2N4DA

Ec-nmr structure of agrobacterium tumefaciens atu1203 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target att10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
AGLSFHVEDMTCGHCAGVIKGAIEKTVPGAAVHADPASRTVVVGGVSDAAHIAEIITAAGYTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Agrobacterium fabrum str. c58
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu1203
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n4dA00
3HDSA 1YG0A 1Y0HA 2BJEA 2QLXA 3QGPA 3CJKA 1GXUA 3TRGA 1N5SA 2AP6A 2HLTA 1CC7A 2K1RB 2OFHX 2OMOA 5B08A 3DXSX 2RMLA 3HHLB 1AFJA 1U7LA 2CRLA 1FE0A 2XMUA 2VH7A 5B0CA 3QMQA 3LGMA 3DCAA 4OJGA 2W4CA 2PD1A 2AJ1A 2EW9A 2IYGA 5F0UA 5B0FA 1MWZA 2BYCA 2HFOA 2XMMA 2XMVA 1SI9A 2QYCA 3BGUA 2QLWA 3I9ZA 1LQ9A 4OJ3A 2HQIA 2LQBA 2OD6A 1X8DA 2HIQA 3KG0A 4YEAA 5B0EA 4U9RA 3KG1A 2ROEA 4OJ1A 2HLUA 3GZ7A 1X0PA 1FE4A 5B09A 4NL5A 1N5TA 2FHMA 2KYZA 2L3MA 1OQ3A 2ASYA 2BUNA 3FGVA 1SB6A 1SQEA 3KKFA 2KKHA 4A47A 1YRXA 1MWYA 1OQ6A 2G9OA 3UDCA 4F67A 3LGNA 4Y2MA 5B0AA 1TUVA 4DPOA 1KQKA 1Y3JA 2N4CA 1X7VA 2W4PA 3MCSA 5IXUA 2LDIA 2XMWA 2RILA 4FNIA 5B0DA 3TNVA 4HI1A 1IUJA 1VQSA 3BB5A 4A48A 3E8OA 3T9NA 1FVSA 2AW0A 5K9FA 3MZIA 5T7LA 5KAKA 1AFIA 3K7RA 1Q53A 2OAUA 2KT3A 3HHLC 1FEEA 1OPZA 5T7LB 1TZ0A 1CPZA 4HH1A 1W2IA 2XMJA 4QOTA 1QUPA 1XBWA 2GGPA 1K0VA 2IYIA 2ZDPA 2OFGX 1AW0A 1S6OA 3BM7A 2FTRA 1JK9B 3FMBA 1R6YA 1Q8BA 4EFAC 4NPOA 2LXFA 2PGCA 5A6PA 1VQYA 2BJDA 4HL9A 4A46A 2BBEA 4HI2A 2OP5A 1JWWA 2QIFA 2ROGA 4Q2LA 1GXTA 1RJJA 4ZOSA 2IFXA 1APSA 2XMTA 2GFFA 2N4DA 1URRA 3HX9A 4Y2IA 2OKQA 1S6UA 2GCFA 3HHLA 2RU9A 4OIXA 1TL5A 3F44A 1WD6A 4A4JA 1KVIA 2RSQA 1Q4RA 4Y2KA 1YJTA 3IWXA 4DN9A 4YDXA 3HHLD 3HFKA 1Y3KA 1YJUA 1TL4A 1YJVA 2ROPA 4ZA1A 2LQ9A 2ACYA 2K7JA 1FESA 2ZDOA 4FNHA 1Y9OA 2K2PA 4Q2MA 1P6TA 5B0GA 1KVJA 1CC8A 3BN7A 2K7KA 2XMKA 1ULRA 2GV1A 2FIUA 2K1RA 1Q8LA 1TR0A 2GO8A 2KT2A 3HF5A 2GA7A 4HH0A 1FVQA 2FB0A 2Q3PA 2AJ0A 5A6WA 1P8GA 3FRYA 1YJRA 3BF4A 3IWLA 2HFNA 5F0WA 3KNGA 3LO3A 1N5QA 3BR8A 3WDOA 2VV5A 2OD4A 3CJKB 1N5VA 1OSDA 2N7YA 3VTIA 2JDJA 4OJHA 2W4DA 1V3ZA 3BDEA 4DL0C 1FD8A 5B0BA 2GGPB 3TOQA
chains in the Genus database with same CATH superfamily
1M1KT 3W5YA 5D0EA 3K5OA 2JEGA 2D9PA 3X1LB 1P9YA 1TKZA 2QA2A 1IKVA 2AP6A 4NI2A 5LMUF 2Y0BB 2FD2A 4DSEA 2DGTA 2DY1A 1S9GB 2AHOB 4MAKA 5AJ3F 3FUYA 3FK4A 3K5MA 3CCUS 4M5DA 5ETKA 1D8YA 3RUBL 4NLDA 1PJ5A 3MTKA 5C2GA 4LF6J 2YKAA 3HHDA 1UA0A 1FWKA 3GILA 2AWZA 2IYGA 5K8OA 2EK1A 2BEFA 2QYCA 2W7OA 3OW2R 1JNRB 2OD6A 4QWAA 1RHRB 4OZJA 5CCLA 4KQZA 1JQGA 2W2NP 3EUNA 2QA4G 1VGYA 3I31A 1SJFA 5LSRA 3QGHA 1G3OA 2ZVIA 2MZJA 4IKAA 2R2SA 2IAJA 3A8IA 2BKPA 4B02A 3BBBA 1SCJB 1DQAA 1Q86T 5L38A 3IXQA 1H38A 1TFYA 1NPKA 3DOLA 4G1IA 3CXCR 4IRKA 4FVCA 4X4RA 2HFVA 2HNZB 3Q8VA 3J7YI 3G6YA 4DV4F 3N01A 4N76A 3OL9A 1FA0A 3PYEA 5DDPC 3FFIB 3SSRA 3RBZA 1UMJA 2YKNA 3MTJA 2HPUA 5KFFA 2I5JB 2N82B 4CIOA 4ERDA 1MNEA 1ELOA 3OVAA 2ZJRQ 5K14B 2Y1LB 1UZHA 3CCWA 3R5CA 1BQXA 2R7WA 1R8BA 2RRNA 3CJ4A 4QPXA 1KTVA 3C19A 4JV2A 4ILLA 1FRIA 2J76E 3H90A 3R8YA 2G1DA 3H2UB 2V67A 2XMJA 4KHPJ 4LFAF 4CTAA 5I3QA 4X4PA 4Q8FA 1N32F 3W8GA 3CWJA 2FVPA 3FNNA 2WBMA 2PMZD 1URNA 2E1RA 2HVIA 1WUUA 1C1CB 1WEYA 1O6XA 3HFVA 4X84A 3G8SA 3CCLS 1NKEA 1RTJA 5J2PB 3FMBA 3MM8B 1WSRA 5L9NA 4DF4A 1F5CA 1WHXA 5HVGA 4DV5F 3BGLA 3NRBA 2EBGA 4IQMA 2H9ZA 2XO7A 2W7AA 5A8RA 4PXDA 4EBDA 3QQCD 3CDAA 1GXTA 3CJTA 3CVKA 4RU9A 1XC9A 3CJSA 2FDNA 1EP4A 2EFQA 2MGZB 3GMGA 3CCSS 2GCFA 4I64A 2FJBB 4C8YA 1WD6A 1AT1B 1F3FA 2HGLA 1S79A 2XEXA 2PIIA 2BE7D 1Q4RA 2VBWA 4TVAB 4WJBA 3VZHA 2VONA 1V5IB 4DN9A 2QLJB 3C3LA 4C6AA 1YJVA 2XLJA 2DGQA 1WNEA 2NXNA 1RTZA 3UNYA 4UY85 1OPIA 1EKRA 4KSEB 3S7RA 3ZZOA 1KSPA 4DQIA 4ECTA 4WE1B 2FIUA 2KHDA 2NLWA 2RIJA 2IRXA 2VFSA 2WONA 4XIUA 3F0NA 5HK4A 1XTZA 1R27B 1FVQA 3BPSP 1KN6A 2DGVA 4BWJA 2D41A 4ALZA 4O0NA 4J91A 4B3TF 3J7AN 2YWGA 4DDFA 3M4XA 3AXKA 1GMWA 1LWEA 4ER8A 2JJ4D 3AOAA 3D6FB 3TEGA 2HFNA 3T1YF 2AJQA 3H40A 2JC1A 1HLWA 4ES3A 2EFGA 3I4PA 5DDRC 3JTNA 4FF3A 4TNOA 1WJ9A 3SI8A 4B9UA 1CBKA 4Q0BB 3QGIA 1MROA 4NLGA 2XS5A 2JX2A 3LAKA 2GX8A 4K5SA 3WX8A 2M2BA 3PKYA 2W4DA 5E33A 2DEIA 3BDEA 4QJVA 1DFDA 4MKAA 3VHQA 2KH9A 4NLYA 4DV5J 1YJNS 3HDSA 2J6SA 5EN1A 5FD1A 1Q5YA 2CPFA 3ICLA 1RT5A 4LF2A 5J2PA 1UCNA 3D9BA 4ZVUB 1WG4A 4PPDA 4NA1A 3BJYA 2OFHX 4N41A 4LQ9A 5B08A 4LSNB 1PBAA 4NXNF 2EFVA 3HHLB 3RZAA 4MIBA 4V1Ak 2UUTA 2XZDB 1RT2A 1K9MT 4YQWA 4AQYJ 5ETVA 3S6EA 4DG1A 2GHWA 1X5OA 2F9JA 1JIHA 3M8PB 3EWGA 3MI7X 4ZCMA 4D3HA 5JUMA 1RWWB 2UUAF 1RT3B 4LREA 2IVMA 4KFBB 3LALA 1XMBA 1W26A 2MHNA 3CF5Q 3VGVA 4RWXA 4K4WA 4DQPA 2YNGA 4KT0C 2EC2A 4HT7A 1X0PA 4GO5X 3HJVA 3BGRB 4RZRA 1Q82T 1HNWF 1IN0A 1YK9A 4WK1A 4MFBB 4E0DA 4C11B 1WI6A 2J0WA 1JXEA 3PFOA 3H4DA 3TW0A 4ZP7A 4EZ9A 3KNAA 4ECUA 1XNRJ 3CDBA 4A47A 2E7VA 1DTQB 4HHJA 3HD1A 1GMVA 2JH3A 4OX6A 4Y2MA 5DLFA 2C3OA 1Q81T 1N36F 4CZCA 1QSYA 5D8HB 1UPPA 4O3OA 2IAJB 4XO0A 3G6VA 1Y3JA 1S4EA 1KQFB 3CCQS 1YRTA 1RADB 5HVFA 4DS5A 1YBAA 5BYSA 4N47A 1C0UA 3T9NA 1QAIA 2FLNA 1Q16B 3IR6B 1NPPA 1NU4A 4WWSA 3WC0A 1LWXA 1FEEA 2QYGA 3HT0A 