2N3ZA

Solution nmr structure of de novo designed protein, rossmann2x2 fold, northeast structural genomics consortium (nesg) target or446
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
MGRLVVVVTSEQLKEEVRKKFPQVEVRLVTTEEDAKQVIKEIQKKGVQKVVLVGVSEKLLQKIKQEANVQVYRVTSNDELEQVVKDVKGSGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of DE NOVO DESIGNED PROTEIN, Rossmann2x2 Fold, Northeast Structural Genomics Consortium (NESG) Target OR446
rcsb
source organism Synthetic
molecule tags Structural genomics, de novo protein
molecule keywords OR446
total genus 29
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2n3zA00
2N3ZA 2MR5A 2LR0A 2N75A 2L69A 4J29A 2KPOA 2LVBA 2MR6A 5GAJA 2LV8A 2LTAA 2LCIA 2LNDA 2L82A 2LRHA
chains in the Genus database with same CATH superfamily
2ZJ7A 3GFVA 4FNMA 4R4JA 4XKJA 2HPAA 3EMVA 3FCOA 3G9ZA 5EE1A 2IUFA 2D0OB 4FHGA 3I9JA 4JB2A 4J9VA 4Q4AB 3W2IA 3CB4A 3EQ2A 4GKVA 4TRJA 1UC8A 5DP2A 3WNBA 5G1OA 4OJTA 4I4TF 4AJ1A 2OXTA 5LZ9A 2WTBA 1QV6A 3BG5A 4MCJA 4PZUA 2PCLA 3KC2A 3L6RA 3Q88A 3RWBA 1XJQA 1FFBA 2RAVA 2DWCA 4DDVA 5EJ9A 5IVPA 5JCJD 2EP8A 3VA7A 3TLBA 2Z4SA 3IP8A 1HEUA 2XUJA 4HPWA 4X1IA 1E6MA 1WMAA 3JATB 2XQJA 4F3YA 4FGLA 1UFRA 2VKQA 3Q3JB 1G0OA 1CP3A 5FWDA 1AN9A 2X0KA 3IKVA 3CKLA 4ANFA 4CL3A 1MV8A 4EJMA 4TUYF 4CM1A 3I92A 5E8RA 4ZEOA 3LBAA 2Y71A 3TGLA 4U7JA 4Q66C 1RXEA 1V8BA 3KR2A 2QU7A 4KHZA 4LOLA 4ZCPA 1P7YA 3E5MA 4D43A 3IRVA 3OBIA 1B6RA 1SHTX 4OGFA 2D0DA 2DQKA 4LV5B 5DNEA 5FYDA 5H02A 3UN1A 4ZJYA 2ZYRA 4BATA 1IHYA 4DS3A 1QMPA 1Q44A 1UFKA 2FUG6 2AMLA 1KR2A 3DVLA 4UTPA 2HC9A 3ACDA 1JLMA 1ZISA 2Q3BA 1HQYE 1RJEA 3JAWB 4IUBS 1RPZA 2VYFA 3U3RA 4IHQA 5J4HA 5CB0A 1T3GA 2PSSA 3AVXA 3ICCA 2G4LA 3BMNB 4Y6SA 3PC7A 4GOOD 2NOAA 5JXWA 4BU0A 1GKUB 1ZNXA 1P0PA 1TM3E 3IC5A 5KAMA 1KY5A 1GQOA 3UV6A 3ZTTA 7MDHA 1Q0SA 3SC4A 4EA9A 2DOKA 3ZI4A 1UBHS 2YICA 3GJ8A 2HPVA 1J0CA 2C3MA 2Q0SA 3DUFA 1O6FA 1XA0A 2CNNA 4ARBA 5LJIA 1EG2A 1X14A 4R84A 1OLXA 1CLEA 1ZOPA 4GLBA 2ESRA 3AKCA 2OYSA 2R5NA 2HU2A 4P4SA 4BWGA 1R6VA 4AIIA 5FXMA 3GJZA 5BSRA 3DGEC 3WC4A 3RC8A 4OK6A 1XJ5A 2FQYA 5A4DA 3TPZA 1JPNA 2HJWA 2FZKA 3H65A 3B9QA 1P7VA 4RHYA 4WCVA 2ATVA 4H0NA 4BL5A 5BVGA 3ZQ6A 3UW3A 1JWLA 1BROA 1T4CB 2YH2A 3SYNA 2D3TA 5JAIA 4K9KA 1ISGA 1E60A 2BEWA 3N59A 821PA 2IBSA 1GZUA 2EJUA 4EZBA 6PFKA 4Q3AA 4DCPA 2G0NA 2P35A 4EARA 5IAAA 3TLCA 5EZSA 1RE0A 4AJ9A 2FW8A 3W9UA 5G4KA 2V6IA 5BPHA 1ULUA 1HL7A 2FPUA 3BXHA 2X9LA 4MW6A 1ZVVA 4JQCA 1KSHA 4CEHB 1OWLA 4AN0A 5CNKA 4BNJA 3N39C 4H7DA 1AQ6A 4Y9SA 5ES4B 5DU2A 4YV0A 2XXAB 1M54A 1EUDA 1U98A 1J9GA 1U11A 1Y48E 5DTQA 1SXQA 2R6ZA 2JK0A 4TSFA 4TZ6A 2GEUA 1VCMA 1JEQA 5IBPA 4NIMA 3KSAC 1V96A 4Q4AA 1GPJA 3TXAA 3FGNA 3AEQA 2WAOA 1YSCA 2OC9A 3JVEA 5E4FA 5FUMA 1XYVA 1EB8A 3UG7A 1VPWA 3CBGA 2W4MA 3OFSA 2GASA 1MX5A 2ZI3A 5J4VA 1MA3A 1XZHA 4XYEA 2EAUA 5KTTA 1XVUA 1KY4A 1CIVA 1YFLA 2RK6A 3NIGB 4BASA 1HFEL 4U2KA 3OC0A 2E37A 2AD5A 1RYYA 2ZJ8A 3H11B 4MUAA 4RL6A 4X1KB 4IYJA 5B2ZA 3QUSA 1E3LA 3I01M 3O4JA 3OEWA 4MS1A 1DC6A 4P0TA 3RV4A 5B58C 4JBGA 5JSFA 3NHRA 3THXA 1T8PA 4IRXA 3FH0A 5BW4A 4XIJA 5JARA 4PBTA 3IAM6 2WM3A 3AERB 5LD2B 2FMIA 2VR1A 1TYCA 4JT8A 1T4BA 2REXB 4DSUA 3L6DA 2WHXA 1JMYA 3BSFA 3A1CA 5E6SB 3QUCA 4EQ6B 5F2NA 1CRPA 1IB6A 4KXUA 2IDKA 5A4KA 2JGDB 3L1VA 1R50A 2F48A 4PFSA 1A96A 1H0RA 4EPRA 5H83A 1U9YA 1KXJA 1LZLA 4LWOA 5FWXA 1KDOA 2JD2A 5CLQA 2I3BA 3GWZA 3RUFA 4CM3A 4IIFA 4Q9NA 1JHQA 2OYCA 3SMVA 1QWSA 2DF8A 3DQZA 3F9RA 1UDXA 3QITA 5BUZA 3TB6A 4H08A 5JAOA 2DBYA 1W7AA 4GM4A 1Q1AA 4AF8A 2OZEA 2E55A 4HN4B 4IJ6A 5ALLA 4JL8A 4JI3B 1ZH4A 1T1RA 5DTRA 4ZVQA 1AA6A 3T9BA 1JQJC 1C7ZA 4J94A 5FRDA 4CCWA 1KTVA 1HFJA 3FRIA 3KL4A 4GZ3A 5KX5B 5HM6A 1YKSA 1CJTC 1V4NA 3KRTA 3M3HA 2QTLA 4P9NA 4W5QA 2XCIA 1F9AA 1WZNA 3QE3A 1ISSA 1A95A 3PD0A 3A9WA 1YIOA 4JOBA 2OOSA 3JQGA 1Y7LA 2GXUA 5C2JB 4YX9A 4NI5A 3KWJA 5J5CA 3ZU4A 4TUYA 3CO0S 4B3TB 1L5QA 3D0OA 5DWDA 2ZITA 5AUPB 4BC1A 5BP7A 2LUOA 1U3FA 2IHBA 1AXEA 1IWBB 1USGA 5THQA 4ACBA 2VHCA 4R83A 4ZOLB 2OZKA 4WY8A 3DEIA 2PJDA 3PNQA 4L75A 2GCOA 2PUWA 2PRIA 5F9MA 4X7MA 1E1QD 3F7OA 4Q1VA 3U49A 1MV5A 1VI5A 1CZLA 2DR0A 5AJTA 3U7FB 4LSGA 2QRKA 4PZ9A 3LZCA 1DLIA 1AXRA 2WG0A 4XQGA 4HN9A 5AKYA 1E3SA 3MCZA 1NBIA 4YMTA 4P3PA 4D79A 2BN4A 2H0RA 3CH4B 3O0DA 2QZPA 1NLZA 4R7ZA 1N8TA 1YDWA 4OV6B 2OBYA 4BFTA 1CFJA 1TK2A 3CGGA 2CVHA 1NFFA 1OLUA 1TVMA 3NDJA 2HV9A 4EKIA 3G88A 3I3OA 3SC6A 4BNZA 3SVLA 4W99A 2XCTB 3D0QA 1QH8A 4TYMA 5A02A 2FNAA 4NFLA 1WMDA 4LMRA 2E21A 3PEEA 4F93B 2PL9A 1KDPA 1QVWA 3DDCA 3HB9A 3I4FA 2HU7A 1ZVJA 4PF1A 1M1UA 4ISBA 4YASA 2OFFA 1MGOA 2F1HA 2AK3A 1LJLA 2QVLA 1LVUA 2BMAA 2AZDA 3EBLA 5HOEA 1HFWA 2I1QA 2CWDA 5HW0A 2YWRA 4IGFA 1ZCJA 2B25A 1DPGA 2G1AA 4RZIA 1D7AA 1VIVA 1C9DB 5JSZB 3ILSA 3LYLA 4H7IA 4NNPA 4ZQHA 3BA1A 1MJFA 4YV1A 1B16A 3B8EA 3DZFA 3THXB 1FDUA 1AV6A 3EIEA 4EW6A 5A9SA 1T35A 3UBMA 4KN9S 3R5SA 1QGAA 3MBOA 4U00A 4HEJA 4HLNA 2RGEA 1YGYA 2RCNA 3LUHA 3AW9A 4PE5B 4QFDA 3VDQA 2P4SA 3I76A 4L5IA 2XQIA 1N7GA 3MUEA 3CLUC 1YIAA 5K3CA 4B45A 3DJFA 3I1JA 1UC9A 1PZGA 5K0JA 5CK5A 3FVWA 4LWPA 2QD2A 4ZRDA 2NYVA 5DNAA 2CCGA 1UQRA 5DBIA 