4HKQA 2Y3YA 2GZOA 4A46A 4A8XA 4FS1A 4CLLA 3TOQA 2ZD1B 1Q95G 4B3SF 1X60A 2QSWA 2NPIA 2HHTA 3HULA 4D3HA 4LRAA 1T03B 3M7VA 4QWCA 1RB0A 2QL9B 4B3MF 2K3KA 1BUXA 3I5AA 4LF4F 2IIHA 4C48A 2E1AA 4LF5J 2FVSA 4J90A 1IWAA 2BRKA 4KHMA 1IBLJ 3IBFB 2Q1LA 3DOMA 4DR7J 2WVBA 3W9IA 5E3QA 2A6MA 2VPZB 3BN4A 3D28A 2GCFA 4AXJA 2FY8A 5J2QA 2F9DA 3HXMA 2IY5B 2XWXA 4EUVA 4NI2B 1SVDA 2E7WA 2CPHA 3EZ5A 2KDOA 4ZCMA 4MT1A 1U7LA 1DURA 1QAIA 5MAOA 3IGVA 3F0NA 4E8UA 2M8HA 3I55S 2BE2B 1HR0J 1S79A 3KLEB 4ES2A 4UY85 3S1TA 3PZPA 2PO4A 1PAEX 4WXWA 4NEYA 5KFLA 3J7ZT 2IDLA 1XBWA 2W9CA 4P9SA 1HBOB 3J81j 3G9CA 2F40A 1R6YA 1SI9A 1S1TA 1FO1A 2W4CA 2VJUA 1VBKA 4J9UE 1DTQB 1KLMA 1WD6A 2C3PA 4U7CA 5DG9A 2I5JB 4RW9B 2VHGA 2C28A 2RU3A 2SXLA 4L3KA 4ID8A 2CQ1A 4OI3A 5IC6B 1FRLA 2V2VA 2PDAA 1M0SA 3KUEA 3KJVA 2YH0A 3OT9A 1S5ZA 3VGVA 3QWPA 1RT2B 2R2RA 3AODA 3H98A 3KNAA 1H38A 1UVLA 3TYTA 2WSCC 5HL7Q 2IRYA 3HSZA 2M88A 2AEJA 2W2MP 1TP7A 3MMCB 4OHXA 3M8ZA 5HJXA 1HBUB 3MM7B 1WI6A 3TNVA 1CJVA 3EVMA 1KHVA 3GFXA 2RRAA 5EWFA 3UCZP 1WC5A 4OX9J 4EO8A 2R7XA 3FBBA 3RAMA 3W1YC 3GIRA 1NK7A 5KFKA 4ZLJA 3D9BA 3V81A 1M5SA 2VC1A 2IPOB 1Y5IB 2ASJA 2H4YB 3TX8A 4C8ZA 4DV7F 3NNCA 1QSSA 1QAYA 3R9LA 2XNRA 1ZA1B 3CD6S 1N5SA 3LPYA 2H51B 2GC8A 5GAHU 3C14B 2QV6A 3EDRB 3PTWA 2MY8A 3MCMA 1IKXB 2DEIA 2EPIA 2ZITA 4JB8B 1PCAA 2DCUB 2J7KA 2IFXA 1XEZA 2CQGA 2AWZA 3ILJA 4ZOSA 5D78A 5RUBA 2AHOB 2MDAA 4O4RA 2OMLA 3DOKA 2LEPA 4RNNA 3HSJA 3QGPA 2UUWA 4F50A 4WFZA 1G7CB 4ECVA 4LFCF 5D6GA 3DRPA 3IA0A 1FEHA 4I7FA 1NSQA 4ZVHA 3MM9A 2YQ1A 3G8TA 3KLFA 4K2XA 1NU4A 2XTJP 5LOQA 1UEVA 3P5TL 1FEEA 3PIOQ 4WZMA 2ZH1A 1K9MT 2X1FA 2GVZB 3SSQA 4PWDB 3BM7A 4C3LA 5LMUF 4RKUC 2MKHA 2FC8A 4L75A 1BQXA 2DHGA 1RTHB 2CPXA 3CCVS 1RAIB 4I64A 1ZYQA 1S1XA 2DKOB 4DR1F 1EETA 2L9DA 1RE1B 2ZJRQ 4F7VA 3CJRA 3KLHB 3KK2B 4PXEA 3D4JA 4KT0C 2HVDA 1XNQJ 4M5DB 2Y8YA 1T05A 3WDOA 1YJNS 3TVZA 5ETKA 3MXHP 1NAQA 1FESA 1KFDA 1B7YB 2BXJA 3ITHB 1S12A 7AT1B 2HMIA 3FC9A 4DUTA 4DXLA 3PVXA 2DGTA 2GA7A 3HDSA 1HBMA 3Q24A 3Q89A 1TKTB 1I94F 1F5BA 5B0BA 1UKUA 2VQFJ 2HBZB 3R7SB 5B0DA 4JI4F 3IWLA 1B99A 1VQYA 1HWIA 2HWHA 4LRFA 1WSRA 1FK9B 2QTWA 3EGZA 2LXUA 2HFOA 2NUHA 5J2PB 1F5CA 1RWXB 2QX0A 5KFAA 1RABB 2E1RA 1U49A 1TL1A 1RTJA 2WW8A 1X7VA 3Q8RB 1F6TA 3MCSA 1W26A 2HLTA 3TUIC 1X5OA 4ETZA 3D66A 3L95X 3AB4B 3M6WA 3DRSB 1FF2A 1K1QA 2QL5B 4UOCA 3CJKA 2RQCA 1UZHA 3IRXA 3SI8A 1V5IB 1N32F 4OMFG 1NSKL 2UVUA 1RT3B 1AT1B 2ZBPA 2CJ9A 5J2MB 1IWGA 4NCAA 1KRPA 3FGVA 2MQOA 1TKZB 3E01A 3QRPA 2JH3A 1YK9A 1Y10A 2NXNA 1JJCB 2DXFA 4Z37A 2VBZA 2WSEC 4WP9A 4X4PA 2LDIA 2D3O1 3TJ9A 4HEA9 5LT5A 4DV3F 1MG7A 2OELA 2WHOA 3VZHA 3A1YG 4USKA 4GKKJ 4DZDA 2HHQA 4GC6A 2WVCA 4DF4A 1AZSA 1KQFB 3ENAA 1HMVB 3K8VA 2H5IB 4DR5J 4B3SJ 4ES3A 2MY7A 2DXEA 4K4SA 3K59A 4OZ0A 4AQYF 4ZPWR 3OJUA 3ETMA 1Y0HA 1C0TB 3QPIA 3KHGA 1KC8T 2BJ3A 2YQ3A 2XCAA 4X4OA 2F3JA 4ED6A 4DR4J 2H5EA 2DTJA 2BE9B 3C19A 1BQNB 3KWMA 4KO0A 2GIRA 2J5AA 2NZ4A 2N3OA 4PPZA 2RDIA 5KOWA 3DRRA 3TJAA 2JX2A 5B0GA 3OSPA 3T6BA 2XQCA 4C0BA 2KVQE 3RBXA 4USIA 3MAQA 5ETLA 2P5VA 3LA0A 3CJ5A 3VAGA 3AD7C 2K8GA 3VZIA 2N4DA 5D0HA 3JYTA 1EQMA 1RTIA 2QJ3A 2DXDA 1U6ZA 4X64J 2AZ1A 4YY3F 1OYEA 2MEWA 3MPDA 2JL9A 1IBMF 5LL6d 4IG0A 5F8LA 4P74A 2XB2D 2PN6A 4C2MA 5BR8J 5KFCA 2LEAA 4ILLA 1BE4A 5KG6A 3HSDA 4PABA 8AT1B 1F3VA 3ZZUA 4J9NA 5KFQA 1FA0A 2JLEA 3KK3A 3VCDA 3G6XA 3KXDA 2UVWA 2HLUA 4QBUA 4X65J 1UMJA 2B0GA 3KUGA 2V8VA 2FC9A 4ECYA 4BCAA 2YPYA 1PGZA 3P3DA 2AJ2A 3I0SA 3N4WA 3TZXA 3WC2A 3PW5A 1X8DA 2HWTA 3DOMB 2DRAA 5IS2A 4L74A 4KC5A 1FVSA 4GVBA 4PAAA 1SJ3P 4RBUA 5J2QB 4B3TF 1LW0A 3R1HA 2D3ZA 5HVGA 2G1HA 4FYDA 1VQMS 1YJWS 3PV8A 3BJYA 3CDBA 1A9NB 4NYPA 5KT3A 2Y1RI 1D9FA 1ZETA 3NNAA 2MLYA 4S0MA 2J9DE 2V2ZA 5KG0A 1JKHB 2E5IA 2VJVA 2W9CB 4DSIA 2ATCB 2XHCA 4C8LA 5DGAA 3QGGA 1S1TB 2QC3A 4F4WA 3V6JA 2DGUA 3N79A 2EFOA 3D5MA 3TAPA 1NDKA 2CNKB 4LF2A 1KLMB 3ZZTA 1WC6A 3PXGa 4FNIA 1M1KT 2ZBIA 4USTA 1N33F 4F4KA 2H65B 3FSYA 4GKJF 1BQMA 3PKYA 4CT8A 2J8AA 4I2PA 2DHSA 4PG6A 2R3VA 3KDOA 5KFNA 2WW4A 2IMOA 1NUEA 4QU6A 1MLAA 1Q16B 3ELHA 3KJVB 3OXFA 1XR7A 3SZ2A 2YPZA 2CADA 4OI0A 5AXMA 3C8YA 3CIZA 1KP6A 3R7BB 4E2FB 2OPSA 5KFEA 5AXLA 4HVZA 2ZFHA 4OHYA 3HZGA 3D1QA 4I6YA 3NOGA 1CJVB 2CA9A 1OY8A 3QAUA 4W90B 2DNHA 2EW9A 3EICA 3B54A 1HNZF 3GFYA 1R8HA 2M8DB 5U47A 2X3GA 4J9MA 3V81B 1VGYA 2BJ1A 5IZHA 4USUA 2HEKA 3TVYA 3CJSA 2L9WA 4O3RA 1C1CA 1X5TA 3W61A 2C2DA 3CDUA 1JLCA 4DSLA 3Q22A 5DZ7A 1FRIA 2KKHA 1N5TA 1Q8LA 4NLQA 3KDNA 