2N46A

Ec-nmr structure of human h-rast35s mutant protein determined by combining evolutionary couplings (ec) and sparse nmr data
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 51
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2n46A00
1II8B 4IDHA 2CL6X 4NCIA 4LK2A 3WP1B 2VSFA 4LYJA 1IXSB 2A78A 5AR1A 4A6PA 5IRCD 2R44A 1X8JA 3L43A 4Q1DA 3PFIA 5KPDA 3CONA 2JLXA 2J7KA 3LW7A 2PZGA 4LPKA 2O8CB 4UXJA 5AJZA 1J99A 3QEJA 4NYIR 3I72A 4Q19A 1U0LA 3MFYA 3AF2A 4IXNA 3ICEA 2TMKA 3OEED 2ZRBA 1XBTA 1TL7C 2V7QD 1CU1A 3S1AA 4R2HA 4CEHA 4OQMA 1GUAA 1X6VA 4ZCIA 4LV5B 1E9SA 3DHWC 2OAQ1 1XWIA 3IDQA 1UKYA 4XWOA 1BH2A 5E3HA 4Q4AB 2IS4A 3MJRA 1G17A 1HQYE 1IN8A 4JLAA 4M22A 3QG1A 4XTCS 2IYVA 1QHNA 1NKSA 2AKYA 2NOAA 3T15A 2WOOA 4WIAA 5CB6A 2FG5A 3LNCA 1XD2B 3WBJA 1E98A 3QPUA 1YR9A 2CVFA 2OBMA 1ZW6A 1XPOA 1RRGA 2ZQ5A 2G1KA 2YJTD 1G16A 3FFAA 4HDQB 2JLSA 3FHTA 1X1SA 2YWEA 3K0SA 4Q4JA 5LBIA 2J7PD 2W00A 3BD9A 1UEJA 1EG7A 3VFDA 4G1UC 1OH6A 4CDGA 2C03A 2ZI6A 2P3SA 2ZPTX 4EPYA 1FP6A 2Q9CA 3AF4A 3OEHA 1ZM7A 2KI5A 3KFXA 3PUVA 2AFHE 3GP8A 3R9XA 2WBLC 4Q4AA 1COWD 4UNRA 4PC3A 1CLUA 1NF3A 4CW7A 4YMTA 3VX4A 3I5YA 1D2MA 5CDFA 1ZIOA 2HF9A 2P0EA 1OSNA 2FZLA 3QOFA 1XZQA 4POAA 1QHIA 1XX6A 1XFAA 5JHGB 2PJRA 3CLVA 2QGZA 2NQ2C 3TAHA 1K8RA 2ZUDA 1JXOA 1TAGA 1WXQA 2YOHA 3NEJA 3AQ4A 1OJLA 1TX4B 3PEUA 4QXAA 4DDTA 2HF8A 2VBCA 1LV7A 2WJJA 3MJHA 4DSOA 2JLZA 1XJ0A 2BCJQ 4TYWA 3VHXA 2AR7A 3UMSA 5AK0A 4PO8A 4KO8A 4EKDA 1KDOA 3C15C 3FE2A 3IPYA 3OF5A 3Q5EA 2JJ1A 3A4MA 1UBEA 1QVAA 1QHXA 4XVRA 3WNBA 4LHVA 1NSTA 4IEEA 3O8BA 2V8OA 4XD7A 4AY2A 1IN6A 4HAWA 2F55A 3QIAA 4IKEA 1IXZA 1GNPA 4W7SA 1GKIA 2ZJ2A 4X8HA 2QGNA 5EE3A 4XVUA 2FX3A 3HYRA 4ESVA 1LFDB 3DL0A 1CKEA 5TVKA 1YR7A 2GK7A 3EIHA 3FKSD 3ZVLA 3EARA 3C5CA 1CJTC 5ELXA 3ND8A 4NYIQ 3QEOA 2CEAA 1IN5A 3RS3A 1H8HD 5LD2C 2IX3A 4MGZR 4TLDA 2HUPA 2NO9A 3NWJA 1SXJB 2JIZD 3DOFA 4P0TA 721PA 4HAUA 1F6BA 5SZHB 5A0FA 2PX3A 1XXHE 1W49A 3MWJA 3PXGA 1SGWA 1NBME 2V4ZA 2QT1A 4R2IA 2BM1A 1XU4A 3FKQA 1SHKA 2WWFA 3ONWA 1MKYA 3ZH9B 1TMKA 4KVAA 5FBRB 1KI1A 5GJVC 3R8FA 5LDDC 5LPNA 1KI4A 2XTMA 1XB2A 2LKDA 2R6GA 4MYHA 3IPXA 3MWLA 2ZXUA 4Q00A 1N2CE 4XSGA 1XJQA 4FMBB 1L8QA 3KJIA 5J47A 2ECKA 1FUKA 3CO5A 3LY5A 2QL6A 3SHFA 1NKTA 2CK3A 1M6NA 4EJSA 3V9PA 5F9HA 1I4DD 3MD0A 4Y0AA 3P26A 4HB3A 4US1R 1Z63A 3BGWA 1Z0AA 1G6OA 2JAQA 3G82C 4OJQA 3FTQA 3W5IA 3GLFB 4Q1AA 4B2LA 1EX6A 2HJGA 1GZSA 3GFTA 2QAGB 4GNKA 4HB2A 3SYLA 1U8AA 3IBGA 3EXAA 4YC7A 5DYIA 4QKQA 3BJIC 1E0JA 1AKEA 2Z0MA 1DE0A 4AYXA 1VYVA 3GJ3A 3PUWA 1G7CA 3GLGA 1HQCA 3SHWA 3HPQA 5GVSA 1YR8A 2B6HA 2BVNA 4DSTA 4Q4HB 1VCNA 1VHTA 5L3QB 5JHHB 3IHWA 3C4JA 1T3SA 1II0A 4B3BA 1LNZA 1TU4A 3O8DA 1GM5A 4LZZA 2X77A 3K0FB 4E07A 3HPRA 3NC0C 3VTKA 4FW9A 4DLWA 3UATA 1KJZA 2MMGA 1GWNA 1OFIA 1YZLA 3M4YA 1KTVA 1U0JA 4RZ2A 3A6PC 4HUQB 2YWHA 4PHFA 3QVVA 1KMHA 3GLFA 3D7MA 3OEHD 3SJBA 1E0AA 2OLJA 3RS4A 3QJYA 2XXAA 3LRPA 2FSIA 1EESA 3THYB 3QNUA 4JBXA 4UQOA 2QM8A 3B13B 3W8NA 3CF0A 2JJ8A 3CNOA 1WA5A 2DR3A 2IYLD 3B8HA 1KIMA 3TH5A 1ZM2A 5L3QA 1Z06A 2QEQA 1P2UA 2PLRA 1W4CA 2OXCA 2WOJA 3FGNA 2ZYUX 2O5VA 1KSJA 4YXWD 1GTVA 2C8VA 3K0FA 4M2LA 1EFRD 4JBWA 2W2XA 3P4XA 5AJWA 1CR1A 3Q7PA 3GEHA 3JZMA 5FOWA 1Q20A 1II9A 2EWVA 2YVUA 3OHMA 5KNBA 4Q01A 3M0EA 3BE4A 5B58C 2ZIAA 4FMCF 4HUQA 2NPFA 1EWRA 4PFSA 1E2FA 1KI6B 2QRNA 4LJAA 2JJ1D 4NDZA 3WYAA 4DVGA 2XAUA 5IK2A 1EFCA 4M53A 4IVRA 1WB9A 1DAMA 4PHTA 4M1MA 5JMTA 2BMFA 2C2HA 4WBSA 1T5LA 4LHYA 3QENA 3AVTA 4P4UA 2AD5A 1KI3A 1A2BA 3CWZA 4MYUA 3HU1A 2FGKA 1F2TB 5CLLA 5DHFA 1QG2A 2WWYA 5EXTA 1NMXA 3CWQA 3T1QA 1J90A 2OE2A 3BORA 3SE0A 3L0SA 1HE1C 3L8ZA 5DI3A 5EP3A 4NTZA 4AD8A 2P65A 4HLCA 4YMUA 3TQFA 5JSZA 1HT2E 3WMEA 2W0SA 3OIYA 2A9KA 2QNRA 2PL3A 2DFLA 5DISB 3REFA 3B7GA 1NVVR 2ATXA 2VO1A 5EUQB 3ZYCA 2WSMA 1VCOA 4ERNA 3U7EB 3ECCA 4G5SA 4DT1B 3QF7A 1KI8A 1KI6A 3BK7A 3HP1A 2JASA 3QXCA 4OHZA 4C0QC 4BZXA 5KU1A 3DPUA 2QENA 1NVUQ 4LBZA 3VNVA 4MRVA 3GMTA 4A0FA 2G6BA 3E70C 1ZNZA 1T5IA 5JS8A 1F2TA 1KJWA 3ZVMA 2KWIA 2NO6A 1M7BA 3SOPA 3I5XA 4BFWA 5BN3A 5KSPA 1XMVA 5E7IA 2IWHA 2CK3D 3GLIB 3MAAC 2IW3A 3PUZA 2RAPA 4YMVA 4B3FX 3U6BA 4AKGA 5KUTA 5KOYA 1TQ4A 4LX0A 3TAUA 1RRCA 3U61B 1CF4A 1SXJD 2RB4A 2ZR0A 1M8PA 3MWYW 4O0MA 1AM4D 5CYPA 5FI1B 5EE1A 4Q7JB 4ZV4A 2C5LA 1NY5A 4LJ4A 4YQFA 5KSOA 3B60A 1KYIA 2Z43A 1JQLB 3SU8A 1ZM4A 3A58B 1JBKA 4QBHA 1S96A 3AP2A 2YKGA 1DOAA 4G3XA 3FHCB 4RD2A 1FQJA 2ODEA 3MUFA 1I2MA 3FHOA 4DDVA 4QM7A 4EJSC 1U94A 2IF2A 5CLQA 2O0KA 1E79A 2CCGA 2OFXA 3AUXA 6Q21A 1OXTA 1G5TA 2PH1A 2GXQA 2ZROA 1ZVQA 4R7ZA 1DARA 2VP6A 3ETLA 2ZSEA 5CJPA 3UG7A 1E3MA 4LYAA 3TUZC 3CPHA 3I8SA 2DWQA 2JJ2D 4LOAA 3B2EA 4JBYA 4MA4A 4RD6A 4DEXA 2GCOB 4A0HA 5G3ZA 3E1SA 3SBDA 3VMFA 3QKRB 3ADKA 4R71A 3TR5A 4RKEA 1S2MA 1OT3A 1P73A 2FSFA 3TVDA 2KJQA 4BPBA 2W83A 1GSIA 3CRW1 2ZANA 1R7RA 5KSYA 3TSOA 3RNLA 4BLRA 1E1QA 2QE7D 1L7VC 4Y0VA 2XNSA 2WJVA 5FPKA 3KB1A 2GCPA 1NLFA 2ZRMA 8OHMA 2IXGA 2CE2X 3K9NA 3RS0A 3SDZA 2ZI3A 2IA5A 4RFSB 2EFHB 4F4IA 3QI2A 2HLDA 4TTQA 4LJ7A 2Z5FA 1HE8B 4QHTA 4V02A 1ODFA 5EE9A 3WHLA 4JT2A 4R9UC 