3SHWA 3ZJYA 1B00A 3RAEC 2Z83A 5EXDA 2HREA 3RBZA 5BYJA 3GN2A 3GHYA 2C2OA 2J3QA 2OGUA 1L8QA 1IWOA 2W6QA 4Q34A 1YU6A 5I9MA 2CXUA 1OYOA 4XVQA 4RKFA 3PV0A 3PSHA 2VPPA 3HGTA 2IZOA 1KMHA 4G0OA 2BBSA 3HP7A 3C4QA 3WQRA 2B9EA 3AVQA 1JAZA 3ETLA 3DMTA 4GP9A 3RC7A 1TYBE 5HIJA 2VJLA 3L02A 3MD9A 1WULS 2QNIA 5CGZA 2AOTB 1NLMA 4G56A 1R9MA 1ORWA 1B0AA 5EL0A 4AROA 4JUCA 1YHYA 4BKUA 1V7CA 2GYVA 5HRUA 4ZAYA 4L9RA 1R6BX 3K72B 2E1RA 3NFRA 3O4HA 1J1ZA 1MRSA 4JGGA 3IMEA 4BNFA 3ZE6A 1OPXA 4QTTB 4NDNE 1TCBA 1Y1KE 3S7ZA 1VI6A 4KGVA 2Q62A 4FZ3A 2GCOB 1BCRA 4CETA 3E7XA 4E03A 3IXQA 1E89A 2BH9A 3P19A 5DHFA 1TZCA 5G0SA 4YJGA 1FUYB 5JVDA 3QKRB 5CH8A 2OO7A 4K7JA 1VPLA 4N5IX 1M0EA 4LBZA 2H9AA 5JS6A 1GG2A 2WM8A 2FKAA 3JTMA 2IYRA 4S1VA 3ZHXA 2IUTA 4GUAA 3RU9A 4NE9A 4L16A 1IG0A 3UFXB 3JYOA 3TTXA 3VR3D 4N3GA 5IN4A 4L1KA 1K88A 2RHLA 4IMPA 4J2TA 1DE0A 1X9HA 2NPIA 3HACA 1KH1A 3PXXA 5C52B 4HSEA 4A10A 2BEJA 4MYRA 3I04A 5HZMA 2P3OA 1Q15A 4DLSA 2RI6A 3GT3A 4EO4A 1G66A 1AG9A 5NULA 4FHZA 4E21A 4P7FA 2B4QA 2KX7A 3ZGXA 4DDWA 4Q7JB 2VP5A 3KQNA 4R2WA 3DZBA 4XIGS 3VAZA 3FNFA 4RL4A 2IODA 3GLHA 2QTTA 1R5OA 3HGQA 2CFSA 3WK6A 2H7XA 2HOQA 5DNYB 3ADOA 4XEHA 2FFQA 1THZA 3S70A 7AT1A 3ROFA 1EUCA 1KK3A 4P3XA 4KQJA 2QMYA 4BEBA 2BFCA 3EWAA 3KOYA 4PQGA 4BUZA 4DT1A 5KYYA 1ZIPA 2ZJ0A 3U62A 2XA2A 1AKYA 4NX2A 1IWPB 2OCBA 5HK9A 2YNMC 4OREX 3SYTA 4BVEA 3U7QA 2ZR8A 3RS7A 1H4SA 5D85A 1VE6A 3B38A 2YRWA 4YHBA 1F0PA 2Y93A 3JVUA 2DKFA 1GPKA 3BIXA 1CJKC 1V8OA 1B8PA 3BXPA 4BC0A 3E5NA 1EEHA 1ZUHA 2HK8A 4JIMA 4M99A 2NTJA 5CX1B 2B8WA 5ALOA 4K6KA 3BDVA 4QYIB 2HXYA 2FZCA 3EXG1 3L1HA 3N5KA 3ZH9B 1KRWA 1QO7A 3ZN2A 3SICE 1B1AA 4HZGA 4IVPA 2H63A 1PW5A 3GPBA 4QTUB 4B3MB 1J0EA 1KK1A 2EYQA 5F2OA 2XJ4A 4IDEA 3ZR4B 4YRCA 5BR7A 3JWPA 4DBVO 4OX9B 1ZBQA 1SAYA 2OB2A 1H1LB 3CX3A 4KZPA 2GZDA 3ET4A 1UOPA 3DKIA 3TNLA 2QXUA 1H9AA 2WMDA 3LHIA 3R5XA 4HLDA 3FVQA 4URWR 1IHDA 3D5EA 3I3SR 4FYXA 4UBKA 1PX2A 1JSLA 1P39A 2ZRDA 3N6RA 2RH9B 1LQUA 5EUCA 2AW3A 1WLYA 4BIIA 4D81A 4OX9Y 4OGGA 3SFZA 1FMFA 2JFXA 3G2JA 4IDCA 2JCGA 4GBMA 4XCVA 1T2VA 3RT1A 4D25A 1EJ2A 2X15A 4OHRA 3HUDA 1OE0A 5DLYA 3ZX4A 2FSIA 4FKBA 4EVSA 5CFMA 2WWVD 3IGFA 2AVNA 2YMLA 3PGMA 2PEYA 3RIHA 3Q3VA 1ONSA 4TTQA 5BSFA 3IXMA 2DPMA 3CNLA 1OGYA 4G1MB 2P40A 1SOVA 1OKKA 2CNBA 1BW9A 1FX0B 2DLDA 4MQMA 1DCFA 2IUYA 4BUJA 4EPWA 4BKMA 2HCBA 4C7KA 1U8AA 5LBUA 1R8SA 1G63A 2OCPA 1E0JA 2IE8A 3VR6D 1U0NA 4CT4B 3JYHA 3B3AA 3AILA 3A6LA 5I45A 3H8WA 4PO3X 1Q19A 2XIJA 1H6CA 2GNAA 2VUSA 4LOJA 1BAPA 5AVTA 1JMVA 3TRHA 5C8YA 3PC8A 1VG8A 1XNJA 4OLAA 1BYUA 3GLIB 1RW4A 5H0IA 1FP7A 3RVMA 4FB5A 3DLHA 3EAQA 3LLVA 3JARA 4YRKA 5JIBA 5L51A 1K8YB 2NTYC 5FI3A 4C4ZA 4CR8A 1FNBA 1VZ2A 2CDRA 4EG3A 3S1AA 3JWHA 3I83A 2J9FB 1ELOA 3ID6C 3MJ4A 3EVDA 3SIWA 4DIUA 1JW9B 4EYSA 4JKOA 2EATA 5IT0A 2HGSA 3KLPX 4Z9YA 3NHMA 1U1CA 1NKVA 4LOHA 4X91A 5I7FA 4ZMSA 2FQQA 5HFJA 1P1KA 2PWPA 3CMCO 1YB7A 3VNAA 1PUJA 2EOAA 2BEUB 5JNTA 1L4KA 3FFBA 5FAKA 1P0QA 4KR7A 4PO1A 2YCLA 1GQYA 1Y7TA 1HE4A 4EMTA 3CLTD 1CY1A 4IHJA 1EFHA 3W4KA 2C57A 2CW5A 4MV8A 1JKMA 3ETNA 2ZE6A 5JDIC 3PDHA 1GN9A 4FD2A 4YGYA 2R97A 4NBUA 5TARA 1VLLA 1ZCAA 3L7JA 1SG9A 1ZN8A 4PYMA 2ZUTA 3SEAA 4XPZA 2ET6A 2NVBA 4MUFA 1OFGA 3IL2A 2GZ2A 3IPCA 4MMZB 2GLUA 2XKJE 3N86A 4YRJA 4R1OA 3H2BA 4ENTA 3HBJA 3KT0A 3NHLA 2O8FA 3D0KA 4FBLA 5L4NA 3ACBA 4IIDA 2BSAA 1LI5A 2Q5HA 3OZGA 5JSHA 3H05A 3ND7A 4DV4B 3BE4A 4E5NA 2A57A 4AO8A 3TNFA 1QZUA 1JG2A 2EEPA 3KKEA 4Q1CA 2VJPA 1A2KC 3B1JA 1KDRA 4GM1A 3WGQA 1RHRA 4F5EA 5CLHA 2H1IA 5IAGA 2BI4A 2KJQA 3C7TA 4J0IA 3RVOA 1U7XA 4NPAA 1M2GA 1QKIA 3NXKA 4D0RA 5K4GA 1L5FA 4K0RA 3SZLA 4CUKA 1UDAA 3ZDZB 4OOEA 5C18A 3I2GA 3OUTA 2AN9A 2VK2A 1FA9A 1N5RA 3DL4A 4I4IA 2OORC 4KWTA 4PFQA 3SQXA 3LT5A 1U28C 4L28A 4MW7A 1KZYC 2AMVA 1BXGB 2YWXA 4ETWA 5B55A 1HDCA 4YBZA 2QGNA 5CVUA 2GLTA 3L2OB 4ILEA 4CV2A 2VHEA 4XDYA 1WXEA 4YO7A 3CEJA 3LT1A 5FH9A 3ZU3A 3CIOA 1EUYA 1OBCA 1DQSA 3GH1A 1QIIA 3RS8A 3LY9A 3SHQA 3QWFA 2DWUA 3A4TA 3LK7A 1SU8A 1S2GA 2GRUA 4C43A 5A0VA 1AN0A 3A1UA 3Q3GE 2G36A 1NVVR 4QUBA 1I7PA 4UPDA 1JILA 2D5CA 2Q2WA 4RDCA 2G83A 4QC2A 1GLNA 3DOIA 4Z4EA 3NGMA 5B3JC 1ZKDA 2H51A 2RKOA 3BRQA 1YA6A 1YR7A 4UTZA 3HYNA 4FNAA 2ZYVX 5IJ0B 2WQ7A 3D0RA 5A0TA 1QHSA 4M9ZA 3QEKA 5J59A 4W9NA 1KEWA 3IAHA 3Q5GA 3JARB 5DXAA 5GINE 3QYPA 3SM9A 9GPBA 1KJ9A 1L7VC 1X70A 1JPVA 1B3BA 1NUUA 3DPUA 2E85A 1FMJA 2BKVA 5G0WA 3ZQJA 2OFOA 4XJXA 1OGIA 5JS8A 1H8ED 1K5HA 3STVA 1XMQB 2FG5A 4IX1A 2NVWA 4BVKA 3X1KA 1PWYE 4IIEA 3UAXA 3WXMA 4CKXA 5BR1A 1JRLA 1XRQA 2ZRPA 3Q9NA 3QRWA 4OAQA 4RA9A 4UBNA 3ZPXA 4AU1A 5ILOA 4Q47A 3IVAA 1YZQA 3K8YA 1OPRA 4H4CA 4TXJA 5HS6A 4V1CA 3LNTA 1U0GA 3PNYA 3C8DA 4HDOB 3CX6A 4JU9A 4TMVA 3F98A 2CKMA 2I1WA 5EJ4A 3PBKA 2L0XA 4I55B 2HY7A 3SYRA 1C80A 4NEQA 5FUVA 5DNVA 1FVXA 2GF9A 3C8MA 1CQWA 4DCOA 3ILHA 5AJWA 4YMLA 1JQ3A 3I6BA 2QPLA 3R20A 3PUKA 2YY7A 3FYUB 4XSVA 4G2NA 1JDSA 2AFIB 2HJGA 3FDFA 4YRBA 1IHOA 1X1SA 3LZ6A 4QEKA 1H2RS 4RSGA 1Y8ZA 3K1AA 5ALWA 2WPDA 1RI1A 4FR0A 4K05A 4K9NA 4CMHA 2NZYA 1FVOA 3I53A 2WYUA 2DY1A 1R0RE 2XMSA 5IM5A 1GU0A 1DXHA 5REQB 3ZCRA 1SH7A 1RHJA 3U39A 3KJIA 2V54A 1D2CA 1F5SA 1VHLA 