4CO0A 4DR1J 4JI1J 2Q6BA 1SC3B 2OTJS 5HP1A 1XWLA 2DNYA 4A48A 3K5MA 4Y2CA 3TA0A 3W9JA 3HCXA 3F44A 3J7YI 3IRWP 3GE9A 2ZM6J 2FLPA 1QE1B 2DNLA 4B9LA 1VQ8S 3H5XA 2C2RA 2QMUB 3PHEA 2AYMA 3DU5A 4IOBA 4NLPA 2AJ1A 3ZNUA 3HHLB 1HHQA 3DRPB 2D69A 2UVVA 3MM9B 2DIVA 3OVBA 1XIQA 2V8GA 3TRGA 3KLFB 2QA4G 2W2NP 4DSFA 4DR2F 3KLGA 1T7PA 2EFGA 5HANA 3CT9A 2BW2A 3H7HB 2KXNB 2CPZA 1TQLA 1FDDA 2ZDPA 3U02A 2Z30B 3H20A 5L1KA 4JV5J 1F9EB 3V6DA 4TYAA 4F26A 2DNPA 4WP3A 1S1XB 4DV4J 3PFOA 2F4FA 1EETB 1R0AA 2N4CA 4J9LA 4RNMA 4QW9A 2Z0GA 4NXNF 3D6MB 4Y2KA 4LRCA 1JQGA 5K8MA 2HGNA 3BB5A 2ZC3A 4ZVGA 2UUAF 1U1OA 1T05B 4DZ6A 5F3ZA 4DPYA 2U1AA 1QM9A 4OV6A 2MSTA 3O3LA 3GP9A 5ETNA 2ZDOA 1N32J 2HMIB 1SH3A 1D0EA 3U1NA 3SCKE 1HBMB 2HZAA 1YQHA 3Q8VA 5GAGU 5DS7A 1GXLA 2J0XA 3JTPA 1BC6A 1RZMA 1TFWA 1Q86T 3FKBA 1BWEA 3BGUA 4K2JA 3MCNA 3ONQA 1RT7A 1Y3KA 1C2PA 2OO4A 4G1IA 3SV3A 4NCBA 4IOAQ 2BABA 1LWXA 2IVFB 3DLGA 1CJTB 2R7WA 3CC4S 3P5BP 1U8SA 5E3RA 2KO1A 2ZH4A 1VR6A 2BX6A 2ASYA 4DV2F 1KOHA 2H3EB 4K4XA 1KWMA 2HQIA 1RTJB 3HKZD 3VR1A 3A8KA 4NLRA 4F36A 4JI5J 2ROPA 2WBRA 4HHUA 3PNIA 1B7FA 3M1VA 4Z7YA 9ATCB 1B4SA 2UV8A 2OLWA 2X3DA 5E3CA 1R89A 4RLEA 2IJNA 3VHQA 2AIRB 3DLJA 1REGX 4UZCA 4WKYA 1CPZA 1AB8A 2QE5A 3D1HA 1BHNA 3IBWA 2E1CA 3KJFB 1RWVB 3HT0A 4M1KA 3BPSP 1S1WB 5EX3A 5HBMA 5GAEU 5HJYA 3H0PA 4EGLA 2OIHA 1TUVA 2MJUA 3UD5A 3Q2SC 2E29A 4DX7A 1CSJA 1WC4A 5KFRA 3UR3C 3HO1A 5LM7E 4Q5VA 1HYSA 1X5SA 4K0KJ 4OQJA 2HRYA 4F2SA 5KT4A 2NZCA 2LKZA 3AFGA 3PJ9A 4ZIWA 3EVOA 1QUPA 5KFJA 1KQGB 3OL8A 2LQ8A 1TL7B 2CJKA 1YX2A 2QN6B 3CDEA 4CLYA 1WF0A 1UWBA 2I1RA 4FPRA 2BJDA 1LV5A 3EM1A 4ZVRB 1LWCB 3DM2A 4KO0B 2CXEA 3AAWB 4F04B 2ASDA 3HHNB 5CYMB 3TAQA 2LECA 3MUMP 3SQGA 1SV5A 1WC3A 5CZXA 2M9KA 3DRRB 4RUCA 2C2NA 2DGSA 2LCWA 3LF0A 2IVYA 4B3TJ 2ADCA 5J1EB 4ED0A 3CCZA 3CDWA 1P1TA 1VQLS 1ZA2B 3PR4A 4CTAA 2XG8A 1R0CB 2DR7A 4EI2A 2DPJA 3JYTB 1RTIB 4O44A 2X1AA 1FDNA 1SJQA 3MD3A 1QD1A 2I8EA 2WVEA 4CNYA 2YQ0A 2VG5A 1LWEA 2BDPA 4LF7F 4IG0B 3GFZA 1L3UA 5A8KA 3RW6A 3KHRA 3THVA 1JWWA 4J7CA 1M5PC 3WZ0A 4DL5A 5DQIA 4G1PA 4KGKA 1ELOA 4ECRA 3KK3B 1VK3A 2BE7D 2HKEA 4PG5A 2PA3A 4ZN1A 2FQQB 4F02A 2ZUGA 4LF8F 2FB0A 4OI1A 2NYHA 2E7VA 3TX0A 3I0SB 2B9EA 4CWBA 4UUXA 4CI0B 2NXCA 5HMYA 3JQMA 1H7WA 4NLWA 2MKKA 2MPUA 1LW0B 3RB0A 3ZTPA 4DI6A 1L3SA 2UUBF 4JI7F 4ZCKA 5JUMA 2B8QA 2DNRA 5H9FK 2GX8A 3UD3P 1JJHA 2PFDA 5HVHA 1RLDA 3JSMB 2JEFA 4O3NA 5GMKa 3GJRB 1YJRA 1S4FA 4YR2A 4YB6A 3K7RA 4LREA 1R31A 4XDDA 3RZAA 4GC7A 1RWNB 4HR2A 4GO5X 4OYXA 3CMQA 2VIHA 3M30A 5KFHA 5KFUA 3UW1A 2GHVC 3CD5A 2YWHA 3JXOA 3NS6A 2RU9A 2CUYA 4O4GA 4QIGA 4M5JA 3LAMA 2CNOB 3OUYA 2POKA 4RPFA 1MU2A 4UQGA 4DQIA 3BO4A 2AW0A 3FMWA 1TKXA 3CB4A 2IRUA 1RTZA 1HWKA 3LGHA 4DPXA 1R8CA 4PUOA 4BWJA 3BSOA 5AJ3F 2FVQA 4C7QA 1F3FA 1PBAA 3K5PA 3VWSA 5HROA 3OV7A 3U1MA 4WXOA 1F60B 3FNNA 3M8WA 1WACA 3U27A 1RYSA 3V4IA 2OPSB 4FKXA 4L72B 2ASLA 3CCJS 4KQZA 4FS2A 4KE5A 3N01A 4J91A 1NSPA 3HKWA 2OHDA 3VV2B 5IT4A 2CQIA 3CJQA 3KKFA 2RDJA 3MOZA 3G86A 1AW0A 1WOSA 1HBNA 2U2FA 1APSA 1HI8A 5FLXY 2VUGA 4DX5A 1MN9A 4G1QA 1CBKA 3D6FB 4KYZA 1NZAA 3US5A 2EC2A 2Z2YB 4LF6F 4EZ6A 2JHEA 3IFEA 1Q4RA 1X4AA 4ITSA 4CLUA 4WTOB 4KGMA 5L8RC 4F67A 4N47A 2Z8QA 1JLCB 4M94A 2DY1A 4P72A 3JSBA 3AA8A 4KB7A 4IO9Q 4F4YA 4OJGA 1D09B 3I9V9 4NCGA 3GJTB 4P2SA 2XLKA 5HP1B 4NXNJ 4NYZA 4ZKAA 1P8GA 5HN0A 1S9GA 2CIMA 1RYRA 3UN3A 1G4CA 4O3OA 3CCUS 5DM7Q 3J81Y 4AE5A 5L46A 3IWXA 1SBRA 1WOOA 2V50A 3IM8A 4CH7A 1NK4A 2R8GA 2CZVC 1WEXA 3AOBA 1GMUA 3IG1A 3ZZYA 2WOMA 4MIAA 1T9WA 2G2YA 4EWTA 2E9TA 2EXUA 4LBHA 2VKZG 1SCJB 1L3KA 3H5SA 3BR9A 1T9UA 5AXKA 2CQPA 2HHSA 2FTRA 4QYRA 4X62J 1JXVA 2J9CA 4P73A 3T5LA 4R0JA 3A4TA 5L39A 2CJXB 4DUYJ 1Y9OA 2KM8C 1OSCA 2QA2A 5FD1A 3V6DB 2B4OA 3FFIA 2ZVIA 1UETA 3DLEA 3NGDA 4DV2J 1R0AB 2B7BB 4LRBA 2NS1B 2GMJA 3O5TB 2KG1A 2L3MA 3PO5A 3CIMA 4CO3A 1QY7A 2GVDA 2KL8A 1PC5A 4J9VA 4NLYA 2KU7A 3OFFA 1DRZA 4MKVA 1GTEA 2VBWA 2EBEA 1YRXA 3AOAA 3I4HX 2HIYA 1DTTA 1UAWA 3MR6A 1WHWA 3M2UA 1S76D 2HHUA 4N76A 1VJQA 2CDQA 1HLWA 3K89A 5LJ3Y 3AQPA 4FPIA 2VB6A 1PYTA 2QA1A 2RKIA 2ZH2A 4M5IA 3RBDA 4LQ9A 4NEZA 2A6OA 1N36F 1Y4ZB 1RT7B 4CP5A 4P7TA 4KHPF 1RSCA 3HJVA 2CYYA 5HQ8A 1RK8A 5KT7A 2DRDA 2ZH5A 3DLGB 4X4VA 3J7AN 4NXMF 2HVEA 2HQ3A 1S48A 5DDQC 4DG1B 4QW8A 3PDNA 1VISA 1NKCA 1QTMA 1WKJA 2ADBA 2PD1A 4XAKA 1CS4A 1NK6A 1U25A 2CWKA 3M1VB 1JLBA 1VOMA 1KKHA 1MWZA 1FJEB 3BKTA 1SIWB 4EFAC 3IAM9 3MEEA 2Q43A 4A4JA 2Z57B 2Y9HA 5D0RA 1TU0B 1U1KA 4KH1B 2DD8S 