2N3LA

Solution structure of rna recognition motif-1 of plasmodium falciparum serine/arginine-rich protein 1.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
89
Chain Sequence
b'GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDVKKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine/arginine-rich protein 1, PfSR1-RRM1
publication title The N-terminal RNA Recognition Motif of PfSR1 Confers Semi-specificity for Pyrimidines during RNA Recognition.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Rna binding protein
total genus 10
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n3lA00
2Q79A 2ZJRQ 2XNRA 2OIHA 3Q2SC 2L41A 5MLCV 1X5SA 3MD3A 2NZ4A 4Z2XA 5D78A 3SMZA 1W2BR 1VC5A 2MGZB 5IFMA 1FHTA 4FXVA 3VAGA 2ADBA 1M90T 3N9UC 3L3CA 5DETA 1U1NA 2BZ2A 4YOEA 3B4MA 2NLWA 2LKZA 2KXNB 3SDEB 2DB1A 3EGNA 2G4BA 2FC8A 2DH7A 4QQBA 1U6BA 3U1LA 1ZH5A 2MMYA 4TLQA 2MZJA 1FO1A 3LQVA 2HGMA 5IM0A 3G71S 1X0FA 1AUDA 3VAFA 1HD1A 3CC4S 3CMES 2DNOA 4LMZA 1N8RT 3G8TA 5BJRA 2CQPA 2X1FA 1VQ4S 3NNAA 1K9MT 2DGSA 2MKKA 3LPYA 3MUVP 2DGTA 2O3DA 2VOOA 3Q2TC 1X4BA 3G9CA 1VQOS 2X1GA 4OZ1A 2M4MA 2MQQA 2B0GA 1OWXA 4EGLA 2DO4A 2RRBA 2F9DA 1VQNS 1VQPS 5LXRA 3NMRA 1JMTA 1WHWA 1WEZA 2CPIA 2J76E 2LA6A 1H2VZ 2RQ4A 3THPA 1M5VC 1WTBA 1SXLA 2U1AA 2MKIA 2YH1A 2MZQA 1U2FA 2BOPA 1KC8T 4PR6A 5DM6Q 2CQGA 3CD6S 3MI7X 2L9WA 3CCRS 2OSQA 3HHNB 2OTJS 2FY1A 2CPHA 5D77A 2DNKA 1QVGR 2QEXS 2LEAA 2CPDA 2CPYA 4WIIA 1VBXA 3ZZYA 2RS8A 1WF1A 2M52A 2XS7A 3I55S 2D3OR 3P49B 1X4DA 1G2EA 2G1DA 2HVZA 1WHVA 4U67Q 2DNGA 3G6ES 3CMAS 3G96A 2RRAA 4RU2A 2LECA 2DITA 2M8HA 2DNRA 1KQSR 2G0CA 4WCEQ 4BS2A 2DNNA 3CCVS 1Q7YT 4ERDA 1YWXA 3R1HA 5CYJA 2MSSA 2CPXA 1P1TA 3R1LA 2DK2A 2DIUA 1IQTA 2DH8A 4W92B 4CQ1A 2MQOA 3FEYB 2WBRA 2DH9A 3VAJA 4CIOA 1RK8A 1VQ7S 1K8AT 2OJ3A 1R8HA 3CXCR 1K73T 2MJUA 3US5A 1YTYA 2VOPA 2DGUA 2KRBA 2E44A 3CCLS 5DM7Q 2DNPA 3IWNC 2FPHX 2KVIA 1L3KA 2DNYA 1NJIT 2CPFA 1D9AA 1O0PA 3BO2A 3S7RA 2CQ4A 2DHSA 1PGZA 5H1SV 1Q82T 3OW2R 2DGXA 2M9KA 3K0JA 3MDFA 3CULA 1WI8A 1VC6A 5CA5A 3CCJS 4QPTA 2I38A 2K3KA 2KN4A 3PIPQ 1NO8A 2ADCA 1YHQS 2RUGA 4YUDA 5IQQA 1BY9A 3V4MA 4WKRA 2SXLA 1UP1A 2UP1A 2LCWA 5DDRC 2M2BA 2KM8B 2MJNA 2AD9A 1F9FA 2MKHA 3DXBA 3I56S 3P6YC 5HO4A 4WFBQ 5GAHU 1N88A 2JRSA 2MXYA 5FJ4A 1A7GE 1X4HA 2CQDA 2MZSA 2I2YA 3TYTA 4UQTA 3S6EA 1VBYA 1SJRA 1H2TZ 2OTLS 3MOJB 2DGWA 2PE8A 2L08A 3HI9A 2CQCA 4TU8A 2DGOA 2MKCA 5GAEU 2GO9A 3MURP 1YJNS 2MY7A 2HGNA 4QU7A 1HA1A 4LIRA 1VBZA 2HYIB 2DNMA 1WG5A 5HL7Q 2J8AA 2KM8C 1UW4A 3UCZP 3MUTP 1FXLA 2MSTA 1XN9A 1X5OA 3TO8A 2DNZA 4PKDB 4TU9A 1X5TA 2J0SD 4FXWA 2RQCA 2MQMA 1YJWS 2A3JA 2CQ3A 1WHXA 2AYEA 1WG4A 2KYXA 4IUFA 2MKJA 3S01A 1X4AA 3VAMA 1U1PA 3DLLQ 1S72S 1QVFR 3H2VE 5IM0B 1S79A 2N82B 1CVJA 5LSLA 1M5KC 1VQ6S 2CQ1A 2N3LA 1UFWA 2XS2A 1VQ5S 2RU3A 4IO9Q 1WF0A 3CF5Q 2MB0B 2E5IA 1YIJS 2M8DB 2JVOA 1X5PA 2LYVA 1YITS 2XB2D 2ZJPQ 1WEXA 1U1RA 1H6KX 2LXIA 1DHMA 1OIAA 1WELA 2KU7A 2QFJA 2E5GA 2M70A 1D8ZA 4C7QA 1UAWA 1OO0B 2DNHA 3UWTA 2U2FA 5GAGU 5DDQC 2DHXA 2D9PA 2MGZA 2MZ1A 3FEXB 1WEYA 2V94A 3EX7B 2CQ2A 5EN1A 3UE2A 1ZZNA 2CPZA 1WI6A 1M5PC 2KH9A 5GMKa 5ITHA 2KFYA 1N52B 4F26A 3PIOQ 1A9NB 2DGVA 3BEGB 3CCSS 1SJ4P 3SDEA 1VQ8S 3VF0B 2YKAA 4PRFA 4F02A 2MYFA 5GVQA 2MKSA 1JJ2R 2JX2A 1P27B 3CTRA 2EK6A 2CQIA 1VQKS 3CCMS 1FNXH 3CPWR 2K8GA 3NS5A 2MY8A 2N7CA 2CQBA 1FJ7A 5LXYA 2DGQA 1R8PA 2MQNA 3H2UB 1SJFA 2KRRA 2CJKA 4P6QA 3CCQS 2AYGA 2EK1A 3CCUS 4LJMA 1M5OC 1M1KT 2DISA 3MUMP 1H2UX 2FHOB 2D9OA 2KG0A 3CCES 3CUNA 4ZKAA 2DHGA 4IOAQ 1WWHA 2QA4S 1QM9A 1VC0A 1WG1A 4C0OC 5JVGQ 3NS6A 3JB9k 3UD4P 2DNLA 1OPIA 1KOOA 2MZRA 2HGLA 2M7SA 2F3JA 1B7FA 1SJ3P 3VAIA 3ZZZA 4ED5A 1VQMS 1VQLS 3G4SS 2CQ0A 2X1BA 2JVRA 2YWKA 3D2WA 2KI2A 1YI2S 2N3OA 2LMIA 3BS9A 3R27A 5CXTA 4WFAQ 3B4DA 2MZTA 5JVHQ 3U1MA 2KXFA 1FJCA 2CQHA 2JWNA 2EVZA 3J7YU 1N54B 2AYMA 4V19X 4WFNQ 2ZJQQ 2M88A 1JJ4A 2RNEA 4Y0FA 3UCGA 1X4EA 2VODA 1Q81T 3EGZA 4OZ0A 2XNQA 3RW7A 3J7ZT 1Q86T 2M0GB 1ZZFA 2KHCA 2J0QD 2LXUA 2RS2A 1YJ9S 2KXHA 2E5HA 3MD1A 3MXHP 3P5TL 3NNCA 2MHNA 3VALA 2XS5A 1URNA 4CH1A 3TP2A 1VQ9S 1KOHA 1WF2A 2MQLA 2RT3A 3UD3P 3IRWP 3BO3A 1RKJA 2CPEA 3NNHA 2MPUA 2MQPA 2LQ5A 2DNQA 2DHAA 2FC9A 4TU7A 4J5OA 2ERRA 4UY8T 2CPJA 3G8SA 2F9JA 1DBDA 2PEHA 5LJ3Y 4CH0S 2HZCA 2XSFA 4M5DB 5DDOC 1PO6A 4W90B 2E5JA 2KT5A 1X4FA 5GADU 2VONA 3CC7S 2GHPA 2RVJA 1NU4A 5LJ5Y 1U1KA 2AYBA 2YTCA 1WHYA 5DDPC 4YB1P 4IOCQ 1U1OA 2OSRA 3CC2S 1U1LA 4F25A 1DZ5A 1HL6A 1X4CA 3UCUP 3RW6A 2DO0A 3SXLA 2LA4A 3VAKA 3ULHA 1U1MA 1HD0A 3P3DA 1U1QA 4QU6A 1JJHA 2YH0A 2X1AA 1KD1T 1SJQA 1DRZA 3VAHA 4A8XA 2DIVA 3BO4A 2KG1A 4C4WA 1U6FA 4WF9Q 1FT8A 4Y00A 5LSOA 1FJEB 1X4GA 3THTA 3S8SA 2LEBA
chains in the Genus database with same CATH superfamily