2VF8A 1W36B 3RSLA 4O2RA 4NCHA 3CH5A 4BFUA 1XCGB 2QORA 4IVQA 4F92B 2DPXA 4OI1A 3RWMB 4JT4A 2MSCB 1WRBA 4DRZA 1Z6YA 4IOMA 1GDDA 4FMDF 1S9DA 2C9CA 4PPNA 1ESMA 4CF7A 4D4KA 3LVQE 1GP2A 3ND9A 1MO6A 2IHBA 3THWA 1DAKA 5HPYB 4W5JA 3AP3A 5FTNA 1I4LD 2CJWA 4ZCLA 2IS1A 4DIDA 1TPZA 2C77A 2C98A 4QBGB 4B76A 1NVVQ 3GEEA 5FR2A 1T8UA 1FTSA 2F7SA 2REBA 5B30A 1OKKD 2R9VA 2QP9X 4AIIA 2D7DA 1G8GA 1W0KD 4MUAA 4RFSA 2G1JA 2NO1A 1UJ2A 1A1VA 2F9MA 2EFCB 4URZR 5HE8A 3R9WA 2BIFA 3Q3JB 4B44A 1W5TA 3AGPA 5C4MA 1G5RA 4FN5A 3U3OA 3F8TA 3A37A 3A1VA 3I73A 5FUVA 1A4RA 1JB1A 1R5BA 5DE3A 2AK2A 1E32A 2F43A 1Z08A 4QJ3A 2JLUA 3QSYA 1PLJA 1JPJA 1CEEA 1ZU5A 1RPZA 3PUYA 4DEYA 3SNHA 4JVLA 2PCJA 1KO4A 4BWYA 1SVLA 3WBKA 4PX9A 4HB4A 1Q0UA 3U44B 1Z6TA 2BDTA 3LBHA 2ATVA 4Q7KA 3RHFA 2GJSA 2ZSDA 4D80A 2Q9AA 4E5UA 2HCBA 2YC4C 4B32A 2ZU6A 4TZ0A 5JCZA 4OKSA 4JSTA 2BBWA 1ZD1A 1N5KA 1E2JA 1ZMXA 2PT5A 2QT0A 5FL7D 4JKYA 4AG6A 3JVUA 4Q1BA 1HURA 5EXSA 3GEIA 3P32A 5FH9A 4M9ZA 2GEDA 3HWSA 4OI0A 1ANKA 2J0UB 3J81k 2NZJA 1KK2A 1RYHA 2ANCA 3DO6A 4DCNA 3LLMA 1F60A 2I3BA 3HR7A 4V03A 4CGZA 3U4QB 4K8OA 3WYFA 4MRNA 4JLPA 1H8EA 1MT0A 1TQ2A 1ZRHA 4N0EA 4LHWA 2WWXA 2ZVPX 3QPWA 4IJMA 2ZJ8A 2QMUA 4X8MA 2H92A 1U8YA 1GFIA 1RRPA 3Q85A 3U44A 2JCSA 3BFVA 4MRRA 1E79D 1DAIA 4L5BA 2ZRDA 3REGA 1AK2A 1S4QA 1FOEB 4GL2A 1SVSA 1P72A 4TLBA 1G4UR 2YHSA 5AJVB 2F3TA 1T8TA 2W2VA 4CEJB 5BXQC 3ADCA 4WVFA 4NPHA 1Q1BA 3UWKA 4MRSA 3ZQ6A 4XJXA 1C9KA 3RANA 3HR8A 2X19A 5HTKA 1OPXA 2ZE8A 4MYTA 1KKLA 3GFOA 4IVPA 2EWWA 2QMEA 2A5GA 4U5XA 5FBQB 2N1BA 3MLEA 3SQXA 2D2FA 3U4QA 2FMXA 4KFTA 2PT7A 4ASUA 4D4MA 2JLQA 4N0DA 1XEXB 2WKPA 1E6CA 1MH1A 3B1XA 4P32A 4ZO4A 2WKRA 2BMDA 2QPTA 5TXGA 4A9AA 3BBPA 4GMXA 4CVNA 3GQBA 1F5NA 2HLDD 2BKUA 1YZQA 3R8CA 3AVPA 2R6CA 4TMTA 4MDFA 2WMOB 4AK9A 3GLIE 4OK5A 2W6ID 2IWRA 4CEJA 1EFHA 1WCV1 1E9FA 4U7DA 1ZC4A 2D4HA 5FPSA 2QP4A 4Q21A 2WHXA 5G41A 2D62A 5FOTA 1NN5A 1UADA 4JIMA 2ZR9A 3A1WA 5IDVA 4ACAA 4ZI3A 2GK6A 3VAAA 1KY2A 4DDUA 2GILA 1FNMA 4UXIA 1N6LA 3C5HA 2XOKA 3L0IB 3JVVA 4Z8YA 2P5SA 4TQUS 5TV2A 1OE0A 1K5GA 3KJHA 5CM8B 1LS1A 1JECA 1OIVA 4PPGA 5EJEA 1CIPA 1KK1A 1YU9A 2AKAB 1OYWA 1UF9A 5BN5A 2GF0A 1W36D 3I3SR 1KSGA 4R98A 821PA 1Z0DA 3Q72A 2ZRKA 5FTKA 2P5TB 3NG1A 1XPRA 4F91B 3BH6A 1B0UA 1KSHA 1R4AA 2VHCA 5SZIA 2W58A 4NH0A 1HT1E 4V0NA 5EZ5A 4NHOA 4BASA 4NYMR 3S1AB 4TTPA 3EIQA 4UNQA 3MMPA 1IQPA 4CEHB 1E1RD 4TTRA 1CP2A 3BAFA 3EA5A 2IXEA 1E69A 3I62A 1XTJA 2VP2A 3WRXC 3CIOA 4A92A 5K8UA 2D2EA 3P4YA 5CIQA 3U3JA 1W36C 4D82A 2NO0A 3PEWA 5E4FA 1JEDA 1P62B 521PA 4DIEA 3VKGA 1D2EA 2OCAA 4NKRA 2JATA 2ZREA 3AEZA 3RWOA 4NZYA 4UXHA 3ZVNA 2CNWA 1P6XA 2CHGA 2VHQA 3GLHE 3K9HA 4FCWA 2R8RA 2J41A 1W44A 2QQ0A 1NL3A 2FEOA 5FUWA 5JWRA 2XZOA 1QZXA 3LA6A 1FP7A 4JLDA 4PSAA 3AB3A 1KOFA 2R65A 3D8BA 1G18A 3C16C 4HI0E 4C0SA 4V0MA 1VYTA 3N70A 5H8WA 5HZHA 2H7VA 5CJ2A 2YZ2A 1YKSA 2C9OA 3H2YA 3IBYA 4GPTA 1ZJ6A 1LF5A 4JJZA 4Q4JB 1Z8FA 2GJKA 4GMDA 1LS6A 2F1HA 3BB1A 3RS7A 3Q8XB 4OQLA 2ZJAA 3U3RA 5UKDA 1Z6XA 2JLRA 5EP2A 421PA 5J4YA 2WVJA 4TMWA 1AGRA 1ESNA 2PMDA 2YWGA 4HDOB 1D5CA 3E2IA 4TLAA 3CBQA 4QBIA 3DM9B 1XMIA 1Q44A 1KZGB 4OJKA 4PQRA 3T1OA 2ZYTX 3LAWA 4U00A 2IS6A 3BXZA 4M21A 2GHIA 5JJIA 4LV8B 4B6EA 4F93B 4IDPA 1KZ7B 2F6RA 5KDDA 4GP6A 2XSZA 1DAGA 3DDCA 3LLUA 5KTYA 4L8GA 2IXFA 2QSYA 3IGFA 4RCZA 1CJKC 3D6TB 1XTSA 1OIXA 4HEJA 3O8CA 4BFSA 1CJVC 3PR1A 4JYCA 1JR3A 3P20A 5DI9A 3PJRA 1QDEA 3PV0A 2CXXA 5DH9A 1TNDA 4AKHA 4MYCA 3M6AA 3VU9A 1ZU4A 4LJ6A 3AKYA 1U99A 4ASUD 1NMYA 3QBVA 4ZKEA 1W0JA 1YVDA 1OXSC 3EZ9A 3BOSA 3CW2A 3T5GA 3EA0A 2VP5A 1KNXA 2RMKA 1GRNA 3EASA 5DN6D 2AWOA 4BLPA 2ODBA 2ZRAA 5GJCA 3A1TA 3IO3A 4L9SA 3L8YA 2IYRA 1VPLA 2AWNA 3SFVA 1W48A 5CIWA 2YNMA 4DHEA 2DYKA 1G3MA 4XIGS 1RIFA 3RAPR 3ZZTA 2JLVA 2FV8A 3WMFA 2ZJZA 3UMFA 2V54A 1QHHB 1GVNB 1QG4A 4QL3A 4EFNA 1VIAA 1TUIA 1E9BA 3QPVA 3W6OA 4MKIA 4A2PA 5L8VA 5TMPA 3ADDA 1N3BA 3A1SA 1ZUNB 3WY9A 121PA 2G88A 2J46A 3LBNA 3DZDA 4URVR 2A30A 1XMJA 4Q47A 1X1RA 1Z0FA 5F9FA 3RSOA 4WXRA 2IYQA 5BYKA 2DCUA 1YRAA 3NH6A 4HB0A 1E0SA 1US8A 4NYMQ 4IXMA 5KPJA 1WP9A 2ZRPA 1VCIA 2UZ3A 5TARA 1W5SA 3IHLA 5AUPB 1YZKA 2ZS9A 1NIJA 4C2UA 4IEIA 1UPTA 2ZE5A 3GJXC 4FWTA 1CR4A 3SYNA 1G8YA 1EFUA 4US2R 2QM7A 1QHSA 4Q48A 1R5OA 5CB8A 2VSOA 3B82A 4RD1A 1OH5A 2ZRLA 2ZJOA 1G19A 3L0OA 1QHHA 4V0KA 1LTQA 1SVMA 2HV8A 3EX7C 2B7BA 1P7CA 1KSFX 4DDWA 3N2EA 1HUQA 1E2IA 1G21E 1E9CA 2CHVA 2EQBA 2B8WA 2FPKA 4LSGA 5G40A 1ZCAA 4EJSB 5AJXA 1KI7A 4KSBA 3TIFA 4TT3A 3VR6A 5FBLB 5HKKA 4KYUA 2G77B 1Q21A 3VR3A 3A4LA 5M04A 3I8XA 1F2UB 2OCYC 5BW8A 1U8ZA 4FD2A 5JECA 2CNWD 4GDFA 4ABYA 2OZEA 1SVOA 2RGAA 2I4IA 4K46A 4ZCMA 4UNSA 2WIBA 2DWPA 2WV9A 3GLGB 4Q7LA 3GJ7A 1PUIA 2BV3A 3AUYA 3AVWA 1NY6A 2B21A 1XTQA 1M34E 5KNCA 1ZNWA 2QRZA 3BWDD 3UANA 2O8DA 3PCRB 4HAVA 2O0HA 3QXSA 4C0AC 1W4BA 2JLWA 2WZQA 2IL1A 3ICQB 4HUTA 2P67A 4PC2A 3PUXA 4FMCB 4TWZA 4NE2A 2OBLA 4LY6A 1KMHB 3CR8A 4TL7A 1BKDR 1FX0B 5C4GB 4NU0A 5GJBA 3PEYA 3X1XA 4ZI2A 2XXAB 1NIPA 1SKYB 2ZSAA 2ZI5A 3FVQA 1T91A 1F2UA 2DY1A 4FI3C 3VKWA 5JI3E 3F3YA 3LD9A 1BYUA 4DKXA 4OHWA 4M1KA 