2N46A

Ec-nmr structure of human h-rast35s mutant protein determined by combining evolutionary couplings (ec) and sparse nmr data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 51
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2n46A00
1JR3A 2GJKA 2QAGB 2VP5A 4D4JA 2G1JA 4TZ6A 2WZQA 2W2XA 4MYHA 1BYUA 1XEXB 2DB3A 4PZZA 2WOJA 4IOJA 3CONA 2VQSA 2CBZA 1BKDR 4MKIA 3B85A 4JVSB 1F3OA 4A6XA 4C0LA 3BRWD 2RGNC 2QE7A 1IOZA 1GZSA 1DAEA 2OBLA 2W2VA 1SKQA 3NH6A 4LJ4A 3U60B 4JMPA 2FWRA 3AQ4A 3EC1A 4HLQB 4LJ7A 4LHYA 2BMJA 1HH4A 2WKQA 4NYIR 5KUTA 1N0VC 1XTJA 4FMCB 4W5JA 2CCKA 5FL7A 3VKWA 4OHYA 2PCJA 2GCOB 2AK3A 1XCPA 2CLDX 2EFEB 3NH9A 1FUKA 1E2HA 1K5GA 1N6IA 2ZSAA 1SXJB 1WA5A 3M0EA 4DSTA 2Q6TA 2PX3A 4UJ3A 2N1BA 1CP2A 2IEZA 3I32A 1WF3A 2WWHA 3WMFA 3X2SA 1IXRC 3PUWA 4KCGA 1S4QA 3LXRA 1G5RA 1HE8B 3NTUA 2IT1A 3FVQA 4MUAA 1N6LA 1EESA 1U0HC 1LTQA 1HQCA 4U02A 3OHMA 4UXIA 3QPVA 2REBA 3GMTA 4EFNA 4QOSA 4LGMA 5KHOC 1V5WA 4A8JC 3ZDQA 3ZD7A 4P4SA 4UXHA 3QI2A 1SVOA 2W58A 5B57C 2QM8A 3QPWA 5BYJA 1XCMA 3X1YA 1IY2A 4Q9LA 2QBYA 3SI7A 4ABYA 1XTKA 2MMGA 3OEEA 2YOFA 1U2RA 2ZRCA 3AKCA 3I5XA 2GK6A 4JYBA 3SJBA 1YJ5A 3HP1A 1M2OB 1CF4A 1E2KA 2GZHA 4IVPA 2J7PD 5EUMA 1XD2A 3LVRE 1S1MA 1IHUA 2J45A 1XMVA 2VBCA 1KSJA 3KQNA 2YHSA 5DO9A 1SQ5A 3QIAA 4B47A 3VNUA 3VR1A 1UAAA 4G5SA 3ICEA 1JR6A 2QTHA 2V3CC 1C4OA 2CJWA 3TAUA 3DKPA 2GXQA 4OI4A 4D82A 3DEFA 1G7CA 2TMKA 2KI5A 1UKZA 4LSGA 4QXAA 4YONB 1II0A 1CJKC 4W9MC 2DPXA 4O3MA 2HCBA 3I8XA 3RC8A 4EFMA 2IEYA 1E9AA 1P75A 3AVTA 5GVSA 4AYTA 4BFTA 5EE1A 1U99A 1KDPA 5L3SB 3UPUA 3VR6A 4F7WA 1CU1A 2GDJA 1LB1B 1TQDA 3A37A 3PEYA 1R5OA 2CHQA 2FX3A 1G1MA 1DVRA 1RYHA 2HYDA 3NG1A 3QKUA 2IYTA 1CRPA 4HZUB 1KO7A 5J5CA 1XB2A 1COWA 1Z6GA 5CK4A 4JT2A 4ASUA 5LDDC 2QZ4A 3B9QA 5IK2D 3CZQA 3QUSA 4Q01A 1XTSA 4DVGA 2OAP1 1YU9A 1ZM3A 2R6DA 4P33A 1S1CA 3KX2A 1R0WA 5JFGA 3VAAA 3AVOA 3Q7PA 221PA 4JZKA 2ZU0C 2YJTD 1E96A 3MJHA 1GKIA 5SZHB 2OEPA 2QUZA 3ETLA 4TYNA 3E5HA 4OQLA 4MRSA 1KI2A 3ND9A 5GJWC 4QNMA 1OFIA 1FTSA 2FZLA 4JKYA 5TXGA 3U6BA 1E2EA 5KTYA 1G5PA 1UBFA 1W4AA 4BRUA 4F91B 1X3SA 5FPKA 2R6CA 4NDZA 1J8YF 2W6JD 4TQAA 3Q9LA 4JYCA 3TVDA 1EFUA 2GAAA 1NVXQ 1S3SA 2VPPA 4M1OA 2J0VA 2VIIA 4HLUC 2EW1A 3UWOA 4BZQA 1S3GA 2W00A 1Z29A 2JLSA 3OFND 1LS6A 3M1IA 2EYQA 1CJVC 3CZPA 2D4HA 1UJ2A 3AF2A 1XTIA 1U0LA 4AI6A 4N0EA 1ZM4A 3BBPA 2WM9B 4AIIA 2X19A 5F3WB 5FH9A 1YR8A 3TUIC 1W2GA 1AM4D 1OKKA 1KTVA 4A0FA 2BBWA 2O8DA 1FNMA 2IXGA 5EZ6B 3VR4A 5IT5A 1Q1BA 3KUDA 1KMQA 1U9IC 3B8HA 2XEXA 5KYKA 2Z6VA 4JL8A 2Z5FA 3WXMA 1XF9A 1RJ9A 2CMKA 3ZVLA 4DCSA 1Z6XA 4TLBA 1F48A 4TYQA 2FG5A 1II8A 1CR2A 3W3AA 4B3DA 4LI0A 4AYWA 2G1KA 2Z43A 1US8A 2ERYA 1PJRA 1NY5A 2ZI3A 2GTPA 1II9A 1BMFA 2GJ9A 4D2IA 2RGBA 5JI2E 1J7KA 1U8YA 1YQTA 4KYIB 2WSSD 2CXXA 3TKLA 2X77A 3SZRA 3IHLA 1KK2A 2QG6A 4HUQA 5H1YA 3CX6A 3K09C 2A5DA 2ZRMA 1QHSA 4UNQA 4ZDIA 2FFQA 1TU3A 2GXUA 5DH9A 1OPXA 2F7SA 3MSXA 5CYOA 3D6TB 2A30A 1QDEA 2C9CA 5FBQB 3QPUA 4QM6A 1F2TB 3IO5A 3LWNA 2UZ3A 3K1JA 2D06A 2OLKA 4Q9JA 3NDBB 2ZRLA 1N6NA 3GJ6A 2WBLC 4WA7A 4B2PA 2ORVA 4BFSA 2ZYWX 3I61A 3G82C 1WXQA 2A5JA 4DLXA 621PA 4TWZA 2QMEA 1D9XA 2C9OA 2ZI9A 3LBNA 2CCJA 2JIZD 4JSTA 1OH6A 3L0OA 3GJ3A 3KTAB 1JPJA 3PCRB 2ORIA 4Q02A 2ZJ2A 3W6NA 1S0UA 1UDXA 1ZM7A 5EE3A 1VKJA 2FZ4A 4V02A 1M7HA 2DR3A 1AZTA 5E4FA 3QKSB 2F9MA 4G3XA 4XSHA 1VTKA 5EXXA 2RGDA 4JLPA 3ZQ6A 4Z51A 1Z83A 2BBOA 2G6BA 1W48A 2XNSA 2PZFA 1S8FA 2IL1A 2OE2A 1AGPA 3KKNA 2XXAB 1KMHB 3A1TA 3B82A 4URZR 1MO6A 1EFTA 2ZPTX 3WP1B 2RMKA 2BHRA 2OSBA 3Q8XB 1M74A 2WAYA 3FHOA 2ZR7A 3K0CA 1Q57A 4U00A 1W36B 3VR5A 1KGDA 2ZRIA 1ZUIA 2P5TB 3O8CA 2JJ1D 1GKUB 5DGXA 4KODA 2HJGA 1TF7A 2BMDA 3IEUA 2XB4A 1Z07A 1TQ6A 1JAIA 4MUBA 3WMEA 1R0YA 3QEOA 3TSZA 1KI6B 2R8RA 1XD9A 4LHWA 1DOAA 1E9BA 3KZ1E 3R8FA 2ZEJA 1KO4A 4CEJA 2D3WA 3T1OA 1F2UB 3H2YA 3LDAA 4CF7A 1G4UR 4RD3A 3T06B 4BLQA 2D62A 3ZYCA 2J46A 3SE0A 4JLMA 2VLIA 4OI2A 1KSHA 3GEEA 3LQQA 4JLNA 4DEXA 2ZS7A 4PHGA 2ZRJA 3EX7C 2BBSA 2EFGA 1XDBA 2JGNA 1UBEA 1GVNB 5FBVB 4PHFA 1SZPA 2VP2A 1GOTA 4QC2A 1J70A 1EK0A 1E2LA 1P9RA 2PMDA 4GNKA 2CVHA 1GNQA 1NMYA 1YVDA 4L5BA 3QXHA 4ZCLA 2FEOA 4QBIA 2CCGA 2ORWA 4DT1B 2MSEB 2P2LA 4GZMA 4EQ6B 1HT2E 3QEJA 4KITB 1D2MA 5AJZA 4A9AA 3RRNA 3AP1A 4A2QA 1JNYA 2UVQA 3C5HA 4HB0A 2FPMA 1KYIA 3SJAA 3QKRB 4RZ2A 2KWIA 1P5ZB 1NLFA 2WAXA 4MRRA 2QA5A 3Q3JB 5BW8A 4AURA 1GNPA 1B23P 4HAUA 5FPHA 5FUVA 5JECA 1U94A 2J7PA 1GWNA 2PMKA 2WKRA 3ZVNA 2O8BB 1NF3A 2OESA 2MSCB 2XAUA 4ESHA 5JZVA 1GILA 2UKDA 3V4FA 1W2HA 4PC7A 1L2TA 1DG3A 2HLDD 3WYFA 4YLGA 2GKSA 1O87A 2O8EB 1NG1A 5J47A 2P0EA 1TNDA 2GNOA 4Q03A 4JBWA 4N1AA 5L3RA 3N70A 4MITA 3PENA 1E0AA 4LJAA 1OT3A 4US0R 2Z4SA 5FUYA 4WZBE 3O47A 3H4MA 4HDCA 4F4CA 4A15A 1OH5A 3VNVA 1F5NA 4DDWA 1GL7A 1KDRA 3CRMA 1DTSA 3QF4A 3BB3A 3GP8A 1P73A 1N5LA 1KK3A 2VEDA 4MGZR 2ZSBA 3BH7A 4YXWA 4DKXA 1KDOA 4K81B 2YINC 2G0TA 1KKLA 1NJFA 3LXXA 1JAHA 3SU8A 4MRPA 4KBGA 2ZYTX 3A4MA 2GK7A 1OIXA 2QU8A 2IHBA 5EQTA 3RS2A 2IUSA 1AKYA 3WHKA 4YMTA 2QSYA 4ILEA 3GJ0A 5EXSA 3PUXA 2O8CB 2YZ2A 4IW3B 5CM9C 4NCJA 5JRZA 5IK2A 1CJMA 