2BTQB 1CEEA 4H4EA 4IXNA 2XNDA 3O8QB 2EIXA 2J33A 5FDFA 3WQBA 4I9GA 3KKZA 1VP9A 3UOGA 1N2GA 2DB3A 4JJIA 4GNKA 4AKEA 1BJRE 1TYEB 4JR1A 3WGMA 1NR5A 4B3CA 3NWBA 4BQNA 2JW5A 2O1WA 1NR1A 1Y33E 4K87A 3EEIA 5LM3A 1OYWA 1SPBS 2VEDA 2HD4A 4MB0A 4FSHA 1U7HA 4TV8F 1VYUA 4FOTA 3OX3A 2QLJA 3OM8A 4LZWA 3O26A 4BFCA 2NO5A 4LZOA 5DK6A 2F59A 3GZNA 4JLSA 3URMA 1EFRD 2WPNA 1NWHA 3GW8A 4DIDA 2OKCA 4K9RA 5COAA 3K9BA 5IUJC 5KSZA 4EG6A 2HA2A 2W98A 3C3YA 3EAFA 1NRIA 4HDRB 4LSZA 5KYWB 1B7GO 3ZCUA 2CGEA 8GPBA 3TL6A 5CFZA 4BX3A 3WYNA 1QH1B 1DQPA 4GXRA 4B3FX 4J3JA 5JR3A 2FX2A 2DTDA 4DWJA 1Z7GA 1FP4A 1GP2A 5FULA 4ESVA 1W4ZA 3UJ9A 1O5TA 1Z0JA 3GQBA 5LZ7A 4DNOA 3G2OA 4S1NA 1XK6A 1QU2A 4N6OA 2B2CA 1G4UR 3COYA 3IUYA 3AHFA 4IZHA 4PR0A 5JI3E 1FDSA 1V5IA 4LJ9A 3CLRD 3S7TA 5B1SA 3CRZA 1RFGE 4PGHA 3KHTA 3MWDB 2G09A 2Z9BA 4XM0A 5BW5A 5KYGA 1K1EA 1TAUA 4TTVA 2OQ2A 1N5JA 1PBTA 2FFRA 4Q3OA 1G8GA 4J4BA 3DO5A 4U0JA 3LBHA 4DUGA 3DV9A 1NATA 3WWPA 4CCAA 4A26A 2TS1A 1RZRA 1MTOA 1IG3A 2PWAA 3ONDA 4R69A 4S2EA 2AI1A 1Z39A 4TSRA 3CISA 2G28A 5AUNB 2QWXA 1BGWA 4IO0A 1HKHA 2BY4A 2WJIA 2HA5A 2YXDA 3DQQA 5BV7A 3FOZA 3DC7A 3IQEA 3FWNA 4PANA 3ROKA 3L4SO 1M8PA 1GTMA 3EFEA 4I1VA 1CIJA 3ANNA 5TB5A 2WUGA 4ZDKA 1R37A 2AXQA 2F2TA 1S89A 2CV0A 4ETMA 1H6BA 2H8KA 4HUQA 4V02A 4UPEA 2C92A 4RDIA 1J5PA 4NMWA 3COVA 2DBRA 5HKLA 1D1TA 2P91A 1PNVA 2VXOA 3Q0EA 4HWTA 2JI8A 4OMFG 1Z75A 1COWD 4GI3A 1VPEA 3T9AA 2I91A 2UKDA 4M1EA 3VKGA 3HU2A 3QLUA 1JALA 3LXUX 5EGNA 5ICCA 4RJKA 4B3HA 4ND1A 5KTOA 1L5LA 3NBYC 4GYYA 1FE8A 2VP0A 1PL6A 1BRTA 2H0QA 2JIPA 2IXFA 5G0UA 3OA2A 4MGKR 1XPRA 5JRDS 5LYJF 1VB5A 4PX5A 5HVNA 1YC2A 2PFGA 3IBSA 1GZ3A 3L4EA 5HDQA 1M2OB 4HGYA 5TQJA 5COBA 3W7AA 2OBBA 1SBHA 3FJOA 5JAQA 2GTPA 1Y5NA 2D59A 2PV0A 4XTRA 1CXZA 4MS4A 1YZ3A 3FDJA 4Z7QB 2AZTA 1J06A 3DAPA 1U3UA 4TWJA 3L4KA 2QTVA 4F4DA 1L4MA 1P2SA 4PSAA 3W3AD 3OE1A 1JG1A 1A9ZA 4RJ2A 4Z9FA 2Q5IA 1R8JA 5JJ5A 1DBSA 1J0DA 4YAUA 8ADHA 1G9XA 1SUAA 1KHHA 1PSZA 8AT1A 3TR5A 1MZPA 1KAQA 3M3PA 1X7GA 4B31A 1S4QA 1LLFA 4QUHA 2RH8A 4F8JA 5HQTA 3GZNB 4TXNA 1S9DA 2PG3A 2ZTSA 1KIFA 4BPBA 1UDBA 4K9MA 1M66A 4O3FA 1EM8B 1P72A 4MP3A 4WI1A 3WI7A 2W48A 4U9UA 3VKHA 5TDHA 4UAVA 5FT9A 4BO4A 5JU6A 3SSNA 3CA8A 5ITWA 4BPRA 1JPUA 3HCWA 2IRWA 1DKMA 2XUAA 3P9IA 3W8EA 4ERNA 2WJ6A 1V3VA 1FLAA 4WBXC 1IULA 3OICA 4N47A 3D9QX 4FQ8A 3DEHA 3WA6A 1EAMA 2WK1A 1RWQA 4Q9IA 2DMRA 3L8FA 4YQFA 4H3HB 4KE7A 5FTWA 1M76A 4RZXA 1V11A 4FJ0A 3RV3A 2XT0A 4MQ6A 2Y68A 3VJKA 1YCHA 2JEOA 1EE1A 4MSUA 1U6KA 4M9CA 5E1OA 5TT0A 3QP9A 1QO0A 2V59A 3EIHA 4IKEA 5P8WA 3HBFA 1MO2A 1DWPA 1VTKA 1F3LA 2XOEA 3FUXA 4GPIB 3I0ZA 2CLEB 3ONNA 2ERYA 4S24A 3IP3A 4J0KA 3PL5A 3TXYA 4YRLA 1URPA 1VIDA 4CE6A 3QQPA 2I54A 3JZDA 5E0KB 2WIBA 2YV4A 1T4DA 5HHTA 4MQ5A 4CF4A 1H9BA 2IEGA 3JPYA 3Q8LA 1Z4IA 3O7MA 5AI4A 5LOVA 2CMDA 1YU9A 4YJ2B 3SFVA 2REOA 3KR0A 5DGXA 1GPMA 1TO2E 3CSSA 1IJBA 5HGXA 5DP1A 1L5WA 1VG0B 5AKIA 3MTQA 5L95A 3AFIA 1LFAA 3A25A 1BH2A 4HLUA 1R8YA 2BGMA 5C1BA 5HS4A 1XD2A 1BU5A 3PKZA 1EFDN 1NV8A 2GCNA 3LIIA 1TM4E 1XALA 2AXNA 3E9DA 1GRRA 3DMHA 3OX2A 5CIWA 3BMXA 1Z4PX 1B0ZA 1Z8NA 2AG5A 3GJQA 1HG0A 4KHPB 2XWQA 2P8SA 3KLBA 3QXSA 1KDYA 1ZK1A 4KQCA 3ZJVA 3GVHA 2O8EA 2OV2A 3T1NA 2M6SA 5AUOB 1Z8FA 5HK8A 5LPNA 4I55F 3S40A 2VT2A 4CQJA 1H23A 2QUZA 1PTJA 1L4LA 2CNDA 3OZWA 4BTLA 4HZUB 3QE9Y 2QD5A 4EA6A 3U26A 3BN3A 2GYWA 2HA4A 2CBXA 3IERA 1TJ5A 3PUJA 3A06A 3FCAA 3O73A 4NJOA 5BXYA 4MK4A 4F0JA 4WOKA 3QPCA 3DE1X 4NFYA 5A3JA 3VR5A 4YEDA 3NOVA 1YQXA 3WLJA 2YXNA 3A4VA 1IY9A 1QWOA 1KWGA 3WDLA 4EGJA 1YQTA 4TT3D 2DH6A 3SJ7A 3SMQA 3CINA 1YB6A 2EJTA 1MO6A 1J42A 1B74A 1C8VB 2ZIAA 3GI1A 4M0FA 1G5IA 2GPSA 2O14A 4CNQA 1DELA 1MJ5A 4ZV9A 1E1QA 1KZ9A 2XGGA 3LUAA 2JASA 3FMFA 1AS2A 1C7EA 4K2AA 4F4JA 3O8RA 2C4UA 1X1EA 2FRXA 2ID9A 2NZVG 4XCQA 2ODNA 4CMJA 4YUAA 3WZLA 3II6X 3NR2A 5LMNB 2V7BA 4DPMA 4HFRA 1AKQA 4NZMA 4QT4A 3AHEA 1WPXA 1W34A 1UK8A 3OWXA 4IGEA 2YINC 3DDHA 3T5MA 1E6CA 1ZFNA 4OP1A 1PR6A 2AV6A 3N76A 4MAAA 4AURA 2A1UB 2G5CA 3C97A 3WYEA 7REQA 2XZLA 4FM9A 1GDDA 2W2MA 4OHYA 3PA8A 2AYYA 1DQNA 2N42A 2J09A 2IHJA 2WNIA 3OZEA 4YBRA 4AP6A 3BL8A 4MQ4A 2VCEA 3AQ4A 1S01A 3TCXB 3QEBZ 3JQBA 2YWEA 3T5PA 5J2UF 3NOQA 3OJXA 3R5TA 3P71T 2FPMA 4DR4B 3ORSA 5K3SA 1PEYA 1NA5A 2J46A 4U6QA 2WU0A 4ND6A 3WMWA 5CYGA 2OO5C 4H18A 2J7PA 2IYZA 3H2JA 1E2PA 1FYDA 2YHSA 4LBYA 2VHVA 2YVQA 4PIVA 5AOCA 5AK4A 5K0NA 3A2KA 1X7HA 1GOTA 4RH0A 3KYJB 3HABA 4GR9A 4PC6A 1SA0B 3DBHA 3TOCA 3U4DA 1IN7A 3EBOA 4MRAA 1IN5A 3A0UA 3TS1A 1PJ8A 2C2MA 5KYNA 4IILA 1QKKA 1JLKA 4UC0A 2PSDA 4U2FA 1HRKA 2QV0A 1JEYB 4MVJP 1FMCA 1WCWA 4FMDB 3MSCA 1ULHA 2G1JA 3A2LA 3KR9A 1C4OA 5M5BA 5B12A 1EP9A 1UP4A 2GBPA 3LKDA 3O4FA 1JIQA 5AW7A 4A8JA 2FMTA 1K66A 3EISA 2QTGA 1NPYA 2PBFA 3S44A 1S2MA 4ND5A 3U60B 3O2QB 1XA3A 4MJXA 3E03A 3R6DA 4XPIB 4X71A 1SVUA 3MPOA 3GEHA 3RIXA 1NUTA 4R05A 5CXQA 1NUAA 2B82A 2DUMA 4P54A 3TDNA 2PR2A 3D43A 3DBVO 2CB0A 2PMCA 2QM7A 3T95A 2EZ4A 1P1IA 4JKYA 1X19A 2O8EB 4KITB 2B99A 4C4PA 1N5IA 3ZDRA 2R1TB 1O95C 3WFZA 1BE1A 2JK1A 2PS9A 4LX0A 1SY7A 3JU3A 3TTTA 3RE1A 3OCJA 5D1HA 3LP8A 1DKNA 2APJA 3LX5A 1KIAA 4RA6B 3RASA 3EGVA 4MIYA 3SVTA 