1TL7A 1OS5A 1NXIA 2FB0A 2FZKB 4EFAC 4GKKF 2ALYB 2UV8G 4NL5A 3DI6B 2YWWA 2H5JB 3L3CA 3M6UA 4ZVFA 5HLFB 2DXDA 2EWHA 4CTAB 1FWKA 3TR5A 2QA4G 4J7CA 3FRZA 3SYZA 4JP8A 1X0FA 3RR7A 2XG8A 4WYLA 1ZTWA 3D3BJ 5A2QU 4LMZA 1N8RT 2N4DA 3LPYA 1TKXA 2GA7A 4XDCA 4DPUA 1RT3B 1GXUA 3ITHB 2XMVA 4C0HA 1VQNS 4QYZJ 1JMTA 1XMBA 1WEZA 2DEIA 4NI2B 1W25A 4RW8B 3BSOA 3AA9A 1S77D 4C6AA 5DM6Q 3C16A 3CJ3A 4FF3A 1IKYA 4FF1A 1JXEA 2XY5A 2QEXS 3HKZD 1NHKL 3L4BC 1CJTB 2BBEA 3LW5C 3WIVA 4ELTA 2XCAA 3UPFA 4JI6F 2YKNA 3EMTA 1J27A 2V67A 5SUHA 2KT3A 3QGHA 2VB6A 4L3KA 1C2PA 4USHA 5EX0A 2C2ZB 1HQ2A 5C24A 3OUYB 1K73T 4UOCA 2C2KB 2DGUA 1HWKA 2E44A 4LVNP 3TVZA 4LR9A 1XQIA 2N7YA 3GYNA 4CLKA 3LAMA 4IG3B 3H20A 3GYXB 1HWIA 1IM6A 3JSYA 2QMXA 3O6QA 1CJVB 2YNHA 3IWXA 1RT2A 1FRMA 4PQUB 3CE8A 5GAHU 1N88A 2YQ1A 4KE5A 3OL9A 2A2CA 1QSLA 3MEEB 3FUYA 4NRTA 3FDSA 3MCNA 3KK1A 4LQ9A 3A8JA 3I87A 2BANA 4QW8A 3DDIA 1SH0A 4LF9F 4WTOB 4ZCIA 5M2UA 1T3NA 3GR0A 3UCZP 1IJEB 3OFGA 3O44A 4ZPCA 2R7TA 4TU9A 1LK7A 2RQCA 1U47A 3JSBA 3CJQA 5C7PA 4QR1A 3I4PA 1IBMF 1S1UB 3CCWA 2HQIA 5IM0B 1S0MA 1SL1A 3TA0A 3Q0AA 5KT6A 2JEFA 2VZ9A 2R9LA 2XB2D 4DV7J 4DOZA 5KG0A 1E6VA 2COLA 3BREA 1YBTA 1C4CA 2YX4A 3KG1A 1IVZA 3I5BA 4Y6IA 1Y4ZB 2E66A 4OX6A 3LP1A 4GVLA 3KXDA 2J6UA 3HHLC 3FSXA 3NP5A 5B0AA 4PG8A 4FF2A 4LF8J 1RAHB 1Y9OA 4FYWB 4OV6A 2RE1A 3DDKA 4LUBA 2ASJA 4TLRA 2HMIA 2CQIA 4I69A 3QRRA 1FNXH 1DTTA 4K7QA 3PYFA 2E5LF 3UNYA 2DGQA 3JQJA 4LJMA 2OAUA 1S1WA 2D9OA 2CAJA 2CKWA 1HNWF 4C0OC 1RWUA 3TJ8A 3CW2C 3UD4P 1KOOA 1X7VA 3ILLA 2F7VA 4TQRA 2V4JA 5C2GA 1U8WA 5KFIA 4WBFA 3ZZZA 2CQ0A 4KB7A 1BMQB 1GMWD 1YI2S 2QTWA 4P72A 5JVHQ 1H72C 3EXCX 3KJFB 1SPBP 5F8MA 4V19X 4RBTA 1ZZFA 3QMQA 2LXUA 2KXHA 4MJKA 3SSQA 1RA6A 3J80Y 2RSQA 4CO4A 3BH7B 1UVKA 1UFLA 3PKYA 2VJUA 3G2XA 1HQUA 1SJ1A 2WB4A 2H48B 4YP3A 1AROP 4DUYF 3R7SB 4LF7F 2QMUB 3DGPB 4FBUA 5HLFA 2B9YA 4RWXA 3MR5A 4CTAA 4XPCA 2YH0A 4DFPA 2PFFB 4RUCA 1H3DA 3TRGA 3U7JA 4ETXA 1RT4B 4OZ5A 2R8JA 3HD2A 2CNNB 4LSNB 2ZDOA 1I3OB 4XAKA 1RWXB 4FXVA 5EUHA 3ITHA 1U2CA 5DETA 1ZS6A 4U6PA 2BZ2A 3TARA 3E01B 3IC1A 4B3MF 2Y1RI 2J9DE 1S5ZA 3U1LA 1IWAA 3LF0A 4OYXA 3G71S 1RSCA 3I31A 3CMES 2RB7A 4ED2A 5IXUA 1K9MT 3K5NA 1SBRA 1X4BA 1VQOS 1YLXA 3QFHA 4WFZA 4EGLA 2AT1B 5BYSA 4NLGA 2Z58B 1XNRJ 1VQPS 3NWRA 2B9WA 2RKIB 2ZHAA 1HPZB 1REGX 3M8PB 4R25A 4LSZB 2IRYA 2H51B 2FZCB 3ZNUA 4ZJOA 3ZZYA 1UKUA 2FJXA 4WXWA 4IG3A 4B9VA 4JI4J 3CMAS 5ETKA 1Y5LB 4AQYJ 1IBCB 2FVCA 2Z30B 4RU2A 4MKAA 2G0CA 5F8JA 4TY9A 2KTQA 5CYJA 2DR9A 2DCUB 5HVFA 1NPPA 4NLXA 2DIUA 3BGOP 1IKWB 1V5VA 2O67A 1K8AT 2C2OB 3W65A 4OI0A 3P96A 2P5VA 4RW4A 2GZOA 2ZEJA 3KKFA 2OHDA 2Q1LA 2KVIA 4LRBA 1F2HA 4FP9A 2Z8QA 3HP6A 3DLKB 4LREA 2YNFA 3A3NB 2GX8A 4NLDA 5D15A 4B3RJ 3GCWP 5ETMA 1A7GE 2B5JB 1SJRA 3MOJB 3OLBA 4K50A 2QL5B 3TA2A 5F0UA 4J9SA 2MY7A 2QA2A 2BQUA 2K2PA 2ZH3A 1SUQA 4UTGA 2BACA 4PKDB 2E1RA 1SIZA 2KYXA 5J1EB 1HR0J 1I51B 3W66A 4F04B 4IO9Q 3R9LA 2H65B 4M8LA 3C6UB 3SQGB 3I0SA 2W01A 1RT7B 5AE2A 4B3SJ 2Q6CA 4WZQA 3PO4A 5E41A 4UY85 4QWCA 4KBIA 2CYYA 1F6TA 1H7XA 3W8PA 3H4DA 2DCLA 3ISND 2ZUAA 1Q8KA 2DGVA 2MTLA 1JLEA 4RU9A 2UU9F 2VUGA 2IMOA 2BYCA 1AZSB 3TNVA 2X3GA 1EKRA 3AJ2A 3R5JB 4DZDA 4MIBA 2IM3A 3M8WA 2LFVA 1SB6A 1N32J 3BF4A 1XMQJ 9ATCB 3R5DA 3FCHA 4LFBJ 1KKHA 3W7BA 1WWHA 2NUUG 1WG1A 4RWWA 1PBUA 2VG7B 2V50A 1NJZA 4U7UD 2NSBA 2GS8A 2F3JA 4NCAA 4D3GA 5ETTA 2BJ9A 2XMJA 2YWFA 3D1OA 3G4SS 2YX7A 2MLXA 1FNMA 3JXOA 5IWAF 2EVZA 3J7YU 1HYSB 4ZPVR 1FFWB 3GG0A 1T05B 4RNOA 4Y0FA 6FDRA 4K4TA 4GC6A 5C25B 3MD1A 3DGPA 2UUCJ 4PZVA 1VQ9S 1NJWA 4I6WA 1RKJA 2ZBPA 3SCJE 1ZOTA 2VFUA 1CJUB 4CYUB 1RT4A 2HS0A 2HSEB 4Q0BB 2EXUA 5J1PA 2BOAA 2EI5A 3HT3A 4OZNA 3EGVA 4USIA 4KT0C 2HHTA 5CCMA 1RHUB 2EFVA 4AL6A 1DZ5A 3V5RA 4YR3A 2JLFA 3VAKA 2D7SA 1HD0A 2C2MB 3E01A 5KFFA 1R0AB 2QZ8A 3HD1A 1YBUA 5EWGA 3VAHA 3UW1A 4Q7AA 3FBBA 2KG1A 2AF6A 3TI0A 2A10A 4CLZA 3M32B 2EFGA 1YJRA 1S9FA 2ZBRA 4OX7A 1LFPA 2NZ4A 3JS9A 5IFMA 2F1FA 2XMTA 1S49A 2HAIA 2JDJA 1L5UA 3BH6B 2NLWA 2LKZA 4KRWA 1DFDA 3M8PA 1MU2B 4WU3A 1E6YA 3KK2A 2ZM6F 1Z2ZA 2CIMA 4A8FA 1RBLA 4AXJA 4BC7A 5KG1A 2YXLA 3MFHA 4KKOB 3BDEA 3Q2TC 2VKRA 5F8GA 3Q8YA 2WONB 4HI1A 3NMRA 3W9IA 5DQHA 4PXBA 3TX8A 4F7VA 4YY3F 2WSEC 1FK9B 3L9ZA 2Y8WA 1T02A 1FI4A 1FKOB 4DV0F 1EP4B 5EDWA 2QO3A 3LGMA 5L1LA 3QAEA 1EX8A 2CDRB 3P49B 3UDEA 3DLKA 2G1DA 1IUJA 2FHKA 3CD0A 3L95X 5EGYA 2DBBA 1N36F 4P2MA 3KUEA 5D6GA 1GTEA 4FPIA 2UUBF 1YWXA 2VV5A 2CPXA 2OPQA 3M9NB 1HI1A 3ZFVA 4W92B 1JLGB 1L3SA 4IR1A 1VQ7S 2IA0A 2ROPA 2IAJA 3BR8A 4G1QB 1IKXB 2UVWA 4M1KA 5KFVA 2DRBA 1C0UA 1GFWB 4ZP7A 3CB4A 3M05A 1IQZA 5D4NA 3Q8RB 2HS3A 2ADCA 8RUCA 2VFVA 4CNYA 2M2BA 2IYIA 3CEDA 2XQCA 4UQTA 2Z57B 1HI8A 3DRSB 1NSQA 2GHVC 4OIXA 3PYDA 3PHTA 1JLFB 2ASYA 2DRAA 4ZJQA 1RT7A 4HACB 1F0XA 1S6PA 1RE1B 1LQ9A 1S7HA 3MM6B 1FDBA 2CQ1A 4O0NA 4I2QA 2H5EA 3ET6A 1EZZB 1S1XA 5KG6A 3O1LA 4X4TA 3C46A 1TK5A 3T5JA 2ZJPQ 2FJAB 1Z2LA 3N5FA 3HHLD 2RDJA 2MHEA 2IM0A 1KNZA 4NOHA 4ECWA 2HG4A 3W9JA 4O3QA 2H4YB 2D1CA 5FDLB 3RTVA 4DL0C 2VG7A 1VIXA 1VQYA 5ITHA 4DFMA 4YDDB 4CI0B 3TA1A 1ITPA 3BEGB 4KH1B 2O01C 3OQ2A 4JOUA 2MYFA 3GQCA 1RTHA 4OHXA 4OYBA 1KN6A 2QG9B 1TAUA 1QTMA 5CCLA 1RXOB 2B4VA 2YPZA 1LOUA 5L1JA 1N33F 1SJFA 2FHJA 2AYGA 2W2NP 4KO0A 3JB9k 5IS2A 2NS1B 2YY3A 3EVOA 1HBNA 2XHWA 4JBCA 5IV4A 1U2RA 1SC1B 3U1MA 3N0VA 4CO5A 2FJWA 2PGCA 2ZJQQ 7FD1A 4ECTA 4TYBA 3OTOF 5HMXA 2QYCA 3BGRB 4FYVB 1F60B 4LF5J 1MMNA 4CO0A 1TMMA 1R0AA 2BW7A 3KFWX 1HW9A 3S1TA 1U02A 4PXEA 5A8WB 4LRFA 3N6MA 2VICA 3MPUB 1BLUA 1FD2A 4H4OB 