1G19A 1GUAA 1VCIA 4RD4A 3R9XA 3OE7D 1PZNA 4KBFA 2MSDB 2ZU6A 1ZIOA 1P2SA 3AUYA 3CX8A 2ZR9A 5CDFE 4LPSA 2RH5A 4MYCA 1OFUX 4IDOA 2ZREA 3QOFA 3MD0A 1X8LA 2RKOA 5LB2A 5JS8A 4NYMQ 1NN0A 3SDZA 4RFSB 2WJJA 4KU4A 5JCPA 3TMKA 1WRBA 4MKFA 3GJ5A 2IYQA 4HDOB 2V55B 2W6JA 3GQBA 2ZJAA 3DOFA 1KOFA 1HYQA 1OXXK 4DWJA 3P27A 3P4YA 4TSFD 2E87A 4MYTA 1G21E 4A0RA 4PAMA 4BRWA 2W83A 5LBIA 3OFNA 1FQJA 5BXQC 1XEWY 1SVIA 3D8BA 4KJZA 3SQXA 1QHIA 3DOEA 1A2BA 1EG7A 1VYVA 3U5ZB 2QI9C 5CDFA 4GPTA 1Z6YA 2ASEA 3GLGB 2FH5B 5A0FA 4NONA 1MH1A 2C9YA 2BWJA 4M9ZA 4XH9B 3GLHE 4WBSA 1HEIA 3FPAA 3HPQA 3IBYA 3S1AA 2V54A 5AJWA 5FTKA 3MAAC 1TX4B 3WYGA 4A8JB 4C7OA 5L8VA 3RS7A 3DM5A 2ZRNA 3PV0A 4TL7A 3P26A 1W4RA 2RGEA 4JKIA 1AA9A 3K53A 2WOOA 5DSZA 1DAGA 1KAGA 4JS0A 4Z8XA 1XMIA 1ZCAA 4I1OA 2AXNA 1OB2A 2IWRA 4GBMA 3LLUA 3EZ2A 2VP0A 4NCNA 4ZKDA 4G0NA 4O2RA 3TQFA 2A9KA 2ZE5A 3KQHA 1JI0A 5LPNA 4X8LA 2ZI6A 3ZZUA 3F8TA 3BJIC 2W0MA 3PFIA 5CYPA 3CKLA 4NBSA 5DN6D 5FPSA 5TVKA 3VMFA 4ZI3A 4B6FA 4KVAA 5A5GA 521PA 4OK3A 2ZTSA 2BCJQ 2OM2A 2C99A 3GLHA 3HR7A 2F43B 1KO8A 2GBLA 2GEDA 4FMBB 3U44B 1R8QA 4U7DA 3BH6A 2P3SA 2YWHA 4LYFA 2B7CA 4ESVA 3KQLA 2FSFA 4D0GA 4D6PA 4LCBA 3THWA 2ZVPX 3W90A 4B33A 1E32A 1S96A 1AZSC 2O8FB 4C0JA 1SXJD 3CRVA 1RRGA 1QF9A 1KI4A 4OKSA 4CEHA 1UBGA 1N3BA 4EJSC 1FL9A 1AS2A 4LX0A 5IHPA 2D7DA 1GDDA 2JIZA 1N6OA 2XOKD 2JLYA 2Q0HA 2QGZA 3TW4A 3K0FB 1NY6A 2AHOA 2PH1A 3F5FA 5CIWA 4A6PA 3FKSD 1LF5A 3EIHA 4RZUA 4TLCA 3PIRA 4M1KA 1E9EA 1DELA 3SJZA 1KI1A 2A2ZA 2ANBA 3KKQA 4LYHA 1E0JA 3U3JA 1IN6A 1QG2A 4DBLC 4WOPA 4B75A 4DDTA 2CEAA 4DLVA 3CF0A 2FV8A 3RLFA 3KUCA 4ZIRB 3O8RA 1RE0A 2ZAOA 1JPNA 1R0ZA 3R7WB 1X8JA 1QZXA 1QHXA 2WIAA 1PLLA 3LVQE 3SJCA 5C4MA 2DFLA 2EVWX 3CW2A 4QHYA 2OFWA 1Z63A 1WB9A 3BFXA 2JJ1A 4NYIQ 3UIEA 4I1SA 3RS0A 5LB4A 3J81k 1T5IA 4KAXA 2ZRKA 3BB4A 2QORA 1OXUA 1T6NA 3WNBA 3KQUA 3AVPA 1MABB 3NWJA 1VCOA 1G3IA 4CDGA 1A1VA 3B1WA 3LW8A 1XNJA 4B6EA 4TYWA 3EC2A 4DZZA 2WJVA 3UG6A 5E7IA 4LJ8A 5G3YA 2PBRA 1JEEA 1GSIA 3RYTC 1RC8A 2HYIC 2N46A 2AXPA 4LUCA 4NCIA 4OK5A 1FFHA 4CGZA 3ZH9B 3QKTA 3GD7A 1E4VA 1UEJA 1UADA 3JZMA 4BLOA 5AWFC 3JZAA 4QHTA 5SZJA 3GPLA 2AX4A 3UATA 1WCV1 3R8CA 4JJKA 1PVOA 4LHXA 2P6RA 5B58C 3AGPA 421PA 4CW7A 3CLVA 3VHXA 1AJEA 5FTJA 4R71A 4Q4JB 5EP3A 1MRSA 3U61B 1UM8A 3THXB 1EWRA 2WWFA 2BKUA 1KY3A 1T8UA 1L4YA 1W49A 5FR2A 3SN6A 2DWPA 1PLJA 1E2QA 2QENA 5AK0A 3KFVA 1SVKA 4UNSA 4C0SA 4PTLA 3TR0A 5BN5A 2XJ4A 3FFBA 3MRSA 2B6HA 3ADDA 2ERXA 5DYGA 3SQWA 4UNNA 4TLAA 4D25A 4XWKA 4UNPA 4MGYR 5JSZB 4LC1A 1NI3A 3DPUA 4PSKA 3LH5A 1HY3A 1YZLA 1Q1QA 3V9PA 4PZLA 4OJQA 4OQNA 1WQ1R 2C96A 1NMXA 2OCPA 4BUJA 1IXZA 2ZITA 4BASA 1MO4A 2E1RA 1P6XA 3NHBA 3F0TA 3FMIA 1TF2A 2B92A 3T34A 1G64A 1EXMA 1G8YA 2HLDA 3AF3A 3IQXA 5AR1A 2ZANA 1DS6A 2OZEA 1E1RD 4RD0A 2A7QA 2BCGY 1TEXA 4URWR 5D3MB 4PZYA 2IBMA 2GWHA 5BN4A 1CJUC 1PUJA 3L82B 4P31A 4LPKA 3RSOA 3LX8A 4Q7KA 4DHEA 2ZJ5A 1E94E 4MKGA 4Q7MB 1DPFA 4PO9A 1XEWX 2VHQA 4TN1A 3ASYA 4EPYA 5TARA 1P2VA 2P6NA 4TZ0A 3IBGA 2R44A 2IS1A 5KU1A 1E2GA 1J2JA 3I8SA 3AM1A 4NE2A 2J0QA 1D6JA 5AUNB 5JHHB 2IUUA 5IF9A 1U8ZA 4PQYA 4NH0A 5FOVA 3KXIA 2ZAMA 3IIKA 1ZUNB 3UKDA 3IPXA 2PT5A 5C46F 3U7FB 4Z8YA 4DIDA 5BYKA 4MRNA 4DCTA 4YDHB 2ZQ5A 1D2EA 1TQ4A 1Y63A 3NBYC 2JAQA 3CNNA 3FKQA 3OE7A 4UKDA 1E2DA 3GEHA 3L8ZA 1TTTA 1W46A 5EE0A 4G5QA 1WMSA 4IVRA 4M1MA 3B1ZA 2AKYA 2HEIA 4UNRA 4IDPA 4ZCMA 2WWYA 2YKGA 3CUEF 3MMPA 1WE2A 3KL4A 2QSZA 1XFAA 2QT0A 1VG9B 5K8TA 1XMJA 1AK2A 5H70A 4QBFA 5TMPA 3CRRA 1NKTA 1JEDA 4G1UC 1AQYA 4KSBA 4B74A 821PA 5JEEA 2FDCA 4BPBA 1RW4A 5G3ZA 5KNBA 1T0JB 2IUTA 1RIFA 1M7GA 5HE8A 3T1VA 3NBXX 4ARZA 4WAUA 2F1HA 3L43A 3X1ZA 4ACAA 1IJFA 4Q7LA 4TSFA 3MFYA 1FP6A 3FTQA 4DSOA 3U4QA 2J0SA 4FCTA 2IYLD 4YXWD 2JLXA 1U81A 1WP9A 1XJQA 2YWGA 2BEJA 4LY6A 1Z6TA 3K0AA 3W8NA 4DCVA 4I1VA 4US2R 2J0UB 2JLWA 3BE4A 1ZC3A 4KFRA 3LO5A 2XTZA 4C2UA 4HI0E 2FMXA 1FX0B 2JLZA 1TF5A 1WBDA 3IKJA 3EG5A 3RRMA 4EUNA 3H86A 2GHIA 1ETUA 2VL7A 3UG7A 3ICQB 1RPZA 3SYNA 3GLFB 1GTVA 1GM5A 4PHHA 1E9RA 1OW3B 4M9QA 2KJQA 3C16C 4KHZA 1UF9A 1FUUA 4QM7A 5TY0A 2ATVA 4B48A 3ZD6A 5JHGB 2IYYA 1XU4A 2VHJA 3LFUA 1G9XA 1NL3A 2XB2A 5L3QA 4JVMA 2P65A 3OZXA 3VFDA 2BM0A 2CE7A 2GEUA 4MGKR 4TMTA 2IS2A 1Q12A 2J59A 4OQFA 4TLDA 1SXJE 8OHMA 2HT1A 4LYAA 2JLVA 4MKHA 1E0KA 4CZ2A 4Q5IA 1DAHA 3CPEA 4L9SA 3VX3A 4X8HA 3MWYW 2D2EA 1E2MA 3RS4A 1G4AE 3KXLA 1XCGB 2QAGA 3L0SA 2JATA 2WWXA 4A92A 1DO0A 2GRJA 1NVVQ 1E0SA 2ZJZA 4EFLA 4Q9IA 1XEXA 3I4LA 4LHVA 1UKYA 4AYXA 2J87A 3TJZA 1W36D 3SBDA 4EIWA 1R7RA 3VX4A 2VP4A 1DADA 2CL0X 2J41A 4GFDA 3AVQA 1FMLA 5DN6A 2ZVQX 4TYPA 4LBWA 1ONBA 1RKBA 2DY1A 3E70C 3K9GA 2Q9CA 5C4GB 1YZQA 2WVJA 1KI3A 4GL2A 4B71A 4DB2A 4IDQA 3A1SA 5JBQA 1XD8A 5JWHA 3AF4A 3H0KA 3SOPA 5E7JA 1P72A 2ZS8A 3NHAA 3NEYA 2GCOA 3TE6A 3EPLA 2QRNA 4L4UA 3THOA 1SKYE 1NN1A 1QVAA 1D5CA 2AWOA 3G0HA 3QXSA 3B7GA 4Q1DA 5C18A 1SXJA 2GVZC 2IX3A 4QGAA 2FSGA 2GZAA 1KNQA 4LZZA 4DSNA 4DJTA 5J4KA 4Q9HA 3LBIA 2Y8EA 4M9SA 4B32A 4AKHA 2ZI5A 3T1TA 3GEIA 3OEHD 3F3YA 2BJWA 2XOKA 2C78A 4DCNA 2RGAA 1AS0A 3FB4A 4C0KA 3FKSA 2V4ZA 3A4LA 