1R6AA 2PO5A 1LI7A 5CFPA 4UFPA 1KH2A 1RAIA 4MQFB 3DVAB 5DEOA 1P2VA 2ETXA 4B17A 1PJZA 1KOJA 3H17A 2FSSA 1H5QA 4MIEA 1RQRA 1Y6JA 4ACAA 3DXFA 1FBTA 2JFNA 4BZPA 4C1BA 1HURA 3D7LA 4IJKA 2J0EA 5JZVA 1IN4A 3REOA 1IZZA 1TW2A 1QOQB 4M8KA 1ZN2A 1L7QA 2AEEA 1Y8QB 1UF9A 3P45A 2XMPA 3F3SA 3OTWA 1SCDA 1VE9A 2FTKE 1VKRA 5E6UA 1EXVA 3QBEA 3MQ4A 1U0OC 3ESXA 1T5LA 3FTQA 1P7CA 2P5YA 4J3NA 3T3DA 3V8QA 4BJ1A 3BVPA 4Z3KA 1MVOA 1YB1A 2H2GA 4IOKA 3VHRA 3I5YA 3Q0TA 3Q8KA 1P9NA 4UEJA 1YS4A 4WLNA 4BNXA 1E7QA 4GMHA 2M9MA 4R5MA 3B8HA 5IXJA 4NBKA 1ZU5A 4RVSA 1HO3A 1ULBA 3PYXA 1XZLA 4OPMA 4D5EA 4DT1B 4ERXA 1Q7EA 4JP5A 4RH3A 2VT6A 2OAEA 3Q72A 2XTAA 4D80A 1J1IA 2HEGA 1HE1C 3ZEIA 4GDMA 1J5XA 1M67A 1H9CA 1H85A 1G7RA 3EB9A 1G8YA 1AS3A 1O96B 4NS4A 3RC9A 4DDKA 4WD3A 2VSOA 4Y1RB 5ICGA 2QYOA 2C04A 3FHOA 3M2TA 4MP8A 2OQVA 4OB6A 5ERGB 4ZZ1A 1TU0A 4N5MA 1OLOA 3DQPA 3OQVA 3R9WA 3IP5A 1V4VA 2CDCA 3AJ9A 1WY5A 4PQRA 1W36D 4GH5A 4BXOB 3FHLA 1DTSA 3NX4A 4E94A 3PHIA 1XJWA 3UAVA 2HCJB 1DWQA 1NG1A 2R00C 4GOXA 4OKIA 5D8DA 2OXIA 3UJHA 3OEYA 3WGTA 3UTDA 3H5OA 2VSNA 1Z25A 4C0KA 2ZCUA 2YWFA 3WQQA 1P3DA 1THMA 2AK2A 4GZLA 2X23A 1NQVA 2VA8A 4UATA 3L9XA 4L72A 2PWYA 2AHRA 2SNIE 3MWLA 1X7DA 3OIYA 1DHRA 1TUEA 2K4MA 3D2CA 4IKOA 3WJ1A 2HBQA 1LBTA 1WAMA 3SEQA 5A6VA 1YNSA 1SFRA 4FNGA 1OX4B 3ZU5A 1XLWA 1JLHA 1JP7A 2CUZA 5CFLA 3DMPA 1JFTA 2EWWA 5EP3A 4YRNA 4TV9B 1JKJB 1DPFA 3U3XA 3GEEA 1G6HA 2HA7A 3PHHA 4L5JA 4X8LA 3LO8A 1KZ7B 3O8LA 1O4WA 5DCYA 4BMYA 1WW8A 2HLNA 3ZWOA 1YA8A 4LRYA 1JL3A 3FSGD 2AC4A 1MN6A 3NH9A 1TADA 4KH0A 3D8TA 1ZMTA 4DLPA 5IK2D 3ZE1B 1E9FA 1EDDA 5FBHA 4CKWA 2MMCA 4C7MA 2E49A 5L7TA 3K70D 1JFSA 3AUJB 2WUFA 4Y2XA 1WXWA 4NS1A 1CJCA 5GONA 1DKPA 3OHPA 1LBEA 4QXPA 4TVKA 1XBTA 5ITZB 5I7OA 1G8JA 1DC3A 2BEVA 4ZYTA 1T36A 3PUWA 3PWKA 5ARCA 1G59A 3I5UA 1U0BB 2CL0X 5T67A 3GGSA 1B8OA 1JG6A 3FWYA 1JDVA 4HDKB 5U1PA 2RHJA 3GGCA 4E3WA 2X6RA 1N2IA 4MI3A 1G5QA 2P9HA 2PRYA 4HGQA 4BNTA 1YQGA 3WO1A 1JT2A 2L18A 3OZDA 4JKIA 3TINA 4E5SA 2P3LA 1YJ5A 4H0FA 1H2FA 1XC7A 3AI1A 1RAGA 3DTNA 3IUEA 1KOGA 4IY1A 1OAOC 2AEJA 3KD3A 3ASUA 1NJ8A 3UJNA 3QNWA 1XCLA 5BV8A 1NY6A 4JJZA 2CVZA 2W6JD 3HLTA 4OEHA 1SBQA 3NOOA 1RABA 3FHJA 1JLLA 3IEXA 3RSGA 1PI3A 4HEQA 1GTSA 4REQA 4CG1A 2QMEA 3VVBA 1RVDA 5I9TA 3L1KA 5AVSA 1IZ0A 1CJMA 1BS9A 3GBVA 3LFTA 4HB2A 5EYPA 4JQZA 4Z4FA 1XLTA 2FUKA 3AVOA 4JC0A 4N0PA 4ZQFA 4RWEA 5IVHA 2O8CB 2GZHA 4BVHA 3KCQA 1RYBA 2G9RA 3DEAA 3GARA 1Y8AA 2ZIGA 2BI8A 4BRZA 3N2NA 5DVZA 4F85A 4LRTB 2OC4A 1CQJB 3SBDA 4BY9E 3G3EA 3G68A 3DA8A 2AN4A 2FOIA 4EW2A 2IYSA 3BT7A 4RANA 3ZHCA 1JHOA 1QOZA 1W1IA 1XPOA 4BO0A 1WXXA 3MB5A 1ETUA 2FPWA 3OA0A 4Y1GA 2OCYC 2K2QB 2Y9MB 5TMEA 4MV9A 1AGNA 3RNLA 3I6IA 4LYAA 1XE3A 4G4GA 3RRJA 1KEEA 1KYQA 4C4RA 2PANA 1D2AA 2HU8A 4B2YA 5C5IA 2EHJA 4LE0A 1ZPDA 4I1IA 3T3GA 4KGZA 4YLEA 2H2FA 3R8FA 3L46A 3SHOA 1PJRA 1CDZA 3IEPA 3KV3O 4QDTA 4U7HA 4EUEA 4H3SA 2ZI4A 3QVKA 1G21B 4MICA 2I71A 1PJBA 1PJTA 5KYUA 1E58A 3R7WB 4W7SA 4LHZA 2R4TA 3WBKA 4IPTA 4TOIA 4FMDF 4NYJR 1OJLA 4U9HS 1C2TA 1B42A 4MYCA 5JNWA 1JJ7A 4ENRA 1K9SA 3D4NA 4LY6A 2Q9UA 5FNVB 3QUTA 3R23A 1AE1A 4Y30A 1B73A 2XF2A 3OQIB 5HP4A 2A9JA 3IT0A 4BGIA 1MO5A 2WWHA 4HWKA 4WESA 2E9SA 3QOYA 2VYQA 4MRNA 3GIWA 3ZVMA 4R7TA 1HZJA 4AJKA 2BMEA 1E3TA 1HYBA 2YZGA 4DR2B 4JIGA 5HR5A 5AJXA 1XMIA 5I7HA 4YDQA 5LB4A 1Z2DA 4WE3A 4BVBA 4ZC8A 1LBSA 2DUJA 3C14C 2BHRA 4RF2A 1Y6GA 3H5WA 4TV9F 4UM5A 5TF0A 2BKAA 2CXOA 2JFGA 4XZ3A 3KETA 4IJVA 4O5AA 2RE8A 2ZBFA 1OI4A 3O9ZA 4RK4A 1YR3A 3U13A 1R0SA 4YRGA 2O5VA 3IJ5A 1Z74A 4R2KA 3ZDYB 1WBBA 4CT5A 2WVAA 3IDZA 1DWUA 1GJRA 2P7HA 3DKKA 2ZSBA 4HDKA 4K2HA 1Z5WA 4KB5A 4MWOA 3KQLA 3KTFA 1KE2A 3T7CA 5IANA 2LP4Y 1ADGA 2PVCA 4PHHA 3E6AA 1VCOA 1C7IA 1KVTA 4A1FA 2FVYA 3ELDA 4E0BA 5HIAA 2HCFA 4HEHA 4RVGA 1A50B 3LRPA 4I4NA 4INOA 4EHJA 4AY5A 2ID8A 3BE8A 1NI4A 5K1ZA 2JS7A 5DSTA 1PNQA 2JEYA 4GXQA 1LQ2A 4QPZA 2AEFA 5I48A 5KTMA 2GZAA 1XJCA 1TVKA 2LW7A 2V97A 3MD0A 3VPBA 2IPNA 2JBAB 5KVVA 4QOHA 5I7RA 2JJMA 3V5NA 1JA9A 1JE0A 1EHCA 2I0FA 2WD7B 4HYQA 1RAFA 4RD4A 4JI1B 3K71B 2B21A 3HRHA 4FEYA 5TJHA 1O94A 5JWOA 4DZZA 5AXBA 1RQLA 2VWGA 3DKVA 2CLIB 4H7KA 4JI0B 2IQIA 1GZVA 3OQHA 4MVJM 4P5DA 1X1BA 1A7KA 1YACA 1F48A 1YRHA 3D7MA 4EABA 5AM3A 1N77A 4HGOA 1EG7A 1YB4A 5C35A 4F4HA 3VH3A 2WMOB 4LIPD 1Z9BA 5JEDA 3GRKA 2OD2A 3MWGA 4C14A 2VDKB 3EXHC 4UD6A 3JZFA 2A7XA 3OT1A 3ASYA 2J0QA 2PE5A 2V7EA 2VAWA 2H2WA 3INYA 1SUCA 4GNRA 4YS6A 5EPOA 3RYTC 5T6MA 1P73A 1PL7A 3TDMA 3T7SA 2CVOA 1U4NA 1TEHA 1GRQA 2FW9A 2C8VA 1B41A 2TMGA 1RJGA 3BH0A 3KXDA 4UVDA 4YQEA 4R51A 2V5AA 1E98A 3SP1A 4BNNA 1O57A 2PY6A 4OBXA 2Y27A 3BB1A 4W5OA 1UXIA 2XQKA 3DZCA 2VDQB 1JBQA 2V7GA 3IP9A 3KB1A 1SCAA 1DIBA 1SOAA 2YKGA 2VDVE 4RVOA 4ZQCB 2VJKA 1FYWA 1CHNA 2FSPA 2GEBA 2Z1NA 1EVJA 1VE1A 4EF4A 4ZTUB 1OLSA 1DIAA 2E4ZA 1DSSG 1HDXA 1WSWA 3G2IA 3ND9A 3M6LA 3O8QA 3QW4B 3X0DA 1KQGA 2YYZA 4MLCA 1TQDA 2DT8A 4LMBA 3ZY4A 5BSGA 2FLWA 2GZ3A 5JADA 3F2IA 3L7YA 2BR4A 1JIKA 2ZS7A 2TSYB 3CVVA 2FOLA 3AUFA 4DRXA 1RWBA 1KZ6A 1GG9A 2FN8A 1X86B 1U0RA 2QV7A 3QX8A 5CRIA 1Q7RA 1W52X 4RX1A 5C5EA 5M34A 2XCOA 1NLUA 5IRCD 4J1NA 4U1RA 5L7YA 5H3HA 5EHIA 