1N4LA 3M32A 4DDFA 1RHRB 3K5PA 2BJ3A 4A8WA 5AJ3J 3OHAA 3HHEA 2I9SA 4HKQA 4QPXA 1MWYA 4GKJF 2OSRA 1MG7A 3HCXA 1U1LA 1GMUA 4H4MB 3M1VB 3UNGC 1U1MA 4ZVSB 3MPVA 2ZH7A 1HNVA 2PC6A 5K8NA 3K8VA 1U1QA 2KYZA 5I3QA 2LEPA 2X1AA 3J7A1 1DRZA 4A8XA 4LBPA 4CLYA 2KJVA 4FXDA 3MZIA 2FVQA 1RADB 1RABB 3TOQA 3DYAA 5HP1A 5CH7B 2KB2A 3SMZA 2MGZB 3U1NA 2B6AB 3DM2A 4K8RA 4Q45A 1RYSA 5HBMA 1UA0A 1EIYB 4OYAA 3T1YF 1CQNA 4MKYA 4K4WA 3ILOA 4ZLLA 3EGNA 3PM9A 3VGUA 4DPYA 1KVIA 1YRTA 3T3FA 4ECYA 3O3LA 1BQMB 4FNIA 3VZHA 4DV2F 4DR3J 4M95A 2J9EA 2EW9A 3MPWA 2M5YA 1VHIA 4NRUA 3ENQA 2MQQA 2YQ3A 3V6KA 4TN2A 3FBCA 5KTQA 3N4WA 4J9PA 3QAUA 5KFXA 4RW7B 1VJQA 1NHUA 2XGQA 5DZ6A 4DHVA 3A8EA 3MPYA 2XC9A 4HEA9 3D6MB 4G1QA 3DU6A 1VBXA 4U8VA 2E9TA 3I55S 2IMWP 2V34A 2GJ2A 4J9VA 4NYZA 2DNRA 4BS2A 4BBYA 4BDPA 4ERDA 2J6TA 2XLJA 1Y5IB 1FX4A 3RBZA 5M2PA 2GIFA 4P75A 3ZZTA 1CS4A 5KFLA 3DMJA 2QSFA 2ZKTA 4UUXA 5LOQA 1FFGB 3Q83A 3M8QA 1O0PA 1TUGB 5GADI 3EE3A 2C22A 4HACA 4IH7A 4DMZA 4BHQA 2J7WA 4QR0A 4F3MA 2I38A 1S99A 4ZA1A 4ED7A 1B4SA 2DPIA 1HWUA 2YNIA 1FE0A 4EMDA 2CFXA 1BY9A 5L39A 2YPYA 2MXYA 2HNYB 4LF6J 5F9LA 1AXQA 5E3RA 1GQEA 3BBBA 4LFAJ 5F41A 4W4MA 2QLJB 2JNJA 1B0VA 3EPGA 4QU7A 1FXDA 2LQ9A 3D0IE 2GGPB 1JJCB 2C28A 3QIDA 2UVRA 4HR2A 1EQ0A 2B43A 1JIHA 3SEOA 3QYYA 1YJWS 2P2CB 4ENOA 1S72S 1M5KC 4E8UA 3Q8SB 3AODA 3SV3A 2E5IA 4B9TA 1YIJS 1R43A 3D54A 4MFBB 3IGNA 4N8NA 4DQPA 1NKCA 2GW8A 1OY8A 2QFJA 4C7QA 1UAWA 2QLXA 2U2FA 1FEHA 2WHOA 1KQFB 5CZXA 1VCTA 3RZAA 4GKKJ 3BZQA 2MLYA 2FHMA 4DV7F 1RWVB 2BKPA 3HHDA 3OJSA 5BR8J 3FCWA 3MR7A 2VG6A 2XMKA 1VQKS 3PKMA 1NK4A 2EK1A 3SSSA 4LF8F 5KAKA 2UUTA 1SKSA 1TKZB 3BGRA 1VC0A 4F4ZA 1RWPB 4Y2IA 2RIJA 2WCXA 1YKWA 1RLCL 1RT1B 2J0WA 3H0PA 3M9OB 5A8WA 1U8SA 4M5JA 4OX9F 1CEZA 5GMEA 2BW2A 1TUWA 1IKVA 1RHKB 4OZ2A 4CRJA 3KHLA 4U9RA 4EYIB 3IM8A 3RW7A 3NAIA 4JI8F 2BA9A 1Q8BA 3M1VA 3BQ2A 2FTRA 4TVAB 3UD5A 3BGUA 5K14B 3POTB 1BC6A 2FIUA 2BE2A 4IKAA 2MQLA 5IOLA 1ZM2A 3C15B 4UY8T 3TZZA 2CZ9A 4WP3A 5GADU 3CO0P 3RRGA 1H7WA 1YJUA 3M4XA 2F40A 3HPOA 3R7BB 2ASDA 1Q8IA 3PX4A 4DPOA 3MECB 4OFZA 5ETQA 3K7RA 3MR6A 2P6TA 4C0BA 2W9BB 3D0HE 3O8WA 2D69A 4D3HA 3DLGB 1HKAA 1WKLA 1IBKJ 2ZH6A 4RO0A 4JV0A 1RAJA 2WVBA 1NCLA 3KLVA 1BQMA 3Q89A 4P7VA 4KV8A 2A2DA 1NSKL 3BQ1A 1IXKA 2FY8A 4L6V3 3JYTA 2W2QP 3CJKB 2R8KA 1LW0B 2WB1D 3GFHA 2DB1A 5EX3A 3CJRA 3R97A 2YKOA 3UN2A 3BPSP 5KFGA 1ZH5A 4K5SA 3GE9A 2HGMA 3H59A 1IR2A 4USJC 3QGPA 2CG4A 1CULB 4BC9A 1PIEA 4IG0A 2C3OA 4L73A 2P8IA 5H9EK 2XZDB 3F0NA 3EM1A 2UUAJ 2M4MA 1JQGA 2F63A 4WTYA 2F9DA 2RHSB 1V3SA 1JB0C 5ETSA 4X66F 1Q4RA 3LOUA 5L9XA 1NB2A 1WTBA 4RL1A 4FYXB 4ETZA 2PN6A 3DRRB 1DQAA 1CQMA 2DXFA 4DR7F 5MAOA 2LEAA 2CPDA 4DF4A 3NCPA 1WF1A 2XO7A 4H4KC 4JV5J 3MEDA 3B78A 1VRTA 5ETNA 1YG0A 4MK7A 1T9XA 2E5LJ 1ACMB 4KHPF 4QW9A 1QUPA 4QIVA 3VAJA 4CIOA 5DJBA 1S97A 4DQIA 4DI6A 2GV1A 3C6TA 4DCOB 3ZNJ1 2DNYA 2V69A 4O44A 2CQ4A 1TKTB 1PGZA 2GGPA 3MDFA 1WI8A 1VC6A 4ZCMA 4C3KA 3J81Y 2ZHBA 4K0KJ 3IN5A 3AH6A 4I0WA 4LFCJ 4EO8A 2AJ0A 2A1BA 2SXLA 2UP1A 4IFVB 1TVRA 4EK2A 2P9CA 1N34J 1VK3A 2LLZA 3TYTA 4L3NA 2FGOA 4B3TF 4OZ3A 4MMOA 2JLGA 3AOCA 1DARA 2ZBCA 1RTJA 2C3PA 2V8PA 4LIRA 2HYIB 1REVA 2DNZA 1VHFA 1ZM9A 4NXNF 1C1BB 4TXSA 1WKKA 5F8IA 3A1YG 3SFUA 3AQPA 2JEIA 5LM7E 4DX7A 1N5QA 2V6AA 2YWHA 3K17A 2IDLA 5ADZA 2HHSA 2K7JA 3MEGB 3GIMA 4KFBA 1XC9A 1QSSA 3DNCA 3LWLA 2AGOA 2FGCA 4EU0A 2RDDA 5EN1A 1LNQA 2KH9A 3TQEA 4ECZA 2ZFHA 3CIZA 1BQNB 2ZDPA 1A9NB 3CCSS 2G0IA 1NZAA 4PRFA 4F02A 4USTA 2CNKB 2NYHA 3PNIA 1MNEA 3PW0A 5T14A 3CTRA 4B3SF 4WFXA 3ENAA 4B3MJ 3NS5A 2VL1A 3BSAA 1M1KT 3CCES 3QGGA 3BB5A 1OPIA 3G86A 2MZRA 1W26A 2HGLA 1NM2A 2IJRA 2QT7A 1IBLJ 4NX9A 2MQ8A 4FBTA 1CJKA 3C15A 1N32F 2YVSA 4OYWA 1XMQF 2EC2A 4EYHB 1QSYA 2KXFA 4LFBF 4DR1J 4P73A 4CH7A 4F36A 3OT9A 4PXDA 3OR2A 2VODA 3VCDA 2PFDA 3G82B 3TAMA 4ECVA 3QT7A 1WSRA 4HHHA 3MECA 1L3UA 2HNZB 1T9WA 1WTFA 2DVIA 1RZMA 2MHNA 1RWKB 1X9WA 3IRWP 4F4WA 4UZBA 4RUHA 1O51A 3LH2S 1D09B 2CPJA 2VFTA 4DU7A 1UZDA 2ZOGA 4A8QA 1SC6A 1FKPB 2VONA 4O3PA 1UEVA 4DL3A 3HVTA 4U96A 4J9OA 4C8OA 2HLUA 4QJVA 2I5JB 5IT4A 3P3DA 1WOPA 2BJ1A 3IR6B 5KFPA 2XYPB 4DS5A 4XK8C 4NCGB 1FT8A 3MM9B 3S8SA 1KLMB 1RAFB 2NUHA 1CULA 2B56A 3NGTA 5F3TA 4NXMJ 3Q8QB 1FVSA 2HNDA 4R5PB 3R5GA 3MTKA 4ITSA 1RCOB 1FRKA 2MMYA 2DHHA 3DRRA 4DR6J 1UVMA 3PXGa 3BGLA 5DQIA 1DY3A 4IDKB 4PQAA 1VQ4S 2I8EA 4ID8A 2KT2A 3QSYB 1WC5A 3TZYA 3ZTSA 3W9HA 2CRLA 2QLWA 1RT5B 4N77A 5DGAA 2HAFA 3CJ8A 4NLQA 3ZTOA 3VR1A 4U95A 4I6YA 1FE4A 2RQKA 2F8EX 2PA8D 3G6YA 1TL4A 2W2OP 5JJBA 3MI7X 2DNKA 1UZHA 3I9ZA 4XO0A 3W2WA 3RB6A 3GONA 1K1QA 1Y00A 3W5YA 2IM1A 3IS9A 2AEFA 1MSWD 3KDOA 3W62A 2DITA 2LQBA 4K4UA 4LBIA 5KFKA 1GMWA 4IFVA 4DL5A 1FRXA 3KLIA 2IDEA 1IQTA 1KTVA 4FN5A 1WJ9A 5F3ZA 2MQOA 2JZ5A 2OFHX 2PT0A 3QWPA 3JQKA 4ID5B 1RWNB 5A8RA 3HZEA 3PW7A 2G2YA 4B9UA 3R5CA 1NSPA 3C66A 4JI1J 2E1CA 3EDQB 4EBEA 3CCJS 4QPTA 3C14A 3V4MA 2W9CB 2MKHA 2HIQA 1SL0A 2GQCA 1EAYC 2WK4A 1RWWB 2ABYA 1H2TZ 3QIPB 2OTLS 3IG1A 1FFSB 2MKCA 2CWKA 3V6DA 3ZTPA 2O66A 1LWFB 3PG9A 1LV5A 3KNGA 5DLFA 2OPSB 4IUFA 3AJ1A 4AD6A 1LWEB 4K2JA 1T03A 1J5OB 4DUZJ 2N82B 1VGYA 4F2SA 3MMAA 3T1AA 