3K0SA 4RFVA 1W44A 2I1VB 3AF1A 3DMDA 1NIJA 3NKVA 1HV8A 1KI9A 1N6KA 2C03A 5FFMA 2AWNA 2XZOA 1KJZA 2UZIR 3I73A 2H92A 3PR1A 2ONJA 4AWXA 4NPHA 1IY0A 1AN0A 1E98A 1T3LA 5CK5A 2B21A 2EFCB 3TAHA 4I4LA 4PC2A 3P32A 4B34A 4JLVA 2FFHA 1IN8A 3IIMA 1NVVR 1G8PA 4KFSA 4IDNA 1M1YE 1A2KC 3NXSA 1JJVA 1G17A 1VG0B 2JCSA 5GJBA 2ZRFA 3DVLA 5GVRA 2WWWA 4RZ3A 2O0HA 1E6CA 3D3QA 4IHQA 5FOWA 3B6EA 4O25A 2ZIAA 1IONA 4DEYA 2GAOA 2H18A 1ZINA 1Z6AA 4NMMA 4KSCA 2A78A 2B8WA 4JLBA 4W5HA 1I4DD 3RVBA 1OH7A 2BEKA 5DISB 1N6PA 4QL3A 3QBVA 1RVDA 4NZYA 4QJ5A 1ZJ6A 3TVTA 3FFAA 4Z54A 2PZGA 3KB2A 4US1R 4Q1AA 1Q3TA 1G7SA 1FP7A 2EQBA 5G53C 2AKAB 3FWYA 1PV4A 2PLFA 3EPHA 1P61B 2NO1A 4MQBA 1YR9A 2HT6A 3HWSA 1DAFA 1ZP6A 4FWTA 5FTNA 1XXHB 1Q44A 2FEMA 1NNEA 3K70C 1QHYA 3A58B 2Z0MA 3VU9B 4KLNA 3DZDA 5L3SA 2QROA 3WYAA 1X8KA 1E4YA 1KSFX 3L8YA 4IFBA 4E07A 3THYB 5C1BA 3TUZC 4JBYA 4DDUA 4GOJA 4R2IA 3SEAA 2EFDB 2NIPA 4UJ5A 4HZUA 3HU1A 1G3MA 1SVMA 3WRYC 4FD2A 2FNAA 1G16A 3CO5A 2NO9A 4LDJA 2WKPA 1U90A 4JL6A 3T15A 1YR6A 2WV9A 1KO5A 3BERA 4O2LA 1OHHD 4CRWB 1CULC 3CH4B 5HPYB 3U7HB 2CHVA 4LJ5A 5E95A 1OFTA 5AJXA 2H5EA 2BMEA 2QGNA 1KO1A 4JSYA 3T5DA 5E3HA 121PA 2OILA 2YC2C 1E1RA 3DHWC 4QJ4A 1AIPA 3LY5A 2HDNB 4DB4A 4B3GA 4Q4HB 1Z0KA 1S9HA 4FCWA 3CIOA 2QP9X 4F92B 4U5XA 3TH5A 1BS1A 2PX0A 2XTNA 1R10A 1X1SA 1MRNA 4HAVA 3VHLB 3KKPA 2ODWA 1ZRHA 3QXCA 1H8HD 2QMOA 5CB8A 2QNRA 1JQJC 4M0LA 2I3BA 2IYZA 1E9DA 3QF7A 4XVRA 4A0HA 2H7VA 1IBRA 2R9VA 3IPYA 1JECA 4R98A 5A4JA 4EJSB 5J4YA 4URXR 1NLZA 3N5CA 1ZMXA 2OXRA 5JI3E 2F3TA 3OIYA 4HSEA 1CXZA 1OLOA 2EWVA 4J0QA 4P3YA 4BLSA 1P4SA 4LRWA 3BD9A 4XIGS 3ADCA 2XGJA 1XZQA 4HB2A 4OQXA 2XNDD 3LRPA 1NMZA 2QQ0A 4BQSA 1CLUA 4I81A 2CVFA 2F1RA 3EPKA 2ZE6A 1G8GA 2O5VA 3IDQA 5B30A 3I3SR 5UKDA 1E79D 1MKYA 3CPHA 3K0CC 4NKRA 4TTQA 3BAFA 2ZSFA 1UKEA 4IEEA 4FN5A 1LNZA 2FOLA 1HE1C 1KJWA 1G5TA 1Y3AA 3EPJA 2WIBA 2ZUDA 4A82A 1JALA 4DLWA 4ITRC 1Z0AA 3ZS8A 4PSAA 1VCMA 2IA5A 2NQ2C 2GF9A 4C0QC 3ZS9A 2F1IA 3A1UA 4OHVA 3U3RA 1OJLA 2ZROA 3LBHA 2PJZA 3R9IA 3ZZTA 1I2MA 3QENA 4HLCA 3C4JA 1NJGA 1LF0A 3KXKA 4WZ6A 2ZSDA 3VKGA 2VHTA 1Z2AA 1XZPA 1DG1G 3O8BA 3WP0A 1KAOA 2F3RA 5FOXA 5HZKA 5KNDA 2Q9AA 2ZJ8A 3B5JA 3P20A 2IS4A 2FPKA 1MR3F 2J3EA 3W34A 1XMSA 1G7TA 3ECCA 3IGFA 1E99A 4M22A 3T12A 2Q3MA 5FBWB 1UPTA 1F2TA 3G5UA 4B3CA 2H17A 3AVXA 3QBTA 1DEKA 5H68A 1NSFA 4JT4A 2IYSA 2OCAA 4KFUA 3LAWA 4TTPA 4FMDF 5CITA 1E2PA 2KB0A 4IDHA 4Q4AB 2YV5A 5CB6A 1QHHB 2D74A 3ZLJA 5DE3A 1XTQA 2JASA 2H16A 1G8FA 2KSQA 1NLYA 2X2FA 2GA8A 1LV7A 3KTAA 2IF0A 4DLSA 2F1JA 5B2ZA 1TUIA 1YZUA 1ZNXA 3A1WA 4G01B 5AJYA 5LD2C 4M1TA 4BFVA 4NYJR 4LC0A 2ZI7A 2ZJOA 4M9XA 3ND8A 3RWMB 3SFVA 2NZJA 4LJYA 3QKSA 1UEIA 3EXAA 3A1VA 1J90A 5TDHA 1W47A 2OG2A 5DI3B 2D7CA 2XXAA 2PT7A 5AUQA 1KMHA 5JJIA 1Q3HA 3FDIA 1IN4A 5G41A 2DFKB 3RRYA 4AY2A 1W4CA 2LKDA 4YC7A 5D3QA 1HQYE 2GEVA 2OO7A 1M8PA 2RGGA 3PXGA 4TLEA 1L8QA 1VIAA 4Q00A 3RAPR 1GNRA 3W6OA 1ESMA 1ZD8A 2ZUCA 1Z8FA 1JXOA 1KI6A 2B7BA 5B64A 3TK1A 2GCPA 5KSZA 2IK8A 4D81A 1KIMA 3K0EA 2WJIA 1R5NA 1EFCA 1F2UA 4QG7A 5EZ5A 4IXNA 3TLXA 4CT4B 1LVGA 1YE8A 2YYZA 3EAQA 1E2NA 3A4NA 5P21A 1KNXA 5FI0B 3LX5A 2CHGA 4ZI2A 3B9PA 4JLOA 4LBVA 3RS5A 4TT3D 4V03A 1ESNA 3KKOA 3GLIB 4L16A 2ZUBA 4PFSA 5EE9A 2XSZD 1GL6A 1GL9B 3OEHA 1YHNA 5JS7A 1G8HA 4Q1CA 4OI1A 4XOIA 4LK2A 4YMSA 4CEIB 3QVVA 3Q5EA 4OK6A 2IWHA 3MWJA 2A3RA 1DBSA 5K8UA 2RGCA 4Y0VA 2OAQ1 5JMTA 4DT1A 4EQ6A 3MWLA 3QG1A 4HEJA 3N2EA 4OJKA 5EJEA 1G3QA 3R9WA 3RNLA 4DLUA 3TSOA 2WICA 4DRZA 4Q48A 4ZDJA 3QKRA 1IM2A 4P4UA 3WRXC 3KDSE 3T61A 1D2NA 3TIFA 3TUJC 4ZDKA 2N42A 4FXPA 2A5YB 3PG5A 2KBEA 1TUEA 1W1WA 2F6RA 3E2IA 1M34E 3AVUA 2O8BA 1HTWA 3QVUA 4F93B 3KJHA 4D0NA 2O8EA 2KBFA 2IYVA 1ZNZA 1CBUA 2FU5C 4IRUB 3AP3A 4V0LA 4GI7A 2VHCA 4KO8A 4HB4A 4IKEA 2QTFA 3FYHA 1U98A 2ZRBA 4N0DA 2BIFA 2HF8A 2QT1A 4X8MA 4POAA 3RDPA 4QBGB 2HUPA 2QQEA 5AUOB 1VPLA 4TL6A 4YMWA 2NO7A 1ANKA 2DWQA 3RANA 1BH2A 2J7KA 3PITA 4GSYA 5KOYA 4LOAA 4Q21A 4ACBA 1W0KD 1F60A 1G7RA 4P4SB 3CR8A 2VRWA 4O0MA 4LJ9A 2R6AA 3DO6A 2HV8A 4BLPA 5IRCD 1U0JA 1VYUA 5DI9A 1IQPA 2FE4A 2QBYB 1H8ED 4C0HA 1L7VC 3FMFA 2GJAA 4HDQB 1XTRA 1C9KA 3O8DA 1NN3A 4G5OA 2QN6A 4RD1A 3V4RA 3U7GA 4AG6A 2G0NA 3CF2A 2O8CA 4E5UA 4WZAE 1XD2B 2JA1A 3RABA 4BFUA 1SULA 1IJEA 2IXEA 3GJXC 1N6HA 3OF5A 4ZCIA 1ZVQA 4WW0A 1XPUA 4LV8B 1M7BA 1OHHA 1N2CE 2BJVA 4Q47A 3OIWA 5TV2A 2W0SA 1IN7A 1G41A 4UQOA 3GJ4A 3GLGE 3KJIA 2CJWB 3UWKA 3MCAA 1U8AA 3LA6A 1NBMD 1ELOA 1Q0UA 4Q19A 2R6GA 1ZYUA 3VKHA 4JLJA 2F9LA 2R65A 2HF9A 3EWSA 2GBLC 3IIJA 1KKMA 4RFSA 4YDSA 5GADl 1R2QA 1TQ2A 2RGNA 3BORA 2IYXA 2QRZA 3HU2A 4KFTA 2YC4C 1DE0A 1GKYA 1Z2CA 5CLQA 2QM7A 1H8HA 2CL6X 4RD6A 1VYTA 2P6UA 3NDPA 3U6KA 3UMSA 1GRRA 3C7KA 1E9FA 1E69A 4BLTA 4LV5B 1W0JD 1ZD9A 2QPTA 3IUYA 5KPJA 1ZCBA 3CB4A 1Q1ZA 1GAJA 4TQUS 1IN5A 2O0KA 4PO1A 1R5BA 4BEJA 1G20E 1ZU4A 3ZIAD 2ZXUA 4ZPXA 2QL6A 4R7ZA 4PX9A 2WPDD 3GLGA 1VHLA 4IVQA 5FPYA 4QHSA 4BFYA 5C2JB 3DKVA 2XNDA 1Z47A 4V0KA 2IW3A 1YZNA 2ZETA 1T3HA 3HPRA 5DIFA 4K8OA 3ZQJA 5AJVB 5J40A 1V43A 2IS6A 4A8JA 4MYUA 2Q9BA 3GFPA 1E79A 1VECA 2LKCA 2VHUA 