2YNGB 4B3RJ 3PM9A 1HNIA 4DPYA 4ZVGA 1W2IA 3E51A 2R3VA 4DZ6A 4NEYA 2UVRA 3RU0A 4IDKB 4ZIWA 1K0VA 1RT7B 1KQGB 1UAWA 1VC5A 2CZ9A 4DL6A 2YNHB 3RAXA 2KFZA 3LF0A 2F65A 3MEDB 4O3PA 5IT9Y 1HA1A 5IZHA 3M8PA 1UJ6A 5IFMA 4ILMA 1EARA 4ZP6A 4C7QA 4OX8A 4QR2A 3ITHA 4RR5A 1A9NB 1IWGA 2M88A 3GV8B 1M5SA 2CNNB 2KB2A 3DRYA 4IYQA 4ELTA 4TKTA 1CJUB 4JI6J 2JOQA 1J5EF 4X2BA 5IWAJ 4RBTA 3PR5B 3L9ZA 1PYSB 4PWUA 5FDLB 3RB3A 2HZCA 2OIHA 1N33J 4ETXA 4KPYA 4IOAQ 4QWBA 1D9DA 4F3OA 2LQJA 4AYBD 3I55S 2AJ2A 2BW2A 2AYMA 3F41A 2J0XA 4CRJA 1FO1A 3DU6A 1S99A 2HNYB 3DDNA 4DFKA 4H4KA 1SH3A 1F3VA 1FWPA 1GX5A 1NEEA 2K2PA 5F8IA 1F9EB 1X4AA 4M63A 4OZ0A 3DOMA 3EGZA 2LU1A 1MSWD 2E5JA 2K1RA 1B0TA 4CO4A 2ZH1A 1CJVA 1LXNA 1RWNB 4TY9A 4WTOB 1RWUA 4DV2F 5G0RB 3R7SB 1S0NA 4CLWA 4LF8F 1Y5NB 3M7VA 3BGOP 4XAKA 1W2BR 3NAIA 2JHEA 4IG0B 1S57A 4I69A 2KI2A 2AYBA 4HACB 2YQ1A 2WONB 3BR8A 5CYMB 4F2SA 3QWPA 3J81U 4NLVA 1VRTA 2KM8C 5LMUJ 4ZJLA 1U1MA 1IKXA 5HVHA 6FDRA 3BPDA 1U1RA 5HI7A 3H2VE 3OBIA 5KFCA 4M5GA 4OJHA 3MURP 4M5KA 2N3OA 3RAQA 2CJ9A 3Q8QB 3G9CA 1F1BB 2MZSA 5B0BA 2GGPB 3CJ5A 2AJ4A 1X4GA 5E3AA 5E3CA 3TOQA 4XPEA 3GFYA 2XLIA 4TU8A 3UVJB 1ZM4A 1RAFB 1GX6A 5ITHA 2XY5A 2V69A 2GJFA 2CDRB 1NK5A 1N6QB 2E9TA 2PO4A 1FNOA 3GYNA 3KHHA 1HBNB 2EBEA 3OUYB 4KKOA 3P96A 1BMQB 3D54A 4LRCA 5IM0A 1X4BA 1U7LA 1CS4A 4P71A 1PCAA 1OSCA 1CQMA 4N56A 4NMLA 3ZXWA 4PG7A 3TWZA 5HP1B 1CJUA 4NMXA 4WFXA 4P7VA 3D3BJ 2DH9A 6AT1B 4C8OA 1OY9A 2RUSA 1KFSA 1X4EA 3MPVA 4OJ3A 4V19J 3I5AA 2UUCF 1KLNA 3C6UB 3ZO7A 1HQUA 4ED0A 2ROEA 2DVIA 1HL6A 3RAMA 5H1SV 1VK8A 2FJEB 4R8UB 4DV4J 1UVJA 2XHCA 4IDKA 2XS7A 1D1UA 2HQDA 1G1XA 4LUBA 3I96A 2ZZTA 5F41A 2QRRA 2RQMA 2DXFA 3GJTB 2W8LA 2RNEA 2DR7A 3C15A 4B9TA 2B43A 4FPIA 4K4ZA 2HNZA 2W9CA 3NWGA 3H2LA 1TUVA 4NCGA 3SFUA 3CDUA 1VFJA 2CQ3A 4WTYA 4YUDA 5E3QA 3M1VB 4N5SA 3ZNUA 4BC7A 4F4XA 4X4TA 4P73A 2AQ4A 2VB6A 4FNIA 1Z2ZA 2YQ0A 4DV2J 3SZ2A 3JB9k 1S72S 4I4BA 3JSMA 1RWKB 4Y2AA 1E6VA 1FVSA 1RHQB 1XN9A 3G82A 3MZIA 3Q2SC 5LSOA 4LF5F 1TVRA 5KFBA 4UT4A 4FKXA 3PIOQ 4DQRA 1ZS6A 2KVIA 1X9WA 2E5IA 5HMYA 2VPWB 3W1YC 2G2OA 4U6PA 3THTA 2DH8A 2WSCC 3KLVA 1HHTP 2ZDPA 4WKRA 2MQLA 2OPPB 3Q22A 4K7QA 4WYLA 3K58A 2CJYB 4O44A 2E29A 4G1QB 3D2WA 1WOSA 1VQYA 1IKYB 4NLQA 4MT1A 5IC6B 4EUVA 1RACB 1YSJA 2CQ4A 4B3SF 2EKYA 3RBXA 4OYMA 3SDEA 4DR5J 3QJJA 4DR4F 4JYAJ 2CWXA 3EZOA 1U45A 3HHLA 2RH3A 1S1XA 2GQQA 1JKHB 3R2DJ 1N8RT 2OH2A 3Q86A 1PC5A 2E5GA 3QT7A 4Q7AA 4ZN1A 1XMQJ 1R7IA 3SMZA 2WSEC 4LF9F 3PYFA 4IH7A 1FESA 4NZ6A 1U26A 1SVDA 3OJSA 5JXSA 4Q2MA 3R97A 4UUXA 1U0HA 1U49A 3ET6B 2O3DA 3FC9A 1J5OA 1W25A 3QNWB 2OLWA 5KT5A 4DSKA 1IQZA 2GO8A 2VG7A 1P1LA 1DLOA 1ZPWX 4NYPA 2UU9J 1Q8IA 3QBCA 1C2PA 3W9HA 2A3JA 1GTEA 2VKRA 4QQBA 3IS9A 3CIZA 1UEKA 2FZCB 5M2RA 2VA3A 1KOOA 3UO0A 4KIAA 3ZZPA 2Z2MA 3SFGA 3SSQA 4MKBA 4ZLJA 1LW0A 2CQDA 1WC0A 1BQNB 1WACA 3R7BB 1FXRA 1RHKB 5HQLA 4RNOA 1QE1B 1U1NA 3DRSB 2V8PA 4J37A 5FLXU 1JXVA 2X3DA 3I0RA 2CYYA 1JX4A 2DISA 4DPUA 4QW8A 1HNZJ 4C8NA 1R8AA 3GIRA 3O6QA 4DI6A 5D6GA 4LQ3A 2ZOFA 2NCKL 2ZOMA 5BJRA 2QLXA 3IRXA 4RW4A 1GK8A 3AQPA 3GU0A 3Q83A 4DV7J 4F7VA 2DHHA 3R3TA 4K2JA 4OYAA 1WEZA 5K5MA 1S7HA 1YJ7A 4EEYA 1EQ0A 1RHMB 2CIMA 4X4UA 1Q79A 2W2OP 1H2VZ 2VG6A 2B7BB 3IO1A 2MKKA 4GC7A 1T3OA 2L41A 2CRLA 2RHSB 1OY6A 2XMUA 4YR3A 3KLIB 3FSXA 4B9MA 4NXNJ 3KLEB 1FKOB 2XWYA 1HQEB 4TYAA 1FWLA 4CLKA 1IBMF 4L75A 1KWMA 1S48A 4NZ0A 3MXHP 2BYCA 1AB8A 2HFOA 1JLCB 2RHQB 3O44A 5AXMA 3TAMB 2H4WB 3KG0A 4ZMMA 4YEAA 2HG4A 3C2PA 2Y8WA 3DLBA 4BC9A 4PXEA 2V2KA 2NXCA 1IVZA 1TL3B 3OR2B 1XNRF 2IBOA 2L3MA 3A8EA 3AQOA 4QYRA 3G86A 1OQ3A 2ATLA 3E2EA 3T1AA 2BX6A 3K5LA 2PMWA 3OT9A 3TVYA 4ZLLA 4JI5J 2JFDA 1RWXB 2IJNA 2V68A 1PKUA 1LK7A 1U09A 5F8LA 1LWFA 3W65A 5KFWA 3MCSA 1NH7A 1X7VA 1Y5IB 5L46A 5D3GB 2HMIA 1HI8A 2W2MP 1F5AA 3K17A 2XI2A 2HQFA 2ABYA 3NGKA 2J8AA 2SXLA 1SXLA 4ECWA 3NEKA 5K9FA 1GH8A 3FSIA 3H4BA 3HKWA 3UW1A 4NA2A 3BSOA 4YS2A 1MU2B 5I4MA 4M95A 4F02A 3HHLC 1CQNA 3R6LB 4I0WA 5KG1A 4KV8A 1FDNA 1S0VA 3MEEA 3B8HA 3W9JA 1V6HA 3IRXB 1ZBTA 3MM6A 1X4HA 3W2VA 4QOTA 5T14A 4Q45A 1UA1A 1QUPA 2ZBRA 1XBWA 3BR9A 3C6TB 3OFFA 3OXLA 4AUKA 4F36A 4DS4A 1N0VC 2PEBA 3IMQJ 3MM9A 4RU2A 5CQGA 1LKZA 1F6TA 1KEKA 3T5HA 3OTDA 5DZ7A 2XY7A 2L9DA 3VGTA 1S10A 4DL4A 1BD6A 3TJ8A 4NX9A 5CHCB 4X65J 2YVSA 1R0AB 3BH7B 2HS3A 2V8HA 1GQEA 3MD1A 3GSIA 3Q8YA 3I4HX 1MWQA 3MPDA 5DJBA 1RBAA 2UXDJ 2XSJB 2GFFA 4ZIVA 3CJ0A 2D74B 2IY5B 2E1CA 1S9GA 4USHA 2GJIA 1NPRA 3DOKA 5GAEI 1EB0A 2PSZA 3DC2A 5HBMA 1KVIA 1SUQB 3HD2A 4Y2KA 1Y10A 1NM2A 1M0SA 1T02A 4NLWA 4CLLA 4YR0A 4MJKA 2NXJA 3KYLA 1G2EA 3M05A 2ZKUA 1BHNA 1G7CB 1LWCA 2QZ8A 5E0OA 3K5NA 3AY0A 3NGSA 1BC6A 2B3TB 1I94J 1DBDA 4HLBA 3OFGA 3M8ZA 2ZH9A 4PKDB 2B9XA 3H0PA 3I0SB 2ZE2A 1DAXA 2JL9A 1RAEB 1RTIA 3DGVA 3QGGA 5D4NA 3CMAS 4DV3F 1TQLA 4BDPA 2DJWA 2FZGB 2QFJA 4Z7YA 5CABA 1SC4B 3MEGB 3JSBA 3O8WA 5D15A 3VZIA 5GAGU 4JI2J 2HHVA 3IWLA 1NJWA 2UVVA 2LXUA 5F8JA 4HTJA 1S1WB 4FZVA 1TKZB 3WDOA 4JI7F 4PQUA 2NYIA 2RRBA 4KH0B 5T41A 3DOKB 5E3PA 4LF7F 1VJWA 2ILZA 4NASA 1HW8A 2J5AA 3CDEA 3ILOA 3MR7A 5DQIA 2IM3A 1FDBA 1HR0F 1FNXH 