2N4CA

Ec-nmr structure of agrobacterium tumefaciens atu1203 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target att10
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
AGLSFHVEDMTCGHCAGVIKGAIEKTVPGAAVHADPASRTVVVGGVSDAAHIAEIITAAGYTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu1203
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Agrobacterium fabrum str. c58
molecule tags Structural genomics, unknown function
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n4cA00
1Q8LA 1TR0A 1N5VA 2CRLA 2OD6A 1FESA 2GV1A 2N4CA 2OFHX 1GXTA 1IUJA 4YDXA 5B0FA 5T7LB 4HH1A 1CPZA 1Q53A 1AFJA 2BBEA 1LQ9A 1SQEA 2L3MA 3IWXA 3LGNA 4HI2A 2PD1A 2AJ0A 3TNVA 2RU9A 5B0EA 2IFXA 3BGUA 3IWLA 2AJ1A 1N5QA 4OIXA 2BJEA 2XMKA 2RSQA 2VH7A 4QOTA 3CJKA 1URRA 2ROGA 2KT2A 1MWYA 3HHLD 3K7RA 3KG0A 1OQ6A 3BN7A 3LGMA 1KQKA 5B0CA 2RILA 2BYCA 2LXFA 2AP6A 2ZDPA 4EFAC 4HI1A 1TL5A 2FIUA 1FVQA 2FHMA 2N7YA 4NPOA 4A47A 2FTRA 1Y9OA 2GA7A 1APSA 1OSDA 4FNHA 4OJGA 2ZDOA 3DXSX 4HL9A 2HLUA 5T7LA 3FMBA 3UDCA 1OQ3A 2HLTA 2HFNA 2Q3PA 1SI9A 1MWZA 2K1RB 2ASYA 2EW9A 1YG0A 2K1RA 4Y2IA 1YJRA 1W2IA 4OJHA 1VQYA 2XMWA 2IYIA 1JK9B 2OKQA 1TZ0A 2OFGX 1Y3KA 3QMQA 4ZA1A 1Y0HA 1AW0A 1X8DA 2W4CA 3I9ZA 3VTIA 1KVIA 5IXUA 1AFIA 2K7KA 3MZIA 4A4JA 1YJVA 1N5TA 4FNIA 2ROPA 3BM7A 1FE0A 1YJTA 5B0GA 5KAKA 5B0DA 1JWWA 5B08A 2QLWA 3BR8A 3HX9A 4A48A 5A6PA 2LDIA 2JDJA 2GFFA 1S6OA 2PGCA 5B09A 1FE4A 4OJ3A 1N5SA 2XMUA 1V3ZA 1WD6A 1K0VA 1Q8BA 2GO8A 4ZOSA 3BDEA 4A46A 1GXUA 4DPOA 2KT3A 2ROEA 3BB5A 3BF4A 4NL5A 2FB0A 3HFKA 2LQBA 5F0UA 2GGPB 4OJ1A 4YEAA 2GGPA 2W4PA 1FD8A 1FVSA 3HHLB 3LO3A 1TUVA 3HHLC 3KG1A 2KKHA 1R6YA 1YJUA 5K9FA 3QGPA 1OPZA 1FEEA 2BJDA 1KVJA 1X0PA 2K7JA 1S6UA 3HDSA 2N4DA 1ULRA 2QIFA 1RJJA 2HFOA 2HQIA 2W4DA 1XBWA 1X7VA 4Q2LA 4DL0C 4Y2MA 2OP5A 2IYGA 4F67A 2VV5A 2OD4A 3GZ7A 3KNGA 3WDOA 3FRYA 1CC7A 1SB6A 2RMLA 1QUPA 5A6WA 1P8GA 2LQ9A 5F0WA 1TL4A 5B0AA 2BUNA 2OMOA 1CC8A 1U7LA 2KYZA 2OAUA 2QLXA 3F44A 3FGVA 1Y3JA 3HF5A 4Y2KA 3CJKB 2XMVA 2XMJA 2ACYA 3KKFA 4U9RA 5B0BA 3HHLA 3T9NA 3TOQA 4Q2MA 2QYCA 3TRGA 2K2PA 4DN9A 1YRXA 1Q4RA 3MCSA 1P6TA 2G9OA 2AW0A 2XMMA 2GCFA 3DCAA 4HH0A 3E8OA 2HIQA 2XMTA 1VQSA
chains in the Genus database with same CATH superfamily
1NPKA 2HNYA 1Q8LA 2R7SA 4N8OA 4ANDA 1S4FA 4TY9A 2WOMB 3B4DA 2GQCA 4U8YA 1IBMJ 2YTCA 5G0RA 4NYOA 3PZPA 4V19J 1HNZF 1X60A 3KG0A 5F41A 2AGQA 1ACMB 1APSA 3MI7X 2PA3A 3DXSX 2BRKA 3RG6A 4DUZJ 2A6MA 3DLGA 1RHRB 1XNRJ 1VK8A 1S6QB 1AFIA 3ZZPA 3AHPA 5IWAJ 2VASA 3BZQA 4QU7A 3B8HA 4NZ6A 1Q8BA 1A9NB 4KFBA 3BQ0A 4ZPDA 3OLBA 3G96A 4IKAA 2DNKA 2ZJRQ 2BOPA 1IBCB 5A0YA 3NNAA 3L7PA 4P74A 4PXCA 5HQ8A 1B64A 1SC1B 1M5OC 2EC2A 4K4YA 3FCWA 2Q66A 2RF2A 1FD2A 2HNDA 2J9DE 3TX8A 1S6PB 2KFZA 4N5SA 2W25A 1Q7YT 5KFXA 1GFWB 5K14B 4LR8A 1H38A 3VAJA 3P6YC 4QYZJ 4HI1A 2KVIA 2FIUA 3BKFA 3K5PA 4UF4A 4GKKJ 4C2MA 4ANCA 4LSLA 3THPA 2AYMA 2F9JA 3V81A 3U1NA 1E6VB 3SBMA 1UVNA 1NK5A 2ZC4A 5A0YB 4M5NA 1XNQJ 2DGQA 2YVSA 2WW4A 3TWZA 1HD0A 4A48A 2B4UA 2JL9A 4Q7AA 3UVJA 4PR6A 3LP0A 4RKUC 1Z2ZA 4URGA 5F8MA 1KQFB 3UQSA 5F8LA 1O5JA 5I42A 2HFOA 1SUQB 2R3VA 4OYXA 1RP5A 1HA1A 2WVCA 1CC7A 5CYQA 4X66F 3O8WA 5D0HA 4Y2AA 4YHHF 3G8TA 4CLWA 5GAEU 4ZCLA 4DFPA 5KFCA 3MEEA 4YN3B 4U96A 3RB4A 3GV5B 5ETTA 4UY8T 3TANA 2ZNZA 1RWWB 3VHQA 4LSLB 2IA6A 2J6UA 1P9YA 3V81B 1HNWJ 4PXDA 1TL7A 3RAQA 2XMAA 1M5SA 1VFJA 1BWVA 4LMZA 4DX8H 2HG4A 1NPRA 1NB2A 3MECB 2KFNA 1QVFR 4G3IA 1YJRA 1VQYA 1N56A 4FF1A 2GJIA 1RA7A 1NB7A 4WFBQ 4DL5A 4RBTA 2KM8B 4EYHB 2JRSA 2H4WB 2CJYB 4OYPA 2PGCA 3K5OA 3R9LA 3THVA 1TAUA 3KK2B 3MUMP 1L5UA 2MKHA 3TUPA 1K8AT 1I3OB 3RR7A 3J81j 4F8RA 1U0SA 4M94A 4CYUB 4C4WA 1IKWB 2NLWA 5B0BA 4DUYJ 1BUXA 4XAKA 1MROA 3C14B 4KH0B 2EG1A 1U2RA 2W24A 1NDPA 2BJ9A 2DXEA 5KT6A 5KFYA 2A6OA 2V2QA 4DQRA 3MR3A 2OEJA 2RD5C 1X4AA 4PQUA 3CUNA 1RT4A 2EKYA 3TAQA 1URRA 2C2KB 2ROGA 2KT2A 3I4HX 2MQMA 1RWUA 1FVQA 2E1AA 3MDFA 5HLFA 5AXLA 2YWKA 4Y0FA 2EG2A 1CQNA 2NUUG 2RU3A 2JH3A 5LL6d 3AD9C 2OFGX 3RAMA 2OSRA 4ZJLA 1L3UA 2XCPA 4MK7A 2FGOA 3W5XA 3TA0A 2XMUA 4P7VA 3KHLA 1RT2A 3H5SA 2M4MA 1C4AA 3WC0A 2D9PA 1UPMB 1UJ5A 3HVTA 3IAM9 3QFHA 2IM1A 2FY8A 1PILA 2CWXA 3V6DA 2OUGA 1S4EA 4RUHA 1Y3JA 3CC2S 4CTAA 3HULA 3BPDA 2IC3B 2JLFA 3T1AA 5HLFB 3FC9A 4I1TA 3DI6A 1YIJS 5K8PA 3J7A1 5HMWA 1PYSB 3M6UA 4DFMA 4B3RF 2QMWA 1NHKL 3B4MA 3W8GA 4EGLA 1EIYB 2PEBA 1X4EA 4DCJB 2RILA 1WELA 2VBYA 1PO6A 5KFOA 5LJ3Y 3D28A 1GAOA 4CO3A 2VJUA 1RTDA 4QYRA 3W3SA 4DQQA 4Z37A 4B3TJ 5ETRA 2D3UA 3D1QA 2LFVA 4LRAA 2QJ3A 5M2UA 3U1LA 2CZ4A 2CQ1A 1T02A 1U0HA 4E8UA 6AT1B 3CDBA 4X4RA 4DV0J 4M5JA 4NZ7A 3HFKA 1HHQA 3OR2A 2QA2A 1MNEA 3HHLC 4RW6A 3BKTA 2WRMA 2YKMA 3FSYA 2HBQB 3RBEA 3EE3A 3DI6B 2PI5A 4F4ZA 4KE5A 1QUPA 3SCKE 3E51A 4M5IA 3X1LB 2YKOA 4NYPA 4QZVB 2VPZB 4IOAQ 3H2VE 2B9XA 3A8IA 3MM5A 1XWLA 2RKIA 2KXFA 2CYYA 1WSRA 5CAAA 4AQYF 4QR2A 2EWHA 3ULHA 4B3MJ 1N5YB 2NR0A 3GIIA 4X65F 4BCAA 2HKEA 4J9OA 1U0HB 2VKZG 4FPIA 3MTJA 3IR7B 1MN9A 3OR2B 2W2MP 2VQEJ 4NXNJ 3QMQA 2XS5A 2YKMB 2YX4A 5A8KA 1V9OA 1H3DA 3HD1A 2UUBF 2W01A 1H74A 3GYGA 5KFBA 2CNLB 4OHVA 4OZNA 1WG4A 1NK8A 1JLEB 4IH6A 2MZRA 2QG9B 