3MG9A 4B3BA 2BVNA 3QE0A 1J99A 1NRJB 1SHZA 3RSLA 2RCNA 4PC1A 5TB5A 3D7MA 1UFQA 2BOVA 2ZSEA 5KDOA 5DNYB 3SYKA 3REGA 4S35A 4PPNA 4OQMA 3OIUA 4Q9KA 3C41J 3K9HA 1TPZA 3IQWA 2BM1A 2V8OA 5CM8B 4A0GA 1HT1E 1ZD1A 2I1QA 1FTNA 5HCNA 4TMZA 1Z22A 4XD7D 3BXZA 2ZRAA 1IY1A 1A7JA 1NN5A 4FCVA 2JJ2D 2BBTA 3EZ7A 4WVFA 3EZ6A 2ONKA 4BE7B 3AP2A 4F38A 1I2DA 1IXSB 2QMHA 2ZR0A 3JVUA 4BFZA 1VHTA 4M2LA 3MGCA 2F43A 2O8DB 3U44A 3EIQA 5HZHA 2WSMA 2AN9A 3NC1C 5HE9A 2LCFA 2R62A 3A36A 3T35A 4LYJA 2DBYA 2J5XA 3LW7A 3EARA 3IEVA 1YZGA 1Z28A 3FGNA 4BLRA 3U7EB 2YVUA 4QKQA 4A4DA 1K5DA 3K70B 2ODEA 1PUIA 3EASA 3EA0A 3HYTA 5FTMA 1RJ9B 1BO6A 2O8FA 4JLKA 5KO2A 2OHFA 3KJEA 2IXFA 4HLDA 1II8B 4V0NA 3HDTA 4BFWA 2DHRA 4FW9A 2NPIA 4PR0A 3K0FA 4V0OA 5JRJA 2JLQA 3KB1A 1CJTC 1UBCA 1US8B 4LJ6A 1QBKC 3VR2A 2WWIA 4Y0AA 4JLDA 1NSTA 2ECKA 5J4HA 1XEFA 1TADA 1MV5A 5DHFA 3K8YA 4ZDWA 2XZLA 4ZIRA 4I99A 4B3FX 1EFRD 2FN4A 1OXSC 3R7WA 4M8NE 4H9GA 4HUQB 4X8OA 4CVNA 5JJLA 3B13B 1SKYB 4DSUA 2Z83A 1N25A 3W8RA 3W5IA 4GT1A 2CK3A 1OIWA 2ZE7A 5E7MA 4HAXA 3B2EA 2ZE8A 4GP6A 2WJYA 4PXAA 1KSGA 4Q1BA 5EXTA 3BOSA 4HAZA 3B1YA 1NIPA 3RS3A 1MABA 3PEVA 2NMVA 1R4AA 4EAQA 5ELXA 1F6BA 1VIYA 4HLUA 1W4BA 4C0AC 2BDTA 2DYKA 2CLSA 1BIFA 2OXCA 1OYWA 1R8SA 2H57A 3GJ8A 2VP9A 1A82A 1XBTA 3OAAD 2ZYUX 4RCZA 4TT3A 1QRAA 1SVWA 1QVRA 4DUGD 1KZGB 2XSZA 2YWEA 2W6ID 1W5TA 2AR7A 1TEVA 1XWIA 3NC0C 1VG1A 4Q7JB 2Q3HA 1MOZA 4RSGA 4A2WA 4L15A 2OBNA 4M1WA 4XWOA 2G83A 3L2OB 4Q4JA 3BFKA 1O3YA 1P9WA 3Q5DA 3QNUA 4LHZA 4BECA 3THXA 1NKSA 2X8AA 1LW7A 4IFEA 3VTKA 1N0WA 4Z1MD 4UXJA 3WNDA 5F9FA 1U9IA 1S2MA 2EFHB 3Q7QA 1T3SA 2PLRA 3AKDA 4DC9A 3AKYA 2FGJA 4RD2A 1E2JA 1QHGA 3GCGA 1EFHA 2GXAA 2QY9A 2V7QD 5JSZA 4JLAA 3SFZA 5KSPA 3QXXA 1P60A 4B76A 4CEJB 2Q3FA 3SBEA 4BFXA 1OH8A 2J1LA 1G3UA 5F98A 1Q21A 2D2FA 3BGWA 2JDID 4QGHA 3UXMA 2YOGA 4V0ME 5EE5B 3B1VA 4C9BA 2C98A 2V6JA 3TRFA 1FNNA 3IILA 1RRPA 1FPMA 1D8TA 3TW8B 2GJSA 4G5RA 4F4JA 3U3KA 1HURA 5JLJA 5D3MA 4AKIA 5K8IA 1ZUHA 5JEDA 4XTCS 3L0IB 1LS1A 2Q21A 2I4IA 3WY9A 1EWQA 2VSXA 1I4TD 3CWZA 3K09A 4IOLA 5EP4A 1T8TA 2DFTA 3HR8A 1CR0A 2PEYA 3DM9B 4TL9A 4DIEA 2WHXA 4XVUA 1GFIA 1NBME 4GRAA 3U3OA 3VQTA 2GJ8A 2REOA 3I1FA 5FPTA 5JCZA 2XZPA 1W0KA 2G3YA 3PUVA 3BS4A 1NG9A 2GZDA 2YNMA 1XPRA 4A2PA 1E1QA 5DHAA 4HB3A 2NG1A 2BKEA 4URUR 2CNWA 1H8EA 2OLJA 3WBKA 3EZFA 3SC3A 1RFLA 1CRQA 3SHFA 1UDWA 4Q1FA 4V0MA 5CIQA 2EYUA 4LBYA 1JB1A 4NU0A 5LD2B 1OSNA 1Z0IA 3BWDD 2QAGC 3V00A 1HA3A 2BC9A 3A8TA 2QEQA 3LQRA 2OBMA 5BN3A 1RRCA 1XX6A 3LD9A 3I92A 1OFHA 4GOXA 2QMUA 2H1LA 1DAMA 1ZW6A 3REFA 5HR5A 3BK7A 1CEEA 4GP7A 1Z08A 3ZVMA 2HXYA 1LFDB 3GLFE 1FQKA 3B60A 1ZBDA 2C2HA 1X6VA 1NBMA 1K8RA 3X1DA 2ODBA 2RAPA 2EWWA 1BOFA 4BWYA 1A4RA 3QF4B 1JJ7A 4KLZA 1Z06A 4EPRA 4EPTA 4FINA 4MGIR 5F2EA 4B2IA 2ZRDA 4D80A 3FOZA 3CRW1 3QXJA 4NCHA 4D26A 1SXJC 2QPOA 3AKEA 2JLRA 2YOHA 3UMFA 4JBXA 3MWKA 4Q4LA 5J4VA 1MO3A 2YWFA 4HZIA 1G3RA 3T5GA 1XJ0A 1W0JA 2IYUA 2J0UA 1LY1A 1P7CA 2OT3B 2P67A 5GJCA 2JLUA 2A5GA 4C2TA 1FX0A 1CS4C 5HKKD 4QRHA 2K5UA 5ANRB 3ZIAA 3GFTA 4QGFA 1KK1A 5CLLA 2WPDA 1N0UA 3GLFA 1G291 3PVSA 4GOKA 4P32A 4PPGA 3X1WA 4EDHA 2GCNA 1T9HA 4C4PA 4B44A 3RRZA 3NEJA 4YMUA 4QFMA 5HTKA 3LNCA 5CJ2A 1OYYA 5FOTA 2ZRHA 1VCNA 1K6MA 3C8UA 3W3ZB 3FHTA 4BGDA 4CT5A 1KK0A 3QSYA 1ZM2A 1YRBA 4PAOA 3DMNA 2X2EA 3AB3A 4TTRA 2AFIE 4GMXA 2GVDC 2OCYC 4H1UA 2C95A 3SHWA 1OE0A 5SZKB 4CYMA 6Q21A 2QTVB 4GZLA 1X1RA 5FI1B 1KDTA 3I72A 1GITA 3KFXA 3ZVRA 2ZJYA 3B1XA 3AVWA 1ZIPA 1OB5A 2LWIA 4NP6A 4ON9A 2SHKA 1KJYA 2XTMA 4TQ9A 2CL7X 2PCLA 2ZS9A 3M4YA 1CR1A 4XD7A 4YQFA 1AS3A 4A36A 1T4GA 4GMDA 2IYWA 4FI3C 3KJGA 2JJ2A 3FE2A 2IHYA 4OHXA 4ERNA 3TBKA 2C77A 3W5JA 2FSHA 5JWRA 2PZEA 3CNLA 2G77B 4BZXA 4PANA 2VH5R 3ONWA 2FFAA 4AKEA 4IOKA 3P1JA 3LV8A 3QQ5A 3BB1A 4C30A 4WIAA 5FOSA 4P0TA 5EP1A 5FOUA 1Z0DA 2AK2A 3UANA 3AVVA 3ADKA 3S1AB 1AQUA 1QHNA 2G88A 2QP4A 4YMVA 1B0UA 2NO6A 1Z0FA 5KDDA 4C7OB 3BH0A 3HU3A 3WNCA 5KNCA 3GJ7A 3W9YA 2WJGA 2ATXA 4AG5A 2BV3A 3Q85A 1TU4A 4JL5A 2ZRGA 4W7SA 5GJVC 2DFNA 3CR7A 1G18A 3FMOB 5KDLA 4ZKEA 4E03A 1XP8A 4NYJQ 1YRAA 4DLRA 3W6PA 3CM0A 5DLQC 4OBEA 1QG4A 1R0XA 3QJYA 1JR3D 1OV4A 4LV6A 4DXAA 4IOMA 4PQFA 5G40A 2NO0A 3N2IA 3H84A 3I5YA 3CWQA 4XSGA 4EKDA 2BMFA 3ZJYA 2ZM5A 1EX7A 4PC3A 1N5IA 3TQCA 2NZ8A 4OHWA 1ZM9A 4AD8A 4D4LA 1EFRA 1XXHE 2QE7D 2XJ9A 1JXMA 2REXB 1ZC4A 3U3MA 4QJ3A 3PEWA 3GLHB 3NBZC 1YZTA 4HAWA 1C1YA 4TL8A 2H8KA 5FUXA 4L8GA 1YZKA 1RYFA 2FFBA 4M4SA 5FL7D 3IO3A 4NHOA 1E9SA 3CX7A 3MLEA 3VR3A 3CF6R 1CKEA 1Q1EA 5KSYA 721PA 3THWB 5FBRB 4WXRA 2ANCA 3B78A 1P62B 3HYRA 1AGRA 2P5SA 1YKSA 5BQ5A 4IEIA 1Z3IX 1OXVA 4B73A 2HJVA 4CEHB 3NVAA 3BFVA 1Z0JA 2QP3A 2VP6A 4FIDA 4PC6A 1OIVA 2JJ8A 2RHMA 3OAAA 4D4KA 1H65A 2FGKA 4GDFA 1EGAA 4DUGA 3TGPA 1NP6A 2ZRPA 1HUQA 2W6IA 2AD5A 2DWOA 1ZAKA 4RY2A 2OFXA 2R6FA 4EPXA 1JBKA 4OI0A 4B3XA 3ZGXA 4PPQA 4XJXA 5EUQB 1P9NA 4B35A 1XXHA 1P3JA 1X86B 3PUZA 4R2HA 4TMWA 2O0JA 4MA4A 1TMKA 3AH8A 3VU9A 4M1YA 5FBLB 3QY0A 4B2LA 1OXTA 1PLKA 5M04A 2VYFA 3SYLA 1UKVY 3GFOA 1J8MF 4Z1MA 3RC3A 3THYA 3KKMA 3OEED 3CH5A 4JVNA 2V6IA 3UK6A 3ZZ0A 