3DRYA 2DO0A 2YBVA 1HHSA 4ZPVR 4JYAJ 3C6UB 3BEGB 1ZH5A 2BANB 5EUHA 4ZDNA 3E8OA 4BDPA 6FD1A 1T9YA 3BBCA 3BKUA 3MZIA 4J9PA 5L1LA 2F7VA 4XO0A 2ALYB 4DFKA 5HBMB 4HHJA 3NGUA 4N77A 1ZTWA 2HFVA 2V68A 3CJ4A 3VVTA 4C8OA 3BSNA 4LUBA 4UZBA 2IA0A 3GG0A 1HYSB 3ENQA 5J1NA 3OTCA 3A12A 3OTOF 5D0EA 4CCHA 3UVJA 1CULA 5FIIA 2D9PA 1LQ9A 2XSFA 1RAOA 2QLFB 2M4MA 1D9AA 3AJ1A 3A8JA 4DL0C 1KTVA 3ZXWA 1GT8A 3LANA 1GMWD 4IFVA 1FKPA 4NLOA 1EKRA 2AD9A 2ZEJA 4LSLA 1UWBB 4X66J 3Q8YA 4ES1A 2DYAA 1YBAA 2NPFA 4KV8A 4LVNP 1XMOJ 3DM2B 4M5HA 1U2FA 4FBUA 4EEYA 3EX7B 3RYLA 2W2QP 4P2XA 1MMDA 2O01C 4JP8A 1AUSL 2FVPA 2OMOA 3PIPQ 3S6EA 3Q8UA 5ETVA 2JSXA 4KHRA 1SL0A 3ZTRA 3AY0A 1YHQS 2UUCJ 3MCOA 4ED7A 1NH8A 1O0PA 4LFAJ 4FP9A 2FJEB 1HQEA 1LK7A 1OJ4A 1U48A 3DN9A 3PW0A 4O44B 1GMVA 1YZ7A 3I82A 2MLXA 4AD6A 2Z2ZA 1LWEB 2HAFA 1R27B 2E5JA 4Q2LA 2ZZNA 5A8KB 2XMMA 1I6JA 3CW2C 4G3IA 2C2ZB 4K8RA 3L4BC 3NNHA 1Y7PA 4ZVSB 3CCES 5J1PA 1G6BA 1U8WA 3DLKA 4NLGA 5AE2A 2M2BA 2KTQA 3PM9A 4ZP6A 1OO0B 2Z4PA 3E2EA 2HVHA 1S1VA 2EK6A 4AXIA 1U1QA 1IJEB 4NMXA 2JJ4D 1V5VA 2V5HG 5DDOC 3F56A 3FCHA 1FKAF 4PQUA 4U8YA 4I68A 1FX2A 2C2KB 1VQPS 1B3TA 5T7LB 5L9XA 2O66A 1FHTA 1OS5A 4GRSA 2ABYA 4NZ6A 3NXZA 2DHHA 4ID5A 4ZCIA 4IG3A 1FNXH 4TLRA 4HDGA 5KFVA 1U24A 1TUGB 1IQTA 4QYZK 2W8LA 3EXCX 2AX0A 4KAIA 2FPHX 3MMBA 2NQPA 2UXCJ 1NXIA 3CF5Q 1D3WA 3R5JB 3ZC4A 3MTJA 2UV8G 3T9NA 3M30B 1M5VC 4XPCA 4F8RA 4TYBA 1KVJA 1CQMA 3MHYA 2X1BA 4O4GB 3UWTA 4M5GA 4LF6J 4LT6A 4HYKA 4PEOA 4WZQA 3OUYB 4RU2A 2CPIA 2FJDB 3J7Z5 1S99A 2MHNA 3AQOA 4Q2MA 2VZ9A 3D2WA 1VHFA 1MU2B 1Q8BA 1WJ9A 3CCSS 4YFUA 4DR3J 2R7TA 1TKXB 4ZHRB 2CAJA 2GQCA 1HNIA 3GV8B 4ZVOB 4PUOB 1ROFA 2PI4A 4LF9F 3MDFA 4Y34A 5KT5A 1NH7A 5HROB 1HNXJ 5GVQA 4K4TA 2NXUA 3V4IB 4K5SA 3R3TA 2RUSA 3P49B 1XC9A 1V9OA 4QPXA 4WWSA 1V3SA 2UUTA 3KUHA 1UVJA 3W5YA 2R8JA 3OVAA 2HHPA 4HDHA 4CLTA 4FVCA 3DOLB 4U95A 5KFWA 4DCOB 2IJFA 2MKIA 1VRTA 4WIIA 2AYBA 1UWAA 1X4HA 4KPCA 1HBNB 3O2IA 2RT3A 2DNKA 3MR5A 5C42A 4RBVA 5L1JA 1Q0NA 3HVTA 2V8DA 4I2QA 1SJFA 1EARA 5IT9U 4CQ1A 4RW8A 2KRBA 2EVZA 1H7XA 2VODA 3EGVA 1I51B 1YJ7A 4N41A 4ED8A 2KB2A 1NJIT 2YWGA 4RW7A 2LEBA 4IUFA 3BZQA 4LF5F 1IBLF 1TAUA 4EO6A 3NCQA 4DR7F 2HSEB 3THPA 1NJWA 4MTPA 1FX4A 5KFDA 3W8GA 2EFQA 3VALA 4NCGB 4H4KC 1K44A 4O3QA 2GJ2A 2PC6A 4O3SA 2COLA 1S9GB 4NA1A 1X4GA 3I32A 1RHJB 1MWQA 5H9EJ 3T5KA 2HFSA 2LVWA 2MQQA 4ENOA 4H4KA 2KVIA 2NR0A 5EWEA 2NLWA 1LK5A 1HR0F 4RR5A 2AGOA 4H4OB 2OEJA 2L41A 1AUDA 2DGOA 1WORA 3AJDA 3IG1B 3W9HA 3NS7B 2WOMB 5E7OB 5ETSA 2C3MA 1QAXA 2O3DA 3POTA 3I96A 1PJ6A 2NSBA 1AFJA 4PG7A 1YGYA 2OEKA 3UN2A 3HFVA 4JOUA 1FCAA 1FT8A 3NBPA 4F0MA 4OZNA 4U7UK 3L09A 3AXMA 5KFSA 4RX6A 1FNOA 2PE8A 3RTVA 3V6KA 4UW2A 1NK0A 2YKOA 1N5YA 2I9SA 3DMJA 3MFIA 3TARA 5EHHA 3FFIB 4PXDA 3MMAA 3DLEB 2QA4S 2K7KA 5F8GA 5HI7A 3C66A 2R7UA 4IYQA 5IFMA 1UCNA 2IM2A 1NO8A 1K73T 3BV8A 3CWJA 3W63A 4URGA 2EC0A 2GVDB 1VC5A 4LVOP 1U47A 2BR0A 2FLLA 2VFRA 2Y1LB 3Q8QB 1R43A 5A0YA 3GLJA 3D0HE 2CQBA 1DTTB 4C8YA 2EBGA 3M2UB 3LWLA 2MB0B 2OKQA 1NPPA 3CO0P 4OX9F 3S01A 3M6XA 5IQ6A 2R8HA 3PO4A 2BVZA 2RKIB 4Y2MA 4Z7CA 1XMBA 1J5EJ 1X4DA 1RAFB 2CQCA 3N6MA 3FQLA 2RRBA 2MKJA 4ATNA 1ACMB 1NKBA 3PACA 3OTOJ 5A2QY 3Q0AA 1GMWA 2B3TB 3MURP 1TUWA 3DDIA 3BSCA 2JLFA 3J7YU 1RACB 2GIQA 3KJQB 3M8PA 4DV5J 4PCQA 3PR5B 1CS4B 5L1IA 2W1BA 3VGTA 3ZO7A 3G82A 1UW4A 1JLBB 3LGMA 4UOHA 4C8NA 4Y00A 1B0VA 2L08A 2D3OR 1YWXA 3MEEB 3JSYA 3OHAA 4XIUA 2B7CB 4LSZB 5ETOA 2C2MB 2BJ8A 5SZTA 1IQZA 2ILZA 2NUUG 5DQGA 5K8NA 1FFSB 1J27A 2AJ4A 3TZWA 3DNCA 1HW9A 2V94A 4IDKB 3QJLA 4YQWA 3O1LA 2W4DA 3IXQA 2M52A 3DLHA 3C6TA 3LW5C 2AEFA 3R97A 2N7CA 2QLBB 2F4VF 4CT9A 1NKEA 3H2VE 2FIUA 1U0HA 2W2OP 4UOFA 2W7PA 2VFSA 4OZ2A 1U1LA 1VC0A 3CD7A 3RGIA 1QLNA 1T3OA 3UVJB 1CULB 2MKYA 3WBZA 2V4QA 1IVZA 2LLZA 5DO2A 3VAMA 5CCLA 1XK8A 3KLVA 4RU9A 4M5LA 3A8IA 1EX8A 3O44A 2ZJPQ 1VLOA 2HNYA 6FDRA 3TQ1A 4PQAA 3GYXB 4QOTA 1HNVB 4IFVB 2KT3A 4LSLB 1VQKS 4P52A 1XNQF 5CAAA 4EYIB 2RHSB 4KV8B 2HGLA 1JLEB 4ANEA 2BV3A 1OSDA 4TY8A 4F3MA 4KR0B 4QZVB 4USHA 1JNRB 5KFZA 1ZZNA 3SV4A 3I5BA 1FJ7A 2JLGA 4B3RF 1KEKA 3HD1A 2DGQA 1OPZA 5KFGA 1HQEB 3NKYA 4K59A 5F9LA 2B51A 2GHWA 2VQFF 2NSCA 1U26A 2YWEA 2MQNA 2HZCA 1MSWD 5KG3A 3IWNC 4ZP9A 2X1GA 4E0DA 3D0GE 2ZH8A 4KSEB 3QNWB 4EMDA 2R8IA 3ZZPA 1UVNA 4KKOA 5LSOA 2RD5C 1WF1A 1GTHA 1KD1T 4OJ3A 2PMWA 3H2LA 4ZPBA 1ZM2A 2V63A 3DLKB 5LSRA 5IT0A 1RCOB 2GMLA 1FRXA 2IAJB 3ZZOA 1FERA 4CO5A 1CJKA 3KHLA 2YNFA 3NGTA 1S1VB 2ALZA 3UDLA 