2FH5B 1SULA 2GAAA 1BYIA 1UM8A 2GZHA 2VHUA 4U02A 5H70A 3KQNA 1UBFA 1JJVA 1G41A 1UDXA 4NONA 4HZUA 2ZUBA 1NVXQ 4ESHA 1M7GA 4DLZA 1SVKA 1Q3HA 2ZAMA 4P4SA 5J5CA 2PZFA 3PEVA 3KX2A 3RRYA 1JR3D 3QKSA 1E2PA 1Y63A 4QOSA 1J8MF 2OAP1 4HAXA 1SQ5A 2ODNA 2NO7A 1CTQA 1NN3A 1ZAKA 2LWIA 3EZ2A 4ITRC 1MABB 4LJ9A 4S35A 4L9WA 1Q57A 2QU8A 5FUYA 3OIUA 4HYYA 2O8BA 3B9QA 2LKCA 1ONBA 1MR3F 4KLNA 3W6PA 4QNMA 1UEIA 2X2FA 1FX0A 1TQ6A 1E9AA 4LYFA 5CITA 2J87A 3CNNA 4YONB 2B7CA 3FOZA 2GDJA 1YQTA 3W9YA 4ARZA 2PMKA 1OW3B 1BOFA 1RVDA 2GXSA 2H57A 3FMPB 3FWYA 1V5WA 4KFRA 2X1VA 3DOEA 4QRHA 4C7OA 2PJZA 3ZLJA 4G5GA 1KO7A 1N5JA 2ERYA 4IOKA 2VRWA 5DI3B 2RGBA 4RD4A 1N5LA 3IIMA 3AP1A 1IXRC 1ZINA 1ZUHA 5JLJA 2R6DA 3P1JA 4BEJA 5JSZB 5HE9A 2ZRGA 1FMJA 1VIYA 1MABA 5J4LA 3F0TA 3PG5A 2ZAOA 3KZ1E 2KBEA 2C78A 4JL5A 2R6AA 4UNPA 1R6BX 4DWJA 2GEUA 2AXPA 3NXSA 5FOUA 4W9MC 1FNNA 1NN0A 2NGRA 2K5UA 1IHUA 2FA9A 5FPHA 2XEXA 3RABA 4L16A 4XD7D 1E2HA 3TQCA 2O0JA 1D9ZA 4X8LA 4BEBA 1KJYA 3OFNA 3NC1C 1ZBDA 2PBRA 4PZLA 3QE0A 4XSHA 4TMKA 2E1RA 4C9BA 3ZDQA 1JAIA 1Q3TA 3WNCA 3BH7A 3K70B 4NCNA 2DB3A 1NLYA 2H1LA 1U90A 1UKVY 1K6MA 2WJGA 1J70A 1IM2A 3L0PA 3IUYA 4I1SA 4V0OA 4D81A 1ZP6A 2ORWA 5ANRB 1C1YA 3TGPA 4GOKA 4C30A 2VYFA 4DLXA 3T1TA 2VEDA 5J4KA 1N6KA 2DFTA 3W3ZB 2MSEB 1E9EA 2BM0A 1KMQA 4UNNA 4TN1A 1AQUA 1KDPA 1UKZA 3KTAA 4DUGA 5P21A 4Q9LA 1X8KA 4TSFA 1G7SA 1Z2AA 3KXLA 1XPUA 2FOLA 2NG1A 1BS1A 1ZD9A 1ZCBA 2YWFA 2GBLA 4D2IA 1JPNA 2Z83A 3IEVA 1NLZA 4RFVA 3PENA 5IT5A 5LB2A 3UPUA 4OHXA 4TQAA 3VR2A 4BFZA 3QQ5A 1IBRA 4A1FA 4TMZA 1FMLA 4Q18A 3H4MA 4D0NA 4EIWA 2CCJA 2GXAA 3QXXA 4KXFB 4PPQA 1PZNA 2EU8A 4WW0A 3FB4A 3VNUA 4F4JA 4Q9JA 4IW3B 4FIDA 2YINC 2VA8A 4RY2A 5AJYA 1KDTA 1D2NA 4LI0A 1L4YA 2AHOA 3DEFA 1OHHA 5FBWB 2ONJA 2ZEJA 2N42A 1GKYA 1IN7A 2OESA 4LGMA 5DSZA 3CM0A 4Q4LA 2O8FB 3SN6A 3LWNA 3K0CA 3HJNA 3RYTC 3GJ4A 4NCKA 4B33A 1KGDA 1DADA 1Q1ZA 1AIPA 3SJZA 2J9RA 2C95A 2GJ8A 3T34A 1G9XA 4OBEA 2F1RA 4GBMA 2XB2A 3ASZA 3NDPA 4ILEA 1G8FA 2OFWA 1SXJE 1AZSC 1WE2A 2A7QA 3CH4B 1DO0A 4I4LA 4H1VA 3TJZA 4DSUA 5L3VA 1T0JB 3UK6A 3THWB 3A4NA 4HLDA 2CJWB 4BLOA 1IY2A 1R2QA 3KL4A 1Z6GA 3DVLA 3ZD7A 4M1WA 3SYKA 4OK3A 3KKPA 2N46A 2EVWX 2KB0A 4LRWA 2QUZA 4TQ9A 4ZPXA 2FE4A 1TF5A 5BWMA 1IONA 3KKQA 1L4UA 2IUUA 2O8FA 2REXB 2REOA 3F5FA 2JGNA 4G01B 4YDSA 2WJHA 5FTJA 3W6NA 2DWOA 2A5DA 3K0EA 4PC1A 1J8YF 4PSKA 1ZUIA 3TKLA 3U6KA 2G0NA 1R0WA 3ASYA 1ZNXA 3TE6A 4DCSA 1XNJA 3L82B 2OCPA 3RLFA 2Z4RA 5F98A 3LO5A 4D0LB 5KDOA 4PO1A 1DS6A 4ZDJA 3GLFE 3AGQA 4GRAA 2WAYA 2BMJA 2F43B 1DTSA 2HEIA 3CR7A 1SKYE 2QTHA 3BC1A 5IK2D 2XZPA 3QUSA 4BECA 1CS4C 2GNOA 4OHVA 5AWFC 2ZI4A 4BE7B 2X8AA 2CBZA 1HEIA 4JMPA 4H1UA 3ZGXA 2WTUA 4M1OA 2J3EA 2RHDA 1VCMA 1P61B 1QBKC 1E2MA 1XTRA 3KUCA 4K81B 3UG6A 1XCMA 2FSGA 5AUQA 1KY3A 2H5EA 2O52A 4D6PA 4BZPA 3PIRA 4P31A 4C0KA 1AS0A 4MUBA 5FL3A 1FL9A 4URYR 4OK6A 4N1AA 3TNFA 2V1XA 4NL4H 1TEXA 2UVQA 4HATA 4DCUA 3AVOA 4DLUA 4AKEA 1KK3A 3K8YA 4PR0A 4UJ3A 4II7A 3CX6A 1RC8A 3KJGA 4MKHA 1CRPA 2QQEA 1SZPA 3EPKA 1CJUC 2GESA 4EUNA 1BMFA 2J1LA 3I32A 1N25A 4MDEA 4JLOA 4F38A 4C0JA 3AVUA 2P6RA 2F1IA 1FTNA 4FINA 4Z54A 4TSFD 1N6PA 1EX7A 2J0SA 3K9GA 3AVXA 1K5DA 3EC1A 1NVWQ 4EFMA 5FTLA 1QF9A 3I92A 3NIBA 4YMSA 2ZU0C 3LBIA 5KHOC 1PJRA 4A8JB 4DLSA 1AS2A 2KE5A 3K70D 1S1MA 1NI3A 1C4OA 5FOXA 3O8RA 1DO2A 3RVBA 4TYYA 3KQUA 4KBFA 1KO8A 4URXR 4GFDA 1AN0A 1LW7A 4OQFA 4PAMA 3T06B 1NG9A 5JI2E 4MITA 1DG3A 1N0UA 4Q1EA 2ODWA 4A4DA 1YE8A 2B8TA 4B34A 4DB2A 1U9IA 4EDHA 1XCPA 3U7HB 1KDRA 5H1YA 2A5JA 3LV8A 3G0HA 1KI2A 2GBLC 1W46A 3CF6R 2FPLA 3KDSE 4EQ6A 1G20E 4JSYA 2NMVA 1G3UA 1NP6A 2WAXA 3K70C 1W2HA 2WJIA 2ZS7A 1VG8A 4MKGA 1W47A 4QFMA 3BERA 1YJ5A 2EFGA 3PITA 3Q5DA 2IC5A 5K8TA 1VG1A 3LDAA 4PSVA 3CX7A 4OQXA 2XTZA 2GTPA 2CL7X 4Q7MB 4EPWA 1JEEA 3EG5A 3TRFA 5E7MA 4A8JA 1Q1EA 4LBWA 3NEYA 3QKTA 1UKEA 4QHSA 4ZDIA 2XB4A 1FZQA 2R6FA 5SZKB 3Q7QA 2FGJA 5JCPA 1E2NA 2EFEB 3H1TA 2G3YA 2QBYB 1P2VA 1UBCA 3B1ZA 3X1WA 2WMNB 5KNDA 2BMEA 1AQYA 2O8EA 1XMSA 3K0CC 1S3GA 3HU2A 3WXMA 2HYDA 1QHYA 2LCFA 1N6NA 1JALA 4A6XA 2V1UA 1E1QD 1Z6AA 4B71A 4NBSA 1YR6A 2PEYA 3CRQA 1N0VC 1R5NA 2A3RA 2ORIA 3N2IA 1GOTA 1E2GA 2QPOA 3SZRA 4EAQA 2OUKA 4GZMA 1GNRA 3SC3A 1QVRA 4URUR 3EPJA 2ZJ5A 3U7GA 3L2OB 4Z8XA 2IYWA 4HAYA 1EGAA 1R0ZA 1IY0A 3G5UA 3BB3A 1A7JA 3PVSA 1M1YE 5GJWC 4B43A 2V9PA 5FOSA 5JBQA 2J7PA 1J7KA 1G3QA 2NPIA 4IHQA 4RVCA 2WWGA 3NBXX 3OAAA 2A5FA 3NKVA 4ON9A 1WQ1R 3GJ0A 4MGYR 4JS0A 2VLIA 3VR1A 2QBYA 1P60A 3QY0A 4HSEA 4E03A 1FW6A 4JLNA 2RCNA 4QJ4A 4TYQA 4ZIRB 4A82A 1W2GA 2VP9A 1PVOA 3NH9A 3WMGA 2FZ4A 4P4TA 2AN9A 2H17A 4BFTA 2J0QA 4A2QA 1VG9B 2QSZA 2J0VA 1T3HA 2WJYA 1G291 3NTUA 1P75A 2CLCX 3BH0A 4DSNA 1E94E 4PQFA 1HY3A 3TK1A 1M74A 4KI0A 4US0R 4W5HA 2RH5A 2BBSA 3THXA 1H65A 3EIEA 3THOA 3T12A 2RGCA 4M9QA 1KNQA 3OE7A 4IOJA 1R10A 3A36A 4PO9A 1TEVA 1UFQA 1P9RA 2ZRFA 3T1VA 2YC2C 4ZDKA 2CLDX 3P27A 2VH5R 3CPEA 1U98A 4L4UA 1UAAA 4QJ5A 2RGNA 3CRRA 1RRFA 3KUDA 4V0LA 4BFXA 1BMFD 2VHTA 4PPFA 1P5ZB 2VPPA 2ZRNA 3D3QA 1XXHA 4ZIRA 2XTNA 3AV0B 4XWKA 1NBMA 2AX4A 3TR0A 3KJEA 4A2WA 5DNYB 2YOFA 