4ZHRB 2RF2A 4O3RA 5RUBA 5DS7A 1NMEB 1R8AA 4OYZA 3OHBA 2ZC4A 1WELA 4O3NA 2E5GA 5AE3A 4ZVHA 4NE9C 3KUHA 1LW2B 2NXNA 1KVJA 4F4KA 4GMKA 2VC1A 3LP2B 3NKYA 1D9FA 2OPPB 4ED4A 4ILMA 3ELHA 3RU0A 4ZP9A 1WD6A 1UEUA 3ZZPA 4Z37A 4NLPA 1YJ7A 2F8HA 1S9EB 2UXDJ 2ZM6J 1TKDA 1CLFA 1AFIA 1N6QB 3KLFB 4IOAQ 1KS2A 2KFZA 3JTOA 4MIAA 3HO1A 1Q79A 4HT7A 1WORA 3V6HA 3UO0A 2QSWA 3WC0A 4PUOB 4PG5A 3CCZA 4WK3A 3EVMA 3VGSA 3K89A 1FJCA 4A47A 2HLTA 2BKOA 2R2SA 1T9YA 4CDIA 4ZLJA 1W7WA 1OY6A 3DN9A 4PWDA 1PYOB 3QPIA 4IFYB 2V63A 1ELOA 4DV0J 4C9DA 4L72B 2E5HA 5IC6B 3DHWC 3VALA 4PAAA 1DQ8A 2CPEA 3TWZA 2ERRA 4DV3J 1K44A 1N36J 3MM9A 2ILYA 2UUBJ 4IQMA 3UFCX 5LJ5Y 4ZPBA 2YX1A 2YNGB 3CGIA 4ECUA 5GAEI 4B9SA 3MAQA 2ROGA 1NH8A 1XMOJ 3RW6A 2XY7A 2R7SA 2XEXA 5CD4A 3BYPA 1WC3A 3WX4A 5AJ3F 1FKAF 3BO4A 1XERA 1U6FA 3OVAA 2OKQA 4LVOP 3GTYX 4ZVRB 1R6YA 1Q16B 1X5SA 4DL7A 4Q43A 2VPXB 2B9EA 3RBXA 4ILLA 2RILA 1EETB 3E3XA 1QAYA 3FCVA 2BJ7A 2XI2A 2H5IB 3SDEB 4I64A 4J9QA 4C8NA 2JH3A 2VBXA 3CDAA 2QL7B 2X51A 5CYQB 3CCTA 2KDOA 3FRYA 1RU2A 4ED6A 2ZE2B 1LKZA 2DGTA 1VBKA 3WX8A 4OZ1A 2CDQA 4U8YA 3EYZA 3NOGA 3TW0A 4RR5A 4DV4J 3D4JA 4NYPA 4EEYA 1NDCA 3JAMU 2R8GA 4DV6F 4RW9B 4DR3F 2WBMA 1DAXA 2BJEA 5A8KA 3KJVB 4NLUA 1R31A 3K58A 3LGNA 4RBUA 4ID5A 2QE5A 3HHLB 3MTJA 4I2PB 2EKNA 2BVZA 2IC3B 5HANA 3K59A 4C8KA 1SQFA 2M52A 5A76A 5LMNJ 3GIJA 2HVZA 3D7SB 1JLAA 4HH0A 2ZITA 1GAOA 3PO5A 5E0OA 1N33J 3R1HA 2G13A 3HJVA 2W9CA 3MM7B 4J9UE 3D1QA 2PEBA 1XIQA 1RP5A 5DM7Q 3IAS9 1DURA 2HK2A 5D0GA 4MYTA 1L3KA 1HNIB 4DQQA 3CJSA 2XY6A 5EHHA 5HAOA 3KOAA 2XMAA 1JKHB 3NBPA 2RUGA 3RJMB 1G6BA 2OPSA 2LCWA 1TL1B 2WW4A 3F73A 2E1MC 2WOMB 4K4SA 3NGUA 1FJGJ 2BX6A 2FYXA 2V2ZA 2VF3A 3KLEA 4ZHRA 4F4XA 4O3OA 3FC9A 4XDDA 5GAEU 3HVAA 1N0UA 2LVWA 2XM3A 2QLBB 4GO5X 1P9YA 2RAQA 1VR6A 4HTJA 2C2EA 4WWSA 5KFCA 5LMUF 2UUWA 1ZTTA 4Q2MA 5HROA 2V8DA 3TO8A 5I42B 4LF6F 1YX2A 2A3JA 2H54B 2DY9A 4DQSA 2WVEA 1T94A 2ZZTA 1RAOA 5KFEA 1RHQB 3DLBA 2JEGA 3H2VE 4GKJJ 3CJ2A 3NOCA 4B08A 2OPPA 3TAQA 3KLHB 2XYGB 1Q7LB 4J9RA 2M70A 1D8ZA 2V2VA 1GTHA 1OO0B 1NAQA 1LFWA 2FZGB 2PIIA 5B0BA 1N6QA 1FVQA 2JEJA 3FEXB 3EX7B 4UZCA 1U49A 1ZZNA 1HNZJ 3W61A 3PJWA 1VI7A 2JSXA 4TNOA 1M1GA 3PVXA 4YB7A 3BBCA 2R8HA 4OHZA 3H90A 1S6QA 5C42B 3J7AN 3W2VB 5J2MB 3CPWR 2MEWA 4X4UA 2CZVC 1KEKA 1LWCB 4WE1B 4M5GA 3GV8B 2YBVA 5DO2A 2HHHF 2FHOB 3CUNA 4DV2J 4FYYB 2XI3A 2P9EA 3CDWA 3OL7A 2DNLA 4ECRA 3QLHB 4K4XA 5BR8F 2OEJA 3HM9A 1R0BG 1YRXA 1UVJA 2YQ0A 2WW8A 5HN0A 5KFOA 3NGRA 2HEKA 2LXFA 5T41A 4WXOA 1GX6A 3G6XA 3IO1A 2EFNA 3W1YC 1U6ZA 1S9GB 1X4EA 1RHJB 1TTHB 3FGVA 2J7UA 1TL5A 1Q86T 4WKYA 4NEZA 4LF1A 3WBZA 3TP2A 3OR1A 3UD3P 5I3UB 4QCLA 4B3OB 3PR4A 3B8HA 4O4GB 4N76A 1X60A 4A46A 3ENVA 2PEHA 5AT1B 2HZCA 1PO6A 4W90B 3HHKA 3CNQP 2NSCA 3Q8VA 1B0TA 2YTCA 2R7XA 5DDPC 4IOCQ 3R2CJ 4FF4A 1DTQA 2ZH4A 1DQ9A 3UCUP 2W7AA 1WOOA 2C2DA 2NZCA 3ULHA 1JLCA 3KTQA 5SZTA 3PW2A 1M0SA 1HHSA 1MMDA 4NLWA 1CPZA 1RTZA 2XLIA 4Z7CA 4WF9Q 2EFQA 3L7UA 3VGVA 2UXBF 1RKIA 3T6JA 2XNRA 1S1VA 3DOLA 4Q5VA 4EWTA 4RNMA 3MD3A 4KHRA 5B0EA 2WRMA 1W2IA 4ZP6A 4LT6A 5HVHA 1U1NA 3MM8A 3H4BA 3B4MA 1IBKF 4RNFA 5KFUA 2QYGA 3LALA 3TVKA 1NBEB 3HSJA 1TK8A 3QQCD 3PW5A 4I2PA 4KPCA 2CQPA 2VBWA 1VMBA 5IV3A 5F8HA 2HVHA 5A0YB 2VU5A 4ALZA 2BRLA 2AZ3A 2R2RA 3TEHB 4HLBA 2RRNA 3QRPA 4X65F 4N56A 3BSNA 1P9QC 4ZPDA 1WC4A 4QYZK 1KDNA 3SIPB 2BXJA 2XHCA 2RMLA 1C0TB 1HQEA 3MM7A 2FLNA 3GLJA 3NAHA 4YR0A 3A12A 3CO9A 5LSRA 3ADAC 3JSMB 2UUAF 3I6PA 3CMQA 4NZ0A 4JUZA 1NEEA 3CT9A 4IR9A 3EDRB 2IJNA 4BLGA 4LIWA 1HBUB 3DXSX 4ANEA 2DNNA 4BWJA 4DL6A 1TL1A 4ICLB 2B7BB 4V1Ak 3FEYB 3V6JA 1N5SA 1RWOB 2MJUA 3US5A 2CJYB 2B8PA 4JV5F 3KHRA 4DSLA 4FKXA 3S7RA 4DV1J 1PYSB 3OW2R 4ZK7M 4OX9J 3CULA 3MMCA 4Y3CA 2BUNA 1F5BA 4PCQA 2HBRB 3PIPQ 2OEKA 3N28A 2WTFA 5IQQA 3FKBA 1KHWA 1S76D 3NLCA 1NK5A 3T19A 3V4IB 4JI8J 2KFNA 2PE8A 2DR8A 5KT3A 3HI9A 3QJJA 2E9RX 1YJNS 3LP0B 3HKWA 3AOBA 2PO4A 4K0KF 4O23A 4LFCF 1UW4A 2MSTA 4ZCKA 3FFIB 1N34F 2J0SD 3RRHA 2AYEA 3E8OA 4PXCA 3LPEA 2GO8A 2N3LA 3K57A 3QSIA 2XS2A 4OI6A 4M94A 5D3GB 3A8KA 3OBIA 4AT1B 2DJWA 3M30A 1TZ0A 1WKJA 4NLVA 1MROB 2DNHA 3GJTB 3QO9B 5CQGA 5CABA 1H73A 3BKFA 5KG2A 3DI6A 1IR0A 5J2QB 1N52B 2B4PA 2Z2LA 5D8HB 1JXVA 3O2IA 1VQ8S 1YVFA 4UOHA 5HMZA 3D9BA 2Y3YA 1VJWA 2KVQE 3PFOA 4YHHJ 3SCIE 2RU9A 2MQNA 5HATA 3GIKA 3CCUS 3FZ2A 4LF4J 1H2UX 4CO2A 4F67A 4O3SA 1RT3A 1S4EA 5D0HA 1JLQB 4HVZA 1UEKA 4Y34A 2J6SA 5I3UA 4KGKA 4NI2A 3MR3A 2RD5C 2PI4A 3RBDA 4RW8A 3FSIA 5D0RA 4X66J 5D4LA 2BABA 2FJEB 4FPRA 1V3RA 2V4RA 4ZVEA 3MAAB 2LDYA 3HFZB 1YJTA 1CJTA 1Q81T 5KFNA 2XMUA 4DR7J 1GXLA 3QT8A 1IBLF 3PJ9A 2D74B 2RUSA 2FLLA 1URNA 4CH1A 2ZVSA 1WF2A 5KFRA 4C11B 4DJBA 4DR1F 3A4TA 5HSPA 2HFVA 2MLZA 5FD1A 2A6MA 2KL8A 4M5DB 3M2UB 3OUYA 1X4FA 2W8LA 2V8VA 4KHPJ 1N0VC 1U1KA 1ULRA 2AV5A 1U1OA 4TYAA 3BYRA 3W5ZA 2W9AA 3J7YI 4DSIA 2I1RA 2R2TA 4K4VA 1H74A 4QU6A 5IC4B 2FDNA 1CJVA 2B4UA 1V6HA 6FD1A 4PQUA 3AA8A 1FJEB 3BGFA 3W60A 5J2PB 4G1PA 3MEEA 4P2SA 1FRIA 1CBKA 2HQ3A 3T5HA 2C2RA 2F5GA 4B3TJ 2HHPA 2VFSA 3C8YA 3VAGA 2ADBA 2LU1A 4ZN3A 5E2QA 3NS7B 4RX6A 1T8EA 1CC7A 3PHEA 3KG4A 1H38A 4LQ3A 4YDXA 1S1UA 2MZJA 5IM0A 1AUDA 