2BJEA 1KR4A 2FGCA 3Q86A 4JV1A 1S0OA 4PQUB 2CPJA 2QLJB 2BQ3A 2UXBJ 3W2VA 4ZITA 1NPRA 5FLXU 4YR0A 1N0VC 1FTCA 2RE1A 4ED2A 4AL6A 4HT7A 1BGXT 4NLSA 3UCUP 1I5OB 5JMNA 1G3OA 2K3IA 3R1LA 2V0NA 4RWXA 3DI6A 3DC2A 2JRSA 4N56A 4MYUA 3CEDA 4DOZA 4RJVA 4DSEA 4GKKF 1WDDA 2KHDA 1TFYA 3MMBB 2XYGB 3DDKA 3WC0A 4MK8A 3HK2A 4ZJLA 2F8EX 4DR5F 1NK8A 5IWAF 1GX6A 3TUJC 3IR6B 4JI0J 2BUNA 1ZAWA 3QIDA 5D4PA 4V19X 2BKOA 2F9JA 2FDNA 1YLXA 1F9FA 1S77D 3OFEA 4DR4F 2ZHOA 4LRDA 4AT1B 1HNIB 5CQGA 2VFTA 4CYUA 4QU7A 3BYPA 3GV7B 4CRJA 2HQCA 3DRXA 4DV1J 1B0TA 1E6VA 4CH1A 1MWYA 5F8HA 3EE3A 1F2HA 3FBCA 1BD6A 1PILA 4X64F 2DH7A 1AFIA 5I3QA 2ZUAA 2AF6A 5C24A 4KJIA 4KGZB 1KLNA 2YNIA 2W9AA 5BR8F 1VRTB 1M1GA 2WRMA 1QSYA 2RJZA 1A7GE 1TL3A 2V8HA 3UNYA 4EYHB 3MPWA 2BACA 2OP5A 3HVTB 4I2QB 2IVMA 2XMTA 5IC4B 3SFUA 2VQEJ 2PI5A 5BJRA 1RHQB 2LXIA 1RDRA 4QIFA 4RW8B 4X65F 2HWIA 2P8IA 4OYMA 5B08A 1NNDA 1UJ6A 3X1LB 2ZH3A 4RW7B 2W7OA 1ICEB 3MEGA 2E5LJ 3DHWC 2RF2A 5CYJA 4I0WA 3HMJG 1RWPB 3AB2B 1SC4B 4CH0S 1Z2LA 5GMDA 1EP4A 4HH1A 2AJ0A 1M5OC 1U2RA 3RAXA 1F5AA 2YWFA 4JI8J 2FGOA 5A8RB 4I6WA 2V2QA 2XC9A 2DY9A 2F1FA 1QVGR 2J6TA 3BYRA 2J7UA 2V4JA 5K8OA 3H5YA 3H5UA 3VF0B 1VQ6S 3UN5A 2FHJA 5AE1A 2KG0A 4RO0A 2ZHBA 2CJYB 3EZUA 3POTB 5KFPA 3BKFA 4X4TA 3D3CJ 1N4LA 2CG8A 3NBPB 3AJ2A 5CYQB 2MQPA 5D0GA 2J0WA 1X31C 1N5YB 1S59A 3TAMA 3NRBA 1FFGB 2LU1A 1EIYB 3MMAB 2EK1A 2UZAA 1WTFA 1J5OA 3L7PA 2YY3A 2ZKTA 5B0AA 5H1SV 4JI3J 2OPQB 3LP0A 4BWMA 4MFBA 2XY6A 1KFSA 2DCLA 1IN0A 5DLFA 2HK2A 3CJ3A 1PC4A 2VBYA 1DQ9A 4M95A 2GQ2A 1FKOA 2HURA 2FJWA 3C16A 5A0YB 4EK2A 2VG7A 1QJHA 3G6YA 1C4AA 3IR7B 2N3LA 5F0UA 2AJQA 4F3QA 3FJ2A 3N0VA 4C9DA 3PX6A 1UZDA 3FRYA 2AMCB 4CNZA 4OI6A 4ICLA 5ETPA 2F4VJ 3N5FA 2MGZA 4K50A 1HPZA 5D8HB 3C46A 4NRUA 5KAKA 1WSVA 2DNOA 4B3OA 4R25A 3FSIA 1LXJA 2DH9A 2XBPA 2A18A 4K4ZA 2DBBA 4G6VB 2GFFA 4RUHA 4OYAA 4JI1F 2ZHAA 3M8PB 3IGNA 5KFFA 4MK9A 3FVYA 1RBLA 3G82B 4TLQA 4NYOA 4WU3A 4WE1A 2ZM6F 1XNRJ 5LJ5Y 1VBXA 2JEGA 4DV0F 2HBQB 5AXNA 3M8RA 2R42A 3MPVA 1NJYA 2J0QD 3GCXP 2VPWB 3I87A 1PO6A 1FE4A 4P75A 5FJ4A 2N82B 1VQ5S 4B3RJ 1V3ZA 4RNFA 4ZCLA 1VFJA 2DJWA 4USJC 2BOPA 3R5AA 4Y0FA 3D68A 4NA2A 5M2UA 4C4WA 3FSXA 2BW7A 2BQUA 2JFKA 1VBYA 1XR6A 4ZPTR 4IRDA 3MECA 1UFKA 1U0HB 3B78A 3J80Y 4UQTA 5E3PA 2A1BA 4OX8A 5KOXA 1TR0A 2OD4A 3H2UB 3K8WA 4JV5F 3BN7A 3WHIA 3I31A 3W60A 1OY9A 4DV4F 2JC1A 1KVKA 2XYPB 1YSJA 1X9SA 2KFZA 2IJRA 5E41A 4JI6J 1V6HA 2K2PA 1NZ8A 1RUSA 1NK9A 3A13A 1OQ6A 1N48A 1HARA 2VPXB 2OH2A 3OQ2A 4OX7A 4ERDA 5D4OA 4TY8B 3M4XA 5HMWA 3HFZB 4IKAA 2ILYA 3FBFA 4E98A 4NX9A 4R8UB 3P96A 5DDPC 4QWBA 4WPAA 3VQSA 3SSSA 4DUZJ 3OL9A 2HBYB 1JLFA 3QFWA 4JI2J 3FCVA 1UVKA 4X2BA 1PYOB 5IM0A 3OR2A 2LU2A 3EJMA 4PKDB 4DCPB 4DV6J 1AROP 4OZ1A 3FEZA 4K7QA 4V1Ak 2Z2LA 1NDCA 4ZVUB 1YDLA 4FYXB 4IQMA 3BQ1A 5IWAJ 4Z2XA 1URRA 3OTDA 4F3OA 2HHHF 3LP1B 4JI5F 2E7XA 2RIJA 4K4WA 4Q0BA 3LQVA 4PPDA 5I4MA 2MXYA 2JEIA 1CJKB 4QPTA 4U6PA 3GJSB 1SJRA 3OL7A 3FUYA 1WUUA 1VS3A 5AE3A 2KT5A 2FVRA 3LWMA 1SQGA 2HVIA 2V9WA 1RT6A 1JLQA 4J9SA 3W2VB 4MK7A 4QJVA 2QLWA 2MQ8A 2DIUA 2VICA 3CPWR 4DMZA 3MFHA 3DI6B 2HNZA 1N34F 3BGFA 2DNNA 4TQSA 2OPRA 2XS7A 4K0KF 1IUJA 2DNGA 2C3OA 1KDNA 3CUNA 2RHQB 4DHVA 2YX1A 6AT1B 2JWNA 1DQAA 2W4PA 4J9RA 4OZJA 4C97A 4AL5A 2DH8A 2ERRA 1JNZB 2O67A 4LIWA 1X0FA 4WKRA 3NY0A 2KJWA 1VHIA 2CRLA 1H3DA 4LSNA 4Q44A 1IR0A 4CYUB 2A3JA 2HFZA 4IOCQ 5K8PA 5F8JA 4IRKA 1YRTA 2IHR1 1HW8A 1R7IA 3NAHA 1GQEA 2OFGX 1HWLA 3EUNA 4WTYA 5K9FA 3ILIA 1E6VB 3GIIA 1DFDA 4DWIA 1SC1B 2VPYB 1JMTA 3HVWA 2UP1A 2MQLA 4U8VA 4EU0A 2G1DA 4JV2A 5HATA 5C24B 2XZDB 4PG8A 4OJ1A 2YNIB 2PT0A 5GAEI 1LOUA 2FLNA 2GVZA 2VKRA 3UR0A 3OD2A 1KSPA 4RWWA 3CCTA 1R6VA 1TL3B 4OYIA 5HLFA 1DARA 1H2UX 4MYTA 1BY9A 3M9OB 4U7UD 1M90T 4I67A 1I3OB 1X9MA 2B9WA 2MQMA 1S10A 3ISZA 1FFWB 1Z4UA 2XULA 3PFEA 2BEFA 1WHVA 4V19J 2IBKA 1NB2A 1IBCB 3G71S 2YKMA 1X4EA 4I56A 1H6KX 4X4RA 1JJ2R 3PJXA 1XJWB 2RF2B 4LFBJ 2RS2A 2CWXA 2I6WA 1FJGJ 4Y2AA 3QT7A 2QYCA 1EP4B 1HI0P 2Z58B 1X4BA 2FJAB 1RWUA 3ZTSA 2O5DA 1OYDA 3EMTA 1PG5B 4NASA 2J9DA 4DPTA 4BS2A 3QLHA 2DR5A 4ILRA 3EPGA 2VFVA 1TL4A 4HL9A 1MMLA 2HIQA 4RW6A 3HHLD 4U96A 3AOCA 1JB0C 3F73A 3PRVA 4OV1A 3I56S 5GADI 5A2QU 4KTQA 3MD1A 3DHXA 2XMVA 3QWUA 2B6AA 1FK9A 4C0HA 5B0EA 2JVRA 3TO8A 2BYCA 1RWMB 3IS9A 2IYIA 1RAAB 2Y1JA 5EX0A 3TA1A 3GMGA 5HMZA 2R2UA 3OTBA 1BWVA 4IH6A 1SKUB 1VK8A 3H90A 1KN6A 3QYYA 4G65A 3DRSA 2W01A 2XY7A 4TXSA 4YB5A 1SIZA 3JAMY 4YB1P 5KFMA 4UF4A 1OMSA 1J5OB 1GAOA 