4B3SF 2QA1A 1PKUA 2DCLA 2LQJA 1D9AA 4YB6A 4DPYA 3KYLA 3MM5B 4LBHA 2RKIB 3GIKA 2N4DA 1X7VA 1FXRA 2RRAA 2HPUA 5JXSA 2C22A 1SC6A 3V6HA 3SSRA 1JLFA 1REGX 1U45A 5DETA 2Z57B 1QLNA 1LKZA 4DR2J 1RAGB 2V94A 4J9UE 1VIXA 3ENWA 2IIHA 2UU9F 3GILA 4TU8A 1GMWA 1FKPB 1NDCA 4QIWD 2XWXA 2GMHA 1DBDA 2ADCA 4P71A 1SQEA 4MK9A 4WFYA 1KD1T 3GIJA 2FC8A 1TTHB 5A8KB 1JKHA 3W9IA 4TNOA 5C7PA 2CPDA 2J0QD 5IT0A 3M6XA 2F1FA 4I56A 3J80U 3GFHA 3WX8A 4DWIA 5DRKA 2LU1A 1J5EJ 2BDPA 2UXDJ 4JYAJ 4J9PA 5HVGA 3C8YA 3W9JA 2J6SA 4W92B 1N6QB 2RNEA 1X5SA 1EZZB 1K1QA 3PG9A 3M8RA 4L75A 2XHCA 4DLEA 2CQPA 5CCMA 3MM8A 1NAQA 2YBVA 5J2QA 4ES1A 1JLFB 1K44A 3K0JA 3IP0A 4OJ1A 5JUMA 4QPXA 3L7OA 3O44A 1FFGB 4IRCA 4LFCF 4LBIA 4ER8A 1H7WA 3IG1A 1WKLA 1M1KT 1UKUA 3QJPA 4M5GA 1T9TA 1Y4ZB 1NMEB 3BV8A 2CG8A 3W8PA 4NRTA 1RBOB 1JKHB 1RB0A 2DO0A 4I0WA 3KLHA 5HROA 4JI6F 3QZ7A 1QUVA 1CS4A 2R7OA 3KJFB 1RLDA 3PR5B 3IWXA 2PD1A 1YDLA 3Q2TC 2Y0BB 4CLYA 3KLEB 4KRWA 2PI4A 2ZE2A 1MMNA 2N7YA 2OH2A 2V2ZA 3MM8B 4NLOA 5C24A 2RS2A 3PYFA 1VDHA 2F5GA 4DU7A 4FP9A 4DSKA 4DL7A 3UDCA 4OYAA 2EW9A 2L9NA 2W4CA 3EDRB 4A4JA 4NLQA 4K50A 3F0NA 4R25A 1IM6A 3DLHA 3FJ2A 3UNYA 3NMRA 3OT9A 3TO8A 3EX7B 4RBVA 1X5PA 3QLHA 2IMWP 4M5MA 3TI0A 1CS4B 1F9HA 2GIFA 2I0XA 3N6MA 1G7CB 5ITHA 1HPZA 1GTHA 1L3KA 2ZH4A 2HQFA 4WJBA 4NEZA 5EX3A 5ADZA 1YRXA 1VBYA 4USHA 5C24B 4JI5F 2PMZD 5D0RA 1HNXF 2V8DA 1CSJA 4DS5A 4MT1A 1G2EA 2RB7A 1ZS6A 4GVBB 2C2OB 2E5LJ 2BM1A 4C3KA 2CFXA 1HL6A 1QSYA 1GNKA 1TK5A 3QYYA 4KGXB 4I2PA 2HLUA 2K1RB 2R8IA 1RADB 1QAJA 5AXNA 4ZA1A 3QLHB 2VZ9A 2AD9A 1VQKS 3R5CA 2ASJA 1FFWB 2EK1A 2B8QA 1HPZB 2UUBJ 2YNFA 4PWUA 4M1KA 4ILLA 5C42B 3PR4A 4USKA 1MSWD 1FJGJ 2DNZA 4NCBA 2HGMA 4CLLA 1RWMB 2WCXA 5A2QY 3POTB 1JLAA 4I2PB 3R6LB 2W2QP 4LRCA 4NLPA 3L4BC 4DX5A 5FDLB 4DV1F 4GRSA 1UTAA 5DGAA 3DLKA 4RUBA 1FDDA 4DR5J 4OJHA 4ZS6A 5LSOA 5A8RA 2DNLA 1A7GE 1W2BR 2YH1A 2XGPA 1HWIA 5JVGQ 2OTJS 1ZM4A 3SEOA 4AL6A 1T94A 2EVZA 1TFYA 1WC1A 3A12A 1MW7A 2LEPA 5J2NA 2JC1A 1N36J 1X0FA 5GMDA 1YJUA 3WZ0A 4F3OA 1JLAB 1EETA 4USWA 2LXUA 2YKAA 4AUKA 2GO9A 4LRDA 1VQ5S 2IM0A 1BQXA 3KWMA 4DV3J 4JI1J 2J76E 1G6BA 4R0JA 1R8CA 2IMOA 4Y6IA 1YK9A 2I1RA 3R5BA 3I5AA 4DG1B 5KFQA 4K4TA 1LK7A 2DKOB 1VHIA 8ATCB 1EP4A 3D68A 3DLKB 2VPWB 2Z8QA 1Y10A 1BQMA 2CPXA 1WOPA 3AJ1A 4C9DA 5A8RB 4LR7A 1MWYA 4C8ZA 3PX0A 3CCES 1KS2A 4V1Ak 4ECRA 3IR6B 2ZKUA 1DRZA 3S1TA 1ZAVA 1UW9A 1HNVB 4CLFA 5J2NB 4QWAA 2H65B 2WB1D 2HAIA 1IKVB 1OY8A 4NCAA 1YBUA 2DGTA 1T0TV 1JQGA 4CNZA 3NCQA 3PW0A 3IM9A 5I3QA 4ELTA 1EETB 3RBZA 1DY3A 1LV5A 2DO4A 4Q8FA 1HR0F 1DQAA 5E3AA 2PC6A 3LAKA 1U09A 1AB8A 1KTQA 3PRDA 1FTRA 4RNFA 4RU2A 3IGVA 2QIFA 1EP4B 3AT1B 4XK8C 3M8WA 4PAAA 5J2MA 1TL4A 3ZFVA 1NSKL 2DHXA 4ED0A 1RAIB 5E3QA 2M88A 4JV5J 3G6XA 3OL9A 3QATA 1RBLA 3QSIA 2QMXA 4PG6A 3DRRA 4I67A 3HLUA 1UZHA 3SMZA 1PAEX 1T95A 3D0IE 4D3GA 2W1BA 2RUGA 2I6WA 3ONQA 5HVFA 1U6ZA 2AJ4A 3QAEA 4NPOA 4ZVRB 1U2FA 2CQ4A 2VFRA 3UCZP 5CZVA 2FLOA 1UA1A 3W1YC 3PW2A 1NK7A 2J0WA 3PACA 2C3PA 4IYQA 2GZOA 3JAMY 5K8MA 4WTYA 5M2RA 4PWDA 1SPBP 3GIMA 2KVQE 2QLJB 5J2MB 5L1KA 1FE4A 5KFKA 1C0TA 2DRAA 2F9DA 3OVAA 2IM3A 4UT4A 4ZITA 1FEEA 3V6KA 2D74B 4W4MA 1P1TA 3BPSP 5DGBA 1RE1B 1ROFA 3TAMA 3DRRB 4K0KF 1JJ4A 1D09B 3H8YA 3LPYA 1KQGB 2CNKB 2CKWA 1UVJA 2VQFJ 3TOQA 4EUVA 1P6TA 3M30A 5AE1A 4FZVA 3C19A 2LEBA 4L73A 1XQIA 3BGOP 5HQLA 3B82A 1BE4A 1VK3A 2FHJD 2MJUA 4NLUA 1TV6B 3IMQJ 4WXOA 3ITHB 1HKAA 2BE2A 4L3NA 5D6GA 1C0TB 1TL3A 5KFDA 3ZTQA 4IUFA 4PCQA 1NK6A 2AGPA 3N6NA 3B78A 4OZ3A 2AJ2A 3TAMB 3NNCA 1PC5A 3DRPB 1S1UB 4X2BA 1S9GA 2F3JA 5KT4A 2CWKA 4DR6J 3QQCD 2GNKA 4B9SA 4PRFA 4X4UA 3GJRB 4MIAA 3R5DA 2CJKA 4KPCA 3UD3P 3OUYB 3I96A 3QJLA 1TUGB 3ENVA 2OPPB 2C3MA 2GS8A 3OFEA 2NPFA 2JEIA 4KO0B 2AW0A 2D69A 2IHR1 2CADA 1FESA 4CCHA 1TL3B 2OTLS 4EBEA 2VG5B 1RTIB 2XYHB 1NXIA 5LMUJ 3OTEA 1QAXA 3GR1A 1XTZA 4FN5A 3J7YU 1IQZA 4Q5VA 2VB6A 2ASLA 4Q45A 2JC0A 2E9TA 3V5RA 2FUG9 4J7CA 3PNIA 3DU6A 3G2XA 1UETA 2YQ3A 3KDNA 1ZM9A 1SIZA 1VYAA 4KHMA 3I31A 2FDNA 1CJTA 2YPYA 4CLTA 2QA4G 2HHVA 3H2LA 4LJMA 3DFEA 2HWIA 4QIEA 4ZVHA 3PY8A 2F63A 3V4IB 1DARA 4ETZA 2FJDB 3GJQB 4K4ZA 2K3IA 5KFEA 1HR0J 3HXMA 3UCGA 4URSA 2KTQA 3OVSA 5DQHA 1RI7A 3ILIA 2YWGA 1FRJA 4ZIWA 4F2SA 4RNMA 4DU8A 4E2FB 3CT9A 4Y2KA 1I1GA 1NBEB 2JEJA 4YR3A 4ZVQB 2X1GA 1HBNA 3HFZB 2HZCA 2F4FA 3PEJA 3DYAA 5DM7Q 3AOAA 1IR1A 1J27A 3RW7A 4A8WA 4B02A 1UVMA 1CJTB 1QE1A 4RNOA 1U47A 1SV5B 4LF5J 1H2UX 5LOQA 1KQKA 3TUIC 1U1KA 3M8YA 1OQ3A 1FRXA 4ELUA 3G6VA 4P72A 1LWEB 1N5TA 3EZUA 2A2DA 3I0RA 3IFEA 2GFFA 1UMJA 2ZWOA 3LP1A 4IQMA 5HQMA 4PYAA 4C8OA 2YQ0A 4DPTA 2IVFB 1XBWA 2G0JA 4M8LA 3KK3A 4G65A 3VR1A 1FCAA 5D4PA 3QSYB 4CO4A 4MKBA 4DN9A 2V0NA 2BW2A 1JJCB 2HIQA 2OFHX 3BGRA 4U95A 2ILZA 3VGSA 3NCRA 4NLGA 1ELOA 1LW0A 4ED3A 4FYDA 3HHLD 4USTA 5J1NA 1EHWA 3I0RB 2M9KA 2V4QA 2RHQB 3P5BP 2FTRA 3LGHA 2NXCA 6FDRA 3LP1B 5DZ6A 4WKRA 4Y2CA 2VFVA 2XCAA 4MKYA 3CD6S 1RWXB 4TLQA 4FYWB 4LQ9A 2E5IA 3GJSB 1FRHA 1T3NA 4C6AA 3ZZOA 3EPIA 2QV6A 3G82A 3KK3B 1ZTTA 5I3UA 3TVKA 3DNCA 1M0SA 1O6XA 1KKHA 2CPHA 5F0UA 1OPIA 3OFGA 3RRKA 1RT3A 1D8ZA 3DOMA 3QPIA 1VJQA 1JIHA 2B4PA 1BC6A 3D4JA 4DEZA 