4OJGA 4NXNJ 4Q2LA 2HFZA 3DKDA 3G8TA 4NXMF 3OFHA 2Y9HA 1WOSA 2VOOA 4I56A 3MCOA 2Z2YB 2YKMB 4DG1B 2H1YA 4OL8A 2VA3A 1ZAVA 2ZWPA 2AP6A 3K5OA 3LGHA 1M1HA 2R42A 1S0VA 5L1KA 4DR6F 4P71A 3V81B 4H54A 1KC8T 4PR6A 3W63A 4USKA 5DG7A 4R8UB 1HBMB 2L9WA 2EC0A 2OSQA 1ZPVA 5D77A 3UVJB 2UVUA 1VLOA 2EFPA 2QX0A 1NKBA 3AT1B 3M7VA 3J81U 4R0JA 1T9TA 4ZOSA 2DNGA 3G6ES 1BE4A 3DC2A 2HHWA 2EPIA 1RTDB 1Q5VA 4PPDA 4WCEQ 3P45B 4OX8A 1YK9A 2H9ZA 4NLYA 4NASA 2R8IA 3R1LA 2DH8A 2HKEA 2YKQA 2HZAA 3V4IA 1HI0P 1QAJA 3CCLS 4KPYA 2AJ2A 2CJBA 1G3OA 3BO2A 4C8ZA 4NCBA 3ZC4A 5A6WA 2XZWA 5HQLA 3NL0A 3FFIA 2HQGA 3MOZA 5L9NA 2VBZA 1XJWB 2NXUA 4C3LA 1URRA 2VQEF 2ZZNA 1A6LA 3OLAA 4URQU 4JI1F 1TL7B 1C1CB 2DXEA 1RB0A 1FCAA 3T6BA 1VRUB 3VQTA 2JOQA 2IVFB 2WVFA 1WG5A 4ILRA 3MUTP 3UDVA 5IZHA 2BR0A 2HQFA 3QZ8A 3AB4B 2R7WA 3KNAA 2CJAA 2C2NA 2CVIA 1BXNA 3I5CA 1Q0NA 5J2QA 1CVJA 3BR9A 1S79A 5J1NA 1GT8A 2EEYA 3CF5Q 2AMCB 4FKYA 2JVOA 2LYVA 3J7Z5 4OJ1A 4OHVA 4RNNA 4LBHA 4LSNA 2Y1LB 4ES1A 3VHQA 2ZH8A 4DUZF 3C2PA 2PMWA 4CLUA 1WI6A 2PMZD 1WNEA 1G4CA 2WSCC 4OI4A 1UPMB 4F26A 1XTZA 3C16B 3DRYA 3KG0A 1MMLA 1IKYB 1SH3A 3JQMA 4A8SA 1RYRA 4IRCA 2GHWA 2C42A 2JJ4D 3M8SA 2G0JA 4MAKA 4RBVA 2YKNB 3TUJC 2NREA 1GX5A 1KVKA 5LXYA 3MAAA 3PX6A 3IGVA 3R8YA 2MKYA 3AQOA 2DHGA 2ALZA 4DPTA 2GC8A 3PR5B 1RAEB 5D4OA 3R2DJ 3OVSA 5C24B 4FS1A 2RKIA 3Q23A 4KY3A 1VQLS 1HPZA 1XBWA 4C11A 3QBCA 3IBCB 2ZH2A 2JWNA 2UXDF 1HIYA 3MM5B 4ZLNA 4HH1A 2AYMA 2NXJA 5K20B 3PFEA 4KHMA 2BEFA 2RNEA 4I7FB 4UT4A 2ATCB 6AT1B 4JI3J 3CDEA 2YNHB 2EKYA 1RT2B 8ATCB 4X64F 2WAQD 1S4FA 3AHPA 4IQXA 1KOHA 3H40A 3KK1B 3NNHA 1R7IA 3H5UA 2DHAA 5L46A 2BANB 4KYZA 4OJHA 1IKWA 4M5NA 3N6LA 3GJSB 4M63A 2RVJA 3NCRA 3GG1A 3CC2S 2VJVA 2N4CA 4JI5J 3DDNA 2LA4A 3GCXP 4DV3F 3FZBA 1JJHA 5DG8A 1KD1T 4F3OA 1SJQA 1E6VB 2J0XA 3PDNA 3ZZOA 3JAMY 2B5JA 4Y00A 4TKTA 2OD6A 1SV5B 1XMOF 4QWDA 3LP1B 3NWGA 4Z2XA 3ZZUA 2FJBB 3P4UB 5A6PA 3HX9A 3DGVA 4ZP8A 4DG1A 4QYRA 1U4BA 2GMHA 2W25A 1V3ZA 1ZBTA 4Y2KA 3P5BP 1YJVA 1YGYA 3D6TB 1U6BA 2RQMA 4F0KA 5J1EA 2HMIB 4ZMMA 2FVSA 1F2GA 3G87A 2A18A 3CJ5A 4NA3A 1DTTB 3W5XA 2HBQB 4PG7A 2ZWOA 2DPJA 4RKUC 3NNAA 4X4VA 3C6UA 3SQGA 1IR1A 1NDKA 2X1GA 3QJPA 2VPWB 2BM1A 3GMGA 1ZETA 3IAM9 1QAIA 3GJRB 2V4JB 1AFJA 4B9LA 3WQPA 1RTDA 1H2VZ 4DSFA 2HRTA 2U1AA 5F8LA 1YQHA 1T95A 3H5YA 1FTRA 5KT7A 3CCRS 2E1PA 4DR2J 2FY1A 3BKUA 1AZSA 2ILZA 4R0EA 2ZNZA 4EO6A 3MMJA 3OXFA 1IWGA 2KZMA 4DZ6A 4DV4F 2UZAA 1B0PA 2AEJA 3PRVA 1QD1A 1P1TA 4EUVA 1ZA1B 2DK2A 3TZWA 3LWMA 3AB2B 1RA7A 1HQUB 4OYMA 2KRBA 2DNPA 1C1CA 5LMNF 3ILIA 4JI2J 1RDRA 2CPFA 3DRPB 1VRUA 1HYSA 2DHSA 1I94J 2O1PA 1KFSA 1T05A 2ZZMA 4CO3A 1UP1A 4G6VB 5C25A 4L74A 1R6VA 3I56S 3P6YC 4KSEB 2PI5A 4OMFG 3GYGA 1XR5A 2GFFA 1JNRB 5T7LB 1Y3JA 1HLWA 2DGOA 2Q66A 2F65A 1JWWA 1CJUA 3EICA 4CYUA 2GO9A 3JTNA 2HFOA 3MCSA 1ZA2B 3LANA 4Q0BA 1TFWA 1HFEL 4ANDA 1EARA 1L3VA 3LO3A 3TUZC 2Z2MA 2MQMA 1FJGF 1RT6B 4URSA 4YS2A 1U1PA 1PAEX 4PABA 1QVFR 1K0TA 2F4VJ 2Y8YA 2HBYB 2NCKL 1GEHA 2Z2ZA 4M5HA 2R7QA 1FRJA 3QZ7A 1MN7A 5IQ6A 1ZM4A 3MMBB 3Q86A 3QNWB 3HF5A 1U1RA 5L8RC 1Q95G 3LUYA 4RW6B 2NXCA 5GAGU 2DHXA 3HFKA 3NEKA 4OQJA 2W4DA 5CD4H 3AXMA 2IVYA 4X4NA 3D6HB 1MU2A 2MKSA 3R6GB 1CSJA 2JX2A 1S57A 1XK8A 2EK6A 4DLEA 3MM5A 3H2UB 4CLWA 3LA0A 3CCQS 2BJDA 4I7FA 1HNZF 2DISA 1NKEA 2PD1A 4KKOA 3OTBA 4ZKAA 2BKNA 1NNDA 1B99A 2OO4A 2ACYA 3I9V9 2WONA 1VRQC 4RW4B 4Y2AA 5B0GA 5L38A 3QT5A 3B4DA 2MZTA 1FK9A 1UFKA 3MF5A 1NRKA 1N54B 4DV6J 3JTPA 4ER8A 3TAPA 4DV5J 1SKUB 2VASA 4X62F 1FKOA 5HI7A 1EP4A 2YNFB 4X4QA 1BD6A 2B51A 4DS4A 2ZH1A 4KAIA 2J0QD 2VHGA 2C3UA 2CA9A 3DRXA 3NG8A 1FX2A 5B0CA 1Y5NB 3BO3A 4K4ZA 4KGVB 4J5OA 5THWA 3QT6A 4NZ7A 1ZYQA 1JLGA 1J2VA 1M5HA 2XSFA 2HHXA 3O5TB 3W8GA 4USWA 2W8KA 1SUQB 1SV5A 4KJIA 3ENWA 1IKXA 2QL9B 5K8OA 3EWGA 5E7OB 1NDPA 4P7TA 1RQ0A 1NK9A 4WJBA 1OMSA 2RDIA 2HFUA 3TEGA 2B3TB 3FQKA 4ZIWA 4RPFA 3KJQB 3I0SB 3GFZA 2ZJRQ 2G2ZA 3DRSA 3PY8A 1PKUA 4NEYA 3SQOP 5LT5A 2IBOA 4WK1A 4ZIVA 1RAGB 1JLFA 4PPZA 1QAXA 1U7LA 4F0HA 4ZN1A 4HI2A 2DY1A 1JLEB 2I0XA 2KXNB 1QE1B 2LP4A 3GB0A 3MM6A 4JI7F 5LMUJ 1B70B 4NLTA 1SKRA 4XTTA 1MW7A 3VVTA 5KG4A 3ETOA 2L3MA 2ZC3A 3OTDA 3CDUA 4DXLA 4QWBA 1RAIB 4JI0J 4N5SA 1U0SA 5LXRA 4MT1A 1WHWA 1I1GA 2J76E 4P10A 4F0MA 5FDLA 2V8GA 2MKIA 1Y3KA 3CVKA 4RUBA 2V2QA 1KRPA 1SCJB 5AXLA 1N5TA 3GILA 5KT4A 1WC1A 3DRPA 1VDHA 4IOBA 1X4DA 1G2EA 4B9MA 2VQFF 3Q24A 4W98A 3RRKA 2QLFB 1KQSR 2VD3A 3A13A 5KG5A 2FVRA 2LQJA 2DR7A 1AW0A 1RUSA 2HHHJ 1RK8A 1EJ7L 2J9CA 5L1IA 1TUVA 5T7LA 1PYTA 4N8OA 4CLFA 2FPHX 4KTQA 1RTIB 1UETA 3SCKE 1Q82T 3K0JA 3BPDA 2VDHA 1YHQS 1RGVA 4YUDA 1RT6A 5DDRC 2ZBIA 4FNHA 1UW9A 1U45A 4DR5F 1X4HA 2MZSA 1F5CA 4A48A 2L08A 4DLGA 1UWBB 4DV1F 3MMBA 3PW4A 1UMJA 4ZVGA 3I0RB 4H4OA 3EZ5A 2AJ1A 3FEZA 1VBZA 3I4HX 5F9NA 2XZTB 4RW6A 2VA2A 5I3PA 1X5OA 3T5LA 2CQ3A 4H4MA 3EZUA 4OV1A 1D0EA 1RWMB 1X4AA 4FYDA 2ACMA 1E6YB 3FBFA 3KK2B 5LSLA 2VG5B 2R2UA 2MB0B 4IH6A 1XEZA 5KFQA 3NGDA 1NDLA 5I4MA 1S59A 4C48A 3GZ7A 2XWYA 3ZO7A 3N5BA 4ATNA 3TANA 5B0FA 2DRDA 2VKZG 1QTNB 2UXBJ 2MGZA 2B6AA 2CQ2A 1UJ4A 2AX0A 4FVCA 3TX0A 1YSJA 3K5MA 5GMKa 3ICLA 5K9FA 2HZVA 3GFXA 4USMA 2PA3A 2CVEA 4JV1A 