4EPTA 2EW1A 3CPJB 2H8KA 1MO5A 4LCBA 4B3XA 1WDTA 4PTLA 1OLOA 5L3SA 4EPXA 1JQJC 5G3YA 4HAZA 3TSWA 3FKSA 1W4AA 3EAQA 4TYNA 4O2LA 5FR1A 3IKJA 2HYIC 2VQSA 1OFHA 5B64A 4IRUB 4Q9HA 4I99A 1AA9A 4QGFA 3C14C 4QBFA 2CE7A 2V55B 3TW8B 1FUUA 4KFSA 5D3QA 3AKEA 3NVAA 4LPSA 3AVVA 1I4TD 1DAFA 1AS3A 4LC1A 4MGKR 4GI7A 3VU9B 3B1YA 1OH7A 4IDQA 4JYBA 2AK3A 1CJMA 1IJFA 4QGHA 1H8ED 1LVGA 2GRJA 2OM2A 3EWAA 3R7WB 2OILA 3K0AA 5C1BA 3T5DA 4DLRA 1P2TA 4XH9B 2W0MA 4EPVA 1IOZA 1U0HC 4ZKDA 4CEIB 5SZJA 2F1JA 1ELOA 1ZIPA 4C2TA 1U9IC 4KFUA 1ZNYA 2IBMA 4PZZA 1JNYA 1TF7A 4M4SA 2GAOA 1OF1A 3FMOB 4I1UA 5CK5A 3AKDA 4TYPA 1TU3A 4Q5IA 3WRYC 2GKSA 3I61A 3VX3A 1Z0KA 1Z29A 1XD8A 2QA5A 4GOXA 4RJLA 1A2KC 2G0TA 5FPTA 3LX8A 4LWZA 3RS2A 1MO3A 3K09A 2OEPA 4PQYA 1E2LA 1II8A 1Z2CA 4BQSA 5KSZA 1US8B 4TMVA 1KK0A 2AFIE 4G5QA 4RZXA 4A8JC 3ZD6A 3AVQA 4GOJA 3H0KA 3TBKA 1OB2A 1JR6A 1XP8A 1KO5A 4XVQA 5E95A 3R7WA 5A4JA 3GJ8A 2BC9A 2XJ9A 5DYGA 4A0GA 4URWR 1CULC 2VP0A 2O8CA 4DB4A 4BLQA 4AWXA 2IYYA 1D6JA 2RHMA 4JJKA 1W7AA 5CK4A 4JLBA 4CEIA 2QN6A 2OG2A 1XEWY 4DLYA 4ZDWA 3NHAA 1XD9A 2QG6A 1YZUA 4M1SA 4D25A 2ZJBA 2FF7A 2PZEA 1Y3AA 3LFUA 3KQKA 1WBBA 4LV6A 3UKDA 5JS7A 1DBSA 1P3JA 5H68A 4CIDA 2JEOA 1ZM9A 4LBYA 1X8LA 3OAAD 3U3KA 2PX0A 1T0HB 3TW4A 2BBOA 5J40A 2FPMA 3IIJA 4WAUA 4RZUA 2Q3MA 2GVDC 2GZDA 2C96A 1MOZA 4F7WA 4JZKA 4KYIB 2ZSBA 2XOKD 4DJTA 1MRNA 2FJUA 2NIPA 2GCNA 4B75A 3CB4A 1XD2A 2Q3FA 1X86B 5CM9C 1AGPA 1MV5A 2ZM5A 1PLKA 1EK0A 2AXNA 2QZ4A 4RZ3A 4A15A 1Z07A 3ZZUA 2OT3B 5FFMA 1XTIA 4YXWA 2HXYA 2UZIR 4RSGA 1OXVA 1EFRA 1VTKA 4CT4B 1CXZA 3EZFA 1DAEA 3WYGA 3OE7D 1G8PA 2IHYA 4RD3A 2O8DB 3WNDA 3QG5A 1MRSA 2OHFA 3BFXA 3ZIAA 3GPLA 3RC8A 2IYXA 2QMOA 3KFVA 2BKEA 2GJ9A 3B1WA 4I1OA 1RW4A 2F9LA 3KQHA 1NBMD 2IF0A 4KSCA 3LXRA 3MRSA 3ADBA 4KLZA 2ZRCA 1GG2A 1AZTA 2ERXA 3IO5A 3W3AA 3BIFA 2XZLA 4AI6A 1UBGA 1SHZA 4RD0A 2OLKA 2RGNC 3B6EA 4BFYA 3A8TA 4HZUB 4WZAE 3OZXA 1FPMA 4YLGA 1TQDA 2KBFA 3A1UA 4DLTA 3LQRA 5C2JB 1N6HA 4P4SB 2WWWA 3LX5A 3UWOA 3AH8A 4TL9A 2IYZA 1XZPA 3QKSB 1SVIA 3V4FA 1RZ3A 1GKUB 2VTKA 1G7TA 1VG0B 1JXMA 2BOVA 4N3NA 5A5GA 1N0WA 1ZC3A 2QROA 3MWKA 1G8HA 4Q1FA 2ASEA 5KYKA 2QY9A 2WICA 2E9SA 4IDNA 4JL8A 1E0KA 1U2RA 2O8BB 1GIAA 1GL7A 1OV4A 4TMXA 1Z0IA 1R8SA 4C0LA 1VMAA 2BJVA 3T61A 1ZYUA 1R0YA 1YHNA 4ARZB 2ORVA 2XSZD 4PXAA 4ACBA 4BFVA 3LW8A 4WZ6A 4O3MA 1YZTA 3GD7A 2HT1A 4B3GA 4C7OB 4D4LA 3CX8A 5C46F 3Q9LA 3C8UA 2RGGA 5JEEA 1S3SA 1E2KA 2I1QA 4V0ME 3FMIA 3U3MA 5JFGA 3SJCA 4IFEA 3CKLA 1JAHA 5TDHA 1LY1A 2P2LA 3FPAA 1D9XA 1F48A 1SXJA 4DXAA 2HDNB 3HYTA 3TUJC 1GRRA 4B48A 2XX3A 1JI0A 5K8LA 2CL0X 2V6IA 3KKNA 4TLEA 3V4RA 4FWIB 3W5JA 4B2IA 1EWQA 4KU4A 1ETUA 3RRZA 2DFNA 4PC7A 1W0JD 2IYTA 3U60B 1KAOA 3CNLA 2D06A 4FCVA 4XOIA 1P4SA 2UKDA 3X1YA 5AUOB 1OB5A 1N6RA 3NBFA 3U2QA 4Q9IA 2VF7A 5J4HA 2ZJYA 4Q1CA 2P6UA 2W6JA 3V00A 1A82A 3NBZC 5FI0B 4TZ6A 4Q03A 2JJ2A 3K09C 2V3CC 3EWSA 5HCNA 1M2OB 1BIFA 1HA3A 1N5IA 3UIEA 4Q66C 4D0GA 1IN4A 1JR3E 4MKFA 1E9RA 1P2SA 2D3WA 3RS5A 1NSFA 1Q1QA 1CR0A 2BEKA 5B57C 1T9HA 4MGIR 4C0BA 2GXUA 2QAGA 5DLQC 4JLMA 1WMSA 4E09A 1BO6A 3AF1A 2RKOA 3U5ZB 2ZS8A 3RRMA 2QE7A 2X2EA 5TY0A 4JL6A 1B23P 3HDTA 1VDZA 3SJAA 1TADA 2ZVQX 2DHRA 2EFDB 2Q3HA 3KTAB 3QVUA 4Q4HA 4CRWB 2AL7A 2XNDA 3IILA 2OCBA 4LDJA 5DHAA 2D74A 2QI9C 5CDFE 2V6JA 3EPHA 4Z51A 1R0XA 4I81A 2OFOA 3T35A 1HTWA 1G5PA 4HDCA 4G5RA 5IF9A 2RGXA 3KXKA 1T6NA 2PEZA 2IS2A 3ZIAD 4B35A 4LYHA 1FQKA 5J4VA 1TF2A 1SVWA 3THYA 1FFHA 2BCGY 4TL8A 2ZSFA 4NYJR 4TT3D 3E5HA 1IY1A 5HKKD 3LQQA 4HZIA 1DVRA 5EE5B 1OKKA 1Z22A 5DGXA 3SI7A 2OO7A 1E2QA 3CRVA 1W0KA 2IT1A 2VSXA 4D4JA 3OIVA 221PA 1QHGA 3VR5A 3WHKA 3DKPA 4PAQA 4B6FA 2OXRA 2ONKA 4G0NA 1AKYA 3IQXA 5L3RA 2E87A 2GVZC 1Z3IX 2H18A 2GJAA 1Q22A 5EXPA 2R62A 3B9PA 1U81A 3W8RA 3EPLA 4FMDB 4NCJA 3NBYC 3SBEA 1E4YA 1VYUA 1VHLA 4LUCA 4O25A 1WF3A 4RCYA 3FYHA 4KAXA 4QNRA 5AUNB 4GSYA 5HR5A 3KQLA 3QXJA 1YRBA 3RRNA 3KXIA 4A0RA 1VECA 1Z0JA 4RKFA 2WPDA 1QRAA 5IHPA 4I1VA 1G7RA 3TMKA 4B73A 1E2DA 1XDBA 3LVRE 2FDCA 3QF4B 2ZUCA 5EQTA 5CYOA 5D3MB 1OXXK 2FU5C 4PHHA 4S2EA 4WA7A 5FL7A 4QHYA 1PV4A 3H84A 3VR4A 4LBVA 3AF3A 3IQWA 4B3CA 1G64A 3X2SA 4C4PA 1KI9A 2WWIA 3QBTA 5BYJA 3H86A 4KBGA 3TVTA 2ZRHA 2G9NA 3LH5A 4M9SA 1CR2A 1PUJA 4QC2A 1DAHA 4DT1A 1NN1A 4WZBE 4C3ZA 3BB4A 2ZITA 1XEWX 1GAJA 5HCIA 3AM1A 1V43A 2ZETA 1G6HA 1HH4A 3SR0A 5LB4A 4AKIA 4PC6A 4M1YA 4LJ5A 3TUIC 1EFTA 2IYSA 4MRPA 2FN4A 1L2TA 1E4VA 3KB2A 4J0QA 1S9HA 2QTFA 2W6JD 3ZS8A 3GLGE 4OI4A 1SXJC 1ZD8A 2C9YA 2IUTA 3MG9A 4GT1A 3QF4A 1W1WA 2J5XA 3ZVRA 5D3MA 1RKBA 4M9XA 4KCGA 2FFQA 4LHZA 2ZRIA 3TLXA 3OIWA 2IEZA 3GLIA 1TTTA 4LJYA 2F3RA 3NHBA 1G3RA 3B5JA 3U7FB 2FFAA 2J45A 4KVGA 1EXMA 2ZI9A 4PZYA 1OXUA 2QAJA 2WSSA 5EUMA 3K1JA 2XJ4A 1S8FA 3PQCA 2QP3A 5F2EA 2ZTSA 2RGEA 4HLUA 3LXXA 4E22A 2G83A 4IDOA 2IUSA 5JRZA 4D26A 2JDIA 3KKMA 4DZZA 2ZYWX 5GVRA 4XWAA 2CHQA 2EYUA 4QGGA 2XNDD 3HU3A 4NYJQ 1GL6A 1S1CA 2MMCA 2ANBA 2D7CA 2FSHA 3GLHB 1DEKA 4AC9A 4B2PA 1M7HA 2FNAA 5FBVB 1GILA 3OFND 4MH0R 2YOGA 3DKVA 2QAGC 2W6IA 3GFPA 1G1MA 1S0UA 4IOLA 1PLLA 2VP4A 4OI2A 2GCOA 4Q9KA 2CDNA 5BQ5A 