3CO0P 5DM6Q 2IRYA 2J7KA 4ENOA 3Q86A 4IRDA 4A8KA 2BACA 2UXBJ 3IBFB 5I3PA 2CQGA 1L3TA 1B3TA 1M5HA 4HH0A 4NX9A 2JOQA 4KHRA 3W5ZA 1R8BA 2MZTA 2HMIB 3H40A 1RU2A 3OLAA 4FKYA 1VIOA 5CABA 2E9ZA 3HHNB 2RQCA 2DNOA 3LGMA 3PHEA 1URNA 2EBEA 1F3VA 1LEOA 4ALZA 5GMKa 3NGSA 1J2VA 2NREA 2ZJPQ 3EVOA 3DN9A 2ASYA 2ZWPA 1RT3B 3CGIA 5DDPC 1UWBA 2J0SD 1YJTA 2M70A 2FLNA 1T7PA 2W9BB 3IS9A 3BDEA 4K5RA 3TJ8A 3FFIB 1VRUA 1KLNA 4ERDA 1H98A 4USJC 5JJBA 3ILOA 1S6UA 3CCWA 4RBUA 4KKOA 2DNYA 1FJEB 2DVIA 3MFHA 1K1SA 1TVRA 1RAOA 2WHOA 4JI3F 2CQBA 4W90B 4B3OB 4AL5A 2E5HA 2ZH5A 4P6QA 4O0NA 1CULA 4F4XA 4M5DA 5KFRA 2HZAA 3DLEA 1H2TZ 1X9MA 1YKWA 1KR4A 5DDQC 3PV8A 3MXHP 4O44B 2V9WA 4ZMMA 1T9YA 2ILYA 4G1QA 1UWBB 5LJ5Y 1PGZA 1VRTA 3BBFA 3TR5A 1GMUA 1M1HA 2Z0GA 2DNMA 2PFFB 3RJMB 1VRUB 1GEHA 3EM1A 1C1CA 4J90A 1ICEB 3P45B 2IAJA 5HK4A 1N4LA 1NJXA 1VQ9S 1OIAA 4KKOB 5KAKA 4KSEB 1JWWA 4KHPJ 1ZETA 1TVRB 5D77A 4A8QA 4DX6A 5A8WB 4NA2A 3G71S 1RTJA 3QIPA 2ZD1A 5DO2A 2Y0SD 3HKWA 2LA4A 1SL1A 5KFLA 2B3TB 2B6AA 1YGYA 3DLEB 4P7TA 1C1BB 5KG0A 1U26A 4X4QA 2E1PA 4MMOA 3M8PB 2FJEB 5B0AA 2HWTA 4G1QB 2QX0A 3MMBA 2VFUA 4RUAA 1MU2B 1VRTB 2ZM6J 1N32J 3PFOA 1VQSA 4OYOA 4OI2A 3CJ3A 4ID8A 4WE1A 3M2VA 2D7SA 5KFIA 2IAJB 3R5JB 5IOLA 5KFZA 3G8SA 2YH0A 1UVLA 1NZAA 2G0CA 4MYUA 2UXCJ 4R5PB 2EFPA 2HFNA 1HFEL 4YMEA 4JV2A 3ZTOA 2DJWA 4R8UA 2I2YA 4IRKA 3N6LA 3RGIA 2EBGA 1WC0A 3IRWP 5E3RA 1N34F 3M8QB 5ETKA 3UPFA 4IO9Q 2VFTA 2GW8A 1OO0B 3MMBB 1Q79A 2FHKA 1S1WA 4MFBA 1ZM2A 4DV4J 2K7JA 4N47A 2OD4A 1T9WA 4WE1B 5KT5A 3M2VB 3FBFA 2DGWA 1VCTA 4ZK7M 4Q2MA 2MKSA 2ZBCA 3IM8A 2QZ8A 2N4CA 5IQ6A 2K3KA 5A2QU 3NGDA 2ASDA 3K17A 1JXEA 4EI2A 1BY9A 1VISA 4R8UB 3OTBA 2XS2A 3RB3A 5HJYA 3E2EA 2ZC3A 1SL0A 2AP6A 4RW4A 4YS2A 2QL9B 3C6UA 3UD5A 5CZXA 3FMBA 2JSXA 3MCOA 3OHBA 4IFYB 1S1WB 4MFBB 1TL1A 5D15A 2ZH7A 2IRXA 3FBEA 2NXEA 2V2VA 3OW2R 3ILJA 3OXFA 2A1BA 2IM2A 2C28A 1YLXA 3JTOA 1HD1A 1HHSA 3MPYA 2BE7D 4XTTA 2M2BA 4DR4F 3QT7A 1QTNB 3FNNA 1LXNA 3J7AN 4F0HA 2ZITA 2XNRA 1FWLA 4FBTA 4J9NA 1DURA 1UFLA 2CZVC 2MLXA 2QT7A 4MIBA 3D7SB 3W2VB 1C0UA 4CM2A 4O3RA 2R7XA 3C6UB 1YX2A 2G2YA 1FX2A 2GV1A 1V5IB 1R0BG 2XSJA 2D41A 3TNVA 2ZHOA 2R8GA 2BQUA 1JXLA 4OIXA 4ELVA 2DT9A 1F5BA 1U4BA 4LF6J 2EFGA 2CPEA 1CG2A 4JI0J 1VQ8S 1LWCA 2G4BA 3O6QA 5SZTA 2QE5A 2FVPA 3CW2C 1JX4A 2KJWA 4AXIA 2AYBA 2CPZA 2J7WA 3CCRS 4M5HA 3QGGA 1S0OA 4NLYA 2KG1A 3D1OA 2GGPB 1YBAA 1DAXA 3X3UA 2WTFA 2G13A 2ZHBA 1BMQB 2Y1JA 2OIHA 1DFDA 3TEHB 3U1MA 2XSJB 5BR8F 1SB6A 2LQ9A 1WORA 1GX6A 1RGVA 2ERRA 3L95X 2FJAB 1P1LA 3MM7A 1S0NA 4DR3J 3ZZYA 1Z2LA 2KG0A 3T1HF 1T03B 1LWCB 2MQPA 4YDDB 2EFVA 4U7CA 2BBEA 2BKPA 5GAEI 4B9LA 2XLJA 3MAHA 2QRRA 4XDDA 1N8RT 5B0CA 1TL5A 2Z2ZA 3DLJA 2C1EB 3KJNB 4OMFG 5FIIA 1OSCA 3A4TA 4DV2F 3MD1A 3O2IA 1UFWA 1VGYA 5CQGA 3FEZA 4BHQA 1FEHA 3ISZA 2XULA 2FJVA 3JAMU 3CCJS 1RAJA 2CDQA 3I9V9 5T41A 4ZOSA 2AHOB 4DFKA 1XR5A 4PUOA 2B7BB 3LO3A 2XBPA 3CCLS 2RH3A 1B99A 3FRYA 4IG0B 2XC9A 4EWTA 4FYYB 2XEXA 2C3YA 4LFBJ 2K2PA 4KT0C 4UOHA 4UOFA 2V8PA 4OI4A 2VBWA 1DZ5A 2HVEA 1RT7A 4PG7A 4X62J 2MGZB 3H4DA 4CH0S 1IKYA 4DR7F 3GJTB 1Q8IA 2DR6A 3TZXA 3FVYA 3K7RA 3ENQA 4Y3CA 1KSPA 4M63A 1S9EA 2DNPA 3SI8A 4DN0A 3W64A 3MAQA 4TN2A 2XY5A 3QRQA 4PUOB 4I2QA 1JNZB 1RHKB 2MQNA 4DSIA 3FMWA 5EN1A 1HQ2A 1WACA 5LMNF 5L1LA 5J1PA 4C11B 3MZIA 2J0XA 1H0HB 2PE8A 2X3GA 2LXIA 4CO0A 1N5SA 3RTVA 2VA3A 2GJ2A 5GAGU 2V2KA 1Q1KA 1VOMA 2XS7A 3T19A 5GMEA 3PW4A 1RT7B 2DIVA 4CI0B 3M4XA 5HSPA 4LFAJ 4F4YA 3CD0A 1YJWS 3KLIA 2X1BA 2DGSA 4FS2A 2Z2MA 1WG1A 1HARA 2GCFA 5B7WA 1U48A 2F4VJ 1RK8A 5J2PA 3KLGB 2XO6A 1Q86T 2JNJA 3WBZA 1RSCA 1IBKJ 3WX4A 4NLXA 2AJ0A 4I2QB 1KC8T 4C97A 2BANB 3MOZA 5A76A 3KLVA 3C15A 4O0IA 2I8EA 4DDFA 3C66A 3CCVS 1VMBA 2P6SA 2GX8A 4G6VB 3F73A 2HHPA 4LF7F 2DXFA 1YJVA 3QGIA 3KJQB 3ETMA 4WYLA 2W2OP 1YRTA 2KM8C 3QAUA 1S99A 4TY8A 5C25B 4P2SA 3A8EA 5C5JA 3CD7A 4A8XA 3KLIB 3T5LA 3AQOA 2FPHX 1HWUA 4RWXA 2NS1B 5J2PB 1KHWA 5H9EK 4ID5A 3ZZTA 2D1CA 5A6WA 1F9EB 2DY9A 3J7ZT 2DITA 2JEFA 2JEGA 2HS4A 2R2UA 3OL7A 4I6AA 2GIRA 3EGWB 1NHUA 2FQQB 1NDKA 1VQPS 2J9CA 1ITPA 2HFVA 4TVAB 4DCOB 3T1HJ 2LU2A 5AXKA 2KYXA 2NYHA 3S01A 4O4GA 3GV7B 3R8YA 5CYJA 1LFPA 4TY8B 3O5TB 4PPZA 4ATNA 1VBXA 3GYNA 3L09A 2E7WA 8AT1B 4NXMF 1XMOJ 2B9YA 2PT0A 2KZZA 4RUCA 3FSIA 3MEDB 2DD8S 5KG2A 4DV6J 4ID5B 3Q8VA 2MQ8A 1NEEA 3JSMA 1T11A 2EFQA 4MTPA 2Q6CA 2GVDB 3RRHA 4DV7J 3SCIE 3SFUA 4PQAA 2MKYA 4C0OC 3A8JA 3NG8A 1SJRA 4RZRA 3D6HB 1OWXA 3M1VB 2C2ZB 4Q0BA 3ISNC 3ZTRA 4DSJA 2EFOA 4F26A 2UUCF 1NSPA 2XO7A 2B5JB 1S49A 3AJDA 4OHWA 2N82B 3IRXB 5DQIA 3ICLA 2KL8A 1FT8A 1UCNA 1H6KX 4NLWA 3GLJA 4NCGA 4LF8F 2R9LA 2ZUGA 4ED4A 5E3PA 5K5MA 4DX7A 4K2XA 3TZWA 4OX8A 2RRBA 4USUA 2AZ3A 3JSMB 3ZTSA 5EWGA 3CJ5A 4M5KA 2G2ZA 4GMKA 2JWNA 4RW9A 3HMJG 4JBCA 1S72S 1CVJA 3BH7B 1AW0A 1JLGA 3SSQA 3TVYA 3QNWB 2E5JA 4IR9A 2KHDA 2WAQD 4RL1A 4JI4F 2UUAF 5IT4A 3QWUA 4X64J 2L08A 1PIEA 1U8SA 1VBZA 2RAQA 1LWXA 5E33A 2ZNYA 2ZUAA 2R4FA 1RWPB 4TLRA 2NPIA 2ZJQQ 2LYVA 2LP4A 2HNZA 2UVVA 3UNGC 3KNAA 3N01A 1JMTA 1ZA2B 3MM6A 3O1LA 3C3LA 3W61A 3LH2S 2ZH3A 1GXTA 2LQ8A 4RW9B 3KLFB 2ATLA 5HL7Q 5L8RC 2C2RA 4PZVA 1JLGB 