2I22A 3VR5H 4DCGA 4HDSB 1V8ZA 2A9FA 3Q2IA 3WLIA 2REQA 3ZIAA 4EATA 2C7PA 5IVKA 1D8TA 2G9UA 1M1NB 3FLAA 4ZV7A 1I7DA 1NW8A 1W47A 1F60A 1Z68A 4HY3A 3FPBA 3OJEA 2R5WA 1TT5B 3QVGB 2ODTX 4KQEA 5T5QA 3TX2A 3ZE0B 1BVYF 2J41A 2C07A 3OI7A 3PSAA 1ADFA 1YBMA 4D0SA 2JGLA 4LXXA 1Y37A 3GQBB 5IC6A 2GJ8A 5A04A 2V7PA 5FWAA 5EMLA 2XE7A 3LDHA 3S2IA 1J2UA 3EFBA 5K0CA 2J5RA 1Q95A 5F23A 1IC6A 1IPFA 1DRVA 1NMEA 1A4XA 2JI9A 5H5JA 2VQEB 1G7CA 2WIGA 5CAEA 4LECA 1D3AA 1F2UA 3KX2A 3T9FA 4CG3A 5L3QB 1SHKA 5C3UA 1Z28A 2LE0A 2J4CA 5KB3A 5CNIA 1Z6ZA 3F4KA 2HWXA 3VZRA 4D9JA 5CB4F 3GUZA 2V3CC 3M8KA 5HFAA 3TRKA 3I9OA 1RHQA 3RSFA 3RRYA 3LDUA 3HO8A 5D6OA 1VXOA 2ZAOA 2O3QA 5HCUA 1JKFA 2AA3A 2X5OA 2JIQA 4RJTA 3CN7A 4YA6A 3MJSA 3PIRA 3ZWKA 5BVHB 4O4HA 1NPDA 3B1FA 2KWIA 2GDJA 2A9PA 2YJTD 5DI3B 4JNKA 3S2EA 5DHUA 3RIEA 3PHGA 3FYDA 4JOSA 3T3PB 1FNMA 2ZQ5A 2A0YA 3LMKA 3EUAA 3Q7EA 4UHEA 4DG8A 1G60A 2AOUB 1X6VA 5E6RB 2O8NA 1X15A 2VDUE 5IABA 3M5DA 1OU0A 4TN5A 4DILA 5K3DA 1PIWA 3UGQA 1BKSB 2J9YB 5CX4A 5EQDA 3V00A 3WLPA 4EI7A 1LPNA 1OIWA 2HYIC 4MQLA 3MBKA 2W8BB 1Z08A 5FA8A 5LQRA 2ZRCA 3CNNA 4DLLA 2JHCA 5JCJA 3H9BA 4M9QA 3LY8A 2XQFA 4L15A 5EKTA 4BHTA 4C0HA 4AZ3A 2GPWA 4XX1A 2PN1A 3QKWA 3CFYA 3AETA 4U6SA 4BE4A 5JZOA 4E13A 3DLTA 4D9NA 1QG6A 1HE3A 1POXA 3DOFA 3GLSA 1N9GB 3UWPA 2FPGA 3DPSA 4TKUA 4WZZA 2IP4A 4FYVA 3HRIA 4ML3A 5KOHB 1DAKA 2BFBA 4P58A 5M2QA 2X5KO 4RVCA 3B48A 3AJDA 1Z36A 3V7FA 3CX4A 1RKXA 1X7ZB 1NAIA 2WV9A 4G5YA 4DREA 3N7TA 1MW9X 1ZICA 1B14A 2ACEA 5E3JA 1QPBA 3AM5A 1TTHA 1XMXA 5DMHA 2G3YA 4EB6A 1L5RA 2Z2ZA 4RMJA 1YZYA 2JLVA 4R8KA 2ZI9A 4EUFA 3CUUA 4KPUA 5IKOA 2VDWA 3GP8A 2RK4A 1TPYA 2J32A 4KMRA 1K8QA 1Q7TA 3VSCA 2GBLA 2Q7OE 3RAJA 1IQUA 1OU4A 3ANTA 4MUIA 3M7IA 1I3MA 2ZSEA 3K5PA 2YRXA 1LVGA 2GOYA 1SBYA 4FIZA 1WETA 3P9ZA 3U7QB 4E22A 1TCCA 1UJ2A 1Z0UA 3EVGA 2R11A 3FDZA 4FBMA 2XRZA 3KSRA 5KTPA 4FEAA 3V48A 4LFAB 2IYOA 4NZOA 2QSUA 5JH7A 5TMBA 3IMKA 3HJUA 4UNPA 2QX7A 1RFLA 4B7UA 1PW7A 4W5HA 1S8FA 2B8JA 3OQNA 4FDAA 2PTGA 4MCIA 2GPTA 5CG2A 1KIMA 3AYXB 1L4FA 1V1MA 3IPYA 1OIXA 5J47A 4O63O 1N6KA 2Q2NA 3MQFA 5TQ0A 4BBJA 3CNQS 1M6VB 4KH1A 3E5RA 5E2AA 3KHUA 4LYYA 3ABOB 1ZHOA 1VHJA 4X6LA 2CYCA 3EPHA 1TCAA 4HDAA 3VR1A 2DKNA 3LT4A 4OHMA 4JP1A 3H3FA 1PDVA 2D13A 4MZXA 3LW8A 5BWCA 5KVAA 3KR1A 4GRIA 4YQYA 1X7WA 5GZ6A 1YS9A 4US2R 2C96A 4KL8S 3BHNA 4ZI7A 1G42A 2P4UA 3EIFA 3T12A 3DHEA 2J07A 3E7WA 1JVBA 1F8FA 4F7DA 3KXPA 4E6PA 4WZBA 1G20E 1NI3A 4FOLA 2WM9B 1FTNA 3GN1A 5BQXA 3H9QA 1TAHA 4XOIA 4J49A 4EY5A 4MA4A 2QMQA 4QGBA 3SF8B 3QKIA 1ACLA 1V1RB 2I4NA 2ZRNA 3JQ7A 3A1EA 2Z3WA 3UNXA 3W2EA 4AJLA 4F6RA 1DRJA 2D1SA 1W4BA 1IBSA 2R6CA 3DTVD 3N2YA 3PEFA 4RC9A 4S05A 5H1YA 1LJUA 4PLWA 4HMOA 2OD9A 1DBIA 1NSYA 4I0WB 3LX8A 2DG2A 5AOBA 4EJSA 1VLVA 3I5MA 1L1FA 2X22A 4YMHA 1DG1G 4YT8A 1N9GA 4L4XA 3DZIA 2BFMA 1CUWA 1MD9A 1XZKA 1Q11A 2EWMA 3HC7A 1PGJA 1N0UA 4QBFA 4B1FA 4DSOA 4IGAA 3JAMA 1OBOA 1RM5A 2CBZA 3WNDA 2UDPA 4DV2B 4ECEA 1PSDA 2OA0A 1X94A 3V4SA 3T1HB 2PRJA 1JBEA 3NCTA 1AZWA 4GSKA 4TV8B 3ZDBA 1VPDA 2BLLA 3BMQB 4HADA 4B8WA 2GVDC 2Q0HA 1AS0A 3H84A 2DHQA 4B71A 1GAJA 1ZSYA 1YBFA 3BFPA 3LKVA 4NARA 4MWBA 4ONEA 3R7LA 4C87A 3DAOA 1N32B 4ALJA 4G37A 1TF2A 4EPTA 2ZVQX 1BEEA 1GYPA 1OZHA 1ECFA 3Q7PA 4KU4A 2GCPA 4MDFA 1WUKS 4ZT3A 3AL3A 2ZSAA 4QHSA 3WYDA 1PJQA 4PC7A 4RDXA 2HWKA 3FIJA 3OQ1A 3VKVA 3M82A 2PUTA 4FPXA 4Z7OB 1EBBA 4BMCA 3RUEA 4Q48A 1JH8A 5ALEA 3EEBA 4ZOEA 5IYZA 1PL0A 2A1UA 2CXQA 4OP2A 4QJ5A 7REQB 4Q02A 2ZXFA 4BB0A 1IVNA 2DCUA 2I87A 3HPRA 2AB0A 5BNTA 3OLWA 3L07A 5K6RA 3IQGX 1ZQ9A 2F8TA 1SC4A 2ZAIA 2PKXA 3LQ1A 4HQFA 4D8TA 2CLDX 4MW1A 4E5PA 5JHGB 1IXZA 1PN3A 1TK3A 3WB0A 4DV0B 1XZGA 4FDTA 1COZA 1LBHA 3KJXA 2XUKA 5AI6A 4HXGA 4FNOA 3N2GB 4BP3A 4FMCB 2Q6TA 4HRAA 3FZNA 5E1BA 3RD5A 4WZAA 1C1YA 3PFWO 2CD9A 4GKBA 4RZHA 1PO7A 1G9TA 5LQMA 4UXIA 1LX7A 2ZRAA 5KNCH 2V8OA 2CT8A 4ND2A 5EHZA 3FNGA 5EZYF 3NC4A 3L9WA 4HAIA 4Y9RA 4BFYA 2F9LA 2VFAA 2J9ZB 4U3JA 2L19A 2VRNA 1YHZA 3N07A 3W3AA 4P80A 2HMYB 4RKYA 1YJBA 2JLSA 1MA0A 3AL0C 4WLFA 1BFUA 1F12A 1MC5A 1YIDA 1Y6RA 5AHRA 1A9TA 2SHKA 4INJA 1GUZA 3WGKA 1OREA 4F71A 1GU7A 3KPWA 1G98A 5L3SA 2JFOA 3QVLA 1YD7A 2G40A 3GK3A 5HMLA 2N1BA 1Z6YA 2GF2A 2PH7A 3OF2A 4Z1MD 1OZ0A 4LZLA 2F8SA 1T0PA 2VHYA 2N75A 3IB6A 4FHEA 4RGBA 1LBIA 2QZ4A 2WD8A 3D1VA 3HBMA 3K0CC 4PX9A 5AI5A 1GHTA 1GNTA 1M34E 3IX7A 1GSAA 2PLRA 3H6HA 1Y1RA 3LFUA 5SZKB 3RIMA 5DJ5A 2CLKB 1A71A 4LNUB 2PFKA 4Q6WA 4UCXA 4W5RA 2AUTA 2M98A 1O08A 3PGXA 5CLJA 3VPXA 1E7YA 4X3CA 5IKMA 1PR2A 2RBGA 3R76A 3NBXX 3PXUA 1IY1A 2RGYA 2NVOA 3AVTA 3MT7A 4I3FA 1HNXB 4BZZA 4HNSA 1ML4A 1RD4A 2J6HA 1QFYA 3N8GA 2OV6A 2P68A 1FFEA 3HJTA 5F7JA 3P2IA 4CZ2A 1YVDA 2C2ZA 3BTVA 1L1EA 3K0FA 1XZQA 4IEIA 4F3NA 3S8MA 3VGJA 2HU5A 3IBGA 5EA2A 3HI6A 1V39A 3RYCA 2Q1UA 2X9GA 3Q6NA 1QP0A 3NUGA 3KWMA 2H4HA 4ZVPA 1LC0A 4H6PA 1M1YA 2C00A 5AVYA 5MN6A 4B47A 1QP7A 1FZQA 2AG8A 2Z0MA 1Z4MA 3ANXA 5SYNA 2ECFA 2VTDA 4URUR 2BKUA 4UXHA 3W5UA 3UH0A 5I47A 2PYDA 4Z86A 4ZQBA 4HYTA 5FBQB 1EK2A 1P6XA 3RSQA 3WQHA 1Q1NA 4NJMB 5JO9A 2RGRA 3R5KA 1GCIA 5CM8B 5EKUA 3GMDA 5CU7A 4KXMA 2OHOA 4KQMA 2A9QA 3HMQA 4BFLA 9ATCA 1XNRB 