4I56A 4MH8A 4DX5A 4LFBJ 2KN4A 4NLUA 4B3MJ 1R0BG 2AMCB 3TUIC 2RF2A 3O5TB 1Y11A 4TU9A 1M90T 2K8GA 2J9DE 5DLGA 1Y7PA 1C1BB 3KLGA 5ETRA 4G1PA 3L3CA 2AF6A 3K89A 3QLHB 4B08A 3M32A 3RRGA 3AHPA 3DI6A 3OTBA 4CH7A 1KDNA 1T05A 3GFZA 1EETA 4PCQA 2W9BB 4DCOB 2M4MA 1ZZNA 5AE1A 2VOPA 1BQMB 1LW2B 2LVWA 2U2FA 3ONQA 2HWTA 5EUHA 5DG7A 1HBUA 1WEXA 4ZVOB 1XK8A 3US5A 1NB2A 1M5KC 1K1SA 3OFHA 1JLQB 3VGSA 3ZC4A 4K0KJ 1FJGJ 3BZQA 2ZJQQ 4U9RA 1R8PA 4CH0S 3U27A 1SIWB 3Q8PB 2RQKA 4DCPB 1M5PC 1REVB 2GMLA 2UVWA 4C3KA 3EVMA 2RE1A 1D3WA 1VMBA 3I82A 4FPRA 5HN0A 4DN0A 1JLEA 3H5SA 3KKFA 2QA1A 2HIYA 3W2WA 2HFZA 3C6UA 2IVYA 2WOMA 3HFZB 1Z1ZA 2N7CA 3GIJA 4OLPA 3HLUA 1IJFB 1VYAA 4LBPA 3RB0A 1IKWA 3TI0A 1WF0A 1FDAA 2DH7A 5ETQA 3VV2B 3CIMA 3K57A 1TL3A 3ISND 1FHTA 4LSLA 4LFBF 3HSGA 2KG0A 1NK6A 4L3KA 1D9FA 5IT9U 1QSLA 3M8SA 3MCMA 2DR9A 1Q53A 1WC1A 3P49B 3OUYA 1KNZA 2V4JA 1WC5A 1B64A 1UWAA 2ALYB 2RS2A 2UUBJ 2M5YA 2HGMA 3IM9A 3NGDA 5J2MA 4P6QA 3BH6B 3M6VA 3HHEA 1FXDA 4OL8A 1OYEA 3ETOA 1JLGB 2F1FA 2GVDB 3FVYA 5I42B 3OL7A 2OPSA 3SCKE 3KK3B 4B3SJ 1S6OA 2ZH5A 3R5GA 4IFYA 3BBCA 2DHXA 2Y0SD 3BKUA 3MCNA 3IBWA 3O2IA 2KYXA 1N34F 3QLHA 3DLEB 1S76D 4UZBA 3TJAA 2YKMB 4PZVA 4TY8B 5BR8J 5DGAA 3R1LA 1H72C 3TR5A 4DSIA 5HROB 1AZSB 1FRHA 3ZZ0A 1JLQA 3AA9A 1OYDA 1SJQA 3C46A 3HM9A 2DGUA 1S1TA 1UETA 1HBMB 2E5HA 3F56A 2R2UA 3CCJS 1VQ6S 4O4GB 4C8LA 2CPZA 1QJHA 2ACYA 2ZDOA 2XZTB 2KRRA 2GQ2A 2UXBJ 5KFVA 2RVJA 2PDAA 1ZZFA 1S1UB 2KT2A 5RUBA 1BE4A 5GAHI 3HF5A 1TKXB 2OPRA 4KGMA 4DUYF 2KHCA 4RO0A 1YITS 2Z2YB 2AJ0A 2ZE2B 2YTCA 2VL1A 3IAS9 3HI9A 4HEA9 3E01B 4ILRA 1LFWA 3IFEA 2B9YA 2WRMA 3KJFB 5HMWA 1IM6A 1ZTWA 3W60A 4X4NA 1U2CA 5KFOA 1SJ4P 2BM1A 4R0EA 2UVUA 3CJ3A 2R42A 5CZVA 2OD4A 2WVDA 5KG2A 1EX8A 4YHHF 3PR4A 2XSFA 3J81Y 3CC2S 1JB0C 3X3UA 1U1KA 4FYYB 4WXOA 2QTWA 2IRYA 3EPIA 2HHHF 2AZ3A 2M70A 5EGYA 4IOCQ 1V3ZA 1XEZA 4J9NA 1IKYA 4A8SA 1RXOB 4CWBA 4DMZA 1RWOB 1NO8A 3PRBA 3QGPA 3DXBA 3AA8A 4KHRA 4KO0A 4RW8B 3PX4A 4F0KA 3N28A 2YWWA 3Q0AA 4DFMA 3NXZA 2CJKA 5E41A 1VQPS 1RE1B 1RUSA 2OMOA 2Q6BA 2BKOA 4FS1A 2Y9HA 2HHTA 3NAHA 4P10A 2MQPA 3CCMS 3UD4P 2JZ5A 3MR5A 4X66F 1VS3A 4CLZA 3CUNA 4EYIB 1N33F 1HNVB 5DM7Q 5IC4B 2B6AA 2M8HA 1VBYA 2VHGA 3DCAA 1YBUA 2GHPA 4WF9Q 1F9HA 4K8RA 3V6DA 3MD3A 4ETZA 1CVJA 2F8EX 4P52A 2W8KA 2GAGC 4LRBA 4KV8B 1FRJA 2LFVA 4OI4A 4E8UA 2HBRB 3GZ7A 1FE4A 2C3MA 2EFPA 1CJKB 4DF8A 1R0AA 3M1VA 1FRLA 1N5YB 1CJTA 1LEOA 2MYFA 4DLEA 2UV8G 1HNXF 1CLFA 2BJ8A 2K06A 1DJ0A 1HARA 3L7UA 5A76A 1FRXA 3CTRA 3OHAA 4K50A 1MWYA 4F67A 2DT9A 5JVHQ 4C9DA 2IRUA 3LGNA 2HMIB 4FF4A 3BQ0A 3BV8A 3I32A 4KGXB 4HYKA 4LFCF 3B82A 2RQ4A 2MKYA 1U47A 3TP2A 2KFNA 2LDIA 2VD3A 4G6VB 2VBZA 5IQ6A 1SPBP 3P5TL 4DUYJ 2XS2A 2ZZMA 2RUGA 3R5JB 1VQSA 4WK3A 5H9EJ 3LWMA 3MAQA 2VBXA 3K5PA 4IFYB 1KP6A 2MQOA 1ZM3A 3N0VA 2IM2A 3DLLQ 4LSNA 4LF6F 4KAIA 1N0UA 2HWIA 3FKBA 4RW7B 2HGNA 1Y5LB 5GMDA 2DHAA 4DBQA 1BWEA 5D77A 1SC6A 1IM4A 4NLTA 3HVRA 2B4OA 3PG9A 2GNKA 2XG8A 4RBUA 3TEHB 3Q8RB 2I8EA 2RQCA 1RCXB 1FK9A 4X65F 3J80U 3CCES 3D0GE 5KG4A 3UI3A 4DR2F 1R3NA 4C0HA 3AT1B 4DR1J 1JJHA 5EX3A 3MOZA 4HL9A 4F4KA 4HI2A 2OP5A 1T9TA 4F0MA 1HWKA 5IT4A 5KFQA 4Q44A 2V0NA 1RJJA 4QIGA 3MDFA 1RTHB 1NMEB 2C42A 1KKHA 1URRA 3EVOA 4M5JA 4KHPF 2HVZA 3NS7B 4WP9A 4M5MA 2BANB 2A2DA 5KOWA 2HS4A 1MMDA 1UEUA 2BOPA 3C14B 5DETA 3H25A 1BXNA 4Z37A 1TL4A 5J1EA 2B9EA 1RHUB 4FNHA 4P2FA 2BJ3A 1NK8A 2A10A 2HBYB 3MMBA 1T9WA 2IMWP 4DR7F 1KVJA 4S0MA 2AIRB 3ZZYA 1HMVA 1Q8LA 3HKZD 4CLSA 2BJ1A 2KDOA 4ZPDA 4YB7A 1JNZB 2IC3B 3GYGA 5HJYA 2QL9B 4F2RA 2ZH6A 3QIPB 2P5VA 1AXQA 3QT6A 5CA5A 4URQU 5DM6Q 5F0WA 3KJVB 3KOAA 4AL6A 4YMEA 2ZH4A 1GMUA 1U25A 3KUHA 3LO3A 3M9OB 1N5QA 3AJ1A 1RT4B 2V94A 2VV5A 3KWMA 4DEZA 1YJ9S 4LIRA 2XC9A 1OSDA 2FJXA 1K1QA 1QY7A 1UFLA 2DNRA 3ENVA 3RRKA 4O3QA 4BS2A 1JXLA 2HVHA 2I9SA 2VF3A 3DKDA 2LQ8A 3EE3A 1SKRA 3IS9B 4X64J 2B0GA 5KG3A 2NYHA 2ZH8A 3PV8A 1DTTA 4KB7A 4XK8C 1GXUA 1J2VA 3IBFB 2OUGA 3CW2C 3L95X 1HW9A 2BVZA 2DNGA 1NZ8A 3DLGB 3FEZA 1CC7A 4B9VA 1ZA1B 4PUOB 2IDLA 3GJRB 5U47A 4Y00A 1VBKA 2MDAA 2KFYA 1SJ3P 1ZAVA 5IV4A 2RDDA 2YNIB 4EU0A 3PVXA 2W2QP 3D67A 5B0CA 2LU2A 3EMTA 5IT0A 4Y6IA 2ZNZA 3LGMA 4Y3CA 1S9FA 3U7JA 1S1XB 2CFXA 1MWZA 2XMMA 5GAHU 2N3LA 3PTWA 4ENOA 4LRDA 3EX7B 1LQ9A 2M8DB 3ZNJ1 1XWLA 2VPYB 4NRTA 3M9MB 1PIEA 4NXMJ 2IHR1 3CD6S 3W8PA 4A8YA 1V3SA 3RR7A 1HKAA 4AXIA 2FHMA 4YDDB 3UFCX 1E6VB 5KFEA 2WVEA 4QZVB 1AUDA 3FGVA 3ZTPA 4CNYA 1FFWB 4KRWA 1U6FA 2XSJA 1HI0P 3D3CJ 2KKHA 4EO6A 2GO9A 1OQ6A 3NOGA 4OQJA 1AROP 1GNKA 2O66A 3CSKA 3E3XA 1BUXA 3VAJA 3ILIA 4MFBA 1S6PB 1SBRA 4O3SA 1TKTA 3TUJC 2C3UA 2ZFHA 4DX8H 4JV5J 1IQTA 3PEJA 2MQNA 1WSVA 2WAQD 4X64F 1S9EA 5T7LA 3HVTA 1H73A 4AQYF 3J7YU 1RWPB 2CJXB 3C6TA 2V4QA 1OWXA 1TZ0A 4A8WA 4Q43A 3DLGA 2C2DA 3D6TB 1T95A 4AXJA 1TL1B 1OY8A 4ED5A 3RGIA 2V34A 4W92B 4TQRA 3A1YG 1N36J 2V2VA 2UUBF 3TZZA 1YJWS 3MWBA 1TK0A 2MB0B 4FBUA 2FJWA 3A3OB 1H74A 4IR1A 3D66A 5KT6A 2KJVA 4M5HA 4ZCLA 2FHJD 2H65B 4EFAC 1VHIA 4K59A 5BR8F 5SZTA 1SKWA 1HBNA 3IP0A 3KHGA 3UCZP 4ECQA 1LWFB 1TKXA 2YH0A 3CCZA 3SV4A 3SCJE 3GONA 2R7XA 3JAMY 3RTVA 4YR2A 