3JYTB 1I94F 1N88A 1UPPA 5H1SV 4J37A 4DXLA 3TP2A 1DQ8A 3TUZC 2DR9A 1QAIA 1A6LA 4F3MA 1E6YA 4KQZA 1WDDA 1SJ4P 1FHTA 3KHGA 4CRJA 1D0EA 4V19X 1S6QA 2X1AA 3PEHA 1TU0B 1UEUA 4K4VA 1FDNA 4C3MA 4ECTA 1XC9A 1FERA 1S57A 1JXVA 1Z4UA 1NCLA 2DHSA 4DL3A 4YEAA 1NDLA 2N7CA 3MM6B 4ED8A 1Q82T 1IVZA 4DPWA 2YNHB 3QRRA 4ZPBA 2W9CA 4JI8F 4AE5A 4Y2MA 4OYMA 3THTA 2M52A 3UN2A 5HMYA 4NWBA 2PA8D 2P5VA 4QIGA 5F9LA 3KJVA 1NM2A 1WKKA 3I55S 2HW3A 1S6PA 4FF4A 1E6YB 2VF3A 2OHDA 4ZVUB 1N5QA 2HGNA 2MSSA 5K14A 4QOTA 4IH5A 4OHZA 4C8MA 4DJBA 4L3KA 5I4MA 2UVUA 1RT5A 1V3RA 4TKTA 2H9ZA 4AT1B 3CJ2A 1S12A 1YJ9S 3NS7B 3AJ2A 1E6VA 1IWGA 2YKPA 5KFPA 3D6TB 2GAHC 2W9CB 2LKZA 3M6VA 5DG8A 2R8HA 3MWBA 1S97A 1LK5A 2YWEA 2WONB 4QBUA 2PO4A 1JLBB 3DHWC 2NXNA 5F8JA 4CZCA 4WP9A 3KJVB 4KYZA 4ANEA 4WZQA 4MYTA 1SUQA 3H25A 3TW0A 3TJAA 1OMSA 2O5DA 3SQGA 4N56A 3CNQP 5AJ3J 3EVMA 4EYIB 2VA2A 4P10A 4QWBA 1RT5B 1WC6A 3T1YJ 4LF4J 1IR0A 3B6BA 3TVZA 1WHWA 2VL1A 4YY3F 4KAIA 5F8GA 3OV7A 4DPXA 5KFTA 3BBBA 4USVA 4AFFA 5CCLA 3KHRA 4HLBA 4JI7F 3NMAA 4K4XA 2AJQA 3MECA 1R43A 3OXLA 3CC7S 3DDNA 3JS9A 5F8HA 1XK8A 3GWCA 3LP2A 1PC4A 2WVEA 2ZVIA 2VICA 5HBMB 3KUGA 1IR2A 3S8SA 1SKRA 3H42A 3ENAA 2O3DA 2I9SA 2QFJA 2AEJA 3KK2A 3SQGB 2WK4A 1HHTP 2BABA 1R31A 2C42A 3SV4A 2DEIA 4WK3A 4Q2LA 2MEWA 3W62A 4CYUA 4QW8A 2MZJA 4EK2A 1IKWA 4OYWA 2OJ3A 4OX9F 3VZIA 2H5EA 1AT1B 5IS2A 1TUWA 3C14A 1TMMA 5AT1B 2MKCA 4Q8EA 2EI5A 2HFSA 2JFDA 5EX0A 3T5KA 4FKXA 2ZKTA 3LP2B 4FF3A 1VQNS 2QO3A 2BJEA 3OTOJ 1MG7A 5CYMB 4ZLNA 2FLPA 2FVRA 4LIRA 2VG6B 4A8FA 4OJGA 3BSCA 2JLGA 4Y2IA 3NWRA 1FDAA 1HMVB 4NLSA 3VTIA 4NE9C 3LTOA 2EPIA 3I5CA 5L1IA 4H4MA 2F7VA 4DMZA 5KFHA 3ZNUA 1NU4A 4C3LA 5IC4B 5HANA 2V5HG 4G1IA 4E0DA 2HFUA 2ZOGA 5IZHA 3CJRA 5DG7A 1IBLJ 4CNYA 3GZ7A 3CIMA 2IPOB 2MTLA 2DYAA 2BUNA 5ETMA 2HHWA 3P8BB 4KIAA 3TZZA 4U9RA 4RX6A 2Y1LB 4LRBA 4FYXB 2JLEA 3NS5A 4DR1F 3DU5A 2F8MA 2IC3A 3GMGA 1UFKA 5DZ7A 1ZM3A 2CRLA 5ETQA 4C0HA 1HNZJ 2DRBA 3PVXA 4RW7B 4K4WA 3NOGA 3D54A 1OY6A 4H4MB 4K59A 1S7HA 2DGUA 4TQRA 1YSJA 3A3OB 3GFZA 4OI3A 3H5YA 4PKDB 3MR5A 1W2IA 4ECQA 1D9DA 5ETSA 4FXVA 3K58A 3PJXA 3DGPB 5B08A 1WNEA 2CG4A 3NS6A 4C48A 3M2UB 1VQ6S 3CDUA 4LF9F 1VJWA 2LLZA 1NSQA 3BB5A 2MYFA 3H5XA 3FDSA 3D3BJ 1NNDA 3QGHA 2OEKA 3G4SS 2C3OA 4ZJOA 1PYOB 2XY7A 3KNGA 1Q78A 2DPJA 2AT1B 2AF6A 2DB1A 2M8HA 4DOZA 2PSZA 2JVRA 2VDIA 2B4VA 4I69A 4RNHA 2IVYA 4HACA 5B0FA 1EQMA 4OYZA 3WQPA 4UOCA 3BGUA 4C98A 2QLFB 1N5YA 2VH7A 5K8OA 2C3UA 3KMQA 4OI6A 3EYZA 4ZVPB 2FHMA 3OTDA 1HWLA 3VGTA 4P2FA 3V6JA 3FCHA 3KXDA 1V6HA 2E66A 3S7RA 4OZJA 1B0TA 4NMLA 1U1OA 2RVJA 4JI2F 4KY3A 3CCMS 1IJFB 5EWFA 1TKTA 4OJ3A 3FZ2A 1BLUA 1JLEA 4DPOA 4OX6A 4WCEQ 1NZ8A 4XO0A 4XPEA 3HM9A 3R1LA 4X66J 2BJDA 1U8WA 2RT3A 3OVBA 4HACB 4ICLA 2VV5A 4YHHJ 1SH3A 3QWPA 3R27A 3MFIA 2AJFE 4F3QA 4KB7A 3CB4A 4A8SA 2E7VA 3WIUA 3VAKA 7FD1A 1R6VA 1FKPA 1N33F 5KT2A 3SZ2A 2HVIA 5KOXA 2W9AA 3GPAA 4LBPA 2YKNA 2P2CB 4KC5A 4CM0A 1FRKA 2OPQB 1AXQA 3PKYA 3JXOA 5E3CA 3CO9A 4TYBA 2HHHF 1B7YB 3I87A 4C8NA 1TKTB 4Q44A 4U8VA 1WOSA 2CJAA 3J7YI 1WSVA 1HQEB 1KQSR 1ZPVA 1RKJA 4ETXA 2JHEA 3I9ZA 1N6QA 4IG3A 1RACB 3Q2SC 4KGKA 3T3FA 4OI0A 1U2CA 3IWNC 3BSNA 4QJVA 4ICLB 3TJ9A 4WU3A 1KWMA 3L9ZA 2CIMA 2UV8A 5LSLA 3BYPA 2PIIA 3H98A 2GHVC 2NZCA 4A8YA 2CQDA 4WIQA 1XMQF 3OL6A 3DLBA 4WFAQ 1QY7A 1UZDA 3CDWA 1SJ3P 2IRUA 2YKNB 3M8SA 2QSFA 1R8AA 2AQ4A 3VCDA 4BC7A 2R2SA 5KG6A 2MXYA 2B4OA 3M7VA 2HHSA 2PEHA 1SCJB 3VAHA 4WXWA 4IG3B 4B08A 3MR6A 5GVQA 3KLEA 3D66A 1SQGA 3AB2B 1RQ0A 3NGKA 1CJKA 2FVSA 4I7FA 3CXCR 3FEXB 2HQGA 3SFGA 2NQPA 4NASA 3HO1A 3GCWP 3J80Y 5B0DA 4FYVB 2V4JA 4DHVA 2W2NP 5KFFA 3MMJA 4J9VA 4O4RA 5DJBA 2FZGB 5EHHA 3K8WA 1FJCA 2V8GA 1RBAA 2UP1A 2B56A 1X9WA 4KGMA 4RLEA 2JJ4D 3MAAA 1PAUB 3NOCA 2O66A 1XERA 3Q8QB 2ZHAA 3WIVA 1RISA 1DLOB 3FKBA 4B3RJ 2EKNA 2J6TA 2DR5A 1N0VC 3MMAA 1X5OA 4YDXA 2VOPA 1CJKB 3DHXA 2ACMA 3JSBA 4I7FB 1WDTA 1TQLA 3TEGA 4GVBA 1IBMF 3D6MB 1T3OA 4FBUA 1JJ2R 2V4JB 3OFFA 3MD3A 2K1RA 4ZLLA 1Y5LB 1FWPA 4GO5X 1UP1A 4DUZF 3VV2B 2CZ9A 1RT6B 1Q7LB 2KJVA 3N79A 4X4TA 3HHEA 1XNRF 2J9EA 3MAAB 2YXLA 2BRLA 1DTQB 1HWKA 5IWAF 5H9EJ 1WKJA 4MIWA 4TYAA 1SL2A 2F40A 1FD8A 1XN9A 3T41A 1F5CA 3N9UC 4OQJA 3IGNA 1Q95G 1VC6A 5F3TA 3GFXA 4DL0C 3MMAB 4P73A 1GQEA 5C42A 4DUTA 4ZVOB 2ADBA 1SH0A 4LF1A 2BW7A 4NA1A 2Z4PA 2B9WA 3G86A 1B70B 5C2CA 5GAHU 3PKMA 4AQYJ 3VF0B 3I0SB 3POTA 3AA8A 3H90A 1TR0A 4X65J 3HHKA 2DHHA 1VQMS 1WEXA 2N3OA 2VC1A 3RR8A 4ES3A 2PFDA 1DTTA 2XLIA 2CQCA 5FDLA 1DHMA 3NAIA 4JUZA 4L6V3 3NL0A 4HT5A 2RUSA 3IBCB 2H5IB 3VGUA 1Y11A 4ZCMA 1YBTA 5C2GA 4GKKF 3E3XA 1Q0NA 3D2WA 3EXCX 2BQ3A 5EUHA 4B3SJ 1UEVA 3DMJB 4CO2A 3CDAA 1XNQF 2KRRA 1LXJA 5KFWA 3MEKA 2N3LA 2YKQA 2MZQA 2LCWA 3G6YA 2X7IA 4EZ6A 4H4OA 2P8IA 1JNRB 2UU9J 3NBPA 3DDIA 3FCVA 4DPUA 1DTTB 1I51B 3L3CA 2Y9HA 5KT3A 4CO5A 3AH6A 3JQJA 1RZMA 4DG1A 4ZN1A 2LECA 4IDKB 3BSOA 2H48B 4UQGA 2FHOB 4HI2A 4CH1A 1HBMB 3U27A 4YR0A 4TU7A 1KFSA 5KG3A 7FDRA 3W60A 1EKSA 3UW1A 1HNWF 3W63A 2RRNA 1WOOA 4HVZA 2B7CB 3W66A 2QC3A 1HNVA 4F7VA 5CHCB 1IKVA 3NXZA 1REVA 1X8DA 2KT5A 1FE0A 4H4OB 2IJRA 3NBPB 3Q83A 4O3OA 4LFCJ 1NLKL 3Q8UA 1PBUA 5IT9Y 