2ZREA 3ACCA 3AM1A 3FUVA 1PDOA 4IQGA 2Y1FA 1XAIA 1JWBB 3D6AA 4OYYA 5F2EA 3R3JA 1JSCA 3GG2A 1K6IA 2G8NA 3DD5A 3B1ZA 3PR1A 3B13B 5KOYA 2W2XA 1K86A 1Q3KA 1WA5A 2POQX 4NBRA 5JBQA 1XVIA 1XMPA 5JC8A 2HRDA 3TCNA 4ME6A 1KGSA 4OSPA 1F20A 1NV9A 4QQKA 2YFHA 3VNSA 2PUEA 3D6VA 3FNEA 4XVUA 1JR4A 3MWKA 3WGVA 4FN5A 1IM5A 4TL8A 1F3OA 1RQXA 1K6MA 1UBCA 4O4JB 1O96A 5K3EA 1Z5NA 2GBIA 4ZN6A 3HZZA 2QEQA 1RAEA 2WHPA 3TECE 3H1BA 1TQ8A 4IQ0A 4N3NA 3AF2A 4F1JA 1QIEA 1VJRA 3TTUA 5JI2E 3VSBA 2IF0A 3ANYB 1H5UA 3JYLA 1EGQA 3B7GA 5IBQA 2ZJ3A 4IDFA 4L4UA 3TN7A 2C4NA 4BNLA 4LY9A 1H4TA 4Y1FA 4PWYA 2WSMA 4QJ3A 3CRMA 1HNZB 1E6KA 2O8DB 1SC3A 2V98A 3UG6A 1SHZA 2CK3D 2A4KA 1KQOA 1P1HA 2CMHA 3I6MA 4HBGA 4MW9A 1GR0A 5IDVA 3N8KA 3Q98A 4YUVA 3RKSA 4ROTA 3WKAA 3F7NA 2OAP1 1NW6A 1A98A 1K5PA 1Q16A 4TTAA 4P7KA 4EB8A 4ALIA 2QRHA 2XVYA 3KT3A 4AW9A 1Y6FA 2C4WA 4QBHA 4N49A 1LD3A 3E22B 3TAHA 1Y89A 4NG4A 1C4XA 4CKBB 3IE1A 3H9JA 3RFCA 1TA9A 3STTA 4H17A 4K86A 2VF2A 4WNAB 1EX9A 4N3BA 3C5CA 4QGSA 2BZ0A 3S2SA 3E2MA 3O31A 2L42A 1IEVA 4RA9B 3S29A 4F46A 1JR6A 3IAFA 1MXHA 1T6BY 1Q0RA 3O95A 4WXEA 1MOSA 1T2UA 5A4AA 2EERA 4JA2A 1JF8A 1QRRA 3ON5A 1GUDA 3VPCA 4CKWB 3QE2A 3OIDA 1E2KA 3CC8A 1LRKA 3VYTB 1E2HA 2KPOA 4KXQA 4AN4A 5KC8A 4WPGA 4FW8A 3UMMA 3CR8A 3E27A 1WSBA 2WTAA 4UHDA 5HOQA 5AVOA 2BEKA 3PQ4A 4CBVA 2PUBA 2W00A 4BGEA 3D8UA 3NTQA 4HDMA 1QSGA 4KIJA 1BDIA 1CP2A 1QIJA 1FS5A 2J30A 2J6BA 2OBNA 4EDHA 5D5QA 1I2CA 4TMFA 2H5LA 5AH0A 4ZT4A 5LA6A 3WJAA 4EKDA 2HBYA 3I34X 1OI2A 3D8HA 4V0RA 1PK8A 4J7AA 3USES 4RWZA 4Y18A 1FUIA 3HEMA 1R0KA 1ZXBA 2OK7A 2O23A 1DO2A 2QLTA 4PXAA 1Z6XA 2OGTA 4XIIA 4GI5A 4X85A 4FSDA 2WHQA 1NI5A 3CRRA 5LDHA 2WUVA 1EI9A 4KR9A 2XZTA 5CT6A 4YRIA 1U4OA 1MHPA 2QJTA 3AKDA 1NSFA 5DHRA 1D9XA 5JFTA 3G5AA 5H3CA 2WDPA 1BHSA 2QVXX 1ZJ4A 1XWIA 1JZTA 3O8OB 3PFIA 4FU0A 4PLYA 3S68A 1RKVA 4FZRA 1IPHA 3ZCSA 1N6RA 5JOQA 3T3HA 5JAZA 4OD0A 3RT9A 5KQGA 1WVGA 1A9SA 1OSNA 5F1PA 2BGTA 3AIOA 5HF6A 4C04A 3SQWA 4H7PA 3ESRA 1JHUA 5FUBA 2H17A 5H4GA 1RRVA 2VK8A 1WUIS 4TQ9A 3DAYA 1XXHE 3F4LA 1FFXA 1P9LA 3GT0A 4HDRA 4MUYA 1QF6A 3FNBA 4R6XA 2A14A 2XOKD 4QECA 1C3JA 1UPBA 1NC1A 3LOPA 2IK8A 4A6PA 3AR8A 4OJNA 4DV3B 3GFGA 4C7JA 3DDUA 4A73A 2VSFA 4G1VA 4MGEA 1QANA 3AWDA 4C89A 3F5SA 5KKCA 3L8MA 4MRSA 3V9PA 5ALIA 4KI0A 2PAAA 4NH0A 2O57A 3QQ5A 4W1SA 3NNNA 4GP7A 1RHUA 2P4HX 1EJBA 1CUXA 3EMKA 4LWQA 1CYEA 4B46A 4R6WA 2DQSA 1DIHA 2DTEA 4DCVA 5FOVA 3FGPA 1N2CA 3TKAA 1KQ3A 3EPLA 1TIKA 3PENA 1P0CA 2Q6LA 2RB5A 4QO8A 3B82A 4M37A 4WINA 1PFGA 2VLIA 5JSQA 3MJTA 2C94A 2CB9A 2HX1A 3CXUA 1N0IA 3K73O 5BN4A 4IMJB 4G0QA 4NH4A 2OT3B 2AVDA 3A1WA 3ELWA 4Q18A 3W6NA 4D57A 1RT9A 5JS1A 2DM6A 1NW3A 5IF9A 1N3LA 2RJNA 4EUHA 1X8JA 1OB5A 2O8VA 5SICE 2EQBA 3E9EA 4UQLA 4Q7MB 2PEZA 3PEYA 3PTLA 2QN9A 2VZ0A 2NMVA 4PPYA 1H2HA 1RBYA 2AMYA 1UZUA 4YVFA 1QYWA 3LL7A 3I9KA 4QDXA 4KZKA 1E5XA 2HNKA 2PZMA 1O9HA 1QZ3A 4XWWA 3KQOA 2DQYA 2GHRA 2SBTA 2W83A 2XUOA 3O3CA 1U2GA 1RLUA 3M83A 2R44A 3HXPA 4JLBA 4QOFA 3WG9A 2V7UA 3LECA 1N25A 3GA0A 4FE4A 3EEFA 1P61B 1E5VA 4HDNA 4CIBA 1E8DA 4OHPA 1DG9A 2J5KA 5KZMB 1NUHA 4N41A 5SY4A 4US1R 4R5HA 2I4LA 1XEXA 4LBVA 1ZG3A 1PJAA 1ODTC 3FWKA 1I1NA 3F7MA 3PVSA 4MVWA 3SEZA 4B4OA 2PKCA 5TPZA 4TLBA 2C4VA 5I9NA 2NO0A 1NXSA 4X20A 1NLYA 2ACVA 4EWLA 3BDIA 2IYPA 3VO9A 1JHAA 1Y81A 1M6EX 2WWRA 1FU4A 2FMUA 3ISJA 2CLLB 5CGQB 3CZRA 5KHLB 3PTAA 4D8XA 3PFKA 3KDSE 3SC2B 3ZW7A 2GN4A 4GKJB 1YRWA 1X7YA 1ZYUA 3W9BA 4N3CA 5BQOA 5ICEA 2GESA 4B75A 3RAFC 3BREA 4KQ6A 2E6KA 4D3ZA 2VI5A 4P36A 4RGYA 3AK4A 3T3EA 5CCXA 2GXSA 1SZDA 5KNDD 4A27A 2O2JA 4KE6A 3R7AA 4QULA 2JLXA 3T1QA 4EMBA 2MHCA 3OLXA 3CVJA 5I5GA 3ZHBA 1EQUA 2YRFA 4Q0MA 5AM2A 1IHPA 2WSBA 1P4AA 3R5HA 1AUOA 4XFDA 4XAQA 3C3BA 3EIWA 4TTIA 2CLOB 2RGXA 2VJOA 3BDAA 1HRDA 1L8XA 1ZD2P 4MUGA 5DX0A 5FUWA 3RC3A 4AO6A 1I10A 3WE7A 1UWVA 1CJBA 2WC1A 1PG2A 4KUEA 1XV5A 2YIMA 2R7AA 1TFUA 3AM4A 4BVFA 4QASA 3MXOA 4C7OB 1E4VA 2BI7A 2JIDA 4H1HA 3EUEA 3DD1A 4Q82A 4MMYB 3DLPX 4DNQA 2V7QA 4AO7A 3AZQA 3H16A 4GWLA 4CQMA 4DA9A 1ZIYA 2R8XA 2ZQZA 4PYQA 4LJ7A 3SS7X 2BMWA 1E2MA 3QV2A 3K6SA 4J75A 3ZKWB 4CQNA 1DQRA 2B1IA 3JATA 4JDPA 5JW6A 5CFOA 2PZFA 1A2QA 4N40A 3PFGA 1W6UA 4RHTA 1ESNA 2BM9A 4MROA 1UFOA 4IGIA 4YP7A 2BL4A 3RG8A 1DXOA 1U5CA 4Q7EA 2ZZMA 1WTCA 1MO3A 4DQUA 5JYEA 2MYUA 3FSRA 3LIPA 1P17A 3VNRA 4DRZA 2CXPA 3J7AC 3TAXA 4K28A 2JFVA 4TYWA 2Q21A 3CXRA 1N5DA 3C2QA 4P4TA 5IVDA 3SZRA 1MFPA 2A9KA 5DRYA 1VMAA 1SHUX 4OFBA 5KINB 4P34A 1RP7A 4JYCA 4YT2A 4GI7A 2ONCA 4Y2JA 2ZXEA 1TMYA 4X60A 4ZOAA 3C6XA 3ADCA 2RONA 1CUGA 5J4LA 5KSOA 4YAEA 3FCCA 2NUPA 2QRLA 5EZQA 4BQFA 5JZMA 2Z1MA 3I1YA 2C5GA 4QUAA 1TL7C 3P94A 4Q4LA 4ER6A 3GIDA 3SHTA 4F9TA 3V4PB 1RJWA 3RRBA 1MU0A 1Z5OA 2ZUUA 2HJ9A 1YFKA 1Y98A 3ROMA 4RSHA 2C7VA 4Q19A 2E4VA 4Q9JA 1BS1A 3MINB 3C24A 3VKWA 3ZG6A 1QR6A 3WSWA 4LBWA 4E14A 3SQOA 1VHDA 4Y0VA 3CJQA 4DLRA 4IXDA 5EUMA 3PYMA 5I4KA 4NZZA 3AUAA 3FBTA 1N2CE 1UMBB 3HKDB 1G5RA 5KPJA 1GSHA 4TT8A 2XMCA 2Q41A 4AL4A 3HB1A 1LU9A 1JZQA 4BYGA 4ZEMA 4RO0A 5T41A 2IGBA 2DFKB 1WZEA 1MZVA 3HU3A 1BD4A 5EQTA 2ZIXA 1Y7IA 3OSUA 4ZKEA 2V7XA 1BC5A 5FNZA 2R7NA 1EUDB 1MEOA 4IYRA 3TZKA 