3KJQB 3LA0A 2NZCA 1TK8A 2ROGA 1HQUB 4JI8F 3KJVA 1HPZB 1SKSA 2W1BA 2OEJA 4QR1A 1GFWB 4ED1A 4PWDB 2OKQA 3RB6A 2G2ZA 3UDEA 1NK0A 3UWTA 1NAQA 4OI1A 2IBKA 1TL5A 4IRCA 1S1TB 4NLPA 1MG7A 1YX2A 1IKXB 1RYRA 3HHLD 2WW8A 1ICEB 2CPJA 3C16B 5I3PA 2LQ9A 3T1HJ 2DITA 4CH1A 1Y9OA 7FD1A 3GIMA 1JLCA 5J1EB 2IIHA 3ZTOA 5GAGI 2UUWA 3Q89A 3TYTA 5HATA 3C14A 1N6QA 3MCOA 4KTQA 1TR0A 4F4AA 1J27A 2OELA 4IOBA 2HAFA 1UVMA 2PFDA 2MXYA 4YFUA 4ZCKA 1RHJB 1EJ7L 3QIPA 3NG8A 2ZBCA 2DR5A 4R25A 2DD8S 3GFHA 5KG0A 1YDLA 1FT8A 5C7PA 4DR3J 1IR1A 2GW8A 4ANDA 2ASDA 1H0HB 2AX0A 1HIYA 2G2YA 3VVTA 3GJQB 4PG6A 5DZ6A 2W9AA 3PW5A 2FLPA 1SJ1A 1RZMA 3GP9A 3D0HE 1X5PA 3HVWA 2GQCA 4RW4B 3W64A 4AD6A 3QRRA 5IWAF 1ZYQA 2NREA 2N7YA 1FK9B 1G4CA 1FJCA 2KU7A 2V4JB 4IO9Q 2PA8D 5A8RB 4N7TA 1WOOA 1YRUA 2BM0A 3EXCX 2V6AA 3G2XA 1YG0A 4C8ZA 1S6QB 3DNCA 5FDLA 1QE1A 2FLLA 4HTIA 2CVIA 3ETMA 1UPMB 3QATA 4OV1A 5KFLA 2EEYA 2Y1IA 3NS6A 2HHPA 2D3UA 2M3DA 2HNDB 2P6TA 4QBUA 1L5UA 2VFVA 2EFOA 1FE0A 2MSSA 2HZAA 2VH7A 2O1PA 2HNYA 3FBCA 4DV1J 4B3OB 2R8GA 5H9FJ 4I2PA 4FXDA 4R5PA 3TAPA 2RDJA 1J5OB 2AYEA 3ZFVA 3P6YC 3TVKA 1U8SA 1HI1A 2OPQB 2QG9B 1Z4UA 2HQIA 3M2RA 1X8DA 3SCIE 4BBYA 3H7HB 4NE9C 4LJMA 3D4JA 2FY1A 2P6SA 3TZYA 3P4UB 3FFIA 3HPOA 1O51A 1U24A 1N5YA 2IA0A 4I1TA 4LFCJ 3H42A 3HSDA 3R27A 4BLGA 1WG1A 2AEMA 3NS5A 1SB6A 1RKJA 1SQEA 4G3IA 1T11A 5AT1B 1NUEA 1X9MA 2K3KA 3MUVP 5HLFA 4ECZA 2RDIA 3U1LA 3DGPA 2YNHA 3BKTA 3MAAB 1YQHA 3DI6B 3NCPA 3KLGB 2AX1A 2YY3A 5IXUA 1QLNA 3VF0B 2F3JA 4GVLA 1NK4A 1RI7A 2RAQA 3BBFA 5L1JA 4OHYA 2XGQA 4FYWB 1RB0A 2P9EA 3DRRA 1UVKA 4IRDA 2POKA 1HR0J 4P7TA 3AD7C 3TA2A 1KFDA 1KBRA 2YWFA 4LSZB 4OHXA 1U1LA 2NUUG 2FVQA 5C25B 5KT7A 1WTBA 2AZ1A 2V8DA 2VBYA 3D1OA 2WVBA 3MFHA 2ERRA 4FF2A 3V81B 2JNJA 4OYXA 5A8WA 2VA2A 1ZH5A 2AEJA 2C2NA 2DCLA 3V6DB 2OFGX 3T5KA 4B3TJ 2R7RA 1X5SA 1IKVB 4NI2B 1U6BA 4WXWA 1R6YA 1VOMA 4FBTA 4NPOA 1WORA 5CAAA 1R31A 4DFJA 1H2TZ 2C2EA 4QIEA 5A6PA 4LRAA 4QU7A 4HVZA 2A2CA 5LJ3Y 1JWWA 2QIFA 2ZEJA 4TQSA 1IR0A 2Q66A 2MZTA 1T0TV 3THPA 3EDQB 2XYPB 4F25A 2CQ1A 2O01C 1S6UA 3EYZA 3EXYA 4OZ1A 3PX6A 2QC3A 4JI3F 3AB2B 1HHQA 1S1UA 2YNFA 2M0GB 4WFAQ 1JLAA 1VHFA 3IWXA 2X1AA 3CULA 2GMHA 2XZWA 2BOAA 1PAUB 4WFYA 2CJAA 3CCVS 3HSZA 4ZPBA 2R2TA 1HFEL 2VG5B 5EWEA 1VISA 4UW2A 2ZWOA 4C48A 3IN5A 4DV6F 2V8GA 3BN7A 3IR7B 3SQGB 3ZTSA 3GTYX 4FVMA 2DCUB 4A8KA 4QR0A 4DUTA 1TAUA 2EPIA 2FB0A 3DRXA 5ETSA 1DZ5A 1H2UX 4K2XA 3N5FA 2DNQA 3OSPA 3V5RA 3BF4A 2DGWA 4JV1A 1YZ7A 3B54A 3UN3A 5H9EK 3Q8SB 4ZCIA 2MTLA 1QM9A 4OZ5A 1RLDA 1T94A 2JDJA 4NYOA 5HMZA 1HBMA 2OI2A 1FFSB 3T5JA 4DL0C 4J90A 4UQTA 2R4FA 2YXLA 4GRSA 1Y0HA 1E6YA 2BE2A 2UU9F 2HAIA 1FXLA 5KFAA 3G87A 4WU3A 1NH8A 3HHKA 2CQCA 4C97A 4WE1A 1KVKA 3I87A 1HHSA 2DR6A 3L4BC 5D0HA 1K73T 1H7XA 2ZKTA 2RKIA 2GIQA 3MM8A 4IQXA 2C28A 4KGZB 1UVNA 3G8TA 3H98A 3M9NB 1K47A 3KDNA 1L3TA 1T3NA 4JI0F 3QIDA 4O3NA 5J2QB 2OPSB 3D0IE 1RP5A 1RAAB 2VODA 2MQ8A 4USVA 3HULA 1EP4B 5C2CA 3MM7A 1UFWA 3PW2A 2HIQA 2W25A 3VALA 4ZJQA 2BQRA 3M8QA 1RYSA 3M8YA 5KTQA 3VR1A 3TUZC 1VI7A 4RUHA 2HRYA 2PA3A 1N5TA 2KYZA 2VPZB 4ZVRB 3UDVA 4KJIA 4ELUA 1RAGB 1HQEA 1U6ZA 2XNQA 4JI4F 2E44A 2WCXA 4CI0B 3QPIA 4H54A 2L9WA 1QVFR 4MYUA 1A0OB 4OZNA 2IM1A 4OI2A 5M2PA 1NHKL 1M1HA 2CQPA 2QO3A 2Z2ZA 3LPYA 1JLBB 4QYZK 3CGIA 5CYJA 2D1CA 3FZ2A 1K44A 2RU3A 1VQOS 5DDQC 3KHLA 2ZHBA 5C5JA 1QDUB 1Z2LA 2LYVA 1TMJA 3NWRA 3B4MA 2AV5A 3UD5A 1MMNA 1RT7A 1TU0B 3HVTB 4C0OC 5KFHA 1S9EB 5T7LB 1M5VC 1T7PA 2JEJA 4DL3A 1PJ7A 5ETTA 4ES2A 2EG1A 2QE5A 7AT1B 3QZ7A 3JS9A 3PZPA 3TARA 2NS1B 2Z57B 1HNIB 1U48A 4K4VA 2OSRA 3V6KA 2IDEA 1RT6A 2IMOA 3KXDA 1BQNA 1Q5VA 1KS2A 3LOUA 4OHZA 4W98A 5LL6d 1RAHB 3PYDA 1L3SA 5CZXA 1HBUB 1AW0A 2MLXA 1C0UB 4GVBB 2WK4A 3V6HA 1RK8A 3A8JA 4DX7A 4ZPTR 1UWBB 2DIUA 2WB1D 1RTDB 1ZPVA 2ZM6F 5SUHA 2Y8YA 4K4TA 3SCLE 3GG0A 3GQCA 5MAOA 2YWEA 3BKFA 2E7WA 3BDPA 3M2VB 4MTPA 5IV3A 1EAYC 4ZLPA 1VRQC 5C24B 1YHQS 3UE2A 4ANCA 5DQHA 2G0JA 3PJXA 4Y34A 2FUG9 1FKPB 5KFZA 3KK1A 3HX9A 1TFWA 4ZVQB 3EPGA 4GKKJ 1Q7YT 4UZCA 5KG6A 4OIXA 1RTIB 4F0HA 4RNMA 4AL7A 1P27B 3VQTA 1KC8T 1VQ9S 2OJ3A 1T9YA 5KT3A 2BV3A 2HKEA 3TA0A 3AODA 1H98A 2IM0A 3OJUA 2BJ9A 1IBKF 1FKPA 2XGPA 2R8IA 2B51A 3MM5B 2VIHA 1KHVA 4Q5VA 1YIJS 5B0GA 3CJ2A 3LTOA 3FSYA 1XNQF 1ZM9A 2BJ7A 1RT3A 3AD9C 2GV1A 3T1HF 2DNKA 2F40A 3DMJA 1T03B 5BXIA 2GA7A 4LF5J 3JYTB 2XMAA 3GV7B 4O4RA 2E1AA 2WW4A 4ZLNA 1VBXA 3B78A 1IR2A 3CNQP 3DHWC 4LIWA 4RWWA 4CNZA 1QUVA 2XYGB 3W5ZA 1DARA 1RT6B 4OMFG 2MKCA 4E2FB 2QL5B 1KRPA 4DV7F 1RT4A 4ED6A 1NHUA 2UXBF 4N77A 2OPRB 1VLOA 1KHWA 1TP7A 1C0TA 1VJQA 4AE5A 4CT8A 1N4LA 3HO1A 3M2VA 3CJRA 1HD0A 2Q1LA 3IC1A 2UUCJ 4LF4J 2HFSA 2LCWA 2L48A 3AH6A 4TXSA 2FHKA 2B4PA 3R2CJ 1MN7A 1N5SA 2GVZA 3OV7A 1AYEA 1HMVB 1N88A 4UOHA 1M5HA 1NK7A 3HT3A 2JLGA 2F63A 4ZITA 4GKJJ 1MU2A 2G4BA 1FERA 4ANEA 1KR4A 4Y0FA 4DPXA 1U2FA 4M94A 2V8VA 1TV6A 1RAJA 4ZHRB 4DQSA 1X4FA 4RW6A 2WTFA 4TY8A 2IVFB 3CJ8A 2J6TA 3A12A 5HAOA 4HT5A 3CC7S 5CYQB 2X1BA 3GPAA 2PE8A 4OYWA 1RT1A 3AXMA 1D9AA 1PYTA 3M8QB 3W2VB 1Y4ZB 2BZ2A 3CO9A 4CLYA 4F4WA 4JV5F 2OTLS 8RUCA 4DR7J 3QAUA 4QU6A 4F3MA 