4ELVA 2NYIA 3KJNB 3LP0B 3EGWB 4MFBB 3HSGA 2IMWP 4OJHA 1Z1ZA 2BMBA 3G96A 3S8SA 1FWKA 2Y8WA 7FDRA 4KPYA 3EVWA 1N54B 4DV0J 2G2OA 4J37A 3K58A 3KG4A 3C16B 2F8MA 3DOKB 2VG7B 1S0VA 4MIWA 4TVAB 1NDLA 4I7FB 4OZ5A 1SQFA 3T41A 3FK4A 4ELTA 1SKWA 3WIUA 4ICLB 2B43A 2Y0BB 2R4FA 4DU8A 4PR6A 3R5CA 2MGZB 2I2YA 3KK1A 1Y5NB 1J2VA 1SJ1A 4HACA 1Q5YA 5IQQA 1H72C 3IN5A 5CHCB 1C0TA 4K4YA 5E3AA 2ZOMA 4NMLA 4F25A 1HI1A 4NZ0A 1ULRA 4R5PA 2K7JA 2NCKL 1BQNA 3D1OA 3K5LA 1VDHA 4C3KA 2AEMA 1WHXA 4WFBQ 1FD8A 1JK9B 4R0EA 3QJPA 4F4ZA 3DFEA 3TR5A 3PYDA 1T9XA 1FTRA 3DGPA 4MH8A 4A8WA 3H42A 4WE1B 2A2CA 4TNOA 2XMJA 3QZ8A 4WJBA 3BO3A 4CLZA 4M5MA 2C22A 1KS2A 5FDLA 2PGCA 3SDEA 1SL1A 5HAOA 2D7SA 3DYAA 5KT2A 3CJ8A 3Q8PB 5L9NA 1R0BG 4B9SA 1C0UA 3CCRS 2RB7A 3KLIA 1DBDA 2J7WA 3UDEA 1HQ2A 3C15A 2EKYA 2ZBCA 4DR6J 2Y0SD 2JVOA 3HF5A 4LQ3A 4PXBA 1U4BA 3OVSA 3NP5A 4QQBA 4X62F 3MECB 2IA6A 2GS8A 1VQNS 4NLTA 3TQEA 3UO0A 5T14A 4DUYF 1B70B 5KG4A 4ED3A 2YX7A 4A8MP 2CPYA 4QYZJ 2CG4A 5J2NA 2HBRB 3BQ0A 3TWZA 5KFOA 2RNEA 5LMNJ 1N56A 1TL1B 3UNGC 2KFNA 2HHHJ 3NAIA 1U1MA 5HK4A 4FYYB 1T0TV 2DO4A 1HA1A 4WYLA 4PRFA 2ZNZA 2LQ9A 1NJZA 1CVJA 3I5CA 2VDIA 3K2YA 4CLFA 2LXFA 1FDBA 3TUZC 1TZ0A 1WG4A 2R8KA 3CJKB 4FVMA 4TKTA 2XYHB 3IRXB 2D9OA 4O3PA 4IR1A 2QEXS 1KTQA 5THWA 2XZWA 3EZOA 1UFLA 4HI2A 4ZA1A 1JLFB 2EEYA 1IBKJ 3E01B 1NPKA 1JKHA 1LKZA 2ZH7A 5IM0B 3OR2B 1SXLA 2B4VA 2H9ZA 2CQ0A 2MJNA 2WSFC 1N34J 3H8YA 4NLVA 2BM1A 2FD2A 3LGNA 3N6NA 4ECSA 1AZSB 1UFWA 1TELA 4QR0A 2PSZA 2XZTB 3PKMA 5K20B 2H48B 2DHXA 3T1YJ 4LJMA 1RT1A 2IBOA 1XTZA 5F41A 1ZZFA 1TKDA 5I42A 4Q0BB 1RU1A 2FJVA 5JJBA 2E44A 4BC9A 3GR0A 2ZZTA 1FVQA 3VAKA 1H73A 2VL1A 2ZOGA 2MZSA 4JYAF 3HVRA 4F0KA 2VOOA 1ZM9A 1RT6B 1JLQB 3RBZA 4ER8A 4EBCA 2XLJA 1U1RA 3LP2A 1DLOA 4QIVA 1WNEA 2YXLA 4F2RA 4B9VA 1P27B 2HNZB 3JQKA 2DHAA 3UCGA 2HS3A 2XGQA 3QT8A 4QWAA 2RVJA 5DG7A 1N5QA 1RWOB 4ZJQA 2OPRB 3HLUA 2UXDJ 1AYEA 3UFCX 4A8YA 1T3NA 3ENVA 5BYRA 4A8FA 3CJ2A 1LFPA 4J9QA 2P6SA 2VF3A 3GZ7A 1R8BA 4X66F 3CCMS 1S72S 1CJUA 1FWLA 1QSLA 1XMOF 1RKIA 3VTIA 2OAUA 4LSNB 1QE1A 3EDQB 3HHLC 4GVBB 1WOPA 3W2WA 2LMIA 3G6ES 4URSA 3AD8C 3H25A 1OY6A 4DPUA 2UUCF 2X51A 3TVKA 4F4XA 5LSLA 2J0SD 4LFAF 3HHLA 1N6QA 1UEKA 1X4CA 4ECZA 1C1BA 4BBYA 2VFUA 5LXRA 3QATA 3NEKA 1X4FA 4CM0A 5GMEA 2E1PA 2ACYA 4P6QA 1D9DA 3OSNA 4MIBA 1D8YA 2GV1A 3KG0A 3QIPA 2XMAA 3TANA 4Y28C 4RZRA 5KFYA 1JLAA 3VGUA 2UVRA 5HLFB 2RAQA 3WIVA 2UU9J 2FZKB 2RQMA 3EXYA 1Q7YT 2IM1A 3G2XA 1F1BB 4B08A 4RBTA 5F0WA 2QL7B 4A47A 1S97A 2E5GA 1NJXA 2WZ1A 5KT6A 1H0HB 5KG1A 4KGVB 1S9EA 2LYVA 2IC3A 3L3CA 4CLPA 3QGHA 3M9MB 2YKMB 2LA4A 1BQMB 4OLOA 2NXEA 3HHEA 4I2PB 4ZP8A 1EB0A 3GV5B 1T9TA 1K1SA 3B6BA 5DRKA 1RTDA 4OIXA 2JC0A 5D15A 1XMQJ 3GYGA 4I69A 1GX5A 2VBXA 1WDTA 3RG6A 1Q81T 2DGWA 3QSIA 2K1RA 1H2VZ 3G6VA 3T1HJ 2GW8A 2ATLA 4X4UA 3QLHB 3N5BA 2MTLA 3K17A 2HHWA 4B9NA 1N52B 2QMWA 1Q8KA 1S6QA 4ZS6A 3M9NB 4CLKA 5SUHA 3ZTQA 3R6LB 4RW6B 2V4RA 1MROA 1IR2A 4OYBA 2UXCF 3G8QA 4YHHJ 2WONA 4X84A 2B6AB 5C7PA 3ZFVA 4TY9A 1CJTA 2YNHA 4N8OA 1SH2A 1RAGB 3IS9B 1VQSA 2M0GB 2DNMA 4DCJB 3G4SS 5CXTA 3R8YA 1W7WA 1VCTA 3BGLA 1L5UA 1VIOA 2ZBQA 5H9EK 2DR8A 2GJFA 4ZVFA 4USWA 4N5SA 1C1CB 2HFUA 3CULA 2IYGA 2P9EA 4DR3F 1RHMB 4OYWA 1Q1KA 1F0XA 4NL5A 2HAIA 4WCEQ 4AYBD 2YVSA 1NEEA 3B4MA 4M5KA 3RJMB 2CQDA 3FMBA 4QWDA 1HNXF 1FNMA 3VVUA 3MTKA 2MZTA 3SSRA 3KYLA 1S1WA 2E9ZA 2N7YA 3J80U 3X3UA 3NG8A 4EBDA 1ZBTA 3EPIA 3F41A 4DJBA 2GO8A 4YN3B 2C2OB 2RH3A 1RKJA 3KLGB 4I4BA 1SUQA 2FLOA 2R9LA 1U1PA 3QQCD 3KK1B 4NRTA 2VOPA 2MZRA 1FXRA 1Y00A 4HACB 4AL7A 1TL7A 1ZS6A 1JIHA 4B3MJ 4LF4J 2HW3A 4ED1A 2MZ1A 2FHKA 4FZVA 4R5PB 4UTGA 2KRRA 1LWCA 3PYGA 1MNEA 5CYMA 3T9ZA 1YJUA 4YDDB 1UVMA 2ZKUA 1RHKB 1XN9A 2PIIA 1NB7A 2LDYA 3DGPB 5J1EA 3MR7A 1TMMA 1RQ0A 3M32A 2MYFA 1TVRA 2DR9A 3DDNA 3GPAA 3R2CJ 2V2KA 4N7TA 1VC6A 3HHKA 5FDLB 3SDEB 2D3UA 3ENWA 2AU0A 1KNZA 3DYAB 2J6SA 4KIAA 4ZPDA 3M8SA 4ZPCA 1C0UB 2I0XA 3MUVP 4WP8A 1XERA 4QIEA 4RL1A 3KLIB 3MM8A 3MM6A 3AD9C 4C11A 5EN1A 3M8QA 4A8OA 3JSRA 3C15B 2FVCA 1K0VA 4FF2A 4OZLA 3VAIA 2MLZA 1LXNA 4HLBA 3LOUA 3SEOA 1DAXA 3JB9k 1UPPA 2C42A 3QFHA 2R2TA 3PCOB 3HVAA 2V34A 5J2NB 3OJSA 3R7NB 5EWGA 2ZWOA 3ISND 2KJVA 5C2CA 5MLCV 4MJKA 4ZJOA 1ZM3A 3B8HA 4TU8A 1X0PA 2PMZD 2RS8A 1DY3A 3LUYA 4LBPA 1KQKA 2J76E 1MN7A 1SKRA 3GILA 3BQ2A 2C3UA 4DQSA 4DL6A 4NLXA 4J5OA 2M7SA 1DZ5A 2ZNYA 4OYPA 3JSMA 1NHUA 3MEDA 3MR3A 4C8KA 1YJVA 2YX4A 2RQ4A 4FBTA 4P2MA 3SFGA 1B0PA 1LNQA 3HFKA 4DL4A 5KG7A 4GVLA 4DSJA 