2HQDA 2MKJA 4I64A 1WTBA 3SQOP 2KHCA 2FYXA 4NEYA 2LQ5A 3PYDA 2HGLA 2BJ7A 3A13A 4JI6J 5DDRC 2Y8YA 1XMBA 3NGUA 4TXSA 2XMMA 3E8OA 3BN4A 2DR7A 1HYSB 3CEDA 4DUYF 4DCPB 2BMBA 1T9XA 4CDIA 1REVB 3OJSA 1OY9A 2LDYA 2A18A 2KFYA 4N77A 5AXMA 2XGQA 3R5GA 1MWZA 3DOLA 2EC0A 1ZTWA 2A3JA 2ZOMA 1UA0A 4K5SA 2KRBA 2Z56B 2JZ5A 3AD7C 2J8AA 3LWLA 1FX4A 3VAFA 2XTJP 1D1UA 1D9FA 1UEKA 2ZH8A 3E01A 5L39A 4ZP8A 2RHSB 1SJ1A 3H7HB 3R6GB 3NKYA 2VFSA 3RW6A 4QWDA 2W2PP 2V68A 1U49A 3MR7A 4DSEA 1WI6A 4JI5J 3MPWA 1NPPA 3CMQA 1FKAF 2FJWA 2G9OA 3HKZD 1R0CB 1JLCB 1HNXJ 2HNYB 2CQIA 2F65A 9RUBA 3U02A 3DOLB 5G0RB 2B8PA 4UZBA 1RA6A 4NRUA 1VC0A 5ETVA 3GQCA 3IXQA 1NK4A 2ZDPA 1TV6A 5KFMA 1GMWD 1H7XA 1UWAA 2WBRA 3ITHA 3R2DJ 4KPYA 2HBRB 3CJTA 2C2DA 4O3QA 3E01B 4G1PA 2NCKL 3DLGB 4ECVA 1Y0HA 4F0MA 3PO5A 3GB0A 3UCUP 4B3TF 2OPSA 4DQSA 3DRPA 1S1UA 2CQHA 2R2TA 1F9FA 5F8NA 4KFBB 1MWQA 4BC9A 3MURP 5KFVA 2RDJA 2VD3A 2HS3A 4DV0F 1OPZA 1VBKA 2V6AA 1RUSA 1PJ6A 4F67A 5CD4A 2F8HA 1BQNA 4F2RA 3PW7A 3OUYA 2RF2B 3JSYA 2OPPA 2HNDB 4KO0A 4XPCA 3A8KA 1RTHA 1L3SA 3RB6A 4DV1J 2MDAA 2VG5A 3DRYA 4H4KA 1RTIA 4PXEA 5BYSA 3D5MA 2XSFA 4X84A 2OPSB 1PCAA 3KFWX 5D78A 4B3MF 4HTIA 3HP6A 2NSBA 5KG5A 3Q8RB 3NAHA 1JK9B 2RE1A 4CLPA 1F3FA 2G2OA 2OI2A 4ECWA 3CD5A 2VQEF 1F2GA 4TQSA 4NXNF 4RJVA 1BQNB 5D3GA 1NJWA 1WD6A 3UVJB 3V4IA 2W4PA 3LP0B 2L48A 1UAWA 2GHWA 1FK9A 3LOUA 2QEXS 2BJ3A 5CD4H 2KKHA 1LW2A 1QD1A 3SXLA 4P2XA 5I42B 2ZH1A 1RTHB 4KGVB 1IKXA 5DG9A 1XIQA 2H3EB 4ED5A 5CYQB 3K5NA 3R5AA 1S7IA 1CC8A 2R8KA 2QLXA 1S9FA 3H4BA 2HRUA 2CQ2A 2QYCA 2XYGB 3CJ0A 3MEEB 4DR2F 2OD6A 3IR5B 2KU7A 1AUSL 3A3NB 4UY85 3BQ1A 1TL7B 2HAFA 1K9MT 2FC9A 1SV5A 1MMLA 3TARA 4O23A 4ECXA 5D3GB 2CJQA 3C6TA 4WPAA 4OLPA 4Y00A 2E1CA 2A10A 1FK9B 3D0GE 2J7UA 4PG8A 4J91A 1U1QA 3DC2A 5CA5A 1LW2B 1JJHA 1NK0A 1RAHB 1J5EF 2UXDF 4JYAF 1LWEA 1IKXB 2G1HA 1X9SA 2HWHA 4A46A 2FB0A 5GADU 3RBXA 2PN6A 3HT3A 3PJWA 1YRUA 4LREA 3ETOA 2I38A 3KG1A 2RJZA 2VUGA 4IH7A 1KVJA 4HTJA 1RHUB 2V8VA 2H5JB 4DS4A 2Z2LA 4ZP9A 4UQTA 4X4OA 2CPJA 4NMXA 1RCOB 1FA0A 3AOCA 3TX0A 3RZAA 4HDHA 2O01C 1CJUA 1CEZA 4J9KA 3NP5A 1X31C 1MROB 3HVRA 4N41A 1N5VA 1HWJA 2DH8A 3C6TB 5F3ZA 2HK2A 2AZ1A 3JTPA 4PQUB 3M6WA 1RT4B 1VQOS 3K89A 4MKVA 3CJKA 4FVCA 3MCMA 3CTRA 5HATA 2XB2D 4F4KA 3BREA 3FQKA 2UUWA 3T6BA 4AXJA 5CXTA 2MQLA 2XYPB 4OYIA 4USMA 4UW2A 2VODA 2ROPA 5KFSA 3I56S 3H5UA 2QL7B 3RU0A 1TELA 3SV3A 3BH6B 1S6OA 4Y65A 1RT2B 2RDDA 3R3TA 3IC1A 1CJUB 4IR1A 3LANA 4RO0A 1TUVA 3HVTB 1T9UA 2YX7A 4K0KJ 5ETLA 1SKWA 1FI4A 3RB0A 2NUHA 3D1HA 3UDVA 1V5VA 4O3PA 3J81Y 5GAGI 3V6DB 3ELHA 1P8GA 2CVEA 3RYLA 5AE2A 1X5TA 3FGVA 2MKIA 3K8VA 4UZCA 2Y3YA 3CJKB 4CTAB 5BJRA 2AYEA 2KN4A 4DBQA 4PEOA 2CPYA 2XLKA 2HMIA 3TA2A 3DDKA 2P9CA 3UFCX 5B0EA 4U7UD 4N76A 4O3SA 2FVCA 2XMKA 1WF0A 4GKJF 4B17A 1NO8A 4ZDNA 4ECUA 1QSLA 1RTDB 3OSPA 3IO1A 2E5LF 3P4UB 2UVWA 1GT8A 1NKCA 2AEMA 2Y1RI 5F9NA 3BGFA 3QRPA 2MSTA 2W9BA 4F4AA 1X4BA 1SQFA 4KBIA 3FFIA 3GSDA 4I6YA 4RW6B 1L3VA 3V2UC 3KTQA 4TU9A 1KFDA 2AX0A 2HHXA 2J8SA 5D4LA 3PYGA 2DIUA 5ETOA 2QTWA 1NKEA 4I68A 5KFAA 5FJ4A 3ZNJ1 2KYZA 1EARA 1SKSA 1Y00A 4B3OA 4ZCIA 1FJGF 2OO4A 3BBCA 3RRGA 2L9DA 1DQ9A 3G8QA 1FF2A 3W5YA 2IVMA 2HHTA 2BKOA 2DGOA 2KO1A 1LQ9A 2WSFC 1OS5A 2CJBA 1RCXB 1YHQS 2AJ1A 4O44A 1I6JA 2RSQA 5EGYA 1M5PC 3SCJE 2FZKB 2P6TA 3CULA 3FUYA 2XWYA 2RIJA 1LWFA 2AMCB 1RYSA 3DM2A 3R7SB 3QFWA 4DR5F 3K5MA 3GFYA 1U1LA 3MUTP 2Z30B 1G4CA 1ZAWA 2B9EA 4WF9Q 1KNZA 3OFHA 5A8WA 2DCUB 2MJNA 4MAKA 2HEKA 3FZBA 2V34A 3R7NB 3I6PA 1N36F 3BQ2A 1C1BA 1W25A 3M8PA 1S59A 3NGRA 2HHUA 4EBDA 5LSRA 2FHJA 4DV3F 4JI1F 4RWWA 1MU2A 1HQUA 4M95A 3P49B 1LWFB 3HSJA 3DM2B 4CP5A 4ES2A 2VBZA 2SXLA 1S77D 3VAMA 2BEFA 3I5BA 3ZZ0A 1FO1A 1TK8A 2YPZA 1OSDA 2JFKA 3HSZA 2HRTA 4WYWA 4LT6A 4R5PA 2CQ3A 1IWAA 2R7QA 1G1XA 1ZZFA 2WB4A 1B4SA 3B54A 1R7IA 3LAMA 5FLXY 5DLFA 5E5NA 3NWGA 3M8QA 4M5LA 2RQ4A 5J2QB 4F36A 4NLRA 4WFNQ 2C2EA 1N0UA 4B9MA 4QIFA 2XI2A 1ULRA 1HQUB 3IG1B 4QWEA 4JB8B 5EWEA 2MLZA 3VVTA 3GTYX 3KHHA 3W65A 2B51A 1GX5A 2L41A 3KLHB 3I82A 1J5OA 5HROB 1Q5YA 4JV5F 5D4OA 2B43A 3BR9A 3HFVA 1WJ9A 1UJ6A 1TP7A 2OGUA 3LALA 2DTJA 1EKRA 2ZE2B 3HJFA 1ZOTA 5H9FK 1HI1A 4J9RA 4GKJJ 4EMDA 2CXEA 4IFYA 3KOAA 5IC6B 1F60B 4OV1A 5L9XA 4U7UK 4FNIA 4F02A 2UVRA 3GP9A 1R8HA 2JDJA 3SDEA 1RXOB 2QLBB 1TKXA 1J5OB 3F41A 5CH7B 2OEMA 2G0IA 2HRYA 2E7XA 1N48A 2W4DA 3OXGA 3HI9A 2DNGA 4Y28C 3NY0A 4CO1A 2EEYA 2CNOB 2YQ1A 1KTVA 3LA0A 1XR7A 4FXDA 4B9TA 1VRQC 3W2VA 4P75A 2KZMA 4ECYA 1JLQA 3MM9A 1LOUA 2VQFF 2K06A 3KDOA 1X4FA 2HQ3A 3FQLA 3CJQA 2V4RA 2DBBA 5IV4A 1FNMA 3K59A 3AQPA 1RLCL 1WHXA 3QT5A 3DOKA 1CJVA 2WSCC 2HVZA 2VU5A 4LSNA 3SDEB 2DGVA 4AD6A 1FFSB 5ETPA 2VOOA 1TKXB 3FK4A 1QVGR 4ZVGA 3HD2A 2MQQA 1M1GA 4ZKAA 3M2RA 3Q0AA 3UR3C 4BS2A 3NLCA 5HI7A 4RNNA 1WEYA 2KXNB 2RDIA 2XM3A 1YJ7A 2CJ9A 2CPIA 2YWHA 2ROEA 2YNFB 2LMIA 2GGPA 1QAYA 5IT9U 2XNQA 3SCLE 1N54B 4DR6F 1RJJA 1JLQB 4JI3J 3MM9B 3BS9A 3M9NB 4ZPWR 3UDLA 3T9ZA 3VAGA 2XMJA 3DRSA 1KDNA 3HHLA 1P27B 3NEKA 4J9MA 2HBZB 3DOKB 1CJVB 4A8MP 4RPFA 4YB5A 1WUUA 2HVHA 4LSNB 4MJKA 1T03A 4C8LA 2JX2A 1CPZA 4BBYA 3M9MB 1AFJA 3Q24A 2PMHA 1YZ7A 4BDPA 4EO6A 