4B43A 3JVVA 2NPFA 2VF8A 4EPWA 4URVR 4XTRA 2VF7A 5J4LA 5F9HA 3K9NA 3L0PA 2ZI4A 2JEOA 1TAGA 4KVGA 1DARA 2V7QA 1DO2A 2OCBA 2CK3D 4JIMA 5FUWA 1KZ7B 5CJPA 1T91A 4RJLA 1I4LD 2JDIA 3AV0B 2CLCX 1N5KA 2G9NA 3U2QA 2OUKA 1KHTA 4L9WA 5FR1A 4E22A 4II7A 1SGWA 4D4MA 2CE2X 1R6BX 2GILA 3RHFA 4OHZA 2AFHE 4KYUA 1Q22A 4FWIB 4AK9A 4IXMA 4DCUA 1RZ3A 3ASZA 4KI0A 4LWZA 1MT0A 4Q4HA 4C3ZA 4FMDB 4DLYA 4RZXA 4AKGA 4QBHA 2CDNA 3MUFA 5SZIA 3DL0A 2O52A 1KI8A 4KV9A 2WJHA 2VTKA 3K9LA 2GXSA 4OYHA 5K8LA 1IAQA 2WMOB 1GRQA 2OV2A 4R9UC 2VSOA 3EW9A 2ZYVX 1G6OA 2WMNB 1L4UA 4RVCA 5KSOA 2RGXA 2Z4RA 4XWAA 2MMCA 2NGRA 4Q1EA 1GRNA 2XITA 4ZO4A 1COWD 1GIAA 4RKFA 4ASUD 2PEZA 4EJSA 3CRQA 3E1SA 4PO8A 4G5GA 2VA8A 4NCKA 3RWOA 2E9SA 3TSWA 1W7AA 4JJZA 4M53A 2FSIA 3LLMA 1YR7A 3PUYA 3WHLA 1E2IA 3AEZA 5H8WA 1KI7A 1DAIA 1W36C 1EX6A 1CTQA 2FA9A 2FPLA 1VDZA 4PHTA 2NOAA 2GESA 1FOEB 1SVSA 4QNRA 2EU8A 2VSFA 4NYMR 4S2EA 4DDVA 2AL7A 3DDCA 1P2UA 2FF7A 3C15C 3OIVA 5JJKA 1ZNYA 2RHDA 4MDEA 4TMXA 2C04A 4HUTA 1XPOA 1VG8A 2R2AA 2WSSA 2W2TA 3WBJA 2GETA 1G6HA 4NL4H 2ZJBA 4N3NA 4C0BA 2HXSA 1FMJA 1FW6A 4F4IA 2PJRA 3PQCA 4M1SA 4DLZA 3Q72A 4Q18A 5L3VA 3SR0A 4BZPA 3NBFA 1A5TA 1E1QD 3A6PC 1OKKD 4NTZA 2CNWD 4LBZA 3P4XA 4RKEA 3TR5A 4XVQA 5EP2A 4PAQA 5HKKA 4M21A 1CIPA 3CNOA 3UMRA 3BC1A 4HATA 3K70D 2KE5A 1E2FA 1BYIA 1JQLB 2C8VA 1KY2A 3DZ8A 4H1VA 4Q4AA 3HJNA 1XJCA 2WTUA 4MRVA 3EZ9A 1M6NA 1QHHA 3IHWA 1XRJA 4W5WA 1AKEA 5JWOA 2FJUA 1S9DA 3EIEA 4MH0R 3SS8A 4OL0A 4MDFA 1WBBA 3EWAA 3AGQA 3AUXA 3C5CA 2QPAA 4HYYA 3NIBA 2AD1A 4URYR 4AC9A 3H1TA 4TMVA 2F55A 1E9CA 2C5LA 5DYIA 4WXPA 2WWGA 1NVWQ 4IJMA 1TL7C 3GLIE 2IC5A 3PJRA 4ZV4A 3QG5A 1GP2A 4HAYA 2PL3A 4ARZB 4CIDA 1GG2A 3D31A 1T5LA 1BMFD 2IF2A 3MJRA 5DI3A 5EXPA 2QAJA 1RRFA 4EPVA 3U4QB 2J9RA 1JR3E 1D9ZA 5KPDA 1N6RA 2B8TA 3R20A 5FL3A 3T1QA 1OF1A 4PQRA 2NTYC 1ZU5A 1W5SA 2OFOA 3CPJB 2RB4A 3K0AB 3C14C 2V1XA 2V9PA 1WDTA 3CBQA 1ODFA 2GF0A 4QGGA 1FZQA 1SVLA 2XX3A 3WMGA 3AF0A 2ODNA 4FMCF 2V1UA 4PSVA 4BEBA 5IDVA 4D0LB 2DCUA 3OESA 4I1UA 1N5JA 3EA5A 3ADBA 1VMAA 4P4TA 1MO5A 2HCJB 2IYRA 3BIFA 4A1FA 4E09A 2X1VA 5BWMA 4TMKA 1P2TA 4K46A 4TYYA 1Q20A 4KXFB 5HCIA 3M6AA 3KQKA 3AVYA 3I62A 4DLTA 1Z5ZA 1ZNWA 3FHCB 4RCYA 1E3MA 1T0HB 3PEUA 1DAKA 1SHKA 4PPFA 1CR4A 3GLIA 2VO1A 5L3QB 3TNFA 2A5FA 5AUPB 3SNHA 5FTLA 4JVLA 3FMPB 4Q66C 3X1XA 1NVUQ 2L0XA 4CEIA
chains in the Genus database with same CATH superfamily
3A6GA 1FFGA 2WYWA 5A9SA 3NASA 2AXEA 2QAGB 3DYVA 4H2DA 5KWEA 1ZITA 2DPMA 1W4LA 4GOOD 1R66A 3PXCX 2VLBA 4F96A 3IKTA 4R0MA 1XEXB 13PKA 2DB3A 4DR7B 4EUKA 3PJEA 3NONA 2VQSA 5BW6B 2QW0X 1WB5A 2CBZA 2SCUA 2WHQA 3ET5A 4R1TA 5DX1A 3VYWA 1YB7A 3X1JA 3R5KA 1HK7A 2X9GA 1K0FA 4O4HA 4WASA 3BRWD 3EMVA 1NXPA 1FFBA 2ECQA 2X2OA 2OBLA 4FR5A 5KBYA 4IIJB 1AN9A 4WZZA 3D6VA 4Y3UA 2BDEA 3PDCA 3HB9A 2WKQA 5KUTA 3TPZA 1N0VC 3A0RB 2EBHX 5FV7A 4L3VA 2O2DA 4W5JA 1Z82A 3WRWA 2A4KA 2O59A 1VL0A 1K9VF 3JVIA 4NJEB 3ZWVA 4OHYA 4Y1RA 2P9EA 3GIWA 1NUQA 1LCIA 1F4VA 1ZCFA 2CD7A 2EFEB 2FWNA 2HM7A 2PXAA 2VTEA 4GOLD 2NVWA 4ND2A 4ER5A 4FDTA 1N9GB 2FMHA 2XV1A 4B6QA 5AW3A 2N1BA 4COKA 4XYGA 1E5XA 1WF3A 4NX2A 3OE4A 4EEXA 3OI7A 4OOFA 1RAEA 4F3RA 3PUWA 4FS8A 5EJ5A 4FB5A 5C8YA 5CA0B 4OOEA 1J20A 2IT1A 3A6JA 3I04M 1V5GA 3P2YA 4RY9A 4FBMA 1ULZA 2FEWB 5JISA 2GHQA 3DAFA 5DU2A 3OHMA 2WP8J 1QQ5A 4WOJA 4U0JA 5A71A 2B5WA 2PUGA 3ZY2A 4B45A 4DIBA 1WETA 3ZD7A 2XHEA 1MAWA 1JQDA 1V5WA 2I5PO 3G13A 5IC5A 5KHOC 2FEAA 1ENPA 4Z4QA 1ZJJA 2W58A 4OXQA 2J0EA 3FRIA 4LZAA 1OX4B 2Q29A 3HNRA 5BYJA 5B57C 2FEKA 5JSUA 2IGBA 2B20A 3SI7A 4U1RA 3O4HA 2IOHA 1LNSA 1XTKA 4ABYA 2F17A 3T3IA 5JJBA 4IZHA 3OP4A 2G72A 3I5XA 2X76A 2WKWA 3SJBA 1YJ5A 4YRSA 5I48A 1FS6A 3ESXA 1M2OB 5DHQA 4B4VA 2GZHA 3JQGB 4KRGA 1XD2A 3HI4A 4PE5B 4QYXA 2CV2A 4QU0A 1T3ZA 1LBTA 2OD7A 4FPXA 1XMVA 4ZANA 4MQ4A 3DEJA 5AIAA 3OBBA 4PLCA 3VNUA 4LHSA 3EVEA 3VR1A 5EERA 3E2PA 4WI1A 4DA4A 4IP0A 5KYYB 1XNGA 4EX6A 5IKXA 3QBDA 1V0JA 3QMVA 1Z2DA 5FP0A 2YY5A 3NLLA 4TUYA 4P8RA 4A5OA 3SIWA 4R7TA 4MUIA 3CEJA 1EP3B 3DEFA 1UKZA 4ZVPA 3FPEA 3JQAD 4UUBA 3LPDA 1I1QB 1CJKC 1XHEA 1E5TA 3U9LA 2FFRA 1D6NA 4G86A 4RVGA 3DLCA 4BO5A 4I46A 3KZXA 4DV3B 4WPGA 3C24A 5D3KA 4EFMA 5U9CA 3QTBA 1JYFA 5DM70 2VQFB 1NW9B 1P75A 3WWYA 4GPBA 3AVTA 5EE1A 4X1IB 1X7ZA 3V4PB 1I0LA 2IDZA 4I9FA 2W2LA 5JNTA 5L3SB 4EY3A 4F7WA 1FNCA 2YXDA 1L5RA 2YVLA 1Y6GA 5LA6B 2W2KA 1Z7GA 3RVLA 2XUDA 2YXEA 1LB1B 3VHQA 2JANA 4AF7A 4D99A 1R5OA 2CHQA 1G2PA 2YS6A 3FM9A 1DVRA 2ORYA 1DU4A 3CF4G 3HGQA 3QKUA 2UUOA 1SM4A 5AKKA 1XYVA 4HGPA 1K3FA 3GXOA 5CK4A 5EJ8A 2I7TA 1UIRA 1ONNA 3WO0A 4G56A 1XTSA 2EL7A 4DMGA 4DVGA 3WRVA 2H6EA 1K3UB 1S1CA 4FNMA 5JFGA 4DMRA 5D6NA 5LUBA 2QRHA 3FGZA 4KH1A 2DULA 4JT9A 1R74A 3SC2B 1GKIA 4UOEA 3F6YA 1NJ6A 1GTG1 2C20A 2GTIA 5I7OA 3IDFA 3VHRA 1ZD4A 5FWYB 1QPZA 4M98A 4MRSA 4C76A 3Q9UA 4WK0B 5GJWC 2RAVA 1TECE 1ZJ5A 5E1OA 5E3JA 2FZLA 1UM9B 4JKYA 2CXSA 3F7TA 4QSHA 3U6BA 2NU7A 2BR3A 2PVPA 2WQZA 3D7SA 4KPUB 5KTYA 3ZK7A 2GFQA 5ICFA 4IO0A 1BQEA 3QFTA 3C1AA 4KBYA 1S5PA 4CL2A 1Q1NA 1UEXC 3DAPA 1XVTA 1TIBA 1Z75A 3JQ9A 4TQAA 4WLUA 4JYCA 3TNJA 