5JXSA 2B4UA 2XY5A 4OHZA 1J5EF 1YJTA 4FN5A 5C2GA 4MMOA 3W62A 2F8HA 3MM5A 2WK4A 3AHPA 4FXDA 4W4MA 2B56A 2F5GA 2BKPA 2KFYA 3W7BA 2EG2A 2YWKA 1PJ7A 2B9XA 2DK2A 2G9OA 5EGYA 4DV7J 5F8MA 5ETTA 4H4MA 1RT1B 2J9EA 4ZVEA 4CLSA 2CPEA 3QMQA 5AT1B 4DV5F 5I42B 2BOAA 4OZ3A 4KGXB 1Q78A 3RRKA 5F3TA 1WG1A 4URQU 4DN0A 4UY8T 3ET6A 1Z2ZA 3FCWA 2ZE2A 3P8BB 1BLUA 2ZBRA 3SQGB 3B82A 3DXBA 4MKYA 1SV5B 5HMXA 1IKYA 3CJTA 5F8NA 2VASA 2BRLA 3JQJA 1HKAA 2RSQA 4XK8C 2YTCA 3GYNA 3MAAA 2YKAA 4CTAB 3LP2B 4LFCJ 1DLOB 4TQRA 1Y5LB 1WI8A 3K5OA 4YOEA 2G13A 1Q8IA 2Q79A 2VG5B 5KFTA 3P45B 1TK5A 5LMUJ 2ZZMA 4J9KA 5CD4A 4FDFA 2EFNA 3UDVA 2CVIA 3IO1A 2BJ9A 3M8YA 2H1YA 1WC1A 3PW4A 5D4NA 2MKCA 2LQBA 3ZZZA 4IFYA 3KHHA 3ZTOA 2XO7A 4GMKA 1RI7A 2CZ9A 4K4UA 1K8AT 3EWGA 1CJUB 3MEKA 4KRWA 5A6PA 2AP6A 3U7JA 2I38A 4QCLA 2CJQA 2R7SA 5DLGA 4QIWD 3W2WB 4MKAA 4ZVQB 2VDHA 1RP5A 1YBUA 2GGPA 5DETA 4ED4A 3CMAS 1O6XA 3D54A 1OWXA 1N6QB 4ZN3A 1C1BB 4OHVA 3H4DA 3TI0A 3M6VA 1I94J 5JVHQ 2KH9A 1GH8A 1WC0A 4PWWA 2APOA 2V67A 1S0MA 3CCQS 2V9KA 3T1AA 3HJFA 1N8RT 3QIPB 2NREA 4JI4J 3V6HA 4Q43A 1T95A 1R8AA 4Y6IA 4CDIA 4B02A 2FY1A 2F65A 4JUZA 1JLAB 3JAMU 2VH7A 4CLWA 4ZIVA 2W2PP 5C5JA 2ZWPA 1IXKA 4YR3A 1WG5A 3E51A 1NBEB 5E33A 4CO2A 2MKSA 3GG1A 2HHXA 1ZAVA 1GXTA 2HGMA 4LR7A 4TU7A 1AA1B 3R5DA 2JFDA 3K57A 3UD4P 4LF1A 4ZLLA 1VQ7S 1UVIA 3RW7A 1S9EB 2IC3B 3GIMA 5IT9Y 1SL2A 5A8WA 1PSDA 2DPIA 3BH7B 2OSQA 2QFJA 2QO3A 1WF2A 1RTDB 5HO4A 3CO9A 1FE0A 2OPPA 1CG2A 2UXBF 2ZJQQ 4IO1A 2WB4A 1HWUA 2EI5A 4ZMMA 2QMXA 4UOGA 3SBMA 2AZ3A 2FJBB 2K1RB 4DS5A 4WU2A 2EFPA 3D0IE 2W24A 1S6QB 5K5MA 4I6AA 4DLGA 4DV3J 4KBIA 2VU5A 1MROB 2CJAA 4YMEA 2GMHA 1HQUA 2W9BA 2WONB 2D74B 2B5JA 2XMUA 3HPOA 3FDSA 5CD4H 2FHMA 1ZM4A 2XNQA 4G1QB 2YNHB 4MKBA 1LW2A 3U1LA 4C0OC 4JI0F 4DG1A 1RWKB 4XTTA 2G2ZA 2H54B 1UW9A 4DDFA 4UUWA 3IMQJ 3A3OB 4AQYJ 3CD0A 3IR5B 1QVFR 4FNHA 1PBUA 1FI4A 2QSFA 2GJIA 1W25A 3HZEA 2DNZA 5DM6Q 3R27A 3W65A 4Y3CA 5KFIA 3W3SA 3W5XA 5BYQA 3C6UA 4IH7A 2BANA 3CMES 2DR6A 5DG8A 1VBZA 4DV1F 3BS9A 2KYXA 3BF4A 3GU0A 4ECQA 3D67A 2KI2A 3L9ZA 4WK3A 3RAQA 4PXCA 1I1GA 3THTA 2XS2A 5EDWA 3T6JA 4YY3J 2HVZA 1HNWF 1IBMJ 2G0CA 2E66A 2DGXA 3ISNC 1Y3JA 3UPFA 4KFBA 5IOLA 1QUVA 4OYOA 1REVA 4ZP7A 1OQ3A 1O8BA 5D4LA 1RLCL 3V5RA 2VQEF 1KQSR 1SUQB 4NPOA 3RB3A 1FRKA 3RRHA 3MGJA 4DEZA 1EAYC 1FD2A 4ECWA 3L7OA 1S49A 2CNLB 4YS2A 2E5LF 4DBQA 3ETOA 2DISA 1WEYA 2AJFE 1K0TA 4YUDA 3MPYA 4CO1A 1RU2A 5KFBA 3QSYB 5I3UA 4JBCA 3CCLS 2KM8B 1G2EA 2CJBA 3I0RA 1NHVA 4JI8F 2CKWA 3OFGA 1NHKL 3M32B 1TVRB 1JXLA 3IC1A 5GADU 2KZZA 3GQCA 3NCRA 4OFZA 1GEHA 3LH2S 3KMSA 4TU9A 3SXLA 3OXGA 4H54A 3RB6A 1VRQC 4PG4A 4WFNQ 2LA6A 3AH6A 4IH5A 3OBIA 3MM8B 3MM6B 2XGPA 2Z2MA 4C11B 3C2PA 1U6BA 2XWYA 3FRZA 3M8QB 3BGRA 3KOAA 1HL6A 3OLAA 1ZOTA 3TP2A 3RB4A 1MMNA 2Q6CA 1B64A 1M5KC 2IDEA 3RRGA 1KBRA 2ZH9A 2G0JA 2HK3A 5ETMA 1F2GA 8ATCB 1Q53A 1N33J 4GKJJ 3QJJA 2IRXA 1JXEA 2CVEA 5C25A 2C3YA 3LTOA 1FRJA 2GIFA 2VA3A 2YWWA 4DFPA 1YIJS 2KHCA 5ETQA 2ACMA 1RT4A 4DL3A 3GTYX 4JI3F 3ILOA 3T5JA 4DQPA 5T7LA 1T9VA 2VC0A 1VQ4S 1PIEA 3QT5A 1WWHA 4X4SA 1PYSB 2OEMA 3MEDB 4X4QA 1SH0A 4M8LA 4DPOA 2A10A 4RUAA 3BPDA 2FZGB 1S4EA 3CJ0A 3GJQB 1WKLA 2D41A 4FKYA 4IR9A 3ULHA 1U6FA 2NXJA 2HS4A 3KG1A 4W98A 1DJ0A 1SPBP 1HNZJ 3G87A 1IR1A 1A0OB 3MM5B 4ECUA 3OPKA 2MZJA 2XEXA 3LAKA 9RUBA 3TZYA 5I3PA 1T94A 3SCIE 2HS0A 3N28A 4ZHRA 1W2BR 4QR1A 3OLBA 5HVFA 3DGVA 3MR2A 4P10A 4H4MB 4WF9Q 5D77A 2P9GA 3E3XA 3GB0A 2AKWB 3BDEA 2CZ4A 1FKPB 1EJ7L 4U67Q 2KT2A 3EYZA 2XSJA 1E6YA 3ZNJ1 3ET6B 5CZVA 1XNRF 5GAHI 2GO9A 4LBIA 3W5ZA 2ZE2B 3UI3A 4ED5A 1YITS 4WBFA 2F63A 5G0RA 3M2VA 1IKYB 3BBBA 1RCXB 1LEOA 1ZPVA 3QZ7A 3MAAB 3DOLA 5A6WA 4RUBA 3SCJE 3FBEA 3PJWA 3M2RA 1ZPWX 2XHWA 1D8ZA 4USVA 1YJ9S 1OIAA 4DR2J 1URNA 1Q5VA 5D3GA 1K47A 4XDCA 4HI1A 5B09A 1GXUA 4HTIA 2W25A 3B4DA 4U9RA 2YKNA 5K14A 4Y65A 4X4NA 1DHMA 3MF5A 1WELA 2W8KA 4YP3A 3OL6A 4IFYB 2HRUA 3I9ZA 3L7UA 3CSKA 1IKVA 4JI6F 3QT6A 4M5NA 2DVIA 4QR2A 3NGSA 2HQDA 1T8EA 4EZ9A 2UUAJ 1S1UA 4D3GA 3SQOP 3R6GB 5B0CA 4HT5A 4LMZA 2R7VA 1TL5A 4ETXA 5ADZA 1RT5A 2GGPB 4DUZF 2MMYA 4H4OA 4LR8A 4JI2F 2VONA 3WQPA 4NA3A 1EQ0A 5CABA 3I4PA 3HP6A 4IQXA 5HSPA 3CC7S 2ZOFA 4ID5B 4IG3B 4O23A 1Y11A 3MWBA 1RISA 4DV6F 3Q23A 1IM4A 2VD3A 1JX4A 3T19A 1CC7A 1SKSA 3GIKA 1W2IA 1L3VA 2KN4A 5ITHA 1R8PA 2XS5A 2G0IA 3QAEA 1VMBA 2CQHA 2EFVA 2E1MC 4NWBA 1FRMA 3CGIA 5A8WB 3KMQA 2Y1IA 1G1XA 1EKSA 1YBTA 5HQMA 8RUCA 4FF1A 1S7HA 3J81U 1DQ8A 1V3RA 1RA7A 4NOHA 2MSSA 2E5HA 