2W2TA 3R20A 5JZVA 2YYZA 1XF9A 4W5WA 1P9WA 3QKRA 2IEYA 3O47A 2FFBA 4H9GA 5FTMA 5KDLA 2OBNA 2JA1A 2SHKA 4BLTA 2BEJA 3K53A 4KODA 3EZ7A 4JLKA 4BUJA 1CRQA 1O3YA 5G53C 3TSZA 3IEUA 3ZS9A 4P3YA 3I4LA 1VKJA 1Z5ZA 3I1FA 4NP6A 2FFHA 3EW9A 1HYQA 4M0LA 4DUGD 1GRQA 4EQ6B 4DLVA 3RDPA 5KO2A 1TUEA 3C41J 4A36A 1CBUA 1JJ7A 1Z28A 3B78A 2A5YB 3GLHA 4CYMA 1P9NA 3CZQA 3W34A 3CF2A 1RJ9B 4GZLA 2ZI7A 3DMNA 1Q12A 2BJWA 3X1ZA 5EZ6B 1LB1B 2CCKA 3CRMA 1E1RA 4B3DA 4EFLA 2P6NA 1OH8A 3SFZA 1RYFA 4DBLC 5JWOA 1AJEA 2XGJA 1OFTA 1RFLA 1GNQA 1ZM3A 2Z6VA 4BGDA 3MGCA 4DC9A 2CMKA 1NMZA 4C0HA 4Z1MA 2GZAA 2O8EB 2C99A 1R8QA 2WPDD 5EP1A 5FOVA 1OFUX 4PAOA 4X8OA 3AKCA 3IIKA 1OHHD 3GCGA 1G4AE 2L0XA 3MSXA 2PCLA 1XTKA 4AYTA 4EPRA 5DO9A 1XJCA 1RE0A 2RGDA 3AF0A 4F4CA 1RJ9A 2Z4SA 5DIFA 1J2JA 3BFKA 4FXPA 2YV5A 3OEEA 1MO4A 3EZ6A 3FMFA 1LF0A 1Z47A 2V7QA 3D31A 4XTRA 3C7KA 2KSQA 1D8TA 3VKHA 1KHTA 4AURA 2H16A 1OIWA 1OYYA 4LJ8A 4UJ5A 2BBTA 4BLSA 3DMDA 4BRWA 2HXSA 2ZE6A 2Y8EA 1NG1A 1N6OA 3W90A 2Q9BA 1KKMA 3ZZ0A 5JJLA 5TB5A 1F3OA 2J59A 1NJGA 1SKQA 4MQBA 1E99A 4NMMA 3AVYA 1T3LA 4JKIA 4KHZA 2ZE7A 4QGAA 4TL6A 2PLFA 1NRJB 3SQWA 2J0UA 2CLSA 5HZKA 2ZR7A 1GITA 3EC2A 2HJVA 3THXB 3SS8A 4KITB 5K8IA 4YDHB 2JLYA 2WSSD 4JLJA 2VHJA 1HV8A 3FDIA 4L15A 4DCTA 4QM6A 1G3IA 4CZ2A 4OL0A 3K9LA 4OHYA 1DG1G 3CUEF 3NDBB 2WM9B 3UXMA 4OYHA 3OESA 2CVHA 2JDID 2Q6TA 5FPYA 2GF9A 4JVNA 3VHLB 3X1DA 3ZQJA 5DN6A 1E96A 2HCJB 1DPFA 2OSBA 3B1VA 3N5CA 1W4RA 3UMRA 4BRUA 4PANA 1COWA 1E9DA 1XXHB 4TLCA 5LD2B 1WBDA 1IJEA 1YZNA 1YZGA 3JZAA 2XITA 4GP7A 2BHRA 2FEMA 1XEFA 2HT6A 4AG5A 1UDWA 4DCVA 2BWJA 2QMHA 3DM5A 2NTYC 5L3SB 2WWHA 2GETA 2Q21A 2QPAA 2VIIA 4QG7A 5EP4A 5BN4A 5JEDA 3CZPA 4HLUC 1DELA 1E2EA 2WKQA 4HLQB 2Q0HA 4LC0A 1I2DA 4JVSB 2NZ8A 5C18A 5JJKA 5JRJA 3BS4A 3ZJYA 1Z83A 2AD1A 3MCAA 2QTVB 1N6IA 4P33A 2B92A 1NJFA 2VL7A 3VQTA 4BZQA 1XEXA 2IYUA 5B2ZA 2GA8A 2GWHA 3WP0A 2DFKB 4WOPA 3DZ8A 4FCTA 2C04A 4YMWA 2MSDB 4JVMA 1NNEA 3GJ5A 1KO1A 4M1TA 2I1VB 2OV2A 5E7JA 5F3WB 1X3SA 4M8NE 1A5TA 5FUXA 2DBYA 4UKDA 3K0AB 2IK8A 3QXHA 621PA 5GADl 2GEVA 2EYQA 4JLVA 2ZYVX 4KV9A 4LHXA 3QKUA 4KJZA 2FWRA 4WXPA 2ZRJA 1GL9B 4Q02A 3SEAA 3B85A 2WIAA 4G5OA 5JWHA 2R2AA 3FFBA 1O87A 4B74A 5EXXA 3R9IA 1XRJA 1H8HA 4CT5A 4OQNA 4B47A 3RC3A 3BRWD 4AYWA 1T4GA 5EE0A 3M1IA 1IAQA 2JIZA 3KKOA 4PHGA 4Z1MD 3GJ6A 4IFBA 1KAGA 2A2ZA
chains in the Genus database with same CATH superfamily
4J1SA 2CL6X 4G36A 4ZXFA 1RAHA 4G07A 3P0EA 3EFBA 3ED5A 3NDIA 1IXSB 1BFKA 1ODKA 3SXJA 4GM0A 4K7JA 2R44A 3LGXA 1OI7A 3PTZA 5MF6A 1CFZA 4F9FA 2XCLA 2OFPA 2JGFA 2QLMA 3LW7A 1NRXA 1RD4A 3FROA 4LW8A 4EG5A 5LOVB 1NA5A 3PT9A 3AEQB 1WQ4A 4H0NA 1J99A 1NXVA 4Z9XA 5AYVA 1W75A 4XGRA 3T52A 4NYIR 1M5RA 4Z3DA 1U0LA 1PJSA 3MFYA 3RVKA 3ICEA 3EXFB 1YI0A 1UXKA 2C4KA 2X1HA 5CB0A 1TL7C 3JS5A 4BP3A 1KIFA 2GKOA 4EGFA 1VLVA 1ODSA 3KKEA 3M81A 3P2KA 4CEHA 3JSAA 3B9RA 3NNNA 1X6VA 3GT4A 2BEVA 2B1RA 2FY8A 1E9SA 2R8BA 3DHWC 4WDQA 2OZKA 5I45A 1ABEA 2W2QA 2J9YB 3QEBZ 2KYRA 1XWIA 3IDQA 4GGPA 2TECE 1U3VA 2VZEA 2I33A 1QORA 3ICWA 2XKBA 3PHIA 3PJDA 4Q4AB 4GSKA 5FJJA 3U0VA 1G17A 4M83A 4JLAA 2YVAA 4YRRA 5AQEA 5T8KC 2W70A 4PF1A 2INGX 4XTCS 4DV7B 4KFCA 1SWVA 4NMWA 1H0SA 1C80A 2MYUA 3BXFA 2QLFA 5B3JA 3WBJA 3QPUA 3FPLA 5DFAA 4EENA 2NTNA 3HVRA 1XPOA 1OLSA 3UOWA 4QUIA 3HA5A 4UBKA 1TE2A 2L82A 3KOWA 4HDQB 1W35A 3SXPA 3FHTA 1P4GA 3VYVA 5LBIA 1P44A 1CK4A 5J1TB 1UEJA 4F8JA 3EIWA 1QV9A 3HKDB 1ZEMA 2L19A 2XCIA 1OH6A 1C9JA 1X7XB 1BJRE 1P8AA 2P3SA 5JCJD 1FP6A 1NJ2A 1OAOA 2IOFA 2Q9CA 2QR5A 1ZGBA 2VHEA 3AF4A 3EWIA 3OEHA 2WWTA 3SGLA 4EB8A 2COKA 2WBLC 4C05A 5B12A 1DJMA 3OQMA 1NX9A 2YHBA 1TZBA 1NF3A 2QL7A 2VJLA 3O73A 1DIRA 3QLEA 4D3YA 4YP7A 4YMTA 3ITNA 4GE3A 4OUDB 2DR0A 4L4XA 2GBIA 3VX4A 3V6MA 4E51A 5I3CA 1D2MA 2GYYA 2H4XA 1S2LA 2YICA 4M55A 4RHCA 1V5EA 4N39A 2ZB2A 2BFAA 4AZWA 4IQGA 2W4IA 4WNAB 1VB3A 2P8SA 3UV6A 3TBHA 2G5PA 1EQUA 1V7ZA 3CLVA 3M3HA 3O4FA 1K8RA 1K1EA 1U8FO 2O57A 2R4TA 1JXOA 4PR3A 4YALA 1WXQA 2YOHA 3SX0A 1V4NA 1OJLA 3AQ4A 1WL8A 4CG2A 2HF8A 4ZEMA 3MJHA 3L0BA 4CUZA 3RPEA 4YQYA 4DSOA 1N9GA 3FTEA 2D1SA 1UIRA 4EO7A 3QWAA 2G36A 1MEEA 5C8VA 4HQ0A 1IM5A 4E30A 1IZYA 3HRKA 2JJ1A 2VDWB 4I4CA 3A4MA 3QKWA 4QUHA 1W29A 2EC5A 4Z9BA 3WNBA 4C4OA 3GJZA 4LHVA 4TXNA 3O82A 2OO5A 3FKJA 4IEEA 1CUJA 3O8BA 2V8OA 3R5XA 1DOZA 4R6WA 4MB2A 1GNPA 4W7SA 1GKIA 2GSDA 4X8HA 5IN5A 4HDNB 4OB8A 2FX3A 3IA2A 4XVUA 4F1WA 2DBQA 3DL0A 3Q2IA 1PZGA 2J33A 3LQ4A 3FYTA 1JIKA 1YR7A 3AIOA 3LUCA 3PXBA 3BEOA 4IP0A 3ZHXA 1L7AA 1MCZA 3EARA 1CJTC 5JZ9A 3G1UA 3HXTA 4XB2A 4AMVA 1V1RA 4BP1A 3V8MA 1C3JA 4F56A 3S8EA 3EEQA 4PGFA 4JGIA 1IN5A 4QARA 5LD2C 2XF8A 5ALQA 4KWIA 5A9RA 4LE2A 5CNJA 3NWJA 1XLWA 3ONDA 4LQ4A 1YK1A 1BXGB 3VDQA 5SZHB 5A0FA 1AVTA 1FJHA 1N2BA 1XR3A 4GZ3A 3THSA 4ZOLA 4F3YA 4EY6A 3MWJA 3HZOA 1T3TA 4HJRA 1PJAA 5D5PA 3PXGA 3VBEA 3ZNPA 3JWJA 1NBME 2WQ7A 4R2IA 3ZWYA 2XNCA 4CQMA 1N1DA 3OIFA 3FD8A 1SHKA 2IUEA 4RA6B 4N76A 2D1QA 4IV8A 4OGWA 4WACA 3MCUA 1ZHFA 1K6XA 4XFJA 3G2QA 3KYCA 2I3GA 2AN4A 4CKWB 3DMHA 4B4OA 2QIOA 1KI1A 5FBRB 5GJVC 1L1QA 1CLEA 1PHPA 3INRA 5GONF 