3EXYA 4LRDA 3BN4A 3T9ZA 2IY5B 1FWPA 2OPQB 2X7IA 1D3WA 3IR5B 2M7SA 3NXZA 2G9OA 4ZCLA 3K2YA 4H4KA 4A8YA 2IAJB 3QWUA 4RW7A 4X65J 1PCAA 2N3OA 4YHHF 1BQXA 1NJYA 2NXEA 2K7KA 1KSPA 1XR7A 1OY9A 2CQHA 1C0UB 4LF4F 2AJQA 4WFNQ 1NK6A 4KIAA 1NK8A 3BDPA 1AYEA 4WZMA 3T1HJ 1Q8LA 1T3OA 3EGZA 3J7ZT 2KHCA 1N48A 2KO1A 1X9MA 1KR4A 4KH0B 3PV8A 1NPKA 3FVYA 2L9DA 1LEOA 3OTEA 3D6FB 4ZS6A 1RACB 1ICEB 2EFOA 1NH7A 2W7PA 1S6PB 2VIHA 2AYBA 3EVWA 1RCXB 3CJ0A 4AL5A 4F25A 2HQDA 1OSCA 3F56A 2CJQA 3UN3A 5CHCB 1X4CA 2HURA 2HIYA 2DO0A 1XR6A 4K5RA 4I2QB 2XWXA 1QE1A 3ET6B 1S1XB 1S0OA 4J9LA 2DD8S 2ZUGA 3CD5A 4OZLA 2HNYA 3IWLA 2HVEA 2V68A 3PX0A 1IM4A 1SIWB 3IM9A 1HBOB 3Q2SC 3H5XA 1J5EJ 4J90A 3M8ZA 4IYQA 5AXKA 5JXSA 1M90T 1N5VA 1TV6B 5H9FK 1FESA 3VZIA 1RTHB 1FWLA 3DLEB 2CJ9A 4Z7YA 4F2RA 1P8GA 5E3AA 1RLDA 4M5LA 2JL9A 5BJRA 2KKHA 4MFBA 3MAHA 2IRUA 2MKKA 3MUVP 2GAGC 4KO0B 1OWXA 2DO4A 4AFFA 2POKA 4NA1A 2Q6BA 4ZVOB 1HBNB 1Z1ZA 2BRKA 4WPAA 2QMWA 3MGJA 2J8SA 2GQ2A 3H5SA 2AJ4A 3X3UA 2YH1A 3WIUA 2HHQA 2W2PP 1D9DA 4G3IA 1R89A 4QIWD 2LU2A 9RUBA 2OTJS 3OJUA 2PMHA 1RTIA 1OPZA 1APSA 3HXMA 3C3LA 1TFYA 2RRAA 2LECA 4HL9A 1R27B 4F8RA 4DR4F 4C8YA 1Q7YT 1TKZA 3IFEA 3IRXB 1FDNA 1BUXA 1X0PA 1HNXJ 1RT1A 4JYAJ 3PYGA 3PZPA 2CNLB 3CXCR 4M5IA 2QIFA 2VOPA 1UWBA 4DN0A 4HDHA 1Q1KA 3I0RA 4KR0B 3IMQJ 3KK3B 3SFGA 2DGXA 1HWLA 2AJFE 1HNVB 1TAQA 4WKRA 2AD9A 2CG8A 4UOFA 2VG5A 5K14A 3POTA 3S6EA 2CNOB 1VBYA 4DX8H 4BCAA 2GJFA 3DYAB 5HP1B 4TU8A 2DT9A 3EGWB 4ZPTR 3DM2B 5HBMB 2R7RA 1FXLA 1IN0A 3BM7A 4ES3A 4M5MA 1WHXA 3DLLQ 4HHJA 2W9BA 3G8QA 1WF0A 4DBQA 3DLGA 4G1IA 2HS4A 5KFBA 1YITS 2LXIA 1Y0HA 3F44A 2KU7A 2OELA 5HJXA 1KQGB 4ZDNA 1KONA 1XNQJ 5DDQC 1PC4A 1KP6A 2D9PA 2HHUA 2F4FA 1GMVA 4QBUA 5E3PA 1M5PC 3V2UC 3D0GE 3MWBA 3CJKA 1LW0A 4NYOA 1SJ4P 2NPFA 3VF0B 2GAHC 3A8IA 5U47A 3VTIA 3N01A 2OMOA 4YR2A 3M9MB 1VOMA 1N56A 4C98A 7AT1B 1FJ7A 3K5LA 4P6QA 4CNZA 4ECSA 3WHIA 1U0HB 2ZH5A 4Y2MA 2NYIA 2GQQA 3IXQA 1FD8A 2GVDB 1CS4B 3L09A 3D5MA 3DMJB 1JX4A 2JC0A 4DCPB 3G6VA 4CP5A 2OH2A 3WZ0A 5FLXU 4YQWA 3M8QB 2F8MA 3EPIA 2HW3A 4JB8B 2W4PA 2YNIB 4NA2A 3UR3C 3DU5A 3MXHP 3LTOA 4JV2A 4HT5A 2RT3A 2UXCF 2MQPA 2DNQA 3UI3A 4IH5A 2IM2A 2PSZA 1DBDA 1T9UA 5LJ3Y 3THVA 3M2VB 1XWLA 5KFJA 2EG1A 1ZPWX 2KT5A 4JI3F 3CC7S 2GHPA 1HBOA 3I82A 3GV5B 2HRYA 3ILJA 4K2XA 3WDOA 3ISZA 4I1TA 2B9XA 1TKTA 1LXJA 1UPPA 3UDCA 4ELUA 3SXLA 3Q8PB 1UJ6A 1TV6A 5KT5A 3OD2A 1A0OB 3DLEA 3JSRA 1KTQA 2DIVA 2OEMA 1NLKL 2B8QA 2Y0BB 2QFIA 1FERA 4MK9A 2Q79A 2VQEJ 3PACA 4IRDA 4K59A 4QIGA 5MLCV 4JI5F 2P9GA 5G0RB 1W2BR 2A0FB 1O6XA 3CJTA 3TZXA 3KHHA 2FC8A 4BWMA 1C1BA 2ZD1B 4QQBA 2VG6B 2JHEA 1FO1A 3OV7A 2B4OA 1Y7PA 2AU0A 3OFFA 1HD1A 5LL6d 3VGTA 3HVRA 2I6WA 3H42A 3HK2A 5HQ8A 3TJAA 4X4PA 1GXTA 1KBRA 3H98A 3FQLA 3MEGA 5HVGA 4E0DA 4Y2CA 4S0MA 3M8RA 4FZVA 2Q3PA 1M5VC 3IRXA 1SVDA 1MWZA 4GRSA 3BBFA 1YZ7A 1IKVB 3PYEA 1BQNA 1HHTP 2CQGA 2R3VA 3X1LB 1BHNA 2KHDA 3GSIA 5A2QY 3L7PA 3KK3A 2HQCA 4LF2A 4FS2A 2QJ3A 3HSDA 4U67Q 2M8HA 2QN6B 2BE2B 3KMQA 1V9OA 4J91A 2MSSA 1EQMA 4DR2F 4URGA 4EBDA 1UTAA 4A8MP 2HWHA 1FNOA 3HSZA 3VWSA 5CYMB 5KFDA 1NJIT 3TUIC 2EG2A 1FDDA 3VVUA 1V5IB 2G1HA 4DPXA 5IT9U 3KJNB 4X2BA 3R5BA 2HHVA 2X3DA 8AT1B 4E2FB 3RAQA 3G82A 2FLPA 2QC3A 4ZLPA 3KLGB 1JNZB 4WU2A 2HNZA 4WFBQ 2CQDA 2W2MP 4OYOA 3NCQA 2C1EB 4NWBA 4JI2F 4X64J 3HLUA 1I94F 4NPOA 2GMLA 1UVLA 1JK9B 4KV8B 2VH7A 2ROEA 1KQKA 4YEAA 7FDRA 1FKPA 1S12A 3TJ9A 4OYPA 2BQRA 2J8AA 3JYTB 3UR0A 4QWAA 1XN9A 4J9MA 2XULA 1X5TA 4FXWA 3OSPA 4AXIA 4KGXB 4ZPAA 3Q8UA 2GMJA 4X4OA 1K1SA 2I5JA 2HWTA 2RU3A 2UV8A 3FK4A 2M8DB 3GFYA 4IG0B 3D3CJ 3OVBA 3NY0A 2IHR1 4DWIA 1H98A 3HT0A 1FXRA 4NCGA 2IYGA 1S10A 1PG5B 1KLMA 1VK8A 4QZVB 4L75A 3KHGA 1WEYA 2V94A 1U0HA 3ZTRA 2F4VF 3CD7A 4USVA 1UCNA 2GCFA 2W24A 2GVDA 4R5PA 2KFYA 3PIOQ 2ZOMA 3ZZRA 2YKPA 3PTWA 3DOKB 3QGIA 5GVQA 4UOGA 4YB6A 1KWMA 2NPIA 4MK8A 3CCMS 1R3NA 1B3TA 2MY8A 3MEDB 2G2OA 1VRTB 4LRCA 2CJKA 4IDKA 4RZRA 4F4AA 2OGUA 2IIHA 1RT5A 3MEKA 3KMSA 1SL2A 4QWEA 1TELA 2Z4PA 3M6VA 3C6TB 1WDTA 4ECQA 2KI2A 4A8KA 2FD2A 3MR2A 1NZ8A 3BS9A 1U09A 4WFAQ 2P6SA 3VV2B 3M2VA 4O44B 2EBGA 2FJVA 1RI7A 3M6WA 2O5DA 3R3TA 2M88A 3RUBL 4AL7A 4LRAA 3LAKA 2WVDA 2M3DA 3D28A 3HULA 5HQMA 1WACA 1TVRB 1JLBB 4OLOA 1FTCA 2XS5A 4CT8A 1K0VA 5FIIA 1UA1A 2E9ZA 1U26A 5HK4A 3PCOB 2RJZA 1RTJB 1EHWA 2AGQA 5ETRA 1ZAWA 3GP9A 2F9JA 1VS3A 4DV5F 3CSKA 5DDOC 2FUG9 2UVVA 3PRBA 4OI3A 2C3YA 1REVB 5C2CA 5G0RA 4J9NA 3M6XA 1SC3B 1YZ6A 2ZOFA 5ETVA 1SKWA 3IBWA 4DSJA 1FRLA 4EBCA 4LR7A 1HW8A 2XSJB 2ASLA 2ZD1A 1F9EB 4K4YA 1X8DA 2J5AA 2D3O1 1T11A 2CZ4A 5LSOA 1X4GA 3CWJA 3QIPA 4F3QA 4KFBB 2EBEA 2OIHA 4DPWA 1FHTA 1ZM3A 3SI8A 1LWFA 2FJDB 4YOEA 2RHQB 3OXGA 3UQSA 3DCAA 4GO7X 2JC1A 3W3SA 5CAAA 2XGPA 1LWEA 2NR0A 1J5OA 5BYQA 1DLOB 5H9EJ 2DNOA 3HDSA 2BDPA 3AXKA 4ZVTB 1B64A 2DGSA 5EWFA 2D41A 1HARA 2VDIA 4RLEA 3CIMA 1P1LA 3AOAA 4UQGA 1LW2A 4JI6J 3DHXA 4ANCA 1RHMB 1CJKB 2RQ4A 4XPEA 3THPA 2V9WA 1SXLA 3WC2A 2MZQA 3H8YA 1U2FA 3LP2A 4PYDA 3CD6S 2K3IA 4ECXA 3HHNB 2IRXA 3OR2B 5CYMA 4WIIA 4JI0F 4WYWA 3RAMA 2OUGA 3TAMB 3A3OB 2RS8A 5EWEA 2D3OR 4B02A 5G4DA 1WHVA 4GVBB 3GR1A 4CZCA 2VBYA 2OMLA 1S9EA 2FVPA 