5I42A 2JLEA 4OI6A 2QLBB 2VU5A 4NLOA 4ITSA 2ALZA 1OJ4A 2ZUAA 5K8MA 3OR2A 2H51B 1NJZA 4B9SA 3ISNC 4CP5A 5GADU 3TX0A 1WC4A 4JB8B 3NNCA 3OQ2A 3FDSA 4JP8A 2LXIA 2MPUA 2VDIA 4JI3J 3BO4A 3GSDA 4KKOB 5AXKA 3LAMA 1KQKA 3VWSA 4DPOA 3MUTP 1M5OC 1FI4A 4ZP8A 2LP4A 5J1NA 1SV5A 3A13A 3JAMU 3CE8A 3K59A 4A48A 1C1CA 5L9XA 3G6XA 2CNKB 3A3PB 1MMLA 2HBZB 4WP3A 1O0PA 2Q79A 4OYOA 1WELA 2GMJA 1BLUA 2WZ1A 1B7YB 3D28A 3NBPA 4ZPCA 4EWTA 3MECA 4GKJF 3QJLA 1CPZA 1P9QC 3OL6A 1RLCL 1TL7B 2APOA 5K20B 5CYMA 3GYXB 3OTOF 1KD1T 4DR4J 2C3PA 2YX7A 3KDOA 4FS2A 4JYAF 4LMZA 5LM7E 4HKQA 2IYIA 5E3RA 2PEHA 1JJCB 3IM8A 5CYQA 4QW9A 3PFEA 3I0RB 4NOHA 5L1LA 1JK9B 3RG6A 1GT8A 2DHGA 1P1TA 2QMXA 3CT9A 2C2ZB 2V2ZA 3DRSA 3FEYB 1UJ4A 3GWCA 3MHYA 4FXVA 5G0RA 2Z0GA 4DPTA 2FVSA 1NRKA 2ZHOA 2BE9B 3QJPA 5HQMA 3QZ8A 2CDQA 3H5YA 2PC6A 5IQQA 4WPAA 2IFXA 2O67A 1NCLA 3TZWA 5ETOA 2KO1A 4DCJB 3M32B 2RU9A 1ZM2A 2XO6A 2DGOA 4LFAJ 3KLHA 1GTHA 3BS9A 2Z30B 3NLCA 3V4MA 2VQFF 4DV3J 2ADBA 2R8KA 1UEVA 1Y3KA 2RF2B 3MMAA 2B7CB 3T6JA 3CO0P 1UW4A 2I0XA 1ZOTA 2DB1A 3LWLA 4HR2A 3W62A 1P6TA 1RAOA 1FD2A 1NSPA 1MN9A 4KR0B 1AUSL 1BY9A 1CC8A 4NA3A 5DRKA 4EBCA 2D3OR 1S7IA 3LANA 1YKWA 4O23A 4X4SA 3PW0A 4KO0B 4RW8A 3H59A 3ITHB 4ES1A 1YTYA 4LF7J 3BYPA 1B3TA 3R6GB 3BSCA 4OYZA 2H5IB 2BMBA 2XULA 2FGCA 2LA6A 4I7FB 4OYBA 4U8YA 1W7WA 5IS2A 3DMJB 1XJWB 2JVRA 5L39A 2BACA 2V50A 1T03A 2Q6CA 4USMA 5L8RC 4J9PA 1JLFA 3D7SB 4J9QA 4DUZJ 3AJ2A 2BR0A 4OI3A 4WYWA 2R7SA 2B56A 1UKUA 2R7VA 4BWMA 3QRQA 1S12A 4WCEQ 2QX0A 5DS7A 4KPCA 4LT6A 4KY3A 3KK1B 4K4UA 3TRGA 5C24A 3MPUB 2PMHA 3NGUA 3WX4A 2W2PP 1XMOJ 3HJFA 1SUQA 3TJ9A 2RMLA 3T41A 4PG5A 5A8WB 1Q0NA 4OX9J 3NGTA 4G1QA 4B17A 2E1MC 3NKYA 3V81A 3KMQA 3QMQA 2LECA 1SQFA 2J6UA 5I3UA 2Z2LA 3TANA 2OPPA 2ATCB 3VQSA 4DZDA 3EZ5A 2W9CB 1NKBA 2ZVSA 3D1QA 1RGVA 3D68A 3KG1A 4C0BA 2HLUA 3QSIA 3M8RA 2YKPA 3WC2A 1RWVB 4P2SA 4DL5A 2ASYA 1TL7A 2BUNA 4ZJOA 4CM0A 4ECRA 4B3OA 2V5HG 4X66J 5KFUA 3JSMB 4J9OA 3UDCA 2DIVA 1NJIT 2AYGA 2HURA 1JLBA 2MY8A 3JQKA 4FXWA 3W7BA 4WFBQ 2R8HA 2HS0A 2MJUA 3MPWA 3FZBA 2VDHA 2HEKA 2N4CA 4OZ2A 3EICA 3UD3P 2KG1A 2DRDA 4XDDA 5B0DA 4C2MA 3TAQA 4D3GA 2BW7A 5J2MB 4O0IA 3LGHA 3PW4A 2UV8A 2DRAA 1FRKA 4ZPWR 1UL3A 4OHVA 1HWJA 2LKZA 2NR0A 1SKUB 3LP1B 1X9SA 1L3UA 3OSNA 4FDFA 2E1PA 4HH1A 2EVZA 2E5LJ 2EKNA 8ATCB 1T9UA 3MAHA 2KXNB 4V19X 4BHQA 4DX6A 2XCPA 2MKJA 2RRAA 2GGPA 2H48B 4IUFA 1RWMB 2ZC4A 4PPZA 4U7CA 4H4OB 2FVCA 5J2QA 2WOMB 4U7UD 4NXMF 1VK3A 2LQ5A 1JLEB 2AKWB 1O8BA 3NP5A 2FHJA 2E7XA 3OXFA 2LXFA 4L74A 1F9FA 1S5ZA 2G0IA 2MSTA 1HD1A 3LQVA 2Y3YA 2BJDA 5IM0B 1REGX 2C2MB 4HDGA 2X1GA 1FKOA 4HACA 4Q8EA 3DRPB 1UVLA 3FCHA 2CQHA 3AB4B 4J9KA 3JTOA 2OSQA 1E6YB 1ROFA 2BE2B 3AOBA 3IGNA 2N4DA 3TX8A 4NCBA 4ED3A 1NHVA 3SYZA 4ZVTB 4I6WA 3QT5A 1N48A 4UUWA 1TAQA 3CD7A 4JI2F 2ZHAA 4UOCA 2MGZA 2V4RA 3JQJA 1T05B 4CLTA 4I2QA 2MZ1A 1SL2A 1SH0A 1TUGB 2EWHA 1WDTA 1VIOA 2DNYA 2BQ3A 2CA9A 2VUGA 2QL7B 2BRKA 3JQMA 3N5BA 3NOCA 5D4OA 3J81j 4DR1F 3QWUA 5E2QA 3DLHA 2W24A 2DXEA 3MR6A 4ED8A 5B7WA 4HH0A 4J9VA 1FTRA 1TV6B 4DPWA 4ZHRA 2E9ZA 2Q3PA 1YZ6A 2X3GA 5D78A 1RTJB 2XBPA 1FJEB 2EXUA 4X62F 3C16A 1XIQA 3I9V9 2ZZNA 4MYTA 2P8IA 2VFUA 2DGXA 4UOFA 4J9MA 4DR6F 5ETPA 5KFXA 3O1LA 2P9GA 2VASA 2CADA 3PXGa 5KFYA 5LSLA 1ACMB 2UXCF 4JI6F 3CJKB 2HHWA 2AEFA 3W9IA 2YX4A 1DLOB 1FRMA 2NPIA 2VG7B 2WVCA 3PJWA 4JV0A 1IJEB 3IAM9 3MEDA 5KFSA 9RUBA 4I6AA 2M52A 2MKIA 1JLAB 5JJBA 4K0KF 1C0TB 2F4VF 5CXTA 4PYDA 3OLAA 5K14A 5LOQA 5HMXA 1XQIA 1JJ2R 5IOLA 2DGSA 3LP2B 2G1HA 5AE2A 3J7A1 2YKNB 2HVDA 2QSWA 1HWLA 4ZS6A 4PABA 2HK2A 4RUBA 1ZAWA 2F7VA 2QA4S 3T19A 2Z58B 4EBEA 3DM2B 1LOUA 3PDNA 4DSFA 4DU8A 2B8PA 1MLAA 5D0RA 2BDPA 3BEGB 3JYTA 2DY9A 3M8WA 3DDKA 2IA6A 2GIFA 3HCXA 4OJGA 4LF8J 4USKA 5F8NA 4U67Q 2PD1A 2PN6A 3MGJA 1QAJA 2HW3A 2XMVA 3JTPA 4FKYA 1RTDA 1SI9A 3K2YA 4TLRA 3NY0A 4USIA 4WIIA 4Y28C 1WDDA 3P5BP 1S97A 5C25A 1PG5B 4RL1A 3PHEA 1UW9A 4OJ1A 3WHIA 1S49A 2KJWA 4NL5A 4RW9B 2J9EA 2C22A 4C11A 1X4DA 4MKVA 1TMMA 1WF1A 2HRUA 3DRRB 2YKQA 4CT9A 3OFEA 2VQEF 4K4SA 1B0VA 3BGFA 3PHTA 1ITPA 1PSDA 2H5EA 4U8VA 4ZPAA 2KL8A 2D9OA 3I5BA 4M5DB 2ZH2A 1B7FA 3GB0A 3BSNA 2J0SD 4XDCA 5D3GA 1VC0A 4OV6A 3A8KA 3QO9A 1WC6A 4CYUA 5HL7Q 2W4PA 1HNWJ 1WHWA 2CPYA 2CQ2A 3MM6B 3EGVA 4WFZA 5J2NB 4DHVA 2HZVA 1UJ5A 3MEEB 4DG1B 1NDCA 4DU7A 1S0OA 1N34J 3O3LA 5HLFB 1RT2B 1X60A 2VJVA 2JSXA 2RD5C 1NDLA 3K7RA 1VCTA 2OAUA 2R7UA 4X4OA 2M7SA 2MY7A 2ZWPA 2PI4A 1RCOB 3CB4A 3LP2A 4Y65A 1GXLA 1TK5A 2YNIA 4R5PB 4GKKF 4KFBA 4IH6A 4PUOA 2YBVA 4DOZA 1KOHA 5FLXY 3CCTA 1L3KA 3SV3A 1X31C 4CO5A 4QWCA 2E9RX 3MPYA 3R7NB 4Q0BA 3AD8C 1Q8BA 1HWUA 2KXHA 1NSKL 2ZJPQ 2F4VJ 4NLRA 2JVOA 3OHBA 2LEBA 1HQ2A 4ZN3A 1B99A 2XTJP 3HVAA 4DV0J 1IBKJ 3EJMA 1XNQJ 1CSJA 1HWIA 5KFJA 4G65A 1SH2A 2EK6A 3D6MB 3ZTRA 1NSAA 5A2QU 3THVA 3ENAA 2DTJA 1RT5B 2VQFJ 3TAMA 2CVEA 2RKIB 1NKCA 2WBRA 3EZUA 1H3DA 2ZBIA 2FC9A 3T1YJ 3Q2TC 5D4LA 2CNOB 2XB2D 1RAIB 4YDXA 3N6MA 1YJUA 2HQCA 3UVJA 1U1PA 2J9DA 2ZBPA 4DLGA 1QTMA 5DG8A 3PACA 1YLXA 3SIPB 3ZZRA 1EIYB 3BREA 4FYVB 4ICLB 2PI5A 4USWA 5CD4H 4F04B 1FEHA 4MIWA 4PXCA 1SL0A 2UUAJ 