5A3RA 4CG0A 2FXIA 2G82A 4KSBA 2F64A 4F21A 5MN5A 1Z47A 5ISMA 3WMRA 3JRXA 4L0DA 3WLMA 2FDCA 4BB6A 5JANA 4TMKA 1MDFA 4B0PA 2X1MA 2WE8A 1LF0A 2QMZA 3KKQA 4RLHA 1YDGA 4NEGA 3JS5A 1WU7A 2FWRA 1MXFA 1CUSA 1JIJA 3L0ZA 4LQ4A 3OTHA 4EI9A 2IU6A 3O1LA 4LK3A 4ZAFA 3RBAA 2O1SA 2OLJA 3LY5A 4LJYA 2ASEA 5DHAA 4F2PA 1M2EA 3K0KA 4JYZA 1Y3IA 1O2DA 1R15A 4OFXA 1H05A 1C3VA 1ZVMA 1KVSA 3B70A 5L40A 1DX4A 4Z4CA 3L8GA 2XNKA 4BFWA 3WL5A 4IJ5A 2QD3A 4PCUA 3BMOA 2YS6A 1CERA 4L50A 5TIIA 3LQYA 4MR8A 5CLGA 2O2XA 4TKUB 3TQCA 2C9YA 2ODWA 1DUSA 3KJGA 1FC0A 4OCZA 3VSDA 3NBAA 3DEFA 4URZR 1E64A 3TUZC 1D03A 3BCHA 3JAKA 5GM2A 1KJ8A 5EXXA 4CN9A 4NVRA 2BGUA 5FORA 2B30A 5JRJA 3G7NA 3SAJA 2Z2XA 1ZO8A 4A36A 1IUNA 1YT5A 2J5XA 3E9ZA 3ORYA 4LVUA 4X9XA 3RVSA 1PZEA 3V4LA 1C41A 2G9NA 4D74A 2ANCA 1CQXA 2VUIB 2AKYA 3LUGA 3A31A 4EDFA 3AV3A 4CU2A 4P2BA 2CHVA 1EEXB 2R8YA 1KKUA 4JODA 5F5XA 4R2JA 1MQSA 3IQIX 3T7IA 2VDWB 4YGXB 4PYOA 1DINA 3H1EA 1WPGA 1ZSVA 1LBQA 2C9ZA 4FKMA 5CR9A 3H5TA 1IPEA 4HV4A 1KERA 2X58A 4GBJA 3HCPA 3ZLVA 4GOJA 2NU9A 3RSHA 4REMA 4YI3A 4TVSA 3L6UA 1YCFA 2XUPA 4V0SA 2V0GA 3JR7A 1SEVA 3W5CA 2OV1A 5EMKA 1R4ZA 2HMAA 3PQ6A 3P5SA 4RJJA 4WY5A 4ZRMA 3NMUF 3V80A 2A8YA 4FGKA 5C46F 4AAYA 3EF0A 5DHSA 3L5KA 3ZEAA 3U1TA 3VR6H 3CUWA 2XEDA 3DVSX 3UENA 1AMOA 5KDLA 1FS4A 4TLLB 1QQ7A 2EGUA 4IINA 4EELA 4ESHA 1GL7A 3DWGA 3JX9A 2FWJA 2ZIEA 2I7VA 2PS3A 4MKHA 4UAJA 3GJXC 3TQIA 4YCMA 2VUUA 2EL9A 4RZSA 2D0PB 2WF9A 5G3YA 4YMGA 1TECE 2DT5A 3OBBA 5EIFA 1II8A 1UM8A 2A1TR 5FQOA 2I4RA 1VG9B 2EBUA 4HC4A 3TEFA 4ZXPA 4Q3KA 1UMBA 4BMVA 1WLSA 5TQ0B 2QY9A 1XG5A 1K7XB 3AVYA 4OQFA 3IVXA 5CA0B 5HJ5A 5LP6B 4K9LA 4XUCA 4WKCA 1JSZA 4IGKA 1ZX1A 2MOKA 3TYXA 1UOEA 4BQRA 2VJBA 2Q3JA 3OMWA 4OQPA 1G3RA 1SIBE 2PKQO 3TVTA 1IIRA 1I5OA 4UEOA 2NGRA 3QEMA 4GMFA 4IFEA 3P4YA 1OLUB 1IYZA 4A4DA 2B5WA 1Y3CE 2IE0A 3D3NA 3H2YA 4QQRA 3ZJ4A 1CV2A 2ZIVB 3FJYA 3A8TA 1S02A 2WV7A 2J8ZA 4HNRA 4KLCA 3GLFB 4HT3B 1NQXA 3AR6A 1NVVQ 1BRMA 3HVUA 3LUKA 4MRRA 3AH8A 4I19A 2OENG 4EECA 4ZVSA 3KOZA 1TAQA 1WB4A 3P27A 5B2FA 1LK5A 1H2EA 3KZMA 2Z6AA 4ND7A 4Z0HO 1TDJA 2O0MA 1INLA 1OF1A 2FQXA 2PAFA 3PLRA 4MS3A 4ZI5A 3OP1A 4HQLA 1V45E 1F4VA 3CZ4A 4I1YA 1DWOA 1VHTA 3AINA 3KYIB 4K3UA 4LXGA 1YDHA 5KJFA 4FDVA 3QIVA 1FJHA 1U2QA 3B3FA 1TTTA 4MVJF 2HGZA 2O7SA 1A88A 2R0QC 4KDRA 1EFUA 5CK4A 2N3ZA 2EIHA 3KWLA 3NM6B 5ED0A 4N1AA 1VLMA 3WL7A 4D8YA 2MSEB 3O90A 1ZUD1 4UNNA 4R8LA 3X43A 2ZT5A 1OXVA 5DN6D 3T06B 2FLKA 2R96A 5C4MA 2E89A 3HYLA 2AF3C 2QN7A 5CLLA 1AKWA 3NAGA 1GGMA 2WJ4A 4MJ3A 3AIIA 4B3XA 4GL2A 1SCUA 1K2VN 4D3DA 3ST7A 4HNGA 4N3AA 4PPFA 2AJBA 3HKBB 2VNAA 4KQ1A 4MVCA 4L0CA 4KN6A 3P4UA 3AF6A 1MLDA 1KU0A 2XNJA 3TKLA 3ZVRA 1QDLB 3PPYA 1I2BA 1SVIA 2FJUA 1B8NA 3BERA 4PG8A 3LRXA 3N7UA 2PM8A 1N0HA 3HM2A 4D4JA 4L6CA 4JJGA 3LVBA 3LLMA 2J6CA 5DBOA 3RARA 1QDEA 1OAKA 5SZJA 1ZGGA 2NWQA 3QXXA 2ZIWB 2O8CA 4E2XA 1KEPA 3GH3A 2P2DA 3KFLA 1D1QA 3HY6A 3GRRA 4CMAA 1Y8RA 3D02A 2G7MC 1D2RA 2HIMA 3LH5A 2HA0A 2QTFA 2BRUC 3G9UA 2EWVA 2PX6A 3EVEA 4DLBA 3AVVA 5ALXA 3Q12A 3LTEA 5FOTA 5KYXA 5A0FA 3GO4A 1EYZA 5HE8A 4OM8A 1UJ6A 2JATA 3EK2A 3GA7A 3MOIA 4D6XA 5LIPA 1KMHB 4L9SA 5GWXA 5GVSA 3U7RA 5IXSA 2DHDA 1DCTA 4CIWA 4F4CA 1AUVA 1TJYA 5EIXA 1ZD3A 1QHHB 4LZPA 3TOXA 2JIMA 4C7BA 1QP4A 3SFTA 1QC5A 4MPDA 2XTZA 1YKGA 4M8NE 3SDSA 3ISTA 2W6MA 2D00A 2CL7X 2PZAA 3EPPA 4B0OA 2XTNA 3D4PA 3DOJA 4F9FA 3HS3A 2MIIA 1I3KA 1PFUA 1W0CA 2WU3A 3KYCB 1KI1A 4U3JB 5DM4A 3MLAA 3CURA 3JRNA 2WSLA 1V8DA 3FBWA 4FZJA 3AUTA 3WIOA 2O2ZA 2RBEA 3C87A 3CLSD 4IRMA 1DKRA 1W4RA 1X77A 5DCUA 4DBZA 1JAXA 2BMFA 3BD6A 4ZPXA 3ZHYA 2W58A 2WWYA 1UKBA 4GPEA 4YIKA 2Z2YA 5EJ5A 1JR3D 2NTEA 3WMXA 4Y6OA 2DRIA 5LZ5A 1J39A 4OXNA 4QATA 2O3SA 5GPBA 5CUQA 3UFXA 3U19A 1YC5A 4GM0A 4WESB 3MHTA 2OK8A 4RABA 4KR3A 3LGXA 4G5QA 5GVRA 3WHPA 1RXUA 3KV1A 5B4VA 2C54A 2FW7A 3PUIA 2FPIA 4MW4A 3ZWAA 2CCJA 3KP1A 3A9RA 4JVOA 4RD3A 4MGHA 3OTOB 4JI7B 3IUPA 4CLOA 4K46A 2I7DA 4Z0PA 1RZVA 5JQGA 3M9LA 3T94A 4FGUA 2P65A 3ETHA 3UKJA 3ZXIA 1QGOA 2PNFA 4B35A 3SJCA 2WG2A 3NHBA 5FCDA 4J2HA 1U5BA 3U3JA 5JMWA 2F3SA 4Q5IA 1EZ1A 1PWHA 3AESB 4G41A 4NSNA 4A7PA 1PKXA 2RJOA 5D86A 2CNWD 4ZAGA 1I0LA 3IFSA 3B3QA 4X1YA 5I3CA 1ACJA 1RJ9A 1L0BA 2IGTA 2RGCA 2YIVX 3G7SA 1EVLA 5JNUA 3FGOA 4QYIA 4N76A 1FJ2A 2EKLA 3OE7A 4R9UC 4DSZA 3WTBA 3ELBA 1KEEB 2PU5A 5FQNA 3S1LA 3VPAA 2ADMA 3U09A 4XUEA 2AI2A 4A2PA 3AT1A 3ITEA 4LW8A 4ETNA 3UHFA 4X8MA 1E4YA 2G63A 5AM5A 3BMCB 1H1LA 3F96A 4HBZA 3VJRA 1QZTA 3I09A 2QRJA 2PGOA 2WPDD 5FOXA 5K3FB 3VC1A 1DXQA 1SKUA 3GAFA 3KDAA 3IPXA 4OUDA 1YL6A 1MEEA 5ESXA 3ETCA 1X80B 4R31A 3SPXA 2MU1A 1YOVA 5HFNA 3U9SA 3X2FA 3PCRB 1B8VA 5A3QA 2Q9BA 3W06A 2YV2A 3DO8A 3D64A 1JA1A 1NX6A 1XU4A 4NABA 2GTHA 5FF9A 5K20A 1QRTA 1UAAA 1D6SA 1ISMA 4WN9B 3G8AA 4MGZR 1JWAB 2C7OA 2YFKA 1HYQA 1W75A 2ZSFA 1QR2A 4CLEA 2EP5A 3DMYA 3PL1A 3KVNA 1DXYA 2KLHA 3FFAA 3QTBA 4IM7A 1Z63A 5ALJA 1Q1BA 5LCXA 1SCKA 2FW0A 4HPXB 4CM9D 4DR6B 3LUCA 2GD6A 1DAHA 1N3BA 1R64A 1UJBA 3E3AA 5TRTA 1W1WA 2PMWB 4I4LA 1AXGA 1BVUA 1CDEA 2ZG6A 4M21A 4V2UA 4MI1A 1G8KA 1Q0ZA 1VJCA 1ETHA 3I05A 5TQ2A 3UUFA 1OBVA 3AB7A 3H97A 4M9RA 2REBA 3W8FA 1Q12A 1YJQA 