5TT0A 2AYZA 1XB2A 2FMIA 2R6GA 3MN1A 3PIDA 3COYA 1PZMA 3HDJA 4F5EA 4PG6A 4E33A 5K6AC 2ZXUA 5IEBA 3LHSA 3O3MB 4K9SA 2Z2XA 3EYWA 2BHTA 2QTCA 1Y3IA 4MB6A 5CVUA 1Z4NA 2UYYA 3GRUA 4O5OA 1WUKS 4ZYXA 3T7JA 4FQ5A 2AZ4A 2YR0A 1K0FA 3P26A 1TM1E 2DLDA 3BGWA 1Z0AA 1G6OA 3G82C 3OZDA 3SQNA 1KGSA 5CXQA 1TAHA 1TCCA 5ALRA 4B2LA 1UZLA 5FPQA 3I0MA 2TYSB 5DYYA 1JR2A 4FTWA 1H2HA 3JQCA 3EXAA 1WPQA 3MWFA 2X14A 4AMGA 4C7VA 5KNDH 3I2FA 1JSRA 2AJBA 4IDGA 4Q93A 4W5NA 2A57A 5JW6A 4MINA 3PQ3A 1G7CA 3LCMA 3HPQA 1YR8A 3CLTC 1MIOA 3IUJA 4I9FA 2HRBA 3QTBA 2NZVG 4RH3A 1VHTA 2D5AA 3P0RA 3C4JA 4B3BA 4I1PA 1E1MA 1GM5A 1GU7A 4P0PB 4AO8A 4LZZA 1Z5NA 1GVHA 2D4AA 5BVHB 4RU1A 5LUBA 4MQ6A 4AB1A 2XWSA 4YRQA 4DJDC 3NC0C 4DLWA 4FGWA 4LOKA 1WU7A 4BNDB 1RAFA 3WBFA 5AJHA 4RIIA 3DE2X 1NBIA 1NXTA 1OFIA 3IVMA 2Q41A 1QYCA 3M4YA 4MPPA 1W30A 4RZ2A 1PE0A 2YWHA 3HZRA 4I5DA 4KSYA 3EZGA 4UULA 1U5BA 1XZBA 1VGVA 3OEHD 3ORQA 4RDXA 3IH5A 3RS4A 1E0AA 1JI3A 3KK0A 5EHZA 5HKAA 1RI1A 4DR7B 1VE1A 2XXAA 3LRPA 5JAMA 3VBCA 1AKQA 1I3OA 4QQ8A 4B79A 2LZ0A 3W2EA 1WCIB 2HIMA 4GMGA 3VHQA 3WLFA 2VP3A 4I36A 3IAFA 5GWXA 9GPBA 1ZLXA 3GH1A 4RKRA 2QRHA 1I13A 1O6FA 4G1CA 2C82A 3FFXA 1Z8HA 2QM8A 3B13B 3GFVA 1AHHA 3BL5A 3FCYA 2JJ8A 1YBHA 5A1JA 4F2DA 4DLKA 5JCOA 4E5PA 5JATA 3RVLA 1PYDA 1SBIA 2DR3A 4L3VA 4EKIA 4C88A 2WABA 5JDCA 1ZM2A 5L3QA 1Z06A 4GX0A 2QEQA 1ESDA 1Q1AA 2HSDA 3G5TA 3IPLA 4DRXB 5KZMB 3FGNA 1PHRA 1KSJA 4OHBA 1KYTA 3K0FA 1EFRD 4M1QA 1OREA 2HF7A 2OB1A 2R68A 3JZMA 3MT9A 1STOA 1T2NA 5E4YA 3GGGA 1ZJYA 5CT6A 3IVXA 1U6JA 1GO2A 1EWRA 4NFSA 1E2FA 5A4AA 2GN1A 2JJ1D 2XDQB 3IBCA 4CNQA 2E4ZA 4QPPA 3L77A 2XZTA 3G8DA 5AVQA 4UUBA 5D6NA 4RHXA 5LP1A 4KWTA 4X92A 1ZQ9A 4HF7A 2I2XB 1UT5A 2NYVA 3KHTA 4G0PA 2VDVE 3BSFA 3F97A 4GDMA 1KI3A 1LLUA 3CWZA 2B99A 4MYUA 3K92A 4BEVA 5JD5A 4GI2A 2FGKA 2XUJA 1Y8RA 4Q3EA 4FHEA 3PA8A 2P2DA 4HG2A 5EXTA 5JYBA 1GQQA 2OE2A 3M6FA 4OQPA 1HE1C 3L8ZA 4A5SA 4RPLA 5EP3A 3MTDA 3ZD8A 1FU7A 4IXDA 1BQEA 1XVAA 4K5QA 4HGNA 3TQFA 5JSZA 1XVIA 2QTMA 2WK1A 3OZFA 4X24A 2W0SA 4YNBA 4DLNA 2PL3A 3R7AA 4U7JA 5KAPA 3ND7A 1JG6A 1JMKC 3MD9A 3QE2A 2ATXA 3IB3A 4R2WA 4AN4A 4QXPA 3DBRB 3IR7A 4JP3A 3DAYA 1TC1A 2AN1A 3ECCA 5KYXB 4WXHA 3AF5A 3AZPA 3H5NA 3BK7A 3HP1A 2JASA 3ST7A 2O2HA 1V25A 4OHZA 3GLVA 4BO3A 5BOSB 3DE5X 4BO8A 4EGJA 3DPUA 4MI3A 1UPXA 4RANA 5EG5A 9ATCA 2PNJA 1RP1A 3QOYA 4AS3A 4G89A 4LBZA 3AF6A 4JDPA 1CQIA 3GMTA 3KALA 4BUCA 4D3DA 4PAGA 4GNRA 1LBTA 3E70C 1L7XA 1ZNZA 1X1BA 2H0QA 1C2YA 2OHIA 4C6SA 2AJ8A 3T5AA 3MYYA 3T94A 4WNYA 5HF5A 3SOPA 1M7BA 2ZYIA 3C0KA 4L1KA 5BN3A 1XMVA 1JJFA 5FCDA 3KTOA 1DO8A 1X1CA 4AQYB 4J9VA 3UJ3X 3PUZA 4KMOA 4YMVA 2V6BA 5L40A 1YA4A 5KUTA 2BFFB 3ABIA 3LUJA 4QSMA 5GV7A 1QIKA 5C5CA 2G71A 1HNNA 4GOND 4ND1A 5EZYB 3MWYW 2OC4A 1BQ3A 2JVJA 1S89A 2CBGA 1NY5A 3HXKA 4YQFA 1KYIA 3SU8A 4XRRA 4IPTA 4UTZA 3JALB 2W2PA 3K6JA 4QYXA 4TKMA 1FP4B 5T3YA 2RHOA 4OXKA 3ZE1B 5K7SA 1P0FA 3R4VA 4F60A 3ILXA 1DOAA 3IJEB 3FHCB 4EMTA 5B7PA 2ODEA 4J94A 5DM4A 2RGUA 1Y0BA 3BICA 3ETEA 1WD5A 2BAGA 1U94A 3GQVA 5AQ1A 3Q3VA 3RUFA 4WVLA 5KJ6A 2J6HA 1E79A 2CCGA 2HGZA 2O0KA 4LMPA 2EEZA 4QTXA 2J3HA 2OCXA 3QOXA 1ZVQA 1W5AA 4R7ZA 3SVZA 4EATA 3WS7A 1J8DA 3CPHA 4OHKA 4DV5B 4LOAA 2X4LA 4ZJUA 2OSVA 3M34A 1SD1A 3VJLA 1YFLA 1HWYA 2GCOB 2VATA 1I9CA 1M1YA 4UE6A 5G3ZA 3T7KA 3HKCA 4KMSA 2PMEA 3RBXA 2GGSA 3JARA 1UJBA 2O1XA 1DKUA 2VDLB 3ADKA 1MW9X 1L5WA 1G5IA 4J0KA 2IKSA 3I0ZA 2HPAA 1BWSA 2R47A 4ZRMA 3T5CA 1ZN9A 4DGQA 5I7OA 3BIWA 4FGJA 4AY3A 1R7RA 5KSYA 3ZGZA 3PNLA 5ALTA 3RNLA 3USZA 4BLRA 4CETA 5EIEA 5DGTA 1L4GA 4Y0VA 2QOEA 2XYGA 4J1TC 3NZEA 3ESQA 3KB1A 4WOCA 5DM2A 8OHMA 1K9SA 5FAKA 1D7AA 3K9NA 3VOAA 5EGNA 1BA3A 1G2PA 2ZI3A 2IA5A 3FUCA 3SDZA 3N39C 4RFSB 4BO2A 4CL8A 1GPBA 4E5NA 1ENOA 3QI2A 3JQFA 4NIMA 1HE8B 5DVZA 5JNWA 5EE9A 1V8FA 5HM8A 2O6HA 2VF8A 2YIMA 1J0XO 3FF1A 3G3EA 3LBAA 4O2RA 3RSLA 2WYHA 4IVQA 3UCFA 3EG9B 1KU0A 3TF5A 1G60A 3C4VA 4IOMA 5AVJA 4EY3A 2PUDA 4PPNA 3R7BA 4ZREA 2VFAA 1L4EA 3DP7A 4D4KA 1EFLA 3ND9A 4ECAA 1ZIYA 3KSBC 5BW6B 1DAKA 3HJBA 4Y2VA 5FTNA 4ZCLA 2Z56A 2OXTA 2HEGA 3TOCA 5BVGA 1U8XX 4QBGB 3WLOA 4RHYA 2CHFA 2JI9A 3D4PA 1YFKA 1WB6A 1EK6A 3SS7X 4QWMA 5DULA 4LXQA 9ABPA 1Q0SA 3OO0A 2HMSA 4FMPA 2R9VA 3RUAA 5U9CA 2QP9X 2AW5A 4W6QA 2FSUA 2D7DA 5A5DA 1SVUA 3CVOA 1LD3A 4F5WA 1R15A 3TFOA 2C2GA 3GAZA 1XAJA 2HMAA 4MMXB 4DGSA 4OBBA 3DFFA 3Q3JB 5FKJA 1SC6A 3CU5A 3OLCX 5C4MA 2J09A 3FYDA 1G5RA 3V33A 3OKFA 1I5OA 3DDNA 4FKBA 4FN5A 3TZKA 4UBNA 4IF6A 1GG9A 4PZCA 3I73A 3WAJA 1FFXB 4PINA 1A4RA 2FN7A 2HBQA 2XGMA 1X15A 3S99A 3M9LA 4EL0A 5DE3A 4M99A 3KVOA 5K3DA 2F43A 3O4HA 1K06A 2FUKA 1YJQA 4TS3A 4UVHA 4BKOA 5IZCA 2B61A 2P9CA 2WTEA 2O2YA 2ZM6B 5KNCH 2WFZA 1WUIS 3HDQA 4QTZA 4JR2A 3BFJA 4BWYA 4BJ1A 2EERA 3PWSA 4Q6BA 4WINA 3UB4A 2B83A 3A6KA 3C70A 4UHDA 1OC4A 4X91A 3UNXA 2ATVA 3HXOA 3U44B 2C92A 4PLZA 3RHFA 3MFQA 2ZSDA 4W5QA 4CV2A 2OPHA 2WT8A 3P9KA 4D80A 4R5HA 4PG8A 3AERB 4TZ0A 1ZAYA 5JCZA 3B7WA 4JSTA 3HCCA 1LI4A 2BBWA 4XB1A 1N5KA 2AOTA 3JPWA 5FI5A 2OQ2A 3UHJA 5B6JA 4BY9E 1XNQB 2QT0A 4PCVA 2BTOA 3H0CA 4Q1BA 3DLBA 3ACDA 1HURA 