4PWUA 3KLFA 3KLGA 3HJFA 2WBRA 2DH9A 3KDNA 4ES2A 2OJ3A 2ATLA 1R8HA 5DZ7A 4Y28C 2GIQA 2KZZA 1QLNA 2CJXB 1Y10A 4DU8A 4PUOA 3HVTB 1D9AA 4X4RA 3M2RB 2M9KA 3PEHA 5H9FJ 4CLSA 4LF9J 4DF8A 4OHWA 1NO8A 3IA0A 2E7VA 5E5NA 4IFYA 2MJNA 1F9FA 4X62J 2ZVIA 4ZJLA 3GJQB 1AB8A 2JRSA 2I2YA 3I96A 2ZKUA 3FMBA 3RR8A 2JLEA 4X84A 4P2XA 2V9KA 1IBMJ 4NMXA 5F8NA 2DGWA 4DX6A 1I5OB 3OXLA 4DX5A 3MHYA 1BGXT 1S6UA 4TQSA 2HGNA 1HA1A 4KQZA 5HL7Q 1RISA 2HNDB 2YNGA 3HSGA 4MYUA 2DYAA 3MFIA 3PRDA 4E98A 2XLKA 2V5HG 3E2EA 1VQ6S 4HHUA 3RB0A 3AAWB 1OYEA 3DOKA 4WIQA 1HMVB 2NQPA 4DL2A 2D3UA 2IJFA 1XNRF 1H6KX 3L7OA 4C97A 4NZ6A 4CLTA 3U27A 3OTCA 2OLWA 5KT2A 2CADA 1EETA 4MKBA 4Q8FA 1HNWJ 3SDEA 4I67A 4AUKA 2QV6A 5K8MA 3OFEA 3W2WB 2FLOA 4JI4F 1F3VA 2AZ1A 4AQYF 1NSAA 3IS9B 2K8GA 3TUPA 5CYQA 1TK0A 4JI7J 4I6AA 3BKTA 2WZ1A 2ZE2A 1M5OC 2DKOB 3MUMP 4OLPA 3RBEA 3RGIA 2XCPA 2QA4S 1QM9A 4UW2A 3KLIB 2LDIA 3OPKA 1JLBA 3AD9C 1PSDA 4ZVUB 1PJ5A 1QJHA 5KFTA 4XIUA 1SJ3P 3PJXA 3D68A 3VAIA 1VQMS 2HWIA 5A8RB 4V19J 3D2WA 2JVRA 2YWKA 4RW9A 5E3CA 2LMIA 4EI2A 4C3MA 3KJVA 4KGZB 2E7XA 1TU0B 3FMWA 3HHLA 5ETLA 4F4YA 1JJ4A 2IC3A 3C14B 4U7UK 5ETOA 3UCGA 4B3RF 4OZ0A 2CXEA 2M0GB 3MPDA 3ETMA 1NJXA 3P5TL 3H7HB 2QRRA 1CG2A 4PYAA 3B82A 3IP0A 2XSJA 4DUYJ 2R7UA 4LF7J 5KG3A 3IG1B 2XO6A 2MPUA 2R7OA 2LQ5A 4A8OA 2VQFJ 1TL3B 5DG9A 3V6DB 3TQ1A 4CH0S 1S1TB 3QRQA 2APOA 2AWZA 3QFWA 3RB3A 3T1HF 5KOWA 1VYAA 4N7TA 2H4WB 1NU4A 2E1AA 2R7VA 4RUAA 1OQ6A 1WHYA 2GVZB 1HR0F 3CDBA 4IO1A 2OI2A 1HNIA 3I5AA 4DFJA 1UVNA 1P6TA 1H0HB 1T03B 5C5JA 4YMEA 3EJMA 3MMAB 1JKHA 3GIRA 2R4FA 2RF2B 5B08A 1S6OA 4YB5A 1AT1B 3VQSA 1VFJA 3IBFB 2WOMA 3T9NA 1DLOA 4P74A 1S0NA 1T9VA 4Q8EA 2BM0A 2AIRB 1MLAA 3C19A 1WSVA 2B7CB 4CLPA 3N6NA 1VISA 4DR5J 4QOTA 2YWGA 3FSYA 4EZ9A 1SC4B 2WVCA 4QIEA 3J80U 3BSCA 2J9DA 1C4AA 3N9UC 5B09A 1NUEA 2AEMA 4CM0A 2VPZB 4PG4A 5I42A 2J7KA 3UDLA 2G4BA 4N41A 3AFGA 1FDAA 1J5EF 1IJFB 4WP8A 2WSFC 4A4JA 1BWVA 3VAFA 3CC4S 4FVMA 1B7YB 3RB4A 2X1FA 3KLHA 2O3DA 3G9CA 1LWXA 4GVBA 1FEEA 3GSDA 2FHJD 4UUWA 2L9NA 2IPOB 5M2RA 1WDDA 1U48A 2LA6A 1ZAXA 1YRUA 1S7IA 1GNKA 1JXLA 1SQGA 4OI2A 3DLJA 1PBAA 5J2NB 3NGKA 3D67A 3SCLE 1GK8A 3NRBA 2CPHA 1R8CA 3IR7B 5C42A 3U02A 2CPYA 2Y0SD 3W2VA 5J2MA 4PWDB 4DEZA 4MIWA 2UUCF 2XS7A 3M2RA 1LWCA 1QUVA 4WE1A 4KC5A 2IVMA 3MCMA 3CCVS 2AHOB 2H3EB 4J9KA 2JFKA 2Z56B 2GNKA 2W1BA 5K8PA 3QLHA 4ZVPB 1FF2A 3KYLA 3BJYA 4UF4A 4PEOA 2GIRA 2DEJA 1S48A 2DR5A 4ZPWR 3M8YA 2BE7D 1VIOA 4HDGA 4B17A 4KGMA 1S9GA 2K3KA 2KN4A 1NK7A 4LSLB 1HNXF 3SV4A 4JYAF 4O0IA 1UJ5A 1PAUB 2KM8B 3DXBA 2HVIA 5GMDA 1Q78A 5KG7A 1YBAA 4NLSA 4DQRA 4DFKA 4B3OA 1HMVA 3GPAA 4O4GA 5E3QA 5BXIA 1D8YA 3K8WA 2DNMA 5KFSA 1VQSA 3ONQA 4AE5A 3QATA 5DRKA 5AXMA 3S01A 3HZGA 1WC0A 1TP7A 4CLLA 2HFSA 1X5PA 2UU9J 3FJ2A 1F5AA 1WEXA 1OIAA 1O5JA 5FLXY 2E7WA 3HFVA 1I6JA 3ZZ0A 2OPRB 2MZ1A 3OL6A 3T41A 3DLHA 2HVDA 2A6OA 2CPZA 4OHYA 1WC6A 5A8KB 5BYRA 1SI9A 2DTJA 2YKAA 1QDUB 1HWJA 3GWCA 1JJ2R 4LR8A 1P27B 1XNQF 2BE9B 3GV7B 2N7CA 2CQBA 2K1RB 1R8PA 1PJ7A 2HPUA 5IWAJ 1UVIA 1JLAB 1OYDA 2KG0A 4Q44A 5A0YA 1MWQA 3DFEA 2OD4A 1QY7A 5JVGQ 2K06A 4X4SA 3FBEA 4DCJB 2RH3A 3DOMB 2X1BA 1C0TA 1TL3A 5CXTA 1ROFA 4P2FA 1S1TA 2IBKA 2AW0A 3SZ2A 4DN9A 3JSMA 1X31C 3H25A 2GVZA 1WUUA 3NBPB 2W4CA 1N5YB 4I4BA 1YJ9S 2RS2A 5CZVA 5KFAA 1DJ0A 2VFRA 4OZJA 1HBUA 3KLEB 1Q5YA 4ICLA 1SH2A 4DUTA 1D1UA 1OSDA 4DR4J 4QR2A 2VPYB 3BN7A 3AY0A 2DR6A 1RBOB 5HROB 4YB1P 1UL3A 3CJ4A 5JUMA 1HL6A 4TY8B 5K5MA 2Y1IA 2XMWA 2ZBQA 1Y11A 4IRKA 3D1HA 3RG6A 4HYKA 1AA1B 1RAAB 4ELVA 2AQ4A 4USUA 3THTA 2BMBA 4RJVA 1AUSL 2OP5A 1LXNA 4J37A 4ED1A 2XBPA 2L41A 2C3MA 5D78A 1VC5A 3LP0A 5IT0A 3T5KA 4B9NA 2VC0A 1Z4UA 2FQQB 1NHVA 4L76A 3H2LA 3NGSA 4O4RA 2V0NA 2ZNYA 1S6QB 1PILA 2DH7A 4TLQA 2ZHOA 3LQVA 1EKSA 5J2NA 3PEJA 5D3GA 2Y1JA 1FRHA 2XYHB 4YY3J 2BJ8A 1X9SA 1T7PA 4OI1A 1F9HA 2B0GA 1MROA 4CT9A 2RRBA 3QO9A 1PJ6A 4DSKA 2CPIA 5IT9Y 5KOXA 2OFGX 3HMJG 2AX1A 3ZTQA 5ETPA 4ED0A 3GIIA 2BOPA 5AXNA 4NLRA 5F0WA 4ED3A 1TQLA 2AGPA 1QVGR 3R6LB 1R0CB 4LF5F 1TKXB 5DLGA 1Q53A 2JFDA 3G96A 2AKWB 1OJ4A 3OR1B 1KFDA 4MTPA 4LSLA 5KFHA 5AE1A 4Y65A 3EZOA 1VLYA 5KFWA 1JLQA 4CQ1A 4CCHA 5D0EA 3OL8A 2HFNA 3E51A 1YTYA 3BV8A 4PWWA 5JMNA 1KLNA 3IWNC 4NMLA 3J81j 4OYIA 4WP9A 4CO1A 1DTQB 1F1BB 5H1SV 2IFXA 3BQ0A 3GU0A 5CA5A 2HBZB 1JLCB 4ZVQB 2W7OA 2MDAA 1U24A 4HTIA 4C8MA 2CWXA 5HO4A 2GJIA 2Q43A 5FJ4A 3KUGA 1GH8A 3QJLA 3ZXWA 4RNHA 1S1VB 1RBAA 3DOLB 2CQCA 1NPRA 3I32A 4EZ6A 3B6BA 1NB7A 3MURP 4M5DA 2UXCJ 3M2UA 4P9SA 3Q22A 5KFMA 2KM8C 3MM8B 4I68A 3SBMA 2XMMA 2OPRA 3N79A 1G7CB 1G1XA 1WG4A 4P52A 2MKJA 5HMYA 2QA1A 1OQ3A 3VAMA 5E33A 2V2KA 2HRUA 3W64A 1UFWA 1U25A 2BQ3A 2BV3A 1VQ5S 1RU1A 5D4PA 1LK5A 1SQEA 3EUNA 1DHMA 5J2PA 2K1RA 3AJDA 3UWTA 1L3TA 4U7CA 2CUYA 4N47A 4PG6A 2KJWA 2ZH9A 3KWMA 1HQEB 3UE2A 1KHVA 2L48A 1BWEA 3DOMA 1F3FA 1CC8A 3D66A 3ISNC 3RAXA 1PC5A 2PDAA 4MKVA 3R7NB 2QGFB 3B54A 5DGBA 2HK3A 2KRRA 4YFUA 2LQ8A 4FDFA 4OJ3A 1N5YA 3OSNA 5B0DA 4YN3B 2Z0GA 2YKMA 3OTOJ 3NS6A 5GAGI 1B7FA 4ED5A 3P8BB 1K47A 4ZITA 2IA6A 1TR0A 3V81A 3RYLA 3R27A 3TVYA 1M5SA 4DL4A 4NLOA 1T0TV 4R8UA 2V4QA 1HBMA 1R8BA 1RJJA 4DSEA 3MMCB 3UVJA 1O8BA 2D3ZA 4MH8A 1S1WB 1EB0A 2YWEA 2XTJP 2XNQA 4C2MA 3FNNA 4TY8A 2V8HA 4LFAF 5HJYA 3NNCA 3R5AA 3A3PB 3HVWA 5KFZA 4CWBA 4CM2A 2FC9A 4TU7A 5GAHI 4M5KA 3G8SA 5KFYA 3SSRA 2E5JA 3NMAA 3AD8C 4ED8A 5HMWA 4GC7A 1UWAA 2E29A 3UN5A 4C8LA 5B7WA 4G65A 4QIFA 1HHQA 4AYBD 3F41A 1YDLA 3T1YJ 1FA0A 1MN9A 4F50A 4WFYA 4C4WA 1TMJA 3M30B 1NK0A 5DQGA 2LEBA 3AD7C