1S0NA 2OPPB 3HI9A 4Q8EA 1NLKL 1ZAXA 1Q79A 3QO9A 2M70A 3OR1A 2DEJA 3NOCA 3OW2R 3TUPA 1U0SA 5IV3A 1P9YA 3R5GA 3CDAA 2AV5A 3H40A 2R7QA 4C98A 4MAKA 2C1EB 2WTFA 1HNWJ 4O0NA 1HQUB 2W9BB 4L73A 5KFXA 4ECTA 2VG6A 2VA2A 2B5JB 3VAJA 3LO3A 1HD1A 3M05A 1T11A 1M1HA 2YKQA 1S6PA 5C42B 2Z56B 3PW2A 2VV5A 1LW2B 2BBEA 2BZ2A 4B17A 3WX8A 3NWGA 1M5HA 2V6AA 3ZZ0A 1RA6A 1N0UA 2QYGA 3WX4A 3CE8A 3SMZA 5CA5A 1YI2S 4C6AA 4K5RA 1R3NA 3T5HA 3ILLA 1H74A 2XM3A 3J7A1 1CQNA 2FJXA 5F9NA 5CH7B 1P1LA 1RADB 1SJ4P 4F4AA 3UDCA 4FXWA 4IDKA 3O6QA 4LR9A 4P71A 3A3NB 5BYSA 5DQHA 1YZ6A 3CTRA 2R7RA 2RQKA 1GFWB 3UE2A 3K0JA 2A0FB 2M3DA 2LP4A 4WK1A 4DN9A 3RU0A 5DJBA 5IV4A 2KZMA 2HRTA 4WIQA 3MMJA 1U2CA 4LF7J 2P9CA 3A3PB 3QRQA 5HQLA 4KFBB 2ROEA 4DLEA 3ICLA 3GIJA 4B9TA 3JTNA 1L3TA 5E5NA 2D1CA 4WYWA 1REVB 4WFXA 2JNJA 4A8QA 4AFFA 2XLIA 3IAS9 1NDPA 1KHWA 3K5NA 4A8KA 1RHRB 4J9OA 2CQ2A 2QRRA 1TV6A 1YTYA 1IM6A 1HNVA 4Q8FA 2HHVA 4LF8J 1VRUA 4KH0B 5DGBA 3DMJB 2E9RX 3CC2S 4LFBF 1JLEA 2HNDA 2CNNB 1VQOS 1IKWA 1YG0A 1FJGF 3GCWP 4HHHA 4ELUA 3PEJA 5I3UB 2IM0A 3HX9A 3LALA 1P6TA 1LWFA 3W8PA 5G4DA 4ANCA 3S7RA 3NMRA 3I0RB 3GONA 1JLGA 1A6LA 4ALZA 2KXHA 4P2FA 2UUBJ 4JI7J 3NGRA 4WFYA 2YH1A 3SCLE 1T02A 1VQ9S 2FZCB 3PG9A 3CCWA 3W66A 4LIRA 3VQTA 3T3FA 4ZVPB 2HZVA 2OTLS 1U45A 3SIPB 3CXCR 3GSDA 1D1UA 2OD6A 2QGFB 3BGRB 4OX6A 1RBAA 2YKPA 2P6TA 1RAJA 4KY3A 3NMAA 2DB1A 1HFEL 2IAJA 4EBEA 4NZ7A 4CO4A 4XPEA 5C25B 2RRNA 1FDAA 2JEJA 3A8EA 5AJ3J 2YNGA 1S6OA 1RT4B 4CZCA 3QGIA 1N5VA 2PEBA 1UJ4A 3R2DJ 2B8PA 1PAUB 2AQ4A 1LFWA 1KVIA 4DX8H 4RW4A 1BXNA 3PHTA 4NLDA 3JS9A 3ADAC 4CIOA 2BKNA 3Q2TC 2CPDA 2HFNA 3D7SB 4YB7A 2L48A 3CNQP 1UPMB 1S57A 4M63A 5KG2A 2V8PA 3UQSA 1UJ5A 3C6TB 4DSKA 2ZD1A 4FF3A 3NCPA 1RAEB 2B9YA 4F0HA 5H9FJ 1UP1A 1T03A 1HWJA 3IBCB 1ZTTA 2DRBA 3DXSX 2DITA 4FYVB 3QBCA 2KYZA 2PMHA 2WB1D 2PFFB 2OSRA 2CQ4A 5T41A 1Q82T 4DS4A 5BXIA 2MHEA 3MI7X 1KOOA 2HNYB 1QTNB 1VYAA 3G8SA 3PRBA 3N9UC 7FD1A 4PYDA 1UA0A 2WCXA 4UT4A 4BC7A 3D6HB 1NMEB 2EG1A 4L76A 2XSJB 1E6YB 4NI2A 5ETRA 3NLCA 1X9WA 1P9QC 4NE9C 2RUGA 2WAQD 4OYZA 5G0RB 3M2VB 2BE2A 4W92B 3KLEA 3I6PA 1NK5A 5DDRC 3OTEA 3PX0A 3P4UB 3V2UC 3HHDA 4N8NA 3RR7A 3BBFA 3BO2A 1WHYA 3M2RB 1SC6A 4Y2IA 1HBOA 4DR6F 4K4VA 1O51A 4BLGA 4BHQA 3P6YC 2BM0A 4ILMA 5D3GB 4L6V3 2K06A 4ECXA 1DTQA 1PJ5A 1C4CA 4GO7X 2XMKA 4AUKA 1FXDA 2YKNB 2I5JA 3GR1A 2JDJA 4RW9A 5K14B 2OI2A 2Q3PA 4YDXA 5LMNF 4KKOB 3DLBA 4DFJA 3BR8A 3KNGA 2GAGC 1IKVB 4RNHA 2DGVA 2HQGA 4C8MA 4DX6A 1RT2A 1S6UA 5A8RA 4DL2A 4OI2A 2KXFA 4ANDA 3C3LA 1S1UB 2YNFB 3TA2A 4FYWB 4YEAA 3BH6B 2LFVA 4O0IA 2QFIA 1IJFB 3NWRA 2GAHC 3FZBA 3BGOP 3MMCA 1RT5B 1HBUA 5JVGQ 3IM9A 3MM7A 2RMLA 1IBKF 3D6TB 3H4BA 2DT9A 4Q45A 1WKKA 2ZVSA 1XR5A 3GWCA 4OI4A 2QT7A 5DZ6A 3JTOA 3SYZA 1YRUA 3DU6A 1H2TZ 2A2DA 1YVFA 1NRKA 1TAQA 1EHWA 5GAGI 1N36J 1N88A 3GFHA 5CYQA 4Q7AA 5IXUA 4KHPJ 4OL8A 3O8WA 2XCPA 1XQIA 1CEZA 1WEZA 4CM2A 2FHOB 1TMJA 2OJ3A 4C3MA 1YKWA 3AT1B 4NXMJ 1SQEA 3T1YF 2RILA 2LQ5A 3Q83A 2IM3A 3C14A 2V69A 3BREA 2M5YA 1RJJA 1IKXA 2Q66A 4DQRA 2OPQA 4NLUA 1F9HA 3R5BA 1GNKA 2OFHX 2DNQA 2H4WB 2HYIB 5KG5A 2JOQA 2CPFA 3MUTP 2HG4A 2X7IA 3QO9B 3OR1B 1QDUB 3Q8SB 2FUG9 3W64A 3RR8A 1RWWB 1TK0A 4FF4A 3OXLA 2RDDA 5B7WA 4ZLNA 2H5JB 1VLYA 4DU7A 2FHJD 3OFHA 1QAJA 1HD0A 2XI2A 4PWDA 2VG6B 3IP0A 2UXDF 1RTHA 1S6PB 3VAHA 1RAHB 2GHPA 3PW7A 2O1PA 1NCLA 2XO6A 2CQ3A 1UL3A 1U02A 1EZZB 3KLHA 3KK2A 2GNKA 2HQFA 2QZ8A 2J6UA 4PWUA 1NSAA 2AX1A 3TJ8A 3MEGB 2PEHA 1FRHA 3AA9A 3BSAA 4M5DA 1BMQB 1U09A 3TZZA 2EKNA 1FWPA 3QRRA 2GQQA 1TK8A 2G4BA 1ITPA 3HD2A 3AXKA 3ITHA 2MZQA 2BJ7A 4P7VA 5LXYA 3PYEA 3HM9A 3RBEA 1UEUA 1UA1A 1TKTA 3KFWX 3TW0A 2JZ5A 2V4JB 2XMWA 3KTQA 1S7IA 4DF8A 1O5JA 2CDRB 2B4PA 2PA8D 2OGUA 1U1NA 2AT1B 1WTBA 3H59A 2W7AA 2FYXA 3PX4A 2UU9F 1HIYA 3OHBA 5J2PA 4RNOA 3MAHA 3M6UA 3FZ2A 2AYGA 3VAFA 1S9FA 1RHUB 3PYFA 1RGVA 1TV6B 2C2EA 1Q7LB 3FQKA 1X5PA 1UTAA 1H98A 2WBMA 1VRUB 3GSIA 3TAMB 3EGNA 2OUGA 2WVDA 1RBOB 2HNDB 4OHWA 4TN2A 1IKWB 4DQQA 4FXVA 4ZVTB 1HHTP 3NL0A 5A76A 1VI7A 3ZZRA 4R8UA 1LWFB 4USMA 5B0FA 1RT3A 3LPEA 1XMQF 4ZPAA 2ROGA 1JJ4A 3MPUB 1FXLA 5J2MA 1JLGB 1TKZA 2QIFA 2AGPA 2CFXA 2J8SA 5M2PA 3T1HF 3HT3A 2LQJA
chains in the Genus database with same CATH topology