2OQVA 1Z9BA 2ZYGA 4M9ZA 5ENDA 1JXQA 1ULBA 1Z4JA 3K72B 3ORHA 1TVCA 4YDRA 5ALWA 4Z0HO 5K4HA 3GNTA 4X6LA 3ZKWB 1NXOA 4CODB 5BSFA 2VTBB 1KY5A 1I94B 1TJNA 3HR7A 4V03A 4L22A 1OQAA 3PF8A 5ADWA 4PRYA 3SD7A 4ENRA 1JG2A 2HJHA 2XMDA 3E05A 5PNTA 1C81A 2I62A 4DQ0A 3ROTA 2VJCA 4G8JA 5JT1A 4H15A 4J1NA 3SM3A 2JFWA 3PNOA 4J2TA 2GN8A 2JEYA 2RH4A 3Q85A 1RRPA 1SAYA 4YCJA 4QEDA 4V0RA 4DG5A 3ND5A 4YJ2F 4MRRA 1E79D 1QG0A 1V47A 1DAIA 2H5LA 3F2IA 3FM9A 4H6VA 3W5BA 1CB7A 1EFAA 1Z36A 1SUIA 3NBUA 1JSZA 2KPOA 1JEJA 1GA4A 4QULA 2V0NA 2WG0A 1P72A 1GDTA 1XIVA 2BR3A 2HLPA 5B1EA 1T8TA 1UC5B 1UEXC 1GPNA 4J3NA 4D79A 2PFKA 4OQ4A 4XFKA 4MUMA 5IYZF 3ADCA 1YSCA 4MRSA 2Q7OE 4CJXA 1G59A 4Z7QB 5IUJC 3IP3A 5AKJA 3B1KA 4RLHA 3WL8A 4OU4A 4UC0A 2G70A 1KRWA 3D8SA 2I4LA 4LA4A 4HQ6A 5FBQB 3ROPA 3T4EA 3V97A 4MR9A 3AB8A 2FUEA 4RCVA 5EXDA 4ASUA 2D59A 2PT7A 4D4MA 4ZQCB 3KPJA 5CBPB 2WKPA 1DBPA 1G6Q1 1E6CA 1QCDA 3KL2A 4KGXA 5B1YA 2BMDA 2QPTA 2CJPA 3BBPA 1WNFA 4HJXA 2ENUA 3GCWA 3GLTA 4WK4B 1NRIA 1DG9A 1U6IA 2BTQB 4AP9A 3SP1A 4CVNA 4ZO9A 4OXNA 4TV8F 3C3JA 3KLBA 3PCTA 4Y7DA 1BWPA 5K0EA 1RBYA 2WMOB 4KXMA 5B36A 2G76A 3FCXA 3S7TA 2ZWOA 3EUFA 1X7HA 2P91A 4GSLA 2JZOA 2Y0CA 3OI7A 3TTXA 2W6ID 1WZCA 5A7FA 5FX2A 4J4TA 1WCV1 1RJDA 2PD4A 1E9FA 4WZAB 4Y2SA 4CCWA 1JH9A 4ZCQA 2DUMA 1SQ0A 1VI5A 2PX2A 3NTQA 4MS4B 2Z6UA 5FEMA 1VI2A 3VDRA 5HQ3A 1Q0RA 2JCXA 5SYNA 5J5VA 5BO5A 2GILA 4DR5B 3D6MA 3DBIA 2YV2A 3I9KA 5BUZA 4UXIA 1XCBA 3ZUGA 2CXHA 5EJGA 4Z8YA 2HRRA 3KIPA 1OE0A 2E48A 1TEZA 2A9RA 1I8TA 1LS1A 3RRBA 1JECA 1OIVA 3OM9A 3ESAA 4XQCA 5BRNA 1CIPA 4RTRA 1E7YA 2AKAB 4C2BA 2O1EA 1UF9A 5BN5A 2DERA 2PFGA 1QJ4A 1JR4A 2FMKA 3G7SA 3MVEA 3NT2A 1OGYA 4R98A 1W36D 3NDJA 4YYZA 1L7MA 5FTKA 1X9IA 1FUYB 3NG1A 5SY6A 1XDZA 3A2NA 4IXWA 3VR6H 7ABPA 1XPRA 3H11B 1B0UA 1U9YA 1U65A 1R4AA 4ER6A 1MB3A 2W58A 1HT1E 4NHOA 3WV4A 3ZY5A 1HDYA 4UNQA 1C7FA 5A4DA 4W1RA 5TQVA 4ALJA 1M1NB 3VNAA 3VPAA 2C7QA 3IVGA 1ZMBA 5FNVB 1DBQA 2ZJ1A 1V6SA 3IA7A 3CIOA 4A92A 1IWBB 1YB6A 5K8UA 4FR2A 1T2EA 4WL0A 3L7IA 3U3JA 2JFNA 2G4LA 4LVNA 3DMGA 1D2EA 1RC1A 2EJVA 1A9OA 4JT9A 4NKRA 3ER8A 3RWOA 4MV5A 4UXHA 2N75A 3M5PA 3ZVNA 5LQRA 4PPYA 2CHGA 2VHQA 4LXGA 5KU7A 5K2OA 1IULA 3D3JA 1BS2A 5IWAB 1U31A 2R11A 2XZOA 2E5FA 3P96A 1NE7A 3AR8A 3EISA 1UM9B 2OD9A 2C7RA 2Q5JA 1SURA 3AB3A 3KYJB 4RPGA 3RVRA 1WW2A 1NR5A 1MHPA 1U1CA 3HNRA 3D8BA 4D57A 1I1NA 5DTRA 4V0MA 3RT1A 5CRIA 4GR4A 5HZHA 5BNZA 2H7VA 4WEQA 3PNYA 1XYGA 3OKAA 1J4AA 5E3IA 1SU6A 4KX5A 1EUDB 2F1HA 3CA8A 1XQ9A 3JVDA 4D3SA 5CEEA 5LMNB 3T7AA 4B5KA 1Q7TA 1W6UA 4TMWA 3I9FA 3OO1A 1ESNA 4HDOB 1QPGA 4C4RA 3IXMA 3SCZA 1GGJA 2JHPA 2FZGA 2PBZA 4TWJA 3T1OA 1XQ1A 3LAWA 3GLFA 3ZV5A 4KUEA 4EGSA 3BXZA 3Q5DA 2GHIA 4B6EA 3DE0X 5KDDA 1U7HA 1IOLA 2ZIVB 1IVYA 1Y3DE 2BT4A 2VBGA 4HDMB 3FJ1A 5D51S 1E7SA 3C6XA 5T67A 2PMBA 2OV8A 1SH7A 4PXSA 1CJKC 2WC1A 4IGFA 3COSA 4NQZA 1K7YA 1NFFA 1OIXA 3JRWA 5LQAA 4QOHA 4BYGA 3ITKA 4FYPA 4BFSA 2RKBA 3DBHA 3NTRA 5EJ8A 4JYCA 2DJIA 1YTUA 1JR3A 2VPZA 1GCAA 1M6EX 1HFWA 1QDEA 2CXXA 2WHQA 1TNDA 3PV0A 4P7GA 2PO5A 2C4MA 2W5UA 3ABOB 4ANFA 1ZK2A 3INNA 1HKHA 4QSHA 4I6EA 4ASUD 3UEOA 3VHXB 3C7CB 2Z3WA 1VL2A 2OCIA 3KP1A 4HS9A 3EZ9A 1Z12A 2VDJA 3CW2A 2CUTA 4IRMA 4W1SA 3E82A 4MQEB 4QATA 4ZVQA 3SC2B 2RMKA 1GRNA 3EASA 5DN6D 3N0RA 2AWOA 3NTLA 4FS8A 3NIDB 4WXMA 3RK0A 3WHPA 2ISSD 3ZD9A 4GC9A 1SBCA 2DHCA 1U4SA 2IPNA 4R01A 5JY1A 2IDZA 3BA6A 3L8YA 1UBTS 1E2BA 2IYRA 1VPLA 2Z2JA 3F9RA 1AV7A 5REQB 1W48A 5CIWA 3OJCA 2FSVA 3NBKA 2DYKA 1NVGA 5BV2P 3GAMA 1Z2DA 4EFNA 1QG4A 1JG7A 3LX4A 3LDGA 1VIAA 1TUIA 1E9BA 4MKIA 3H2JA 1N36B 3ADDA 1N3BA 4INJA 2ZOSA 1ZUNB 3IR6A 2G88A 4J0CA 4RMNA 3LBNA 1HT3A 2DG2A 1XMJA 4Y6SA 4Q47A 5F9FA 1H0HA 3OBIA 5LJLA 1PQYA 4K9DA 3CH7A 3NH6A 5DSTA 2OUIA 4NYMQ 1OZFA 1PQ4A 1VKOA 5JISA 1WP9A 2UZ3A 5TARA 3OPVA 2VDUE 4RYLA 4LSWA 5AVTA 1EBUA 2ZBRA 2AUNA 4C2UA 2MCFA 4F2HA 3GJXC 1EBFA 1HQKA 1TVEA 1XPJA 5JZOA 1MQ8B 4ZV7A 4FWTA 3NMUF 3TCNA 1SXHA 2GFIA 3DHYA 1CY6A 5AM5A 1G8YA 2DQYA 3MXTA 1G38A 1QHSA 5CT9A 5DNEA 1GYRA 4OQDA 4FGSA 3ZE6A 5GONA 2ZYDA 3MELA 1O95D 4BJ3A 5AW8A 5CB8A 1OZHA 2VSOA 4RD1A 2B82A 3X0DA 3U19A 4ZAVA 1BHQ1 1OH5A 4FB4A 2EF1A 1EUQA 3WFIA 1QHHA 1QAOA 2PWYA 3HYSA 3HO1A 3G59A 1M2VA 4QOJA 4IEFB 3E22B 4IG9A 4P5EA 5FDFA 5LIPA 1KSFX 4XUEA 3N2EA 1GZUA 4OHMA 4RF4A 1E2IA 3RSCA 2G63A 3ZLVA 1VRCA 2X9QA 2P5YA 2QMZA 3BWMA 4LSGA 1ZCAA 3DC7A 5EWLA 3NP7A 1B00A 3BM5A 3IERA 5M3BA 5T64A 3ZXYA 4M8SA 1E7MA 1LRLA 1HE2A 3M1YA 1PYGA 5FBLB 1SPXA 1X7WA 3ZI4A 3VR3A 1NWCA 2WFLB 4TKVA 2WP0A 4DMMA 2B2NA 5DBOA 5ALLA 5BT9A 5A5FA 1F2UB 1IBMB 1U8ZA 1YDMA 3IDAA 4XARA 2I7XA 4Q9DA 4DJEC 5JECA 4O4LB 1PJ8A 3V48A 5CA1A 4BVBA 1R9GA 5GY7A 3PYLA 4ZCMA 2WIBA 2FTKE 3EPPA 2WWYA 1HX7A 3H1FA 3GFRA 4L57A 2NVWA 4Q7LA 2A33A 2BV3A 5KTPA 4ZVSA 5GIPE 4G6ZA 1YA6A 4IQ4A 2I4RA 1NXXA 2GM5A 5KNCA 4ECEA 4EJSA 1RPTA 4MPJA 2OHGA 3FNGA 3PCRB 1E5DA 3F5SA 4KX3A 3VPDA 1CY1A 5AHKA 5JAIA 5LZ4A 4X00A 1CHNA 1Y8AA 3K4QA 1AO0A 5CFPA 2WKSA 1Q0HA 2O4UX 4HUTA 1TZKA 3CLRC 4P58A 4ZCRA 4OL9A 2OBLA 3PGMA 4WZBA 2BHLA 4PYKA 3RTDA 1BKDR 3WLEA 2C1EA 1QMGA 2OVFA 4FU0A 