chains in the Genus database with same CATH topology
4MK9A 2Q79A 1FRIA 3PACA 1OS5A 2FB0A 4IRDA 2HQ3A 4K59A 4QIGA 3T5HA 4EFAC 2C2RA 4GKKF 5MLCV 4JI5F 2P9GA 5G0RB 2UV8G 4P7VA 1W2BR 4KV8A 4NL5A 2HHPA 2A2DA 3BQ1A 1IXKA 3DI6B 2VFSA 3C8YA 3VAGA 2ADBA 4L6V3 3L3CA 2LU1A 3CJKB 3JYTA 2R8KA 1LW0B 2WB1D 3M6UA 4ZVFA 5E2QA 3GFHA 5HLFB 2DB1A 5EX3A 4RX6A 2YKOA 1T8EA 3KHHA 2EWHA 4CTAB 2FC8A 4BWMA 1C1BA 1CC7A 2ZD1B 5KFGA 3PHEA 4QQBA 3TR5A 3KG4A 1H38A 2QA4G 4LQ3A 2VG6B 4K5SA 4YDXA 1S1UA 1ZH5A 2JHEA 2MZJA 1FO1A 3OV7A 3GE9A 2HGMA 3FRZA 2B4OA 3SYZA 1Y7PA 5IM0A 2AU0A 1X0FA 1AUDA 3RR7A 3H59A 4OJGA 2XG8A 2HFZA 3OFFA 4Q2LA 3QGPA 4USJC 1HD1A 4WYLA 1ZTWA 5LL6d 2CG4A 4BC9A 4LMZA 1N8RT 3G8TA 4IG0A 2C3OA 4NXMF 2N4DA 3HVRA 3OFHA 3LPYA 3HK2A 1TKXA 2GA7A 4XDCA 2VOOA 4I56A 2M4MA 5HQ8A 1RT3B 1GXUA 4X4PA 1GXTA 2YKMB 4WTYA 3H98A 3ITHB 3FQLA 3MEGA 2F9DA 2XMVA 4DG1B 4C0HA 4OL8A 2VA3A 4E0DA 1ZAVA 3K5OA 2AP6A 4Y2CA 1VQNS 1V3SA 4QYZJ 1JB0C 1JMTA 4X66F 1XMBA 3M8RA 1Q4RA 1WEZA 1S0VA 1W25A 3LOUA 4FZVA 5L9XA 5L1KA 2Q3PA 3V81B 1M5VC 3IRXA 1WTBA 4DR6F 4RW8B 1MWZA 1IKVB 3BSOA 4H54A 3AA9A 1S77D 4ETZA 4PR6A 1KC8T 1BQNA 2PN6A 5DM6Q 1HHTP 2CQGA 5DG7A 4R8UB 3DRRB 1HBMB 1DQAA 2L9WA 2EC0A 1CQMA 2OSQA 3CJ3A 4FF3A 1ZPVA 1IKYA 4FF1A 5D77A 1JXEA 3X1LB 2XY5A 4DR7F 2QEXS 3HKZD 2KHDA 5MAOA 2UVUA 2LEAA 2CPDA 4DF4A 5A2QY 3NCPA 2BBEA 3LW5C 4ELTA 2XCAA 1WF1A 3L7PA 2EFPA 2XO7A 4H4KC 1NKBA 3UPFA 3MEDA 3B78A 3KK3A 1VRTA 4JI6F 2YKNA 4FS2A 4R0JA 4U67Q 4ZOSA 2DNGA 3G6ES 2M8HA 3DC2A 2HHWA 1YG0A 2EPIA 2BE2B 4PPDA 5SUHA 4WCEQ 1RTDB 3KMQA 2KT3A 1V9OA 4MK7A 4OX8A 2MSSA 2H9ZA 4NLYA 3R1LA 2R8IA 3QGHA 2DH8A 4KHPF 2VB6A 4QW9A 4DR2F 1QUPA 4URGA 1C2PA 4USHA 4QIVA 5EX0A 4EBDA 3VAJA 4CIOA 2YKQA 4A8MP 3OUYB 5DJBA 5C24A 3V4IA 1S97A 2HWHA 1K73T 4UOCA 1FNOA 1HI0P 4DQIA 2DGUA 1HWKA 1QAJA 2E44A 3CCLS 2GV1A 3C6TA 4KPYA 4LVNP 3VWSA 3TVZA 5CYMB 2CJBA 5KFDA 1G3OA 2DNYA 1NJIT 3TUIC 2EG2A 2N7YA 3GYNA 3BO2A 4C8ZA 1FDDA 4O44A 2CQ4A 4NCBA 1TKTB 1PGZA 3ZC4A 2GGPA 3LAMA 4IG3B 5A6WA 3H20A 2XZWA 3GYXB 3MDFA 1HWIA 1WI8A 1VC6A 3NL0A 4ZCMA 4X2BA 4C3KA 3FFIA 3JSYA 3R5BA 2HHVA 3J81Y 2ZHBA 3IN5A 3RAQA 3AH6A 4I0WA 2QMXA 3MOZA 5L9NA 3O6QA 4EO8A 2AJ0A 2YNHA 3IWXA 2VBZA 2SXLA 2A1BA 1RT2A 2NXUA 4ZLPA 4C3LA 3KLGB 1FRMA 1JNZB 4WU2A 2UP1A 4IFVB 2HNZA 1URRA 3CE8A 2VQEF 4PQUB 1TVRA 2P9CA 4WFBQ 5GAHU 1N88A 2ZZNA 1A6LA 1VK3A 2CQDA 4KE5A 2LLZA 3OL9A 3NCQA 3TYTA 3OLAA 2A2CA 4L3NA 4NWBA 2FGOA 4JI2F 3MEEB 1QSLA 4NRTA 4B3TF 4MMOA 3FDSA 4URQU 2JLGA 4JI1F 3KK1A 1DARA 4LQ9A 3HLUA 2ZBCA 1RTJA 1I94F 4NPOA 2GMLA 1C1CB 1UVLA 1JK9B 3I87A 2BANA 4QW8A 4KV8B 2VH7A 2C3PA 1SH0A 4LF9F 1FCAA 2ROEA 1VRUB 4LIRA 1KQKA 4YEAA 3T6BA 7FDRA 4ZCIA 3VQTA 2HYIB 1FKPA 5M2UA 2JOQA 2IVFB 1T3NA 1WG5A 2BQRA 2J8AA 3GR0A 3UCZP 3JYTB 4ILRA 3UR0A 4QWAA 3MUTP 1IJEB 1XN9A 1REVA 3OFGA 3O44A 5IZHA 4ZPCA 4J9MA 2R7TA 2BR0A 2DNZA 2XULA 1VHFA 4TU9A 1X5TA 1ZM9A 1LK7A 4FXWA 3QZ8A 2RQCA 1U47A 3AB4B 3JSBA 3OSPA 4NXNF 1C1BB 2R7WA 4QR1A 3KNAA 3I4PA 4AXIA 4ZPAA 4TXSA 1IBMF 1S1UB 2CJAA 2GMJA 5F8IA 3A1YG 3CCWA 2CVIA 2HQIA 3I5CA 4X4OA 1K1SA 3SFUA 5J2QA 1CVJA 3BR9A 1S79A 2I5JA 5IM0B 2HWTA 1S0MA 3AQPA 1SL1A 5J1NA 2JEIA 3TA0A 2RU3A 1GT8A 2UV8A 3CF5Q 3Q0AA 5KT6A 1N5QA 2JEFA 2M8DB 2JVOA 3GFYA 4IG0B 2VZ9A 2LYVA 3J7Z5 2YWHA 4OJ1A 2R9LA 3OVBA 2XB2D 4DOZA 5KG0A 1E6VA 4OHVA 2IHR1 2COLA 1H98A 5ADZA 4DWIA 2HHSA 1FXRA 4NCGA 3BREA 2IYGA 2K7JA 1S10A 4RNNA 1C4CA 2YX4A 1KLMA 3KG1A 3MEGB 3GIMA 1VK8A 3I5BA 4LSNA 4Y6IA 4KFBA 4QZVB 1XC9A 4ES1A 1QSSA 1Y4ZB 2E66A 3DNCA 3LWLA 4OX6A 2AGOA 2FGCA 3KHGA 3LP1A 2ZH8A 4DUZF 4EU0A 1WEYA 2V94A 2J6UA 3HHLC 3FSXA 3NP5A 2F4VF 5B0AA 4PG8A 3CD7A 3C2PA 4FF2A 5EN1A 1WI6A 2GCFA 2KH9A 2PMZD 1WNEA 1Y9OA 4ECZA 2W24A 2WSCC 4OI4A 2KFYA 4R5PA 2ZFHA 4F26A 3CIZA 3PIOQ 1BQNB 2ZDPA 2ZOMA 2YKPA 3ZZRA 3CCSS 1XTZA 1A9NB 3DRYA 3KG0A 1NZAA 1MMLA 4PRFA 4F02A 2RE1A 3DOKB 3DDKA 3QGIA 1IKYB 5GVQA 4YB6A 1SH3A 4LUBA 4A8SA 4TLRA 3PNIA 2ASJA 1RYRA 1MNEA 4IRCA 3PW0A 2GHWA 2C42A 2NPIA 2JJ4D 3CTRA 4MK8A 5T14A 3M8SA 2CQIA 4I69A 2HMIA 4WFXA 4B3SF 3CCMS 1FNXH 1R3NA 3NS5A 2MY8A 1DTTA 3MEDB 2VL1A 4MAKA 4RBVA 1VRTB 2YKNB 3TUJC 2NREA 1GX5A 5LXYA 2E5LF 2DGQA 3PX6A 2CJKA 3BSAA 3IGVA 4IDKA 4LJMA 2OAUA 1S1WA 1M1KT 4RZRA 3AQOA 2D9OA 3CCES 3QGGA 2CKWA 2DHGA 2ALZA 1HNWF 3BB5A 2GC8A 1RT5A 4C0OC 1RWUA 3PR5B 3UD4P 3MEKA 1OPIA 3G86A 3KMSA 1KOOA 1X7VA 2MZRA 2F7VA 4TQRA 2HGLA 2V4JA 1SL2A 5D4OA 3OVSA 5C24B 4QWEA 2QT7A 5KFIA 4FS1A 4NX9A 2RKIA 3Q23A 2Z4PA 3ZZZA 3M6VA 4FBTA 1VQLS 2CQ0A 4KB7A 1HPZA 1XBWA 4C11A 3C6TB 4ECQA 2KI2A 1YI2S 4A8KA 2YVSA 1N32F 2FD2A 3MR2A 1XMQF 3BS9A 1U09A 4EYHB 4WFAQ 5JVHQ 1QSYA 2P6SA 2KXFA 3M2VA 3EXCX 4O44B 2EBGA 2ZH2A 2FJVA 2JWNA 2UXDF 4LFBF 3MM5B 1RI7A 2AYMA 4HH1A 4CH7A 5F8MA 3PFEA 4V19X 3M6WA 4KHMA 2O5DA 3R3TA