3VCDA 1IXKA 4KE5A 1SC3B 1V9OA 4DUZF 1XMQF 3FRYA 4YB5A 3K8WA 3V4IA 3AOCA 4JI1J 4IG0A 2Z8QA 1PAEX 2MMYA 4OZLA 1Q1KA 4M1KA 3ILLA 3A4TA 4CO1A 2L08A 5A8KB 2Y1JA 4USJC 2HQGA 3RRHA 3KLHB 2ACMA 5AXLA 2V2QA 1RTHA 4DR5F 2B4UA 1XMOF 4LVNP 3DFEA 4URSA 5JVGQ 3L7PA 3J7ZT 1U1QA 1RA7A 5F3ZA 3KLFB 4FF1A 2MJNA 3Q23A 3T3FA 4HHUA 3GCWP 4PWDA 2R7QA 4M8LA 1B4SA 1NDPA 3CC4S 3MR3A 3M30B 1CEZA 2FY8A 2HHQA 1HPZA 1GAOA 5LXRA 1RU1A 2B5JA 3QAEA 4B9NA 3AJDA 3H5UA 2ZD1A 3M6UA 4J9SA 1HNXJ 1NK9A 2FHOB 2FLOA 1PC4A 4JUZA 1VC6A 2GIRA 4UF4A 4WBFA 1QSSA 2LMIA 2CAJA 3GIIA 2NXEA 2HHXA 4RUCA 1U02A 3P3DA 1VQ5S 1JKHA 2MEWA 5F0UA 3S8SA 4DV0F 5B09A 2OTJS 1VRUB 4J7CA 1UTAA 2VG5A 2COLA 3H8YA 3I9ZA 3KTQA 2XQCA 3KMSA 1YGYA 2C2OB 4GMKA 3WBZA 3H5XA 3QFHA 3IRWP 1TL1A 3DLKA 3ELHA 3KG4A 3GV5B 3BO2A 2YNFB 5KT2A 4TU7A 5J2NA 5ADZA 2CJBA 1K8AT 3MOJB 4PYAA 2NPFA 3UN2A 4JI7J 5HO4A 1XR6A 3UR0A 2HYIB 2XNRA 2HQ3A 3OTEA 4QIFA 4L3NA 2A6MA 2YPYA 3DYAA 3FCVA 4JI1F 4TLQA 3P45B 3ILJA 2I5JA 4IR9A 4A8MP 3GLJA 1S6PA 2FJAB 1RDRA 2BKNA 1TKTB 3OXGA 4FYXB 2P9CA 4OX7A 3RYLA 3MUMP 4CO0A 4HDHA 5I3UB 2RB7A 4ZDNA 4RW9A 3U1MA 4AFFA 5CCMA 3DYAB 3FBFA 3U02A 4YB1P 2AW0A 4IFVB 5KFRA 3MEKA 4DR2J 3PIPQ 3CEDA 2HHSA 4NYZA 3G82B 1S1VA 4K4YA 4OHWA 3SBMA 1DTQA 1SIZA 9ATCB 1WF2A 1IBMJ 3K0JA 2AJFE 1B70B 3MF5A 1SQGA 3BO3A 1T8EA 1UVIA 4X4VA 1GMWD 1EQMA 2QLFB 2G0CA 3POTA 1BGXT 3DM2A 3FCWA 4KC5A 5BYRA 4W90B 3WQPA 4JI8J 1DQ8A 2XWXA 2JEIA 2ASLA 4M5IA 3C15B 3M2RB 1NJXA 2MKHA 1XERA 3H20A 2ZD1B 2PGCA 4CO3A 4ED2A 3OVBA 1KLMA 2J7KA 3CDWA 2BRLA 2R9LA 2MHEA 4I2PB 5AXNA 3TVZA 3I6PA 4F4YA 3W5XA 2HHHJ 1UZDA 4ID5B 2R8JA 3IA0A 1AA1B 1FCAA 1FF2A 1S4FA 2XMTA 3M6WA 1V5VA 3QSYB 1ZETA 4Y2IA 3PCOB 3ZZTA 4OZ3A 4LR7A 2OEMA 3CMQA 3Q24A 2RSQA 2W01A 3N79A 1YJTA 5BYQA 5HP1A 4EYHB 2PFFB 4ED4A 4XTTA 2A18A 5CD4A 1AZSA 3NL0A 3QRPA 5JMNA 1XR7A 3P8BB 1NSQA 4J9UE 3TA1A 2A6OA 1ULRA 2ZH7A 3FEXB 3M30A 1MROB 4PR6A 1X4CA 2CZVC 4F50A 1IBLJ 3KUEA 3NNAA 3T6BA 4I2QB 2HNDA 2QMWA 3FRZA 4KYZA 4LF9J 3KLFA 2IC3A 2Y1RI 4ZK7M 2UXCJ 1P8GA 1VQ7S 1WKKA 3NGRA 1YJRA 5GMKa 4Y2CA 1JMTA 3L09A 2CQGA 2HWHA 4KH1B 3MMBB 2P2CB 4USUA 1C4AA 3PJ9A 4ECYA 4DR6J 3AFGA 1N5VA 5A8KA 4USTA 4ZVSB 4MK8A 2DXDA 1D8ZA 1H6KX 1VIXA 3V4IB 2B8QA 4ZP9A 1R8HA 3WIVA 2IPOB 3DLEA 1WWHA 5KFMA 4DV1F 1NBEB 4N8OA 5F9NA 3TZXA 4B9LA 1S77D 1T9VA 1WTFA 2K1RB 4QYZJ 3CD0A 3DXSX 3PX0A 4CO2A 1IKWB 1WHVA 2R7TA 4I68A 4NLSA 3G71S 2YX1A 4ZVFA 2VICA 1L3VA 1PO6A 2EG2A 2B9WA 2DR8A 1AFJA 2DHSA 4NWBA 2HRTA 1BWVA 3HHNB 1SV5B 4ZVHA 5GAEU 4C8KA 1IWAA 2D69A 2HBQB 4B3MF 3DU5A 2I2YA 1WHYA 2DO4A 2JFKA 2J9CA 2DK2A 1A7GE 1TUWA 2YKOA 3BGUA 1VR6A 4YY3F 1CG2A 4EMDA 2LQBA 5GVQA 4U7UK 4IG3A 4PAAA 5B0EA 2WHOA 4RW7A 4URGA 4F4ZA 3M6XA 2C2RA 2FQQB 2LA4A 3EGWB 3LUYA 4LSLB 3S01A 2KXFA 4QWDA 1I6JA 2I1RA 2MZRA 2F8MA 4CTAB 1QD1A 1HYSB 2VJUA 2DNHA 4DSJA 1RSCA 3KHRA 2J7WA 2G9OA 4DSLA 1LNQA 3ENQA 5K8PA 3W2WB 3QO9B 4A8FA 1F2GA 2Z4PA 2R2RA 1R43A 2LLZA 3NMRA 1REVA 2RILA 2XI3A 1IBLF 1FJ7A 3TNVA 1IUJA 2ZC3A 3KFWX 2KVQE 4MIAA 2DO0A 4PWWA 1NJYA 1FJGF 2OHDA 2AU0A 3UNGC 3CPWR 4P75A 1EZZB 4A8OA 2I38A 2FZKB 2XM3A 3PY8A 4JI0J 3IBCB 3HZEA 3GG1A 1VDHA 3K8VA 4K4XA 1Q7LB 5CH7B 3HSJA 3GIKA 2W9BA 2H5JB 4CLPA 4H4KC 3LH2S 2JLFA 4J5OA 3KK2B 2DRBA 3VAMA 2YPZA 3BM7A 2FTRA 5ETNA 3MMCB 3OR1B 4R0JA 2BQUA 1S0MA 4W4MA 3RBEA 3UCUP 2DNNA 1HNVA 3M2UA 4YY3J 5A2QY 1G6BA 3V6JA 1VQ8S 1WOPA 2Z56B 1Q95G 3BGRA 4EK2A 2JEFA 3FQLA 4L72B 3GJSB 4ATNA 1XR5A 4Q2LA 1K0TA 4DFPA 3D6HB 1DY3A 8AT1B 5LMNJ 3OVSA 2JC0A 4JBCA 4RX6A 3D1HA 2VC0A 1U8WA 1N32J 4E98A 2NSBA 3OPKA 4LR9A 4CLFA 3FJ2A 2DNPA 4A4JA 3FBBA 2RJZA 4F3QA 4DL7A 4PQUB 1F60B 3AAWB 1Q8KA 2DNMA 1RKIA 4PG8A 4X62J 2AD9A 2E66A 2C3YA 4I7FA 1S59A 2CQBA 3UR3C 3ZTQA 4EZ6A 3MM5A 3OD2A 5EWFA 2X51A 4OYPA 3MMJA 2QGFB 4ECVA 5MLCV 2AGPA 2FJDB 1VRUA 1YBTA 2CXEA 3PRVA 1OIAA 5EHHA 3VAGA 1N52B 4RJVA 1U2RA 4M5NA 4WU2A 4EI2A 3M2UB 4WIQA 3UDLA 2XYHB 3R5DA 1SC1B 4XPCA 5A6WA 3T5LA 4WZQA 4FYDA 5KFPA 2J0QD 4MKYA 5F8HA 2JWNA 3MMAB 2KT5A 3W63A 1PYOB 3GE9A 4J9RA 5M2UA 2CG8A 3KNGA 3HMJG 3N9UC 1R89A 3LW5C 5HBMB 2CKWA 3TQ1A 4P9SA 1UFKA 2QSFA 1F5BA 5DQGA 1DTTB 4LRFA 1KTQA 1UWBA 3PNIA 3EM1A 4A8XA 4RNNA 1VQNS 2VOOA 4GVBA 2LDYA 3R5BA 3OL8A 3VAFA 5A0YB 4A8QA 3GFXA 1YWXA 3CCRS 1NLKL 3PW7A 4RPFA 1LWEB 1VQ4S 1TELA 4PQAA 4EO8A 5FJ4A 4NCAA 5HROA 4WP8A 5HSPA 2F4FA 4CCHA 2QMUB 4LBHA 3EVWA 2HLTA 5G4DA 2NQPA 2BANA 3MM9B 1PILA 2OGUA 2C2KB 4I67A 3IR5B 4UTGA 2YKMA 4YB6A 3LP0B 2KTQA 3MR2A 3UN5A 1NNDA 2B4VA 2UZAA 2CZ4A 4H4OA 1KQSR 2QJ3A 1F0XA 2FYXA 2GAHC 3R5AA 2H54B 2RT3A 5D4PA 3RW7A 3ZZZA 4ECSA 3NBPB 3SEOA 3G6ES 1T9XA 2AJ1A 2BXJA 3IG1A 5B0FA 3KK3A 5KFGA 4WZMA 2ZBQA 5KG5A 4P2MA 2VC1A 4ZKAA 5KFDA 2O5DA 5KFIA 4H4MB 3VAIA 1DRZA 1I3OB 3DRPA 2V63A 3OTCA 1C4CA 4GC6A 1F2HA 4YHHJ 3NNHA 1WI8A 2VFRA 3FQKA 3FBEA 4KGVB 1NDKA 1QAYA 4CQ1A 4QIVA 3W61A 3KLEA 2CPDA 2GHVC 3PEHA 4M5LA 3ZZUA 4JOUA 1JJ4A 4CDIA 1V3RA 3LPEA 4LF1A 2ASJA 3BQ1A 2VG6B 1RA6A 2OO4A 2NSCA 3TO8A 2UXDF 4QCLA 3JSRA 2FJVA 3G4SS 2K3IA 4ELVA 5KFNA 2MQQA 4HI1A 4ZPVR 2HSEB 4PEOA 3VVUA 5E5NA 2I6WA 4RUAA 2D3O1 2NZ4A 3VAHA 