4NU0A 3PEYA 5DZSA 4KDFA 4ZI2A 2LW7A 1NIPA 3L7LA 4FI3C 2ZI5A 3FVQA 1T91A 1KA9H 2Z09A 1JT2A 5IULC 3VKWA 3DTTA 4JSRA 4CKZA 1TPYA 3LD9A 3LS2A 3VA7A 4OHWA 4H1HA 4LZLA 3QWHA 3KVRA 4FSXA 1SULA 2GAAA 1QGDA 3QE3A 4Z7JA 5FBZA 1MEJA 1PYOA 4HWKA 3JQ9C 3L18A 4TWBA 1G41A 1UDXA 1C8LA 4NG5A 4WKGA 4EF6A 3I5AA 4AMBA 3IQZA 2PSFA 4Z0NA 5FWAA 3H99A 5EGSA 3RJZA 5K1ZA 3ZU5A 3OECA 2YW2A 5FFFA 4LGVA 5J5CA 4WLVA 2QLTA 4CN8A 2PZFA 2XZDA 4B45A 1JR3D 3LCJA 3OX4A 4QOSA 2QD5A 4RFLA 4RKWA 4PS1A 5CX1A 3WDSA 4IMIB 4C04A 1FXSA 1HPLA 1H9BA 3DWEX 1CTQA 1NN3A 2LWIA 3AHEA 3HJAA 3KOMA 4L28A 4LJ9A 3VAYA 4L9WA 4DNQA 2O8BA 4CMEC 4HN4B 2LKCA 1ONBA 1SU7A 5E7QA 3UN1A 3GJSA 4UW9A 5FA8A 3EVGA 4PLTA 3W6PA 1E64A 7MDHA 3T3GA 1L5SA 3OT1A 5JQGF 1FX0A 1TQ6A 4LYFA 3S7ZA 5F3RA 2Q1SA 5GM2A 2J87A 4JWKA 4S04A 4XGIA 3V3KA 5F7XA 3SLRA 4FFLA 3W9YA 2VZLA 3DVQX 3OTGA 1OW3B 2XTAA 3FMPB 2GXSA 4ND8A 4X7BA 2PJZA 2A1UA 1QGYA 1TD1A 3PR3A 4ADSG 1EA5A 3WK7A 4G5GA 4XIFA 2AS0A 1UK7A 5GV8A 4DBVO 2ERYA 5EJFA 2ZWVA 3X44A 2GCGA 2IXAA 4W9RA 2JRLA 4IOKA 1LJUA 1KQFA 2VPWA 1TLLA 2FETA 2QPLA 4IFTA 2IS1A 1ZINA 1JFLA 3OMXA 4EX7A 4GX2A 5IUKC 2R6DA 3P1JA 5IJ9B 2FJ0A 3LPMA 3PVZA 1DWOA 2H0AA 3Q11A 5HDQA 4ZZ2A 3K6SA 2XRZA 2IX9A 1VIYA 1MABA 2F8LA 4RSRA 4C21A 5AVRA 5J4LA 2DHEA 3LRXA 1BH6A 4LFAB 1AHNA 3PG5A 1WZEA 1X7ZA 3F7TA 1ZA1A 2V8BA 4YRZA 1M83A 2C78A 1QE3A 4JL5A 1RWXA 4LY3A 1JQAA 2LD4A 5A62A 4DWJA 4HBZA 2AXPA 1UMDA 5FOUA 1U8UA 2AQ8A 2X9GA 1RPNA 1H2XA 2NXJA 2K5UA 1IHUA 1H22A 1T34A 3D7LA 4IO1A 5CCXA 2YFQA 3TOZA 3PHHA 3GI1A 4BRZA 4IHJB 2Z6AA 1WKVA 3DVAA 2B4TO 4RACA 1VJCA 3HRIA 1VL6A 2ISCA 4GGOA 4HVCA 1M2OA 4FBGA 4PZLA 3LK6A 1Y1SA 3WWDA 4D8TA 4V3BA 5JO9A 1KDVA 3K70B 1XP5A 3LK7A 4R83A 4YJHA 5DXAA 1H2YA 2OHJA 3ZZNA 2YN0A 3V1MA 3CCCA 1J70A 1W88A 1IM2A 4AJPA 4X1KA 4D97A 3RE1A 4E31A 2GVNA 4MOWA 4V0OA 1Q5PA 3GT3A 5CJJA 1X9HA 2ORWA 3Q9NA 2I6FA 1X1TA 4GOKA 2Q07A 1MVOA 3T1TA 2VEDA 4YCDA 4FBMA 4J90A 1RHKA 1TCBA 2DFTA 3FLEA 4M86A 4Q3BA 4AUNA 1KMQA 4UNNA 5K9ZA 1YE5A 2E4WA 3KTAA 4RKQA 5BW5A 1X19A 3C48A 1W93A 2OORC 2A67A 1A76A 4C78A 3IOBA 3VO9A 1EVQA 5HJEA 4Q16A 1BAPA 4RXMA 1WR8A 4A5OA 1SCAA 1Z2AA 5K3FA 2QTNA 1XPUA 3F8SA 2NG1A 2CNKA 3O91A 3D5EA 1H0RA 4DUYB 2PIDA 2NU6B 3IAS1 2YWFA 2GBLA 2MIIA 1JPNA 4PG4A 1Y82A 5G0TA 1ZGZA 1ND6A 4KQIA 3R0VA 4CU5A 4RFVA 3PENA 1V9CA 2XKKA 3A6GA 3KKKA 2KS6A 5LB2A 3WLRA 4YAGA 4ZCSA 3CUWA 4RTMA 3VR2A 1IBRA 2HSWA 5H81A 1CX9B 4Q18A 5ALYA 1Z33A 2PSEA 1HG1A 4EO4A 4HGRA 1I3CA 1AG9A 2HK7A 3DFMA 3QXXA 3QHQA 1PJTA 3JWHA 3OT4A 4PPQA 3WL7A 1G0NA 3ZWWA 1I3LA 3O1JC 1VCHA 2ID8A 2GEBA 2PO7A 1JQ3A 5EHQA 1NQUA 4RY2A 3ESXA 5DW0A 4D9CA 2GARA 3C3XA 5FORA 2PYZA 4RELA 1XALA 1YOBA 2GDZA 3R3SA 4PYIA 4X6XA 4LGMA 1QQ7A 2JH9A 3SC4A 1K7XB 2JCBA 3K0CA 3PX3A 4OHOA 3HJNA 4L5YA 1JWAB 3GJ4A 4XEUA 1L7DA 3CWCA 5FTWA 1J2YA 4NCKA 2HQOA 1DADA 3F49S 3HSKA 3ZTWA 4PN3A 3TVYA 4PO3X 2J9RA 3V8NA 3T34A 1IXYA 2I4MA 1C41A 4FWBA 1AZLA 2BFDB 3EXEB 3HQ4O 4LJLA 4CL2A 2E55A 2XB2A 3V4SA 4CQJA 2OFWA 4DA8A 2XE4A 4KHPB 3O83A 4LF6B 2JA2A 4PCLA 1AB6A 1P4AA 1T0JB 2H4YA 2QM3A 3AHDA 4FOOA 4RH1A 2WV7A 4WEOA 3CKYA 3OBBA 1PR3A 4MS1B 1H1DA 3DVLA 3IX7A 3RGWS 4E6EA 2B35A 3SYKA 4B6PA 3OQIA 1YQQA 2KB0A 2WNHA 4TQ9A 2I0FA 3ZWVA 5HM6A 4P08A 3QEMB 4BWFB 5IAOA 2GRUA 2XD4A 1TKAA 1L4UA 2W37A 3KHKA 4NJOA 5PGMA 5KVSA 4XVHA 2IUUA 4RQAA 3L6BA 4EM6A 4YDSA 2JGNA 1T3GA 1YE3A 3IAHA 3W6NA 4EG3A 4ML3A 3DOCA 3PNBA 2XAAA 3JQ7B 2ZXEA 2DWOA 4GYJA 3K0EA 4GL4A 4PC1A 3TKLA 4A0SA 5KOJA 2P27A 4G4GA 4YV2A 2V3VA 5HJ7A 1XNJA 3L82B 2GZ1A 5DMHA 3PA6A 5G4KB 3RLFA 2Z4RA 5TLSA 1K27A 1NXPA 4UD2A 5KDOA 3I3OA 2ISQA 1DBWA 1T36B 2JFPA 3HBJA 3DCNA 2GI4A 1Z7GA 2CBXA 2WAYA 1LSOA 2WW8A 4FFBA 4MZDA 4AECA 1DTSA 4P34A 4ZRDA 2NSLA 3RU2A 3W5SA 1SKYE 1ONNA 4QAQA 4KR9A 2C4UA 2GB4A 1WCWA 3PLNA 2QTHA 2CV1A 3TINA 2XZPA 4V24A 3WLMA 4U2BA 4DZTA 2XUIA 5IXSA 4OHVA 2KMLA 5EJ5A 4L78A 1SQSA 3HA2A 4Y1RB 4C7XA 2BELA 1YQDA 2CBZA 4JMPA 4Y6PA 1KXZA 5DCLA 2WTUA 2J3EA 4RIGA 3UC5A 1LLFA 1QBKC 1Z17A 3K31A 4YX9A 1YB4A 3QJGA 3R1IA 2EKQA 4CM8A 3ZXIA 4X66B 1MXHA 3TG8A 3CUUA 1KY3A 4L0MA 4LECA 3C3EA 5B1DA 4JAVC 3FVVA 3N74A 4R1UA 1AS0A 4U3JB 2FQQA 2DX7A 2Q8NA 1DU4A 4P5PA 2VDRB 2P7IA 5HX7A 4HATA 5ITZA 3TPFA 3AVOA 3KR0A 3W5AA 1EP2B 1ZKDA 1WCYA 4ZODA 1T8PA 4E5KA 2AVNA 3K8YA 4PR0A 4X94A 5HF9A 3F5MA 4ALNA 1G42A 1JKMA 3CX6A 5IJXA 1RC8A 1JYEA 5IU6A 2QQEA 2Y6VA 1SZPA 3OLQA 3LYLA 1DQNA 4ILKA 1MB9A 1NMQA 3DAFA 5F35A 1RZRA 4M87A 1K7FB 2XYPA 3I32A 3FDFA 4PIMA 2I2WA 3NPMA 1FY2A 3H0EA 1N25A 4F38A 4G26A 2NSYA 4ZO7A 2F1IA 4FUQA 1FTNA 4KE6A 4EJMA 1C4KA 1XRMA 3PDHA 2J5BA 1EX7A 3HRHA 3K9GA 4RM3A 2J0SA 3AVXA 4YJ2A 4MCHA 3OTWA 1D2RA 3F90A 3SQOA 1V5GA 5AVUA 4W7IA 3N8DA 3AMVA 2DR2A 1ADGA 2A1IA 3W05A 4DLSA 3C1AA 4W1QA 1WBJB 2JBHA 6AT1A 1S1MA 1C4OA 5FOXA 1WTCA 1H2BA 1BA2A 2BPOA 2WU8A 3U7QA 4RK6A 1BW9B 1WXHA 2P4QA 3F2VA 5IBQA 5JE8A 1IWPB 3NIGB 4GFDA 5IYZA 5J2UF 1Z7BA 2RK6A 1A3CA 1B43A 2XKAA 3KOZA 3C1UA 1BDMA 3C24A 3EULA 1RU3A 3EQ7A 3VR2D 1KIAA 1YE8A 2B8TA 2YWDA 4U6SA 3UW1A 3V46A 4DB2A 1U9IA 5F1OA 3INTA 5MFZA 4RK4A 1SG6A 5DEIA 4Z53A 4OFXA