3EGNA 3M2RB 2MY8A 1RABB 5LMUF 3C46A 3TYTA 2X3DA 3CDEA 1KP6A 2DNHA 1NSAA 4S0MA 5THWA 3CCQS 5IXUA 3G9CA 2IY5B 1BGXT 3EWGA 3OHAA 2XQCA 3A3PB 3GE9A 2GIQA 3BEGB 2LDIA 4ILMA 1O0PA 1GXUA 2ZH9A 4PWWA 3UI3A 1HW8A 3DRSB 5KFUA 3HHLB 1F5AA 1LNQA 4OI1A 5BYRA 2KDOA 4ZVTB 3D6FB 2HSEB 1PSDA 4YQWA 3LPEA 4IG0A 3FEYB 2P9EA 3GONA 1U7LA 2WSEC 2DXDA 1YITS 2AIRB 4WP3A 3EZ5A 3TRGA 4GC6A 2HQCA 4ED1A 3CCTA 4CLSA 4LR9A 4LF2A 2DGXA 2X51A 5MLCV 1Q53A 4USIA 2MGZA 1BQMB 2L3MA 2DY1A 1SC3B 5LM7E 4HR2A 3OSNA 3PIPQ 4B9UA 4Z7YA 2DHGA 3VWSA 1FKOA 3A1YG 4LF5F 3GCXP 1SI9A 3HVAA 4CWBA 4JV0A 1KOOA 4ZIVA 2O67A 3PRVA 2MQOA 2IBOA 1N34J 4UOGA 4C11A 4N8NA 1AYEA 4ZLPA 1FNOA 2MB0B 2XZWA 4NL5A 3RBDA 4YP3A 4CH7A 1SIWB 4DF8A 4ED2A 1KHVA 2LA6A 1GH8A 3HT0A 4ECSA 1QDUB 5E0OA 2OP5A 4HDGA 2MLYA 4LUBA 1SJFA 3MPVA 4ZP7A 3W9HA 3DGVA 1U25A 1VQ4S 4DLGA 3HVWA 4WWSA 1YJNS 3Q8YA 5KG1A 2ACYA 1VHFA 3P96A 3DCAA 2CJXB 5IFMA 2HZVA 1FKOB 4HH1A 3KLGA 2LEAA 5RUBA 4FVMA 4QIVA 2BA9A 1QTMA 1I5OB 1RTZA 2NYIA 2BANA 5BXIA 1K47A 3EJMA 2WVBA 4WP8A 1EAYC 4F25A 4YB7A 4YUDA 3QIDA 3CJSA 2ZH2A 3N4WA 3P5TL 4HL9A 3CVKA 1O8BA 2DK2A 2CQ0A 3HCXA 2RQKA 2AGOA 1M90T 3GU0A 4ZPAA 3TAPA 2HHQA 4PWDB 3FBCA 3BM7A 4P9SA 4OZ0A 1Q5VA 4LVNP 5KFGA 4BWJA 3OTCA 2VDHA 1IN0A 1X4GA 4LSZB 5C25A 4DL6A 5HN0A 4YOEA 4PYDA 3VAIA 4DR4J 1RDRA 2J9DA 1T8EA 1HI8A 3ADAC 2VC0A 2VJVA 1NHVA 2D3O1 2AU0A 1SKUB 4DZ6A 4XDCA 2GJFA 3EICA 1FWKA 4U6PA 4F04B 3VALA 2Y8WA 2W7OA 1HLWA 3KK1A 3M30B 2UXBF 2ZBPA 4KR0B 1VQ7S 3QO9A 1G3OA 2IFXA 4KTQA 5DLGA 1CBKA 2VPYB 2R7WA 3CF5Q 4C0BA 3M9OB 3M05A 1KOHA 2BE2B 4I6WA 1X4DA 2ZDOA 3JSRA 2ATCB 1SH2A 3H59A 1GMVA 2IYIA 1HIYA 1ZBTA 4OZLA 4K4UA 1UJ4A 1U1NA 2R7TA 3MEDA 3BYRA 5IM0A 1HI0P 1U1RA 1S9GB 1NK9A 3ET6A 2DR8A 3BO3A 2GVDA 4W98A 1KVKA 2ZH6A 3HK2A 2D3ZA 3UD4P 4YFUA 1OYEA 3CSKA 3QZ8A 1T05A 2C2MB 5BR8J 1HW9A 3CMES 3KK1B 5JMNA 3M1VA 1B7FA 2NXUA 2D3OR 3NCPA 2RMLA 3QO9B 2NXJA 3EUNA 2FJBB 2OAUA 2V9KA 4URQU 3JB9k 2B5JA 3MTKA 3IRXA 3PIOQ 3CCZA 1EX8A 4ED7A 3N28A 5T14A 1BD6A 4E98A 3MCNA 5IM0B 1BHNA 3DKDA 2BYCA 4GO7X 4DV2J 1RT1A 4A47A 2GA7A 3RAXA 3ET6B 3OL8A 4YR2A 2HLTA 3NGTA 1FXDA 1T05B 3MMCA 1VS3A 4DFJA 3N0VA 4OV6A 4FXWA 3N5BA 1IM4A 2QGFB 4WK1A 1R8PA 4EO8A 4AYBD 3BO4A 4HEA9 4KHPF 2YY3A 1R6YA 4MKAA 2HIYA 4HT7A 2XZDB 4KV8A 1YI2S 1MMDA 3J81U 2VG7A 5F0WA 2ZZNA 5D8HB 3HPOA 3C2PA 1U6FA 1U6BA 1KONA 4WIIA 4WZMA 2ALZA 2ZZTA 1A0OB 1PG5B 1RT1B 1CQMA 1HBNB 3MUVP 2K8GA 5HVHA 4DR7J 5K9FA 1KBRA 2CA9A 3DYAB 2ZM6F 1N32F 5L9NA 2IDLA 2L9WA 3KLFA 4P52A 1EQ0A 3BDPA 1N52B 3JYTA 3MMCB 1U1MA 1QE1B 2BV3A 1BXNA 3JQKA 4EEYA 3HZGA 5LMNJ 4R0EA 2BJ1A 2FJXA 1DJ0A 2APOA 1PJ5A 1YG0A 2XMWA 2V67A 3OR1A 2UXCF 8RUCA 1XEZA 3T5JA 4KV8B 3UWTA 5B09A 2EK6A 2VG7B 2YNIA 4WKYA 2Y1IA 2GO8A 2R7RA 2LQBA 1WTFA 4J5OA 4UUXA 2YNHA 2A0FB 4RR5A 4ZP6A 2PMWA 1X4CA 2WBMA 5KFNA 4WFXA 4DQIA 4DV4F 3ILLA 2U1AA 3HSGA 5G4DA 3Q22A 4RU9A 2CNNB 4DQPA 1FTCA 1FNXH 2AEFA 2MMYA 1S48A 3BGRB 2PDAA 1YVFA 3LUYA 4GVLA 1QSSA 3OR1B 3IWLA 1F2HA 1LW0B 1F6TA 3O3LA 1KRPA 2HFZA 3CMAS 5E41A 2YNIB 1W26A 4LF7J 1FRLA 4K7QA 1O51A 4QQBA 2QSWA 1QM9A 2QLWA 5A6PA 3G82B 3AXMA 2GHPA 5I3UB 4BWMA 4HHJA 3EDQB 2DRDA 1S1VA 4DL2A 4NLTA 5HAOA 2BOAA 4DI6A 1WF2A 2WONA 2Z2YB 2HYIB 1JLBA 2MHNA 3DOMB 3ZC4A 1FRMA 1YWXA 3OJUA 3TA1A 1SVDA 4Z7CA 1HBUA 2DH7A 1RHMB 2IJFA 3D67A 4PABA 3D9BA 3JQMA 2UUTA 2NZ4A 4FPRA 2GMLA 4X4VA 4CIOA 1VR6A 4WTOB 1IQTA 4ZVFA 1SJQA 3MHYA 5HMZA 1IUJA 5DQGA 5GAHI 1XJWB 4LQ3A 5DS7A 1NH8A 9ATCB 3GG1A 2ABYA 2M8DB 3TUJC 4CT8A 4EFAC 2YWWA 4MK8A 3G87A 3I32A 4NXMJ 4FNHA 2M0GB 4ZPCA 1PYTA 4B9VA 1S1VB 2Q3PA 3HZEA 4LF6F 2UV8G 3ZXWA 4JI0F 3U7JA 4QYZK 4YB1P 5HBMA 3W7BA 2W7PA 1MN7A 4ECZA 3PJ9A 3LF0A 3AD8C 3EMTA 3IS9B 5FLXU 1HBUB 1YTYA 4QU6A 2RQMA 3Q23A 2MZSA 3QGPA 1X0PA 2ZFHA 2ZEJA 2UUCJ 3UDEA 2OELA 3MEGA 4DSFA 3LQVA 3PX4A 1RYRA 1Y5NB 4JV1A 3BO2A 2IJNA 2IBKA 1RWOB 1TMJA 5KG7A 2R8JA 2RS8A 1CULB 4X4SA 2Z58B 1PJ7A 3ZZRA 4M5DB 2XMTA 4LF8J 1M5KC 1ZZNA 2HVDA 4IOCQ 1RHQB 4DR3F 1HNIA 4ZPVR 2BKNA 4OZ5A 2BVZA 4H54A 2Q79A 5CYMA 2VONA 5MAOA 1TAQA 3BN7A 4LIWA 1EB0A 2QN6B 4KH1B 2VG6A 2FLLA 2WVFA 3VZHA 4CQ1A 2QA4S 1C1CB 4IOBA 1HMVA 3CC4S 4JI4J 3MF5A 2UUAJ 4C7QA 2E9RX 1R27B 3HHDA 3PTWA 1SXLA 1ZH5A 1H2VZ 3MEGB 3M32A 3AFGA 2YNGA 4N7TA 4F0KA 3PX6A 2CVIA 1FDBA 4OLOA 4OYBA 3Q8SB 1RTJB 1WG5A 5J1EA 4ZJQA 3QIPB 2ZD1B 2E5GA 3HDSA 2O1PA 2B6AB 4DL4A 1YZ6A 1ZYQA 4QR0A 1HNIB 1NRKA 4KGZB 4FDFA 3AA9A 3F44A 4Z2XA 1NUEA 3OD2A 5L46A 3PM9A 1MLAA 1VI7A 1I94J 4LFBF 2KB2A 1WC4A 2DHAA 4RW7A 5H9FJ 3R97A 2X1FA 3PRBA 4QCLA 5D0GA 4ZHRA 4X62F 2I5JA 4L76A 4NLVA 4NYZA 4WFZA 3M32B 2KXHA 2YNGB 5AE3A 3R1HA 1B0PA 1RWKB 2E44A 4NA3A 3SIPB 5J1EB 3HSDA 3C16A 1WF1A 2FVQA 1WI8A 3DGPA 2M7SA 4NI2A 3M2UA 3FRZA 1V3ZA 4KJIA 4CLKA 4JI8J 3QT8A 4Q43A 1BWEA 3T6JA 4ZPTR 2ZOFA 1TFWA 4QR1A 2GVZA 2DNQA 4OZ2A 5KG4A 2OLWA 4GC7A 1W7WA 3QT6A 4CLZA 1AROP 3MGJA 4JP8A 3PXGa 4ZHRB 2I5JB 4LFAF 1NJZA 4K8RA 2UZAA 4ITSA 3PW5A 2EFNA 3BSAA 4NZ0A 3LGNA 3I4PA 4ILRA 2F4VF 1WHVA 3C16B 1IBKF 1VLOA 4ZVEA 1OQ6A 2WZ1A 2MHEA 3IA0A 2DPIA 4RW4B 1H72C 1Y9OA 4NI2B 4JOUA 5IQQA 5ETNA 2GAGC 2FD2A 1TL1B 1VQLS 2H1YA 2GVZB 1F0XA 