5KAKA 1ZAXA 5F3TA 3VGUA 3ISZA 1AFIA 1D09B 4FN5A 4MK7A 4U96A 2BABA 2DPIA 2CQIA 2F8HA 1OPZA 4OYIA 3A3NB 5F8GA 5K8NA 1UP1A 3I56S 5KFKA 4OLOA 3BQ2A 4CLUA 4TN2A 2VKZG 1RBOB 1U0SA 1CULA 4EGLA 3PYGA 3R1HA 2KZMA 3D5MA 4DR3F 3PRDA 1R6VA 2D7SA 3WZ0A 1VQLS 3DOLB 3IG1B 4L6V3 3BSAA 2CPIA 2Q43A 3G8QA 4LVOP 2DEJA 2YQ3A 3QYYA 4RNFA 4F8RA 4DV6J 3DN9A 4Z2XA 1WC3A 4CYUB 1WKLA 1O5JA 4CM2A 3U1NA 1YVFA 3LP0A 3F73A 2AGOA 5E7OB 1U4BA 2BBEA 1HNZF 4QIWD 1FX4A 1RQ0A 3ET6A 2DYAA 1C1BA 1U0HB 4L76A 4ZOSA 2F9DA 4OFZA 4F26A 1APSA 3N4WA 1I51B 3DHXA 2CG4A 4HHHA 3SSSA 5DDOC 2HHUA 3GCXP 1CJTB 2MKSA 3PKMA 2YWKA 3F44A 4UQGA 2J7UA 1CJKA 5HJXA 3SQGA 5A0YA 1DHMA 3NCQA 4ZA1A 2FPHX 3OTOJ 2WB4A 4YP3A 3G96A 3HXMA 2NUHA 1S1WA 3SDEB 1R8CA 2K7KA 4IH5A 3RBDA 2XMKA 1QVGR 3QT8A 3V2UC 2QT7A 4ZVPB 3Q8UA 1KLMB 2YWHA 1OO0B 1TKDA 3J7Z5 1NB7A 2KZZA 1DQ9A 2EI5A 2B6AB 4O44B 3MEGA 2XCAA 3CJQA 3UQSA 2X7IA 3RB4A 1QAXA 2RS8A 3CD5A 4KGKA 4MK9A 5FIIA 5KT4A 2DBBA 4O3RA 5H9FK 4C8MA 3OLBA 4J9LA 2CUYA 5GMEA 2H3EB 1B0PA 4C3MA 3E01A 2QFIA 3EDRB 1LWCB 2QV6A 3POTB 1VQKS 4C3LA 1JLFB 4WFNQ 1M1GA 1ZA2B 2CJQA 3R9LA 5LJ5Y 2MLZA 2CWKA 3S1TA 3MMCA 3OR1A 4ED7A 2F5GA 4KBIA 1S1VB 4RLEA 1KONA 3C8YA 3FMWA 2BA9A 3SXLA 4NRUA 4C98A 4DJBA 1FD8A 5F9LA 2UP1A 3C66A 2V9WA 3PO5A 4IFVA 2BJEA 2XHWA 3CJKA 4K5RA 4O4GA 3N6NA 3GR1A 5D0GA 1H7WA 5LT5A 4X4QA 4P2XA 3CMES 3TUPA 1FNMA 4YN3B 1RBLA 4JI4J 4NCGB 4Z7CA 2QEXS 2AGQA 4C4WA 1RABB 1ZTTA 4RBVA 4ID8A 2X1FA 1YI2S 5KG7A 5F8MA 2GS8A 1X0FA 3GR0A 2W4CA 5KOXA 3PO4A 5THWA 2PT0A 2EW9A 2DNZA 5C42A 3KK2A 1TVRB 4ZVEA 2QLWA 1HBOB 2CQ0A 3DGPB 3DLKB 3MAAA 2MQMA 1Q78A 3L7OA 1VBZA 1U1OA 2LEAA 3I5CA 5LXYA 2W7PA 5DG9A 1HYSA 2CPHA 1CULB 3W3SA 3DLJA 2IJRA 4RNHA 3IGVA 7FDRA 1A6LA 1MW7A 1I1GA 4AT1B 4OX9F 1YRXA 4MMOA 4DQQA 2KRBA 2GC8A 2OPQA 2OMLA 4NZ7A 5B0AA 3W66A 3KJNB 2XLKA 2IJFA 4PXBA 2CNLB 3HK2A 2EC0A 2B5JB 2AT1B 2XMWA 3EGNA 3KUGA 4R8UA 1I5OB 2XY6A 4GO7X 3MECB 1I94F 3HP6A 1LXJA 2ZM6J 3BB5A 2L9NA 3E8OA 4N8NA 2CPXA 3MM7B 5ETMA 4LR8A 1LK5A 1JLGA 1IBCB 2C1EB 2GVDA 2KT3A 2H4YB 2MZQA 6FD1A 4UY8T 1LFPA 1TTHB 2ZOGA 4I6YA 1VLYA 4PG4A 5DO2A 3UCGA 3ADAC 2GJ2A 2FVRA 1R0CB 1LV5A 1RT1B 2DKOB 3LP1A 1FKAF 4IG3B 1S6QA 1EKSA 4FP9A 4LBIA 1CS4B 3RR8A 3T9ZA 3JSYA 1N56A 2WSFC 1OMSA 4DWIA 1FDDA 5EX0A 3KLIA 5LMNF 4AL5A 2FGOA 4BCAA 4B3RF 4H4MA 2KM8B 2EFNA 1WG5A 2WVFA 2ZH3A 3B6BA 3VAKA 1J5EJ 1QTNB 4ECXA 2QN6B 1NZAA 1GEHA 2HVEA 1FX2A 3HZGA 5KFTA 1EHWA 4A46A 2ILYA 4P74A 5DGBA 1LW2A 1BQMA 2GVZB 2M9KA 2ZNYA 3MFIA 3RW6A 1DURA 4ICLA 1EETB 2CPEA 4TYBA 3WIUA 1HBOA 1RISA 1FFGB 1VRTB 2E5LF 2A0FB 5EDWA 4DXLA 2VQEJ 5C42B 5L1KA 1PJ6A 1SJRA 5AJ3J 2R7OA 1Y00A 2OEKA 4P72A 5HQ8A 5L1IA 2GZOA 3N6LA 5EWGA 2D3ZA 2V9KA 3ENWA 4RW6B 4QWEA 2JRSA 3HFKA 2ROPA 2U1AA 5ETLA 4DL2A 2K7JA 2G13A 2VPXB 2VFTA 1LW0B 1X5TA 4IO1A 5AE3A 4PRFA 1RU2A 3ULHA 1CJVB 3TQEA 2DPJA 4QPTA 4U95A 2A1BA 3J80Y 2VZ9A 2ADCA 4KHMA 1SL1A 3DOMB 2YH1A 4LF4F 4NLXA 3NMAA 2ZUGA 1FTCA 5GADI 5HANA 1NXIA 2DNLA 3SQOP 1N54B 3IWNC 3JXOA 4JI5F 3BYRA 1PGZA 3BN4A 2HFUA 3DDIA 2DNOA 4ID5A 4OI0A 3NCRA 5J1PA 2HK3A 4RKUC 4YOEA 4L73A 3RJMB 1OS5A 4NEZA 3I0SA 1PBUA 3VTIA 3UPFA 4WKYA 2J8SA 3B4DA 2LEPA 3QFWA 1VQMS 4UOGA 2H1YA 2FC8A 1D0EA 1WKJA 2ZITA 2MLYA 2NXUA
chains in the Genus database with same CATH topology
1M1KT 3K5OA 2JEGA 2D9PA 3X1LB 2QA2A 1TKZA 5LMUF 1IKVA 2AP6A 2FD2A 4DSEA 2DGTA 1S9GB 4MAKA 5AJ3F 3K5MA 3CCUS 4M5DA 1D8YA 4NLDA 3MTKA 2YKAA 3HHDA 1UA0A 3GILA 2AWZA 2IYGA 5K8OA 2EK1A 2QYCA 2W7OA 3OW2R 1JNRB 2OD6A 4QWAA 4OZJA 5CCLA 2QA4G 4KQZA 3EUNA 1VGYA 3I31A 1SJFA 5LSRA 3QGHA 1G3OA 2MZJA 4IKAA 2R2SA 2IAJA 4B02A 1DQAA 1Q86T 5L38A 3IXQA 1H38A 1TFYA 4G1IA 3DOLA 3CXCR 4IRKA 4FVCA 4X4RA 2HNZB 3G6YA 4DV4F 3OL9A 3N01A 4N76A 1FA0A 5DDPC 3FFIB 3SSRA 1UMJA 2YKNA 3MTJA 2HPUA 5KFFA 2I5JB 2N82B 4CIOA 4ERDA 1MNEA 1ELOA 3OVAA 2ZJRQ 5K14B 3CCWA 3R5CA 1BQXA 2R7WA 1R8BA 2RRNA 3CJ4A 4QPXA 1KTVA 4JV2A 4ILLA 1FRIA 2J76E 2G1DA 3H2UB 2XMJA 4LFAF 4CTAA 5I3QA 4X4PA 4Q8FA 1N32F 3CWJA 2FVPA 3FNNA 2WBMA 2PMZD 1URNA 2E1RA 2HVIA 1C1CB 1WEYA 4X84A 3G8SA 1NKEA 1RTJA 5J2PB 3FMBA 3MM8B 4DF4A 5L9NA 1F5CA 1WHXA 4DV5F 3BGLA 3NRBA 2EBGA 4IQMA 2H9ZA 2XO7A 2W7AA 5A8RA 4PXDA 4EBDA 3CDAA 1GXTA 3CVKA 4RU9A 1XC9A 2FDNA 1EP4A 2EFQA 2MGZB 3GMGA 3CCSS 2GCFA 4I64A 2FJBB 4C8YA 1WD6A 1KD1T 2HGLA 1S79A 2XEXA 2PIIA 2VBWA 1Q4RA 4WJBA 3VZHA 2XLIA 2VONA 4DN9A 3C3LA 1YJVA 2XLJA 2DGQA 1WNEA 4UY85 1OPIA 3ZZOA 4KSEB 3S7RA 1KSPA 4DQIA 4ECTA 4WE1B 2RIJA 2NLWA 2FIUA 2KHDA 2IRXA 2VFSA 2WONA 4XIUA 3OTOF 3MXHP 1XTZA 1R27B 1FVQA 1KN6A 2DGVA 4BWJA 2D41A 4ALZA 4B3TF 2YWGA 4DDFA 3M4XA 1LWEA 2JJ4D 2HFNA 3T1YF 2AJQA 3H40A 2JC1A 4ES3A 2EFGA 3I4PA 5DDRC 3JTNA 4FF3A 4TNOA 3SI8A 4Q0BB 4B9UA 3QGIA 1MROA 4NLGA 2XS5A 2JX2A 3LAKA 2GX8A 4K5SA 3PKYA 2M2BA 2W4DA 5E33A 3BDEA 4QJVA 1DFDA 4MKAA 2KH9A 1YJNS 4NLYA 3HDSA 2J6SA 5EN1A 5FD1A 2CPFA 3ICLA 1RT5A 5J2PA 1WG4A 4PPDA 4NA1A 3BJYA 2OFHX 4N41A 4LQ9A 5B08A 4LSNB 4NXNF 2EFVA 3HHLB 3RZAA 4MIBA 2UUTA 1RT2A 1K9MT 4YQWA 3S6EA 4DG1A 2GHWA 1X5OA 2F9JA 1JIHA 3M8PB 3MI7X 4ZCMA 3EX7B 4D3HA 5JUMA 2UUAF 1RT3B 2IVMA 