3TVDA 1ZCZA 1NVXQ 3CT6A 2VPPA 4J0HA 2J0VA 3MA0A 1N1EA 2I3AA 2P9JA 4QELA 4BZQA 1S3GA 1T6BY 1Z29A 3IAUA 3DT9A 4CHTA 1O94A 3HBNA 4TV9F 4D9NA 4L9AA 2X15A 3M1IA 3RK1A 5B3KA 1UJ2A 1HNWB 3AF2A 1DLJA 3JTEA 2IUFA 3ACDA 1JDUA 3VH2A 1VE6A 3N2ZB 2WM9B 3FMGA 6YASA 2HB6A 5E6SB 5BY2A 1AM4D 1JSXA 4QFCA 5L6MB 1AT1A 3P9SA 5F23A 3ZWBA 1YVEI 4WUVA 3F4LA 3TE7A 5JR3A 5EZ6B 2QV0A 3HVJA 3ZWDA 4F21A 4JJ6A 1JQ3A 1U2GC 4W5NA 3WG9A 3OIDA 3KUDA 3A6DA 4ERXA 1JEQA 3OZDA 2E0IA 5KYKA 4JL8A 2Z5FA 1ADJA 1FLAA 1RJ9A 1XF9A 2MOKA 2QI9F 3DYIA 3ORFA 3I04A 3QITA 5B3JA 1GGVA 3ZVLA 3FSRA 4CF3A 3T94A 2RI1A 4TLBA 5I5EA 4TYQA 2FG5A 1PGPA 5A5EA 3ANNA 1CR2A 4E2YA 1O4VA 2C9ZA 3W3AA 3H2KA 3NPMA 1H05A 3GMDA 4MVCA 1VMEA 5DM2A 1SQ0A 3CVOA 1JJFA 2DX7A 1HKUA 3GHHA 2ERYA 2CNNA 2WSLA 2PS0A 3CS3A 4MW1A 3TQSA 3BAZA 5H02A 2R25B 1PJ4A 1TFUA 1SQSA 1U2TA 1X2EA 2GJ9A 4PIVA 4XA8A 3OFSA 4KYIB 2JBHA 5U1PA 3WOHA 1D7OA 1G0OA 3FJOA 2CXXA 4PYKA 5EIOA 3TKLA 2HRZA 3DD1A 2B36A 5LWQA 1MJNA 3IHLA 2EX1A 3NNDA 1AUOA 3CX6A 3DLHA 3K09C 5DFAA 3C74A 2D5LA 2EX4A 3N74A 2HC9A 1R6XA 1OPXA 2F7SA 4WBXC 3VC7A 2ILTA 1M0EA 5CYOA 1NULA 5K3DA 4RNDB 1WZIA 3HWRA 5LZ5A 1SD5A 3MEQA 1WZCA 4QM6A 3EGDB 2UZ3A 1CRLA 5IXSA 2MSNA 1H93A 1QQ7A 3ETCA 3QX9A 5EQDA 3HUFA 1YDGA 3GJ6A 1L7AA 4B2PA 3U80A 3AZOA 1E3WA 4EG5A 3EF1A 3Q8MA 2OFFA 3I61A 4WA8A 1O6FA 2X4LA 4F5WA 4DLXA 4AN1A 3AUFA 5CX1A 2XWSA 2V6GA 2ZI9A 4KQWA 1EK5A 1GUZA 3HDYA 1OH6A 8ABPA 2Q9UA 2V74B 3GJ3A 4B82A 4IGAA 1Z8HA 5EE3A 1H3EA 2V45A 5DASA 1OLUA 2IUYA 3GBVA 5D7BA 1Y42X 2OXTA 3Q7TA 1P4AA 3WLFA 3SVLA 2RGDA 1M10A 3HYSA 4Y9DA 4XCQA 1T1EA 2IP4A 3D8NA 2XNSA 5TQVA 4DJEC 1S8FA 1AGPA 1Z25A 2R6JA 1KMHB 3P52A 5KVQA 3LSTA 3O2JA 4URZR 1MO6A 1NX6A 5FA6A 4XR4A 5EZYF 4ARSA 1TFRA 1JZSA 3OQIA 1N75A 3NIDB 4C08A 1M74A 3OY2A 4LQCA 3EZXA 4OUDA 2PSHA 4CIVA 5AVOA 3O8CA 4PYLA 2JJ1D 2N3ZA 5B58T 2HJGA 1YGYA 2I65A 2D3TA 3BRWA 1JAXA 2ZSHA 4LWPA 4GF5A 4MUBA 1R0YA 3U4AA 2KX7A 2R8RA 3IQEA 1GA1A 1Y1PA 2QR5A 1U0NA 2DPYA 4M49A 3GNSA 1H4VB 2QN9A 2H5JA 1YK1A 2KMLA 4QA9A 4JQOA 1TM4E 3BSSA 3RU3A 3SQMA 1V26A 1XIVA 2ZUVA 4KIGA 5ECWA 1ORHA 4CF7A 3KHSA 1M1ZA 3KHUA 1R0BA 2J48A 5CPBA 4P0PB 1G4UR 4RTOA 3MJEA 2P2GA 4RD3A 3V8RA 3BICA 4BLQA 2D62A 2DF8A 2CXHA 1CNMA 2XKJE 3TW8A 3IUPA 3FUCA 3OZGA 3J7AC 1PZMA 4RF3A 4G8CA 1THMA 4YRRA 2FG6C 2R79A 3GEEA 3LQQA 3VU1A 2R5NA 1L8XA 3NM6B 4Z0TA 3VKFA 1YQEA 4MICA 3EX7C 2YCLA 2D5CA 1Q0SA 2EFGA 1LLFA 2D0OB 2K7ZA 4WOKA 4OIFA 1UBEA 3GVHA 4K3UA 3ETNA 4PHFA 1MVNA 1GOTA 2JI6A 3W4KA 4UHCA 4GNKA 3M4ZA 1PJQA 1QGUA 4V2IA 3DV0B 2H65A 1UWVA 3A1CA 3D0RA 4L5BA 3QXHA 4ZCLA 1ULSA 1KVRA 1NYLA 2CCGA 2P2LA 4EQ6B 1G59A 2P41A 2QGFA 4HVLA 4JFAA 1YJQA 2YHIA 3S8MA 1DC7A 4RK7A 4AMGA 4KITB 2V7TA 2CFCA 1N2BA 4NSNA 5K6TA 2JIRA 3U81A 1FNBA 2RHOA 3LT2A 2FPMA 4D02A 1KYIA 2D8MA 5TPZD 3SJAA 1H6AA 1CNFA 3PPXA 4ZAZA 4HPXB 4Z4GA 2QA5A 3EPPA 4ZHQA 2NUPA 4RGBA 1TZJA 1Y1TA 3KETA 5EMJA 1IH8A 1WZUA 4DR5B 5IJ9A 1K97A 2I1WA 3EDQA 1RLOA 1U94A 2PMKA 5AVZA 2PZJA 5KQSA 2OESA 5JZVA 2A0FA 2A1UA 3A6HA 3FDXA 1AKTA 1W2HA 1G1AA 4V0RA 4I7EA 2HCRA 7MDHA 1TW2A 3TLMA 3RG2A 1MHTA 3BT7A 4YLGA 2GKSA 1EXWA 1EE1A 1U2PA 1MA0A 5KYWA 1NG1A 3DUFA 3DVQX 2O8EB 3QQPA 2GNOA 4UUNA 3NGLA 1BEUB 4OGFA 4EOGA 3L07A 2XCUA 4HNVA 5L3RA 3KQNA 3W4IA 4MITA 1NBOA 4Q12A 3WLMA 2HA0A 1OT3A 3OQ1A 4AB1A 5DRTA 1JH9A 3O47A 4WJLA 3NYIA 2M6RA 4HDCA 4I9GA 1CG6A 2YN0A 3JQAA 1M72A 1F5NA 2MDTA 1EFVA 3CRMA 4EW2A 1DTSA 3QF4A 3BB3A 1JG4A 2H8GA 5E8RA 4ZT5A 4F72A 4H1WA 4U2GA 1HNNA 4ZK6A 1XU7A 2HIAA 4YXWA 4EWLA 5IN4A 1KDOA 2CYCA 4PYIA 3K7EA 2Q41A 3O4JA 1KKLA 3P9CA 2H06A 3CTPA 4D4HA 5IMSA 5K05A 4CKYA 3LXXA 5HIMA 3SU8A 2ZYTX 4LHEA 1M76A 4ARAA 4B7UA 2I7VA 1VJRA 5JAUA 3ELYA 3CZAA 3V1TC 3W8FA 4CF6A 1CVIA 4IICA 1N2GA 3JYQA 1GDTA 2IUSA 1FSSA 1M34B 1MEEA 3C4QA 4UDNA 4GWKA 2OYCA 3GJ0A 1C81A 5EXSA 3W6ZA 2GZMA 5JAZA 5CM9C 4ZV7A 1YASA 2OUIA 2O8CB 5LQRA 4QECA 1SZCA 4FFBB 5LXTA 1CJMA 1GUAA 1Y8ZA 1PZNA 4OA5A 4R2WA 4OB7A 4JEHA 3IEPA 3CNHA 4L3WA 2JH3A 1A7UA 1QH8A 3AUYA 5ECYA 1PEYA 3UJDA 3CX8A 4JYZA 3BWEA 2VSQA 4LPSA 4MYCA 4BMCA 5I4IA 2AS0A 3UFBA 4IH1A 1X8LA 4QLOA 4J6EA 2PD3A 4QUAA 4TKVB 5EXEA 1HFEL 2OTCA 3W06A 4BNJA 1EHIA 1E8NA 4KU4A 3V7UA 4HDKB 2BI4A 5JCPA 5AI5A 2IPXA 1P6UA 2JGKA 4CTNA 4MKFA 4QPPA 3HY6A 2ONYA 2V97A 3E4DA 5K0SA 3WA7A 4C4RA 2C29D 5GQSA 1AB6A 1USIA 2H2AA 1BVUA 1EVQA 3E3OA 3NZEA 2XMRA 1W25A 1OXXK 1R4ZA 4MYTA 1G21E 4O4IA 4MKRA 4A0RA 1Y5RA 3IFSA 4MV0A 4RQBA 5LBIA 4AU1A 5TIIA 1FQJA 3TW0A 4ZU3A 2D13A 1FW8A 3ZPXA 4MW5A 2WNSA 4IRXA 5M29A 1SVIA 3D8BA 2ZT6A 3FTNA 2V7BA 3H05A 5F1OA 3MQ4A 2PFSA 5JSQA 4P3KA 4BATA 4JUBA 1T34A 1GZVA 1TM7E 3JYHA 3FNRA 1VYVA 4D9BA 1QH1B 3U5ZB 2B78A 3GP5A 2K4MA 4E5KA 3L7OA 1TT5B 3PX2A 5CDFA 5HJ7A 4UVDA 2HQOA 5IBQA 2ASEA 4DREA 2FH5B 2OCGA 4KO4S 4NONA 1MH1A 2HPVA 3WL7A 3IBYA 1YNOA 1LW6E 2ZYHA 4K9KA 1SBCA 2V54A 3MAAC 2RC5A 3R23A 3WYGA 4C7OA 3FR7A 1Y3HA 5K3EA 3DM5A 3VOAA 2ZRNA 4KLRA 3HN7A 2GPJA 3ZCQA 4JKIA 3TRHA 2ZATA 3SR4A 2WOOA 4F6LA 3ORSA 4NDAA 1FFCA 5K0ZA 1IL0A 3PEFA 4P82A 3GGCA 4I5EA 1OU4A 1I4WA 3D0KA 4G4SO 2NVUA 1EHCA 2GYYA 1AK9A 1O97D 