5B0GA 3VGVA 1FJ7A 4FF2A 2G1DA 2AX1A 1RKIA 2DISA 3D0HE 5KTQA 2FGCA 2KT3A 3H20A 2WVDA 5BYQA 2IDEA 2POKA 1T9VA 2XG8A 4ZVSB 3K5LA 2HQIA 4F4WA 2MZ1A 2A2CA 2OMOA 3US5A 4OX7A 1RAAB 1RWNB 2OPRA 2R7UA 2VHGA 2XHWA 1C0UB 4YY3J 3ZTPA 2YWFA 3H0PA 1AZSA 1C2PA 2VKRA 3TQEA 3UN5A 1IJEB 2OPQA 4JI7J 4U67Q 2E29A 4AL7A 3NRBA 2DH9A 2IA0A 5HP1A 2BM0A 3H2UB 2AKWB 1GXLA 3VQSA 1R0AA 5K20B 1HQEA 4EU0A 2D9OA 3K57A 4IQXA 2R42A 1ZAXA 2YX1A 4HHUA 1WEZA 3AB4B 1XMOF 4DF4A 2LVWA 1Q81T 3CJ4A 4O3NA 2HBYB 4DV6F 3CE8A 3W2WA 3PFEA 3G6ES 2OPRB 4OX9J 4DV5F 4WBFA 3GSIA 1AZSB 4OZ1A 4DV7F 3WDOA 2BX6A 3CCSS 2M3DA 3LW5C 3QBCA 1Q16B 3MM7B 1KN6A 5HP1B 2OMLA 2F8EX 2H51B 3F56A 1R0AB 1D3WA 1Q8KA 1RHJB 1K73T 1VC5A 4D3HA 3RUBL 2RU9A 3Q8PB 2BE9B 4PPDA 3Q89A 2XI3A 2QYGA 5D0EA 4FS1A 4B9NA 3QJJA 1KLMA 2Q1LA 5F8IA 1XR6A 3AODA 2W7AA 3W2WB 1VLYA 1KVIA 5E7OB 1S76D 1SC4B 5IV3A 4LVOP 3HX9A 3MPDA 2GC8A 1YQHA 1RWVB 2BR0A 5LXYA 4J9QA 3N5FA 1K0TA 3DXBA 4X64F 5GADI 2M5YA 2JVOA 1ZA1B 2QFIA 4QWCA 1RAFB 4OHXA 4DR1J 2E1MC 2CPFA 4L74A 4UTGA 2R2RA 2FY1A 3R2CJ 1R89A 4BLGA 2VBXA 2ZBQA 2DNNA 3KUEA 1DLOA 4L72B 2E1RA 1KLMB 1WWHA 2DEJA 4ZCKA 3SYZA 3PO4A 2J5AA 1TKZA 4WU2A 4C8YA 1NJYA 1IKYB 1HBOA 4QW9A 1S79A 4PG4A 1NKBA 1S9EB 2V8HA 1JB0C 1GK8A 1X4HA 2V69A 3FBBA 5SUHA 3WHIA 2ZVSA 1TZ0A 3CIZA 2XY6A 4LF9J 5L1JA 4HYKA 2KI2A 1RT6A 2BZ2A 5FD1A 1KEKA 4OL8A 2CUYA 1S10A 1DTQA 1K0VA 4NOHA 3ZZZA 4PXBA 3V4MA 3L7UA 4K2JA 2BXJA 1C4CA 1CLFA 2XZTB 4Y34A 2R7VA 6FD1A 1TKZB 3OQ2A 2Q6BA 1HBOB 4H4KC 1F1BB 2P9GA 2H54B 2MKKA 2EXUA 4DSLA 1TK0A 2W8LA 2QL5B 2AV5A 3I0SA 2COLA 1WC3A 3UN3A 2BJ8A 3MCSA 3DLLQ 3AOBA 4X4NA 1S1XA 5D4NA 3T5HA 4J9LA 4K4SA 3C15B 3IN5A 3R7BB 1U1PA 4OFZA 2QMUB 3EVWA 2W8KA 1U02A 1OJ4A 1TKDA 3EGVA 4JI2J 3VVUA 3UR0A 2H4YB 1OYDA 2K7KA 3S6EA 2OSQA 4A8OA 1D8YA 3DMJA 3IAS9 3BR8A 1GTEA 2ZBIA 3BF4A 5JVHQ 1FVSA 1H73A 2DNRA 2HK3A 1U24A 1AUDA 4NLDA 1UW4A 3K2YA 5LXRA 5HJXA 2IYGA 1ZPWX 2HURA 3LWMA 5L38A 1S1XB 1NJIT 4DV5J 3MOJB 1N33J 3KKFA 3BKUA 5KFJA 3J7Z5 3PHTA 2CAJA 3T9NA 4HKQA 4DZDA 1WC5A 1Z1ZA 3HJVA 1AA1B 4IDKA 5AJ3F 2VIHA 3AY0A 4EZ9A 1QJHA 2GQ2A 3ISND 1LFWA 2HHHJ 2GQQA 1HBMA 5KT7A 3T1YF 4LF4F 3EZOA 5LT5A 1S1TA 3BJYA 1RAEB 3OBIA 2V63A 4IFVA 5K8NA 4O4GB 4ZLJA 2ALYB 2ZBRA 5T7LA 1PBAA 1NH7A 3IBWA 1IXKA 3DRXA 3JTNA 3M8ZA 2V50A 1UL3A 1Y3KA 3OPKA 3AAWB 4EBCA 2U2FA 5HMXA 1S0MA 4LRFA 1B0VA 4OHYA 5U47A 4ZN3A 1XMQJ 2MPUA 3EPGA 2GMJA 3CWJA 4X4PA 3UE2A 3SSSA 3TQ1A 2ZZMA 3GR0A 3CCUS 1WHYA 1FXLA 4HHHA 4QPTA 3ZO7A 1R3NA 4Q0BB 4XIUA 3FSXA 4CLUA 3GG0A 4I4BA 5KOWA 5DDOC 1S1TB 4IFVB 3D3CJ 3BGLA 1S0VA 2FZCB 3GV8B 1HYSA 1UVKA 5T7LB 4ED6A 2VPXB 3CJ8A 3CPWR 3GIRA 1P9QC 4NCGB 4RW8A 2MY7A 3PCOB 1RU1A 4P2MA 2LXFA 3AXKA 3KG4A 2BQRA 3PDNA 3OTOF 3UO0A 2WOMA 4J9SA 4C8KA 1Y7PA 4IO1A 1M5VC 3MPUB 4PG5A 2OKQA 1Y5IB 3EXYA 4MH8A 4CT9A 3TZYA 7AT1B 1UVIA 3EGZA 3ZZUA 3NNHA 2KH9A 1S5ZA 2B0GA 2NSCA 3KUHA 3MR2A 1SBRA 1EJ7L 5E2QA 2Q43A 3GYXB 4F50A 2WW8A 5M2PA 1IBLF 3VQTA 4RW8B 3PYEA 5HO4A 2C2NA 3WC2A 2HNZB 3P3DA 3KMSA 3HF5A 2CDRB 2HS0A 4UUWA 2XMVA 2AWZA 2AYGA 1Q4RA 5EDWA 1FRIA 1V3SA 1JLCA
chains in the Genus database with same CATH topology
1N33F 2HNYA 2JOQA 1Q8LA 5KT2A 2DGXA 5KOXA 2X51A 4KHRA 3SZ2A 2R7SA 4N8OA 1R8BA 2MZTA 5MLCV 2HMIB 1S4FA 4TY9A 1Q53A 2W9AA 2WOMB 3B4DA 4USIA 2MGZA 2GQCA 3H40A 1BQMB 2L3MA 2YKNA 2YTCA 5G0RA 3OLAA 4KC5A 4NYOA 1FRKA 2OPQB 1AXQA 3PKYA 3PZPA 4V19J 1VIOA 2E9ZA 5E3CA 3HHNB 1HNZF 3CO9A 4TYBA 2RQCA 2DNOA 3KG0A 3LGMA 2HHHF 3I87A 4C8NA 3OSNA 3PHEA 1URNA 5F41A 2EBEA 4ALZA 5GMKa 1J2VA 2AGQA 2NREA 1APSA 3MI7X 1TKTB 4Q44A 2ZJPQ 3PIPQ 4B9UA 2PA3A 3DXSX 2DHGA 3VWSA 1FKOA 2BRKA 3A1YG 2CJAA 4LF5F 3DN9A 1SI9A 3HVAA 3J7YI 2ASYA 1HQEB 4JV0A 1KOOA 1KQSR 3DLGA 2O67A 1ZPVA 1RKJA 4ETXA 1RT3B 2JHEA 2MQOA 2IBOA 3CGIA 1VK8A 3I9ZA 1N6QA 1S6QB 1AFIA 4IG3A 4KGKA 3AHPA 3Q2SC 3ZZPA 3T3FA 4C11A 5DDPC 4OI0A 3IWNC 4N8NA 1UWBA 3BSNA 4QJVA 2J0SD 2VASA 4ICLB 1YJTA 3BZQA 1FNOA 4ZLPA 2M70A 2FLNA 4WU3A 1T7PA 4QU7A 2MB0B 2W9BB 3B8HA 4NZ6A 3IS9A 2CIMA 1Q8BA 2UV8A 3BDEA 5LSLA 2XZWA 1A9NB 4NL5A 4K5RA 3RBDA 4KFBA 3BQ0A 4ZPDA 4YP3A 2PIIA 1VRUA 3FFIB 4CH7A 3OLBA 3G96A 1SIWB 3H98A 2GHVC 4DF8A 1KLNA 4IKAA 4ERDA 4A8YA 2DNKA 1H98A 2ZJRQ 2CQDA 2BOPA 4USJC 5JJBA 1XMQF 5A0YA 3OL6A 4ED2A 3L7PA 3DLBA 3NNAA 1KHVA 2LA6A 4PXCA 5HQ8A 1GH8A 1B64A 1S6UA 4WFAQ 3CCWA 4ECSA 4RBUA 4KKOA 1QY7A 5E0OA 1M5OC 2DNYA 2OP5A 3CDWA 1SJ3P 4K4YA 2IRUA 1FJEB 4HDGA 2DVIA 3MFHA 2YKNB 4LUBA 1SJFA 3M8SA 3MPVA 2QSFA 4ZP7A 1VQ4S 1U25A 2Q66A 1K1SA 1R8AA 1TVRA 4DLGA 3HVWA 2WHOA 1YJNS 2CQBA 4JI3F 2AQ4A 4W90B 2RF2A 3VCDA 5KG1A 2ACYA 4B3OB 4BC7A 4AL5A 1FD2A 2E5HA 2R2SA 2HNDA 2ZH5A 2J9DE 1VHFA 4P6QA 5KG6A 3P96A 3TX8A 4F4XA 2MXYA 2B4OA 4M5DA 5KFRA 3DCAA 1S6PB 2KFZA 3DLEA 5IFMA 1FKOB 4HH1A 3KLGA 2LEAA 1H2TZ 2HHSA 1X9MA 4N5SA 2PEHA 2W25A 4FVMA 1Q7YT 4QIVA 2BA9A 5KFXA 1KR4A 5DDQC 3PV8A 3MXHP 3VAHA 4O44B 4WXWA 1QTMA 2V9WA 5K14B 4ZMMA 1H38A 2NYIA 2BANA 4IG3B 3VAJA 4B08A 3MR6A 2ILYA 5GVQA 3P6YC 4G1QA 1UWBB 5LJ5Y 3KLEA 4QYZJ 4F25A 1PGZA 4YB7A 1VRTA 4HI1A 2KVIA 2FIUA 3K5PA 4YUDA 3AB2B 3TR5A 3QIDA 2ZH2A 1RQ0A 2Z0GA 3N4WA 3P5TL 2DNMA 