3RO7A 4RH1A 1MJGM 2NPFA 4WY2A 5KMGA 4RHUA 4OAOA 1V9SA 2P4QA 1VFPA 1E2EA 4GSYA 2QN3A 2Y8EA 4CGZA 1FFSA 3E35A 1Q14A 2X3YA 3PE3A 4MVJI 4BNIA 1R4NA 2PYZA 1RM3A 5DLQC 3U81A 4IQ8A 7GPBA 5DO9A 1YH3A 5L3RA 3N70A 3FWPA 1K6EA 2A9VA 1SQ6A 3DHYA 2JGJA 5IUNC 4QXQA 1VLQA 4KRXA 3VVMA 1DEXA 1KAOA 1C1XB 2V0NA 1E1CB 2PWBA 3P9YA 5HEKA 5ALTA 4PS1A 1WQ1R 1TKBA 2A5JA 4TMTA 3TPFA 3G2PA 3GD7A 3MGKA 1Z6GA 5FADA 3VPGA 4CKBA 3OETA 5K0LA 1K92A 4BZXA 2OVFA 1NSTA 2YDXA 2HK9A 4JHLA 2FX5A 5EPEA 1H2AS 2Z04A 5CFNA 4AY4A 4C6HA 3EVZA 5IMBA 2QRNA 1M1NA 1R6TA 3L5OA 3UGJA 3HDYA 4PAQA 3WGGA 1P2BA 3KQWA 4NZPA 2XB6A 3DEKA 1K6JA 3NTVA 2JKZA 1OXMA 4YCAA 3KQHA 2QQ0A 3IALA 3WL6A 3U1BA 3BXZA 5CJPA 1W36C 1JJIA 4CMIB 1FMLA 4LSMA 3E2IA 4LZJA 4BKOA 3V9AA 4YCNA 1KR5A 4F1KA 4NBLA 5CYFA 1FF9A 1CZKA 2WKWA 4HGZA 1E3IA 1S6YA 1PV2A 4LVCA 3O75A 3HDGA 4WASA 2X5JO 4X62B 4FYIA 1R5JA 1U2PA 2V6JA 4C88A 2CWWA 4YMSA 1LW6E 5TMDA 5BW8A 4NOJA 4MPJA 3T5AA 3C8ZA 3WQSB 3U0VA 1B3RA 1OV6A 1DADA 3R41A 5JFOA 1N75A 3NAZA 4GT1A 3DNFA 1S2NA 3EF3A 1MCZA 4M7OA 5H70A 4CUJA 1YB5A 1G41A 1F4LA 3DXXA 5HQ3A 5F5LA 2DBQA 2Q46A 5J3JA 4ZVTA 4ER7A 2J3JA 2Q5FA 3C7AA 4B34A 1E20A 4ZODA 4CHGA 5LB2A 2NVUA 3C1TA 1YL5A 3BH7A 3FZEA 4TSKA 5BWMA 5TLSA 1TW3A 3HUEA 4Q93A 3BQ9A 1ORHA 4G09A 5KC9A 4MI6A 2QT0A 5T57A 4M4SA 2UUAB 3HN6A 4OIFA 3OU6A 1VKHA 3DNPA 3W0LB 1IH8A 3EY9A 3UT6A 2ZU6A 1UDCA 4DL9A 1W46A 3D4OA 3SS8A 4B8ZA 3QOFA 5C1IA 1I01A 1JFLA 1RKBA 1XTPA 3ZYZA 5FFFA 3ZZNA 2OSVA 1PDWA 3NWJA 2ZB2A 3EH1A 3UKOA 4Z4QA 2IYAA 1P3Y1 3SEFA 4P3NA 1NE7A 1Y4DE 4B6JA 1XEFA 4WNYA 4BTVA 1J33A 2OMKA 4QKQA 5JDCA 2XMBA 3KYDB 3TG8A 3ERCA 8LDHA 3B52X 3BHJA 4M1MA 2WYIA 5TQ2B 4JOCA 1SU4A 4H15A 2XBLA 1I9GA 1MQ8B 4BYMA 1GTVA 2WJVA 2LCFA 1ZM9A 3QPAA 3P7MA 1DV2A 1EVQA 1WW3A 2IP2A 3CMMA 3EGXA 2YXPX 1II9A 1CEYA 2W6OA 4M83A 1JA0A 3IAM1 3HDTA 2EW1A 2V3WA 2ZGVA 5FV7A 3RC1A 1PZXA 5ADHA 1R5BA 1G2OA 4JP2A 5BURA 4CCYB 1O95D 1SXHA 1SUDA 2ZRJA 5GAJA 4KPGA 3F6RA 2H65A 2D1YA 5H9VA 3MHPA 3AV0B 3FBGA 3OSZA 2HJVA 2IZ6A 4PLZA 4BNVA 1F2UB 4PNZA 2OE2A 1ESMA 3RU7A 3NHWA 1NBEA 1FXWF 1QVVA 2G1UA 2IU4A 4RQAA 1V5EA 2YDYA 1E0SA 1VL2A 1HG1A 4QLBA 1CZRA 5TS3A 4OO3A 3RUPA 1EFVA 4I8IA 2V5VA 3Q5EA 1HMYA 2ZJAA 1JB9A 3EIQA 2R6HA 3HXOA 4KFRA 4NU0A 1QHXA 2XUQA 1MDBA 3EG5A 3F6YA 1PGPA 4WBNB 4D9CA 4WUVA 5JQWA 3SXUA 2XUDA 1ZRMA 5F9HA 1K5GA 1WP4A 2BYTA 1DIOB 4OI1A 4HG2A 2WSYB 4FGSA 4RLQA 2BE9A 2GERA 2OY0A 4MYDA 1QYXA 2Z57A 1EX1A 5EJFA 1I13A 4CTJA 4X45A 2H1SA 1V4BA 3UJ8A 3VH4A 2AKAB 4EJFA 1BFKA 5KQRA 2WTNA 3F4BA 5A5FA 4HVTA 2NO7A 4G23A 3JQEA 2QAIA 1N6NA 1GWNA 4NMHA 1NXTA 5D7NA 2VL7A 1TUBB 1JEOA 2AFIA 4G0UA 4IIGA 4TN1A 4FXPA 1QIHA 1BX0A 4KPEC 3T99A 2Q9CA 4WNIA 3DFZA 1A1VA 1Q6ZA 3D5QA 4WVFA 4V0ME 4BQSA 4EUSA 2YVUA 1X8XA 4LQCA 2ORVA 2O3TA 1S8OA 4IHKA 4R9NA 1Q84A 4AF7A 1CPYA 1JE1A 1P5RA 4H60A 3RT7A 1QIKA 2C59A 2JB9A 3PD7A 4IJQA 2CVQA 2H5EA 3IULA 3SC2A 2I34A 1DDOA 1XL0A 5C7IO 1QV9A 2BBOA 1D4FA 2EKZA 2H4YA 2RGWA 2X1LA 4G5SA 4I6GA 4XA8A 4B84A 5K7SA 1CJUC 1JQBA 3VHXA 1F51E 4OYLA 3WGJA 3PX2A 1OB2A 2EFEB 3U4GA 2YNMD 3AVPA 2XAUA 4KJXA 2DERA 1M0TA 3D8NA 1SU6A 3IOYA 3JWJA 3EEQA 5H80A 1UQUA 3AOEA 3B89A 5LLSA 5LUAA 4DCJA 5J23A 4EY6A 2MSNA 2XNCA 4ICIA 4HSGA 3B7WA 2O1XA 3VVLA 2V9PA 1ODKA 4OI4A 1RIFA 2XDYA 1GZDA 4Q03A 1CRZA 2RJ3A 4D3YA 1MP0A 4OI2A 1DL5A 2AN3A 2DQ4A 4QPJC 2QT9A 1KDTA 3AP3A 4DTIA 3NONA 1DJLA 1WXHA 3PNKA 2I3GA 1M0SA 3LWBA 4PN7A 1UZNA 4O6VA 3TSOA 3MQ2A 3Q11A 3A6PC 2FXVA 1N6PA 1P62B 3F1LA 1JHPA 3OEHA 3PIIA 4J16A 4KYIB 2H52A 1AQUA 3DXZA 4XH9B 4K1XA 1L5ZA 1WD5A 5B6JA 5AJZA 4D96A 1RIIA 3ADBA 4R3NA 5CB4A 2FP4A 4COOA 3NJ4A 4V3BA 2X8AA 2PMDA 1FP6A 5AVRA 2HHAA 1YOBA 1MJGA 2IKQA 1ENZA 2E48A 2I6QA 3BIWA 1TRKA 5F73A 2B92A 4KQ2A 4IJUA 4BE9A 6LDHA 4G0ZA 4E2ZA 2CJPA 1U90A 4G5XA 1H0HA 3OD1A 1NVEA 3QTTA 4L76A 4B6EA 2LRHA 1ZCZA 4CEIA 1FK8A 1W4CA 1LW7A 4QU9A 5DM1A 4YJKA 1IHXA 3ZGNA 3OOHA 3N8IA 3LG2A 4PNHA 3JASA 4ZZ2A 3T41A 2WYVA 3UHAA 2WU1A 1QGED 1ZUWA 3HCAA 4ZOBA 1GL6A 1UKEA 4FWBA 1LH0A 2LDBA 2PD3A 3CZAA 3OX4A 5ESDA 2H1RA 3DEZA 2QOEA 4BGUA 4B4KA 2UU9B 2RSLA 1OFUA 4YYZA 5SZHB 1WJGA 4A15A 4YV7A 2BV3A 1ZJYA 7MHTA 5I9IA 3DLAA 4J0QA 3R1IA 1F4PA 4G0VA 2Q0QA 4UM9B 1M73E 3ZDAA 1B6SA 4EY7A 1W93A 4AP9A 5K05A 3ZNNA 4QELA 4NZYA 3IQDB 2QQEA 3WVNA 4OMCA 1ZD9A 4CEJA 1G7SA 2TECE 4UVEA 1RCTE 1O9BA 4FN4A 2H8GA 4MX8A 1LJ8A 4JDUA 3SLGA 4KQ9A 4EJSB 4WNCA 4J0CA 3O47A 5KVCA 5A7GA 5F21A 2R6R1 4J76A 4CIAA 4YP9A 1Y1TA 4X6UA 3KZNA 4RLSA 1T4MA 4Z4HA 3NBZC 2H08A 2O6LA 2Q5OA 5DLPA 4QGAA 3ZDCA 1XFAA 1BD3A 2CXNA 4AN1A 1S0UA 3MRVA 4OBWA 3AI2A 3EEYA 2GD2A 3OX1A 3WWOA 5JASA 5DT9A 1LPPA 2M1ZA 4A0GA 4URXR 2P9TA 5BYAA 5LQNA 4ZTZB 3HLKA 3AFOA 5DI9A 1IN6A 3RADC 1RPAA 4WXYB 3GLHB 1W85B 4FGJA 2P9JA 3RVDA 2CZGA 3PC2A 2FQWA 5CT9A 3TRJA 4LDJA 1ECBA 3W79A 3V8RA 4OK3A 4F97A 4JBWA 1VZ3A 4X54A 1ZEMA 4JSTA 4DY4A 2F62A 2YJNA 1L7AA 4Y9TA 4DMRA 5KJ1A 3NUZA 1NW7A 4IOJA 1A97A 2CMKA 4UE3S 3PDIB 4JEUA 1T29A 1ORDA 3VZDA 2B1GA 4CQMD 4A8PA 1JDJA 3CGWA 2WZBA 3ENVA 2ZZNA 3BTUA 2VH1A 4W9MC 3U7IA 1OXTA 3GNQA 3P9NA 2H16A 1EU1A 1TZBA 1DS6A 3KVYA 4H0CA 1E2IA 1D6NA 1T9AA 1ZNQO 2OILA 2WAYA 4RTQA 3EXEB