1PTJA 4JS0A 4NNPA 5FNVB 4ODIA 5EIEA 1ZCAA 4BO1A 1GTL1 4HJRA 3EHDA 4DNPA 3CH7A 3HJRA 1DEAA 2VP0A 5FFNA 3FPSA 5K3FA 2A9KA 1HLPA 3IYLW 3LKVA 4MIEA 4NOLA 1Y1LA 1Z34A 3BGOS 4C7KA 4XVCA 1CUVA 3DE5X 5EFZA 3VMMA 4TTTS 2ZI6A 1EP9A 3R5HA 4AS2A 3MFQA 4F71A 3ZIUA 2HY7A 1NURA 1UFOA 1FY2A 2W0MA 1X7HA 5F3DA 4R8VA 1PCXA 1G20B 3R76A 5HVNA 3VNSA 4OXXA 1Q11A 2IZ7A 5FPSA 5REQA 4CDMA 4JH0A 1G9SA 3VMFA 4B6FA 4KVAA 1F51E 3EEYA 3DOCA 2OM2A 2XGSA 2Z3WA 3G2OA 4N3GA 1J23A 3GNQA 3EEIA 3OX3A 4RLSA 1OXKB 4FMBB 4YJ3F 2VBGA 3RIHA 4U7DA 4AS1A 3WGZA 4HEQA 4BP8A 3AB8A 2B7CA 3OEYA 4M54A 3S6JA 1E8DA 4ESVA 3Q3GE 5LYJA 2J9GA 4QDXA 2IVZA 2RHBA 5GMOA 5NULA 3SZRA 1NTOA 4H7PA 3CV3A 3ZKWA 2PRKA 2YZ7A 4BZZA 1PKEA 3THWA 1BXRB 2O4UX 1S96A 5T7BA 1SXJD 3QFCA 2QLTA 4KQ2A 3K6SB 2H31A 2DBRA 2I2CA 3RRJA 1AS2A 1UXJA 1DXHA 1ZCJA 5E4JA 2H85A 1GDDA 5ARDA 4A5SA 1QRUA 2D7DA 1ULUA 1N6OA 1P5JA 1UODA 1YDEA 3EMDA 1XZNA 3FKSD 1XLVA 4I6EA 3UK1A 4CFZA 3PIRA 4ND8B 5EMHA 1E9EA 1U31A 4EW6A 4DR2B 2H1HA 1A2QA 3SJZA 3TTWA 1KI1A 2WILA 3KKQA 4LYHA 5CLGA 1E0JA 2WU1A 3GGDA 4BMVA 1CDEA 4Y6SA 3VNBA 3KAQA 4D9IA 1U2QA 3N2GB 4DBLC 4N82A 1Q7CA 4DLVA 3RLFA 2PMBA 3ENKA 5J2TF 2PU5A 1EXDA 1K4KA 1EA7A 5DTRA 2FZ5A 2XEDA 4PLWA 2F8TA 2D59A 3P0IA 4FIZA 4ME6A 3R7WB 1QZXA 1YONA 1PLLA 1ZWKA 4AJIA 3WJAA 2P4UA 4QHYA 1WB9A 3B52X 3KXPA 2JJ1A 2DR0A 1RXCA 5BQ3A 1GNLA 3VTZA 5IUJC 3J81k 1WKBA 2OORA 3U1TA 2WY2D 3DZBA 4I5DA 5G4KA 3R4CA 3WNBA 3JV7A 3AVPA 4FLFA 1NA5A 1VCOA 3C3WA 3BCHA 3VVBA 3E8SA 3LW8A 1XNJA 2HA4A 4PONA 3S5JA 4TYWA 2PWZA 2PFGA 4KR6A 3H2JA 2WJVA 1D0VA 4HDSB 3UG6A 4HGQA 5E7IA 1KAQA 5KYUA 2AJBA 2C4MA 5AW0A 2F64A 3BQNB 4GI5A 1TJ3A 3NEAA 4CKCB 1FFHA 2Z2IA 4HH3C 2YIMA 3X0DA 1XZIA 3CKMA 2GHTA 3MELA 3QKTA 3GD7A 2BGWA 4HNAB 3O83A 3STUA 4IX1A 3W5UA 5AWFC 1UH5A 2RK6A 3DC7A 2AX4A 1QYCA 1IYZA 4KX5A 1WCV1 2R6HA 4GXTA 2DHDA 4KXYA 1UPXA 4ZQIA 1ZXBA 1KJQA 4ZZ0A 1LDNA 1GAWA 4YAIA 1UMDA 5AW2A 3TZ6A 1LZKA 2EEZA 3ANSA 3AGPA 2ZSJA 1WXXA 3LZ6A 421PA 1VSVA 1W34A 1FSFA 1AJEA 1QJCA 4Q4JB 2C5HA 3RVKA 4FK8A 2QUKA 3U61B 2WAOA 1UM8A 4DEVA 4PIPA 1EWRA 5T4EA 1K7CA 3Q40A 4OUKX 3DXXA 5JQWA 2FP4B 1IWPB 5ESXA 1V6SA 5BN5A 5MF6A 2TRSB 4DV7B 1XNQB 3DWEX 3D0OA 2CLKB 2ERXA 3ZWPA 2XF2A 3SQWA 1I6MA 2QXTA 1WY7A 4OGGA 4UFPA 2NX2A 3R09A 4D25A 1Z73A 4RYDA 5TPZA 4LC1A 3VPDA 1D09A 4EB6A 4TTVA 4Q7QA 3TL3A 2NTJA 3H9QA 1JHZA 3D9QX 2OCPA 1U8TA 1Y9EA 1H22A 1EU1A 1HYEA 2LUOA 4GU5A 1P6XA 3NHBA 5BUQA 4LF6B 1YNSA 2B92A 2O23A 5K99A 1G64A 2AOUB 3IQXA 5AR1A 1X7WA 1SK9A 2ZANA 3VUEA 3MHTA 1A1VA 2C2OA 1E1RD 2W4MA 2A7QA 2INGX 3QV1A 4RD0A 4URWR 5D3MB 4DV0B 2WQ6A 2CVQA 3PL1A 4HMOA 2FJ0A 5K09A 4W5TA 2IBMA 4FGUA 3MS7A 1CJUC 1Z5GA 2JAWA 3QUTA 4YFYA 3GX1A 1ZR2A 5AHKA 5IYZB 3OQNA 4LPKA 2FKAA 4TGLA 4Q7KA 3RSOA 3T3DA 2X3YA 4DHEA 4ENRA 1AF7A 4N5NA 1YUBA 3PGMA 1A8UA 1XEWX 3HYCA 5TARA 2EXXA 1P2VA 4E08A 4TZ0A 3W8DA 2Y1CA 1ISIA 1ZMBA 1QC5A 2X5OA 2ONCA 5A6SB 3I8SA 4J4HA 1YJXA 3IUQA 3OE1A 4NE2A 1D6JA 4KWCA 3AM1A 2IUUA 1R8JA 2HF2A 2V7PA 3ESQA 1BU8A 1OZGA 1W93A 3M6MD 3IIKA 4QUJA 2GRUA 5K2MA 2CNDA 1PE0A 2FPRA 3G59A 4FLMA 1UP4A 4KOAA 3IPXA 1Z4IA 5CCXA 1D2RA 3C39A 4WFIA 2X5JO 1EE2A 4IUBS 3WK9A 2OAEA 2YDXA 5J5VA 5BYKA 2Y68A 4HGRA 1K4YA 4YDHB 4M8SA 1MTOA 4R8LA 1XTUA 3GBSA 1FP2A 2WEKA 1CNEA 3CNNA 3FKQA 4JT8A 4RQAA 5KHAA 1L1QA 3TXXA 1DCKA 4C43A 3GEHA 1RSZA 4RENA 3NGXA 2FMTA 2B98A 1DCFA 3ESRA 4DSAA 2PWAA 1E1CB 1ISGA 1SY7A 3DMTC 1WMSA 3QWAA 3R5FA 1UPCA 1KS9A 5DRYA 3G6WA 4B9EA 2ZT5A 4IDPA 5C5DA 5K8JB 3EGXB 5CVEA 1WE2A 2QVXX 3GUUA 1YQQA 1KL7A 2HRRA 1FFDA 3OKCA 1ZN2A 2QT0A 3CGWA 3FGPA 1PJSA 4OXYA 5H70A 1JVNA 3MPUA 2XMPA 2EW2A 3TCXB 1EGHA 1USUA 5CAEA 4V0QA 4G1UC 1AQYA 821PA 3EIFA 3I2FA 4GR5A 4ND6A 4YVFA 1L4HA 4B09A 4FLEA 3O94A 4EHHA 4FGLA 2IUTA 2X8JB 4KXVA 5HE8A 1NVTA 3NBXX 4ARZA 2CBXA 3E9YA 1ZY2A 1JEOA 1FFAA 4Q05A 1B6GA 1W6UA 1XHLA 1FBTA 3N53A 1CUUA 4Q7LA 4D79A 4YP9A 4KQ9A 2YUIA 2ZBFA 3MTAA 1BQ3A 1R9NA 2IYLD 4FCTA 5ULLA 4COOA 3LUGA 2B8NA 5HNKA 4A10A 4UAUA 2UZ1A 3M34A 2JLXA 2UYHA 4P3PA 2GN1A 2GTHA 4NAUA 5HHTA 3EBPA 3WC4A 4DCVA 2VZ8A 4I1VA 5CTAA 1VL6A 3CT4A 3KWLA 2VCEA 5HFJA 4G0UA 1F38A 5HK9A 2FMXA 4FDLA 4AY5A 4ZI7F 5FI5A 2QLLA 5CFOA 2Q2OA 3B53X 3IKJA 4EG6A 3EG5A 3RRMA 4EUNA 3N7AA 4J94A 1Z5VA 1L7BA 2OVFA 3UG7A 3IP7A 4LXHA 4E3WA 5K7SA 1EAYA 3LKDA 4TKLA 4R1OA 5EVCA 3E2MA 4PHHA 3UICA 1GM5A 3F6BX 2GM3A 1OW3B 2JD1A 4CQLA 5INTA 2I4NA 2QXYA 4G24A 3FTEA 1KP2A 4QXOA 1XF1A 3JALA 1N4AA 3D0QA 4B48A 1KOGA 4QTTB 4I6JA 2WF5A 5GM2A 1NUTA 3QWBA 1BSVA 1BX3A 5L3QA 3JATA 2GEUA 2IS2A 1EVLA 5FPQA 1K27A 8OHMA 2HT1A 1BXKA 3HRIA 2C00A 3I83A 4MKHA 1E3EA 1E0KA 1KHHA 3MVEA 4OVKA 1U6JA 4BNNA 2AJCA 4ZGGA 3MWYW 2YZNA 3G9QA 3SG0A 4GSLA 3H1FA 3WWCA 3L0SA 4WCDA 1MDBA 1XCGB 1ESEA 4X97A 2VFAA 2HTEA 2WWXA 3B2NA 1DO0A 1V35A 2JEYA 2ZJZA 3LSYA 2OV6A 4JJFA 4ND3A 1EFPB 4LHVA 4AYXA 2J87A 3A1DA 5I3ZA 2HI0A 3NHPA 5C1DA 2XQJA 1PNOA 4GG1A 3SQNA 1R7RA 2Q7DA 1DADA 2CL0X 3V34A 2YYYA 4FDVA 3PNQA 4TYPA 5IWAB 4H27A 1QQAA 1D2HA 1ONBA 1A88A 1G5HA 4ZQFA 3E70C 1WTCA 2Q9CA 1QFMA 1JPUA 2X6TA 2GPWA 3L8EA 4GVXA 4J3JA 4KGDA 4CCYB 3KPJA 4XWWA 