3NGKA 3CVKA 4HL9A 2PFFB 1O8BA 1VRUB 2DK2A 4C2MA 4LSLA 3THPA 2CQ0A 2FVSA 2AYMA 2F9JA 2RQKA 1C1CA 3V81A 4I7FA 3CXCR 3FEXB 3U1NA 2AGOA 1E6VB 1M90T 3SFGA 2IAJA 1UVNA 1NK5A 2NQPA 1N4LA 2ZC4A 5A0YB 4ZPAA 3TAPA 1NJXA 1VQ9S 2HHQA 3HO1A 2DGQA 1OIAA 4PWDB 2YVSA 3BM7A 4KKOB 3J80Y 5KAKA 4OZ0A 5B0DA 1HD0A 4KSEB 1JWWA 4A48A 4LVNP 2V4JA 2B4UA 2JL9A 4DHVA 4Q7AA 5KFGA 1ZETA 4BWJA 1TVRB 3MMJA 3OTCA 1IN0A 1X4GA 4O4RA 5D77A 5C25A 5DJBA 5KFFA 4A8QA 5A8WB 4DL6A 4PR6A 5HN0A 4YOEA 3VAIA 4NA2A 1RDRA 2J9DA 3LP0A 4RKUC 1Z2ZA 3G71S 5EHHA 3K8WA 1RTJA 4URGA 5F8MA 1FJCA 3QIPA 2V8GA 2ZD1A 5DO2A 1KQFB 3UQSA 2Y0SD 1HI8A 3HKWA 5F8LA 1O5JA 2UP1A 2LA4A 2B56A 1SL1A 5I42A 5KFLA 1X9WA 2HFOA 4KGMA 2B3TB 1SUQB 2B6AA 1YGYA 2VC0A 3DLEB 4P7TA 1C1BB 5KG0A 1RP5A 4RLEA 1HA1A 1U26A 2JJ4D 4X4QA 1NHVA 4MMOA 2AU0A 1CC7A 2O66A 5CYQA 3M8PB 4X66F 2FJEB 5B0AA 1XERA 4XDCA 3Q8QB 3O8WA 4U6PA 2ZHAA 2HWTA 4Y2AA 1RISA 1DLOB 4YHHF 4G1QB 3MMBA 2VFUA 3G8TA 3VALA 5GAEU 4ZCLA 1MU2B 4RUAA 1VRTB 4DFPA 3PFOA 5KFCA 2J6TA 3MEEA 2DR5A 2W7OA 3RB4A 1VQSA 3GV5B 1N0VC 3MMAA 4OI2A 3KK1A 1X5OA 3M30B 4YDXA 4UY8T 3CJ3A 3TANA 2VOPA 2UXBF 4ID8A 2ZNZA 4LSLB 2IA6A 3DHXA 4WE1A 3JSBA 4KR0B 2J6UA 1VQ7S 3M2VA 3QO9A 3V81B 4I7FB 1G3OA 2D7SA 5KFIA 2IFXA 4KTQA 4PXDA 2IAJB 3RAQA 5DLGA 1TQLA 2VPYB 1M5SA 2R7WA 1VFJA 5KFZA 3G8SA 3CF5Q 4C0BA 3M9OB 1IBMF 2YH0A 3M05A 4DX8H 4LMZA 1KOHA 1T3OA 4FBUA 1JJ2R 1UVLA 2HG4A 1NZAA 2G0CA 2BE2B 2V4JB 3MD3A 3OFFA 4MYUA 4I6WA 1X4DA 2ZDOA 3JSRA 3MECB 1SH2A 3H59A 4R5PB 2EFPA 2HFNA 2KFNA 1HFEL 1QVFR 4G3IA 4YMEA 2K1RA 1YJRA 4JV2A 1VQYA 2IYIA 1N56A 4FF1A 1ZBTA 2GJIA 1Y5LB 4OZLA 4K4UA 4GO5X 1UJ4A 2DJWA 1RA7A 4R8UA 1UP1A 4DUZF 1U1NA 1NB7A 4WFBQ 4DL5A 2I2YA 4IRKA 2R7TA 3N6LA 3MEDA 1RT6B 2EBGA 1Q7LB 2KJVA 4RBTA 3N79A 2JRSA 5IM0A 4X4TA 2KM8B 4EYHB 3IRWP 3HHEA 1XNRF 2J9EA 5E3RA 1N34F 1HI0P 2BRLA 3M8QB 2PGCA 3K5OA 1DTQB 1HWKA 3THVA 1U1RA 1TAUA 5IWAF 3UPFA 3KK2B 5H9EJ 1S9GB 4MIWA 1NK9A 3MUMP 2DR8A 4TYAA 3BO3A 4IO9Q 1SL2A 1L5UA 2VFTA 2MKHA 2GW8A 2ZH6A 2F40A 1FD8A 3HK2A 2D3ZA 3UD4P 1XN9A 1K8AT 1OO0B 4YFUA 1F5CA 3CSKA 3MMBB 1Q79A 3QZ8A 2FHKA 1T05A 3N9UC 4OQJA 1S1WA 3IGNA 4MFBA 3RR7A 1ZM2A 1HW9A 1VC6A 2K7JA 5F3TA 3CMES 3GFXA 4F8RA 4DL0C 3MMAB 3KK1B 1GQEA 5C42A 4M94A 3M1VA 2ADBA 4N47A 1SH0A 2OD4A 4WE1B 5KT5A 4C4WA 1B7FA 1IKWB 2NXUA 3M2VB 3NCPA 2RMLA 3QO9B 2D3OR 2NLWA 4NA1A 2Z4PA 2B9WA 3EUNA 2FJBB 2OAUA 2V9KA 4URQU 3G86A 2DGWA 5B0BA 5GAHU 3JB9k 2B5JA 4XAKA 4ZK7M 4Q2MA 2MKSA 2ZBCA 1MROA 3PKMA 3MTKA 3VF0B 3I0SB 3IRXA 3POTA 2EG1A 3AA8A 2QZ8A 1U2RA 1TR0A 2W24A 3PIOQ 2N4CA 3CCZA 2K3KA 5IQ6A 5KT6A 5KFYA 3NGDA 3HHKA 4DQRA 2ASDA 4ED7A 3MR3A 1JXEA 1VQMS 2RD5C 1X4AA 1BY9A 3N28A 1WEXA 4PQUA 2N3OA 2VC1A 3CUNA 1RT4A 3RR8A 5T14A 4ES3A 1BD6A 2EKYA 1DTTA 4E98A 3TAQA 2XLIA 2CQCA 5FDLA 4R8UB 1DHMA 1URRA 2ROGA 2KT2A 3OTBA 3NAIA 4JUZA 3I4HX 2MQMA 4L6V3 5IM0B 2XS2A 3RB3A 1RWUA 3E2EA 2ZC3A 2BYCA 4GO7X 1SL0A 3NL0A 2AP6A 4HT5A 1FVQA 1RT1A 2E1AA 3MDFA 4RW4A 4A47A 5HLFA 5AXLA 2YWKA 2GA7A 4Y0FA 2EG2A 3C6UA 1CQNA 3RAXA 2NUUG 5CZXA 3FMBA 2RU3A 3OL8A 2JSXA 4YR2A 2HLTA 4ZCMA 2JH3A 5LL6d 3OHBA 4IFYB 1FXDA 1T05B 2OFGX 3RAMA 1S1WB 4MFBB 2OSRA 4GKKF 1L3UA 1TL1A 3MMCA 1VS3A 2IRXA 2XCPA 2ZH7A 3E3XA 4MK7A 3D2WA 2BQ3A 2FGOA 3EXCX 4DFJA 3N0VA 5EUHA 3TA0A 4FXWA 3N5BA 1UEVA 3DMJB 4CO2A 3CDAA 1IM4A 4WK1A 1R8PA 3OW2R 2XMUA 4P7VA 4EO8A 3KHLA 1XNQF 2KRRA 4AYBD 1RT2A 3H5SA 2M4MA 1C4AA 3BO4A 3OXFA 2A1BA 3WC0A 2IM2A 4HEA9 1LXJA 2D9PA 2C28A 3JTOA 4KHPF 1UJ5A 2YY3A 5KFWA 1R6YA 3HVTA 4MKAA 1HD1A 3MEKA 2N3LA 2YKQA 3IAM9 1HHSA 2IM1A 2MZQA 2LCWA 3MPYA 3G6YA 1PILA 2M2BA 4DR4F 4HT7A 4EZ6A 3FNNA 1LXNA 4H4OA 4KV8A 3V6DA 1YI2S 2ZITA 1JNRB 2XNRA 1MMDA 2VG7A 3NBPA 5F0WA 4FBTA 4J9NA 2ZZNA 1DURA 1UFLA 4RUHA 1DTTB 5D8HB 1Y3JA 3L3CA 3HPOA 3C2PA 1U6FA 2CZVC 3CC2S 5KT3A 1U6BA 4CO5A 3AH6A 4CTAA 1KONA 4WIIA 4WZMA 2QT7A 2ALZA 4MIBA 4DG1A 3W2VB 2IC3B 1C0UA 1RT1B 1CQMA 1HBNB 2JLFA 2K8GA 3T1AA 3MUVP 5HLFB 4O3RA 2R7XA 2LECA 4IDKB 4I1TA 3C6UB 5K9FA 2GV1A 3BSOA 3DI6A 1YIJS 5K8PA 3DYAB 3J7A1 5HMWA 4UQGA 2XSJA 2D41A 3M6UA 2FHOB 4HI2A 2ZM6F 4CH1A 4DFMA 4B3RF 3TNVA 5L9NA 1N32F 2L9WA 1HBMB 2QMWA 3U27A 3KLFA 4YR0A 2ZHOA 4TU7A 2R8GA 3B4MA 2BQUA 1JXLA 3BDPA 1N52B 4OIXA 1KFSA 4ELVA 3JYTA 3MMCB 5KG3A 4EGLA 1U1MA 1QE1B 2DT9A 7FDRA 1F5BA 1X4EA 1U4BA 2BV3A 3UW1A 1HNWF 2EFGA 2RILA 4EEYA 1WELA 2VBYA 2CPEA 1PO6A 2RRNA 3HZGA 5KFOA 1CG2A 5LJ3Y 3D28A 1GAOA 4CO3A 4HVZA 1VQ8S 1RTDA 4QYRA 2B7CB 3W3SA 4R0EA 1LWCA 2G4BA 3O6QA 4DQQA 4Z37A 1HNVA 2FJXA 5SZTA 1DJ0A 2APOA 1YG0A 5CHCB 2QE5A 2XMWA 2FVPA 1IKVA 2D3UA 1REVA 3OR1A 3D1QA 1JX4A 1X8DA 2KJWA 2UXCF 2KT5A 4AXIA 5M2UA 3U1LA 2CPZA 2AYBA 2CZ4A 2J7WA 3CCRS 1XEZA 1FE0A 2CQ1A 3T5JA 4KV8B 4H4OB 3UWTA 5B09A 3QGGA 1S0OA 1T02A 4E8UA 2EK6A 2VG7B 2YNIA 3CDBA 3NBPB 2GO8A 4NLYA 4O3OA 4WKYA 4X4RA 2KG1A 2R7RA 4NZ7A 3HFKA 3D1OA 2LQBA 2GGPB 3OR2A 1YBAA 5IT9Y 1WTFA 1DAXA 2QA2A 4J5OA 1MNEA 3X3UA 3HHLC 4RW6A 2WTFA 2MKJA 2G13A 4I64A 4UUXA 2WRMA 2YKMA 2ZHBA 1WTBA 2YNHA 3FSYA 2KHCA 4ZP6A 3RBEA 2WBMA 1X4CA 2Y1JA 3DI6B 2OIHA 1DFDA 2PI5A 4F4ZA 5KFNA 2LQ5A 4WFXA 2XSJB 3U1MA 4KE5A 5BR8F 4DQIA