3DLLQ 1V3ZA 4RNFA 1N6QB 4ZCLA 1VFJA 3HKWA 2DJWA 1C1BB 4USJC 4OHVA 3H4DA 5IT4A 1FKOB 2CQIA 3TI0A 2BOPA 3R5AA 3M6VA 5JVHQ 2KH9A 3V4MA 1GH8A 2APOA 3KKFA 4B9MA 2RDJA 3MOZA 3G86A 1S0MA 4Y0FA 2HPUA 3CCQS 2V9KA 3T1AA 3HJFA 1AW0A 3NGKA 4NA2A 4ZK7M 5M2UA 4YHHF 5CCMA 4DFMA 1N8RT 3QIPB 4A8SA 4C4WA 1HBNA 2AYEA 2U2FA 3FSXA 2NREA 3V6HA 1APSA 2AGQA 1HI8A 5FLXY 4Q43A 2VUGA 2BQUA 2JFKA 1T95A 1R8AA 1VBYA 1XR6A 3FEXB 4G1QA 4Y6IA 4ZPTR 4IRDA 4B02A 2FY1A 1HMVA 1NZAA 3MECA 4JUZA 2L9NA 1JLAB 1VJWA 3B78A 3J80Y 4UQTA 3US5A 2VH7A 5E3PA 2A1BA 4DL7A 4OX8A 1KONA 5KTQA 4LF6F 2ZH6A 5C5JA 4EZ6A 5E2QA 5KOXA 2JHEA 3PRDA 2QLXA 3IFEA 1IXKA 1HPZB 1Q4RA 1X4AA 1WG5A 4ITSA 1TR0A 2OD4A 3E51A 4YR3A 3H2UB 3K8WA 3PEHA 4JV5F 5E33A 4I1TA 4KGMA 3BN7A 4CO2A 5L8RC 5M2RA 4WFAQ 2MKSA 3GG1A 3LP1A 3N6LA 4F67A 2HHXA 5E0OA 4N47A 1ZAVA 2Z8QA 1GXTA 2HGMA 4HTJA 4TU7A 3I31A 3R5DA 2JFDA 2ZC4A 4DV4F 4HH0A 1JLCB 2JC1A 3K57A 4B3OB 4IRCA 3NS5A 3UD4P 4M94A 1UVIA 1VQ7S 3RW7A 1CLFA 1S9EB 2IC3B 1FJCA 1YSJA 2BQRA 3GIMA 3JSBA 5IT9Y 3MOJB 1SL2A 3AA8A 5A8WA 1PSDA 1X9SA 2DPIA 2KFZA 4KB7A 5E41A 1V6HA 4IO9Q 4F4YA 4OJGA 2K2PA 3BDPA 3I9V9 2R7OA 2OSQA 4NCGA 1AXQA 2QFJA 4L3NA 1NK9A 4P2SA 1OQ6A 2XLKA 5HP1B 1N48A 1HARA 2QO3A 4NYZA 2VPXB 4ZKAA 1P8GA 1WF2A 2YNGB 4ZLPA 2OH2A 3OQ2A 5HN0A 4OX7A 1S9GA 5D4OA 1RTDB 4ERDA 4TY8B 3M4XA 2EWHA 2CIMA 1RYRA 4AUKA 1CC8A 5HMWA 3CO9A 5HO4A 1FE0A 2OPPA 4IKAA 2ILYA 4QWEA 4E98A 4O3OA 4NX9A 1CG2A 2UXBF 4R8UB 1OPIA 3P96A 5F8IA 4IO1A 2WB4A 2ZJQQ 1VIXA 4RW4B 1HWUA 2EI5A 4ZMMA 5DDPC 2QMXA 3CVKA 3CCUS 4QWBA 5DM7Q 3VQSA 3FEYB 3SSSA 3J81Y 2R2SA 3OL9A 4AE5A 2FJBB 3PY8A 1JLFA 2K1RB 4OLPA 3IWXA 4DS5A 4B9UA 4WU2A 1SBRA 2EFPA 4CH7A 1NK4A 3D0IE 1UVKA 4X2BA 2W24A 2R8GA 2CZVC 1S6QB 1WEXA 1SB6A 2XI3A 3IG1A 5IM0A 2BA9A 3OR2A 5K5MA 4I6AA 2LU2A 4PKDB 3ZZYA 2WOMA 4MIAA 3DCAA 5L38A 1MW7A 4DLGA 4KBIA 4EWTA 2E9TA 1MROB 2CJAA 4YMEA 2VKZG 4JV0A 2GMHA 4HKQA 1HQUA 4A46A 4A8XA 2W9BA 1L3KA 2WONB 3H5SA 3BR9A 4FS1A 2D74B 5AXKA 2CQPA 2HHSA 3TOQA 2ZD1B 2B5JA 2FTRA 4QYRA 2XMUA 3HPOA 3FDSA 4B3SF 1AROP 2QSWA 5CD4H 2FHMA 4OZ1A 1ZM4A 2J9CA 2NPIA 2XNQA 3FEZA 4G1QB 3T5LA 2HHTA 2YNHB 4D3HA 4MKBA 4R0JA 2Z2LA 1T03B 1LW2A 3U1LA 4C0OC 5L39A 4QWCA 4JI0F 1Y9OA 4DG1A 4IQMA 2KM8C 4B3MF 4DDFA 3BQ1A 4UUWA 4Z2XA 1OSCA 2K3KA 2QA2A 1URRA 3I5AA 4LF4F 3OTDA 4F3OA 5FD1A 3V6DB 2B4OA 3CD0A 3IR5B 3FFIA 1QVFR 4FNHA 2HHHF 3LP1B 1UETA 2E1AA 3DLEA 2E7XA 2RIJA 3NGDA 4JI5F 2FVSA 2BRKA 4KHMA 4K4WA 2QSFA 1R0AB 2Q1LA 3DOMA 3LQVA 4Q0BA 2GJIA 1W25A 3HZEA 4PPDA 2B7BB 5I4MA 2NS1B 2GMJA 3O5TB 2DNZA 5E3QA 2KG1A 5DM6Q 2VPZB 3R27A 2MXYA 4Y3CA 5KFIA 2JEIA 2L3MA 3W3SA 4QPTA 3BN4A 3D28A 3PO5A 4U6PA 3CIMA 2GCFA 4AXJA 4CO3A 1SJRA 3OL7A 5J2QA 2F9DA 3HXMA 2XWXA 1QY7A 4EUVA 5BYQA 1PC5A 1VS3A 5AE3A 2KT5A 3C6UA 4NLYA 2FVRA 2E7WA 4IH7A 2KU7A 3OFFA 2BANA 2CPHA 2KDOA 3EZ5A 3CMES 4ZCMA 3LWMA 1DRZA 5DG8A 2HVIA 1VBZA 1GTEA 4DV1F 2V9WA 2VBWA 1RT6A 1U7LA 1DURA 1JLQA 4J9SA 3BS9A 5MAOA 1QAIA 3IGVA 2KYXA 3W2VB 3BF4A 4E8UA 4MK7A 2EBEA 1YRXA 4QJVA 2M8HA 3I55S 3I4HX 2BE2B 1DTTA 2QLWA 1S79A 4ECQA 1UAWA 2DIUA 3MR6A 1WHWA 3M2UA 3KLEB 3CPWR 2KI2A 1S76D 2HHUA 4ES2A 4DMZA 4WK3A 3RAQA 3MFHA 4PXCA 4N76A 3DI6B 1I1GA 2CDQA 3S1TA 3THTA 4UY85 2XS2A 5EDWA 3T6JA 3PZPA 2PO4A 2HVZA 1HNWF 5LJ3Y 2HNZA 2G0CA 3AQPA 4WXWA 1N34F 3BGFA 2DNNA 2E66A 2DGXA 2VB6A 2QA1A 5KFLA 3ISNC 2RKIA 3J7ZT 1XBWA 1Y3JA 2ZH2A 3UPFA 4TQSA 2W9CA 3RBDA 4LQ9A 1HBOB 4KFBA 1QUVA 1N36F 3G9CA 1Y4ZB 2OPRA 2XS7A 1RT7B 4K0KF 1IUJA 2F40A 1R6YA 1REVA 1SI9A 1OQ3A 1O8BA 1S1TA 2DNGA 4P7TA 4ZP7A 4KHPF 1FO1A 2W4CA 2C3OA 3CUNA 5D4LA 2CYYA 3V5RA 5HQ8A 2VQEF 1KQSR 1SUQB 1DTQB 4NPOA 1KLMA 4DHVA 1RK8A 5KT7A 2ZH5A 3RB3A 3DLGB 1WD6A 2YX1A 2JWNA 1FRKA 3RRHA 3MGJA 4DEZA 4X4VA 1DQAA 2C3PA 1FD2A 4U7CA 4ECWA 5DG9A 4NXMF 3L7OA 2I5JB 4RW9B 2W4PA 4J9RA 4OZJA 2C28A 1S49A 4C97A 2HQ3A 1S48A 5DDQC 4DG1B 4QW8A 2RU3A 3PDNA 4AL5A 2DH8A 2SXLA 1NKCA 2E5LF 4DBQA 2ERRA 1JNZB 4ID8A 3ETOA 2DISA 2CQ1A 1WEYA 2O67A 2AJFE 4OI3A 1QTMA 4LIWA 1FRLA 1X0FA 1K0TA 2ADBA 2PDAA 1M0SA 4WKRA 4YUDA 3MPYA 2PD1A 4XAKA 3KJVA 2YH0A 4CO1A 1NK6A 1U25A 3M1VB 2KJWA 5KFBA 1JLBA 2CRLA 1H3DA 4LSNA 5I3UA 1VOMA 1MWZA 1FJEB 4JBCA 1SIWB 3CCLS 3QWPA 4EFAC 4Q44A 3IAM9 3MEEA 1IR0A 2KM8B 1G2EA 1RT2B 2A3JA 2CJBA 2HFZA 2Q43A 4IOCQ 5K8PA 5F8JA 4IRKA 4A4JA 3I0RA 1NHVA 1YRTA 2IHR1 1HW8A 4JI8F 2R2RA 1R7IA 3H98A 3KNAA 3NAHA 2CKWA 1GQEA 1H38A 2OFGX 1UVLA 3OFGA 1U1KA 3TYTA 3M32B 2DD8S 3DRYA 1HWLA 2DO0A 2WSCC 1TVRB 5HL7Q 3EUNA 1HHSA 2IRYA 1JXLA 4ZPVR 4WTYA 2M88A 3C6UB 3IC1A 3BEGB 1ZH5A 2BANB 5K9FA 5GADU 5EUHA 4ZDNA 1TP7A 3E8OA 4BDPA 1E6VB 3GIIA 1DFDA 3MMCB 2KZZA 6FD1A 3GQCA 4OHXA 4DWIA 3NCRA 4OFZA 1HBUB 2VPYB 1JMTA 3HVWA 3MZIA 3MM7B 4J9PA 3LH2S 5L1LA