2HXGA 2R1VA 3CN7A 3ROZA 3IAS6 1PL8A 4IDQA 5BSWA 3PQ3A 5JBQA 4K9RA 2FPSA 4F86A 1CY1A 3H0KA 3H9GA 5EINA 1J2RA 1XVIA 4WERA 1S2GA 3NHAA 3D7NA 4K9NA 3ZD9A 3NEYA 1B15A 3EEOA 4GRDA 3TE6A 1NLMA 2QRNA 3DB1A 4L4UA 4MUNA 1KC3A 5B7QA 3GFSA 1IG3A 1TZCA 3W77A 4Q1DA 3LGXA 3FVTA 1KS2A 1SXJA 3IT3A 3R8XA 5C18A 2GQ0A 3BIJA 4OAQA 1KNQA 2X1HA 4DTIA 5KCMA 3D2LA 4DJTA 3EIOA 1WNTA 2P40A 4AKHA 4WNIA 2ZI5A 4I14A 3OEWA 4PFQA 4D4GA 3FPBA 3OZWA 2JCBA 3WFZA 4DCNA 1WPGA 2Q5JA 3FB4A 4ALLA 4C0KA 3FKSA 3UOGA 3IOBA 3A4LA 2C07A 3K0SA 1JFFB 4UHKA 1C3VA 2O3QA 1W44A 2X42A 3D6JA 4EA7A 4DUPA 3GGPA 2I1VB 1N32B 2W4IA 3THWB 3L3BA 2B6NA 3ZGYA 2C03A 3G0GA 4AO8A 2XZOA 2J6BA 2RHRA 1C2YA 2BR4A 2UZIR 3L7LA 3PSHA 4I3FA 3TCKA 2Z9CA 4ZOLA 5EMNA 2B21A 3C3YA 1WOMA 1X7DA 3C6YA 4IQ4A 1U8XX 4M3NA 4P83A 4ZARA 3V80A 4B34A 7YASA 2ZM6B 2FFHA 3FF4A 1KEUA 3IIMA 3IH5A 4Z3KA 1AMOA 1X80A 3JQ7B 3C1UA 4PZAA 1CW2B 2BW0A 4ZO6A 1LRLA 2BFCA 2GD1O 3U4CA 1G17A 2VPTA 2JCSA 3FZEA 3N86A 3O8QA 5GJBA 1E2BA 1RC1A 4RZ3A 2O0HA 1SWVA 1JTVA 4MQEA 1B8VA 3ABQB 3HMKA 4QOIA 3D3QA 4MRAA 4H7KA 5FOWA 4HGOA 3B6EA 1PEKE 4O25A 2HHLA 5IASA 1IONA 2D2IA 1LPOA 5U4QA 4AWBA 1DIRA 2BGIA 2AJ8A 2VXCA 3HBAA 2XLBA 4HR7A 4KSCA 2C7RA 4YWJA 4Y30A 1RQXA 4HHEA 4A8PA 2B8WA 4RIHA 3E22A 2REQA 1OTYA 3I34X 2AUNA 2XBLA 3OLQA 4FQ8A 4G5YA 1UT6A 1OH7A 1FP4B 1N6PA 3Q6IA 4OIMA 4QL3A 4QJ5A 5EIBD 4G0QA 2C8KA 4EGSA 4R0VA 4W9NC 4AZ3A 2BD0A 3BFPA 1H42A 1Q3TA 1P81A 2EQBA 3J7TA 2AKAB 4H3HB 2PZMA 4FOTA 5EJ4A 1OBOA 2PLFA 1ZK2A 3SF0A 1CY0A 2HU7A 3K2BA 3SBOA 5TLSA 4BCBA 4NI5A 4WV3A 5FTNA 1QRTA 5KNLA 4KDEA 4C7BA 4HMPA 3A58B 3IR6A 1G8SA 1SB9A 3DZDA 1RLTA 2O7VA 2QROA 4MW2A 4RADA 5SYMA 3UB2A 3ZGVA 1D0SA 4E07A 5C1BA 4JI8B 1QWOA 4P98A 4RQUA 2J5QA 2A1TR 4EJ6A 4MYRA 4WEQA 1ZI8A 2A9PA 3UXHA 3WRYC 5IG2A 4O0LA 3TEMA 1ZH4A 1G16A 3CO5A 3MK31 5JAQA 3SIPA 2KQUA 1OD6A 4MQUA 3L6BA 4TT8A 1YR6A 1R0CA 1KO5A 3NRBA 1TAQA 4O2LA 1O2DA 3SEZA 5DHUA 5HPYB 3AI1A 1EUCB 3RREA 4NBWA 4LJ5A 4JY7A 1SC9A 2OD9A 4IIGA 4XWTA 1K0UA 2AEFA 3T5DA 3E1KA 5HQ3B 4L73A 4LX8A 4C6RA 5CPFA 2WIFA 5KS2A 1E1RA 5E3IA 3TNDA 2HSEA 1QU2A 2C7VA 4MP8A 2CL5A 1AIPA 5EGSA 4MV5A 5C3UA 4EY7A 3OOWA 1Z0KA 4FSDA 1DAPA 4CG1A 4ESOA 3HUEA 4RWZA 4U5XA 3TH5A 2PX0A 3GOQA 1I7LA 1U2EA 3QFHA 4HAVA 5BQXA 4GS5A 3CJRA 2I7CA 4J0EA 1QO9A 4PS0A 3BXXA 1FDIA 1Z56C 2BGNA 3HRKA 3NBAA 4HNQA 4D0SA 3B6KA 2IZ0A 4M46A 4OD0A 1GD1O 1QUFA 5CDUA 3TGWA 4B8WA 2X13A 2OXEA 4EEZA 2FZKA 2H7VA 1IBRA 5BPFA 4BHTA 1JECA 2NYUA 2QZSA 5I01A 3M7IA 2J9ZB 5J4YA 1NLZA 2I3GA 2YHAA 1EZ4A 1S3FA 1JFRA 3AJ9A 1KF0A 1OLOA 4HSEA 1DKLA 4DOMA 3OY7A 1T1IA 5EJGA 3DAOA 3MOIA 1H66A 3BD9A 4LRWA 3L46A 3ADCA 1XZQA 2EW8A 2GUWA 2WW8A 3KZVA 4LKRA 2XNDD 2QNIA 2FSPA 2ZZKA 1NMZA 2QQ0A 2ZLBA 4M7RA 4JSRA 1NV9A 4E30A 1ABFA 3D8RA 3IAHA 3EPKA 1U5BA 4MKZA 3PUJA 4NESA 3OZTA 3Q6NA 3PT9A 1N9ZA 1U4SA 4TTQA 2WTAA 3AY7A 2LVBA 2P3QA 1UKEA 3T0FA 5BSKA 1IBLB 1DBWA 4MLCA 4JELA 3ZE6A 4DVJA 2GERA 1FX1A 1KJWA 2F00A 4ZVVA 3H1BA 1Y3AA 3R6WA 1QE0A 1L4EA 4GMFA 1YRWA 4A82A 4DIUA 1B8OA 2CXTA 2P75A 3HXPA 1Z45A 1KH2A 1XL0A 3IEKA 3KOYA 2DKFA 1N2EA 2EZ9A 1JSZA 4CTOA 3A1UA 4J0IA 4OHVA 4EO4A 1U2DA 3LBHA 3R9IA 4CQJA 3ZZTA 1I2MA 5EOVA 3QENA 2JFYA 4G36A 4HLCA 1NJGA 1LF0A 2VUSA 3T52A 4WN9B 1ZOOA 2ZSDA 3AEKA 5ECDA 2VHTA 3QY9A 3HJCA 1WUIS 3OKPA 2HK9A 4ZREA 2JHGA 1NNUA 2UZ0A 1KAOA 2BFEB 2F3RA 2YV1A 2KS6A 2QRKA 3BSWA 3KEFA 2Q9AA 3T4PA 2G5PA 3B5JA 4K86A 2Z30A 2NXEA 1QVZA 5EJ6A 5ABPA 1XMSA 2ILVA 2ZIXB 4DM4A 5CLFA 1OI7A 1G7TA 3AONB 3IGFA 4JBNA 2MINB 3FFXA 4PVCA 1JFTA 3DDNA 3I5MA 3Q98A 1UPTA 1F2TA 1SKBA 3HJTA 2XNJA 3LGAA 4JWTA 4IM7A 2IDKA 4LVUA 3WWPA 5JMWA 1VBFA 1NSFA 2QTBA 3LK6A 3RSHA 4LZOA 3SZ3A 3TQRA 3VYVA 1SU6A 4FMDF 3WDSA 1WAMA 4YJHA 4PF1A 3UMVA 5JJ5A 3MLBA 2HPAA 4RIEA 2I29A 1YKGA 2FZGA 3ZLJA 2BUBA 2LR0A 4DJFC 4UTNA 1XTQA 2JASA 2KSQA 3D02A 1VOTA 1LV7A 3VVLA 1AGXA 3R7NA 2PE5A 2F1JA 1N33B 3A1WA 3HC7A 5LD2C 1Y7HA 4G01B 2A92A 2H1WA 3DOJA 3H4VA 3AETB 3HA7A 2PKRA 4M9XA 3EUEA 4L4XA 4LJYA 2WV7A 3QKSA 3SLGA 2X0DA 1J7JA 3H4IA 4NBNA 3LC0A 1XQ6A 1KRHA 1MOPA 1T5OA 2PT7A 2ZAGA 3V32A 4O2AA 4RA9A 1QZTA 2M6SA 3FDIA 3Q8WA 4EH1A 3HKBA 4KQCA 1FYVA 2QRUA 1S2DA 3HEMA 3JD2A 4O4HF 4YC7A 2J5BA 2I6GA 1NXWA 5D3QA 4C7XA 3DV9A 3I2IA 3MJCA 3TRKA 4AECA 3FBTA 4K7JA 3NNNA 1M8PA 1GGNA 4GI2A 1QCCA 3PXGA 3V1LA 3K8OE 5C34B 1C0LA 2Y1FA 1U8FO 2WZBA 1ESMA 3NANA 1GU7A 4JA2A 4RU1A 4RDXA 2ZUCA 3U1BA 1KI6A 3TK1A 5KSZA 4TZTA 2IK8A 1FTYA 3DDWA 2VKQA 4X60A 4D81A 4LAFA 1JR2A 2OXIA 3MMXA 3ACBA 4IXNA 3TLXA 3TXAA 1NP3A 4CT4B 2WM8A 5K03A 4HQFA 4RTSA 3WLAA 4Z2YA 4ZVQA 1BHJA 3QTTA 4LF9B 4ZI2A 1MGOA 4JLOA 4LBVA 1JNXX 3OQIB 3NHWA 4BNYA 2XGGA 1ZWLA 4XFDA 4RETA 2ZUBA 3ZE1B 2Z4TA 3UGJA 4FBLA 3ROMA 2XSZD 5AVWA 4H7IA 4FGWA 2DPGA 1IIRA 3IMCA 1IEXA 4G1BA 5T64A 4M6WB 4XOIA 2RKBA 5IM4A 1YU6A 1KE2A 2YRFA 4DGQA 4UTPA 4LF5B 3MWJA 3NJ8A 3DTNA 2XMDA 5CFPA 4JC4A 4O3FA 5H3HA 2BZ1A 3MRTA 5F4BA 1LJLA 2RGCA 3IQHX 2RG1A 4O59O 2W98A 3I6ZA 4CM6A 5KMGB 3B51X 4REOA 4N18A 3F4KA 1U9CA 4OJKA 3NORA 3IVGA 4BNLA 3RNLA 4L5JA 3AMVA 3RUAA 2C88A 2WYIA 1TGYA 2J31A 2VQ6A 1Z33A 4B81A