4KFBB 3LALA 1XMBA 2MHNA 3CF5Q 4K4WA 4RWXA 4DQPA 2YNGA 4KT0C 4HT7A 1X0PA 4GO5X 3BGRB 4RZRA 1Q82T 1HNWF 1IN0A 4E0DA 4WK1A 4MFBB 4C11B 1WI6A 2J0WA 1JXEA 3PFOA 3H4DA 3TW0A 4ZP7A 4EZ9A 3KNAA 4ECUA 3CDBA 4A47A 4OX6A 1DTQB 4HHJA 5DLFA 2JH3A 4Y2MA 1Q81T 1N36F 1QSYA 2C3OA 2R7TA 5D8HB 4CZCA 4O3OA 2IAJB 4XO0A 3G6VA 1Y3JA 1KQFB 3CCQS 1YRTA 4DS5A 1YBAA 5BYSA 4N47A 1C0UA 3T9NA 1QAIA 2FLNA 1Q16B 3IR6B 1NU4A 3WC0A 1FEEA 2YNGB 3PM9A 1HNIA 4ZVGA 1W2IA 3E51A 2UVRA 3RU0A 4IDKB 1K0VA 1RT7B 1KQGB 1UAWA 1VC5A 4DL6A 2YNHB 3RAXA 2KFZA 3LF0A 4O3PA 3MEDB 5IT9Y 1HA1A 5IZHA 3M8PA 1UJ6A 5IFMA 4ILMA 4ZP6A 4C7QA 4OX8A 4QR2A 3ITHA 1A9NB 2M88A 3GV8B 1M5SA 2KB2A 3DRYA 4IYQA 4ELTA 4TKTA 2JOQA 1J5EF 4X2BA 4RBTA 3PR5B 4PWUA 5FDLB 3RB3A 2HZCA 2OIHA 4ETXA 4KPYA 4IOAQ 4QWBA 1D9DA 4F3OA 2LQJA 4AYBD 3I55S 2BW2A 2AYMA 3F41A 2J0XA 1FO1A 3DU6A 1S99A 2HNYB 3DDNA 4DFKA 4H4KA 1SH3A 1GX5A 1NEEA 2K2PA 5F8IA 1X4AA 4M63A 4OZ0A 3DOMA 3EGZA 2LU1A 1MSWD 2E5JA 2K1RA 1B0TA 4CO4A 2ZH1A 1LXNA 4TY9A 4DV2F 1RWUA 1S0NA 5G0RB 4LF8F 1Y5NB 1W2BR 4XAKA 3NAIA 2JHEA 4IG0B 4I69A 2KI2A 2AYBA 2WONB 3BR8A 5CYMB 4F2SA 3QWPA 4NLVA 1VRTA 2KM8C 1U1MA 1IKXA 6FDRA 1U1RA 5HI7A 3H2VE 3OBIA 5KFCA 3MURP 4OJHA 1PGZA 2N3OA 3G9CA 3RAQA 2CJ9A 3Q8QB 2MZSA 4FF1A 5B0BA 2GGPB 3CJ5A 2AJ4A 1X4GA 5E3AA 5E3CA 3TOQA 4XPEA 3GFYA 4TU8A 1ZM4A 1GX6A 5ITHA 2XY5A 1NK5A 1N6QB 2E9TA 2PO4A 1FNOA 3GYNA 3KHHA 1HBNB 2EBEA 3OUYB 4KKOA 3P96A 3D54A 5IM0A 1X4BA 1U7LA 1OSCA 1CQMA 4N56A 4NMLA 4PG7A 5HP1B 4WFXA 4P7VA 2DH9A 4C8OA 1KFSA 1X4EA 3MPVA 4OJ3A 4V19J 3I5AA 2UUCF 1KLNA 3C6UB 1HQUA 4ED0A 2ROEA 2DVIA 1HL6A 3RAMA 5H1SV 1VK8A 2FJEB 4R8UB 1UVJA 4IDKA 2XS7A 1D1UA 1G1XA 4LUBA 3I96A 5F41A 2QRRA 2RQMA 2W8LA 2RNEA 2DR7A 4B9TA 2B43A 4K4ZA 2HNZA 2W9CA 3NWGA 3H2LA 1TUVA 4NCGA 3SFUA 3CDUA 1VFJA 2CQ3A 4WTYA 4YUDA 5E3QA 3M1VB 4N5SA 4BC7A 4F4XA 4X4TA 2AQ4A 2VB6A 4FNIA 1Z2ZA 3SZ2A 3JB9k 1S72S 4I4BA 3JSMA 4Y2AA 1E6VA 1FVSA 1XN9A 3MZIA 5LSOA 3Q2SC 4LF5F 1TVRA 5KFBA 3PIOQ 4DQRA 2KVIA 1X9WA 2E5IA 5HMYA 2VPWB 4U6PA 3THTA 2DH8A 2WSCC 3KLVA 1HHTP 2ZDPA 4WKRA 2MQLA 2OPPB 3Q22A 4WYLA 3K58A 4O44A 2E29A 4G1QB 3D2WA 4NLQA 1VQYA 1IKYB 4EUVA 1YSJA 2CQ4A 4B3SF 2EKYA 3SDEA 3QJJA 4DR4F 1U45A 3HHLA 2RH3A 1S1XA 2GQQA 1JKHB 1N8RT 2OH2A 1PC5A 2E5GA 4Q7AA 1R7IA 3SMZA 2WSEC 4LF9F 4IH7A 1FESA 4NZ6A 1U26A 3OJSA 5JXSA 4Q2MA 4UUXA 1U49A 2O3DA 1J5OA 1W25A 2OLWA 5KT5A 4DSKA 1IQZA 2GO8A 2VG7A 1P1LA 1DLOA 1ZPWX 4NYPA 1Q8IA 1C2PA 2A3JA 1GTEA 2VKRA 4QQBA 3IS9A 3CIZA 5M2RA 2VA3A 1KOOA 4KIAA 3ZZPA 2Z2MA 3SFGA 3SSQA 4MKBA 3CCLS 1LW0A 1WACA 2CQDA 1BQNB 1FXRA 4RNOA 1QE1B 1U1NA 3DRSB 4J37A 3I0RA 2CYYA 1JX4A 2DISA 4QW8A 4C8NA 1R8AA 3O6QA 5D6GA 4LQ3A 2ZOFA 5BJRA 2ZOMA 2QLXA 3IRXA 4RW4A 3AQPA 3R3TA 1WEZA 5K5MA 1S7HA 4EEYA 2CIMA 4X4UA 1Q79A 1H2VZ 2VG6A 2B7BB 3IO1A 2MKKA 4GC7A 1T3OA 2L41A 2CRLA 4YR3A 2XMUA 3KLIB 3FSXA 4B9MA 3KLEB 1FKOB 2XWYA 1HQEB 4TYAA 1IBMF 1S48A 4NZ0A 2BYCA 2HFOA 3O44A 1JLCB 5AXMA 3TAMB 3KG0A 4ZMMA 4YEAA 2HG4A 3C2PA 3DLBA 4BC9A 4PXEA 2V2KA 1TL3B 3OR2B 1XNRF 2IBOA 2L3MA 3A8EA 3AQOA 4QYRA 3G86A 1OQ3A 2ATLA 3E2EA 3T1AA 3K5LA 3TVYA 2JFDA 2IJNA 1LK7A 1U09A 5F8LA 1LWFA 5KFWA 2HMIA 3MCSA 1NH7A 1X7VA 1Y5IB 1HI8A 1F5AA 2XI2A 2ABYA 3NGKA 2SXLA 2J8AA 1SXLA 4ECWA 5K9FA 1GH8A 3FSIA 3H4BA 3HKWA 3UW1A 4NA2A 3BSOA 4M95A 1MU2B 5I4MA 4F02A 3HHLC 1CQNA 4I0WA 5KG1A 4KV8A 1FDNA 1S0VA 3MEEA 3B8HA 1V6HA 3IRXB 1ZBTA 3MM6A 1X4HA 3W2VA 4QOTA 5T14A 4Q45A 1UA1A 1QUPA 3BR9A 1XBWA 3C6TB 3OFFA 3OXLA 4AUKA 4DS4A 1N0VC 2XNRA 3MM9A 4RU2A 5CQGA 1LKZA 3T5HA 1KEKA 2XY7A 3OTDA 2L9DA 1S10A 4DL4A 1BD6A 4NX9A 5CHCB 1R0AB 2YVSA 2HS3A 2V8HA 1GQEA 3MD1A 3I4HX 5DJBA 2XSJB 2GFFA 3CJ0A 2D74B 2E1CA 1S9GA 4USHA 2GJIA 3DOKA 5GAEI 2PSZA 3DC2A 5HBMA 1KVIA 1SUQB 4Y2KA 1M0SA 1T02A 4NLWA 4YR0A 4MJKA 1G2EA 3KYLA 3M05A 2ZKUA 5E0OA 1G7CB 1LWCA 2QZ8A 3K5NA 3AY0A 1BC6A 2B3TB 1DBDA 4HLBA 3OFGA 2ZH9A 4PKDB 2B9XA 3I0SB 2ZE2A 1DAXA 2JL9A 1RTIA 3QGGA 3CMAS 4DV3F 5D4NA 4BDPA 1TQLA 2DJWA 2QFJA 3MEGB 3JSBA 3O8WA 3VZIA 5GAGU 5F8JA 3IWLA 1NJWA 2UVVA 2LXUA 4HTJA 1S1WB 4FZVA 1TKZB 3WDOA 4JI7F 4PQUA 2NYIA 2RRBA 5T41A 3DOKB 5E3PA 4LF7F 1VJWA 2ILZA 1HW8A 2J5AA 3CDEA 5DQIA 2IM3A 1FDBA 1HR0F 1FNXH 4I56A 4MH8A 2KN4A 4NLUA 3TUIC 2RF2A 3O5TB 4TU9A 1M90T 2K8GA 2J9DE 5DLGA 1Y7PA 1C1BB 3KLGA 4G1PA 3L3CA 2AF6A 3QLHB 4B08A 3M32A 3RRGA 3AHPA 3DI6A 3OTBA 4CH7A 1T05A 3GFZA 1EETA 4PCQA 2W9BB 1ZZNA 2M4MA 2VOPA 5AE1A 1BQMB 1LW2B 2LVWA 2U2FA 3ONQA 2HWTA 5EUHA 5DG7A 1HBUA 1WEXA 1M5KC 1XK8A 3US5A 1K1SA 3OFHA 1JLQB 3ZC4A 3BZQA 2ZJQQ 4U9RA 1R8PA 4CH0S 3U27A 1SIWB 3Q8PB 2RQKA 1M5PC 1REVB 2GMLA 2UVWA 4C3KA 2RE1A 1D3WA 1VMBA 3I82A 4FPRA 5HN0A 4DN0A 1JLEA 3H5SA 3KKFA 2QA1A 3W2WA 2HFZA 3C6UA 2IVYA 2WOMA 2N7CA 1Z1ZA 3GIJA 4OLPA 3HLUA 1IJFB 3RB0A 1IKWA 3TI0A 1WF0A 1FDAA 2DH7A 3CIMA 3K57A 1TL3A 3ISND 1FHTA 4LSLA 4LFBF 2KG0A 1NK6A 1D9FA 1QSLA 3M8SA 2DR9A 3P49B 1Q53A 3OUYA 1KNZA 2V4JA 1B64A 2RS2A 2M5YA 2HGMA 3NGDA 5J2MA 4P6QA 3M6VA 3HHEA 1FXDA 4OL8A 3ETOA 1JLGB 2F1FA 3FVYA 5I42B 3OL7A 3KK3B 2OPSA 3SCKE 1S6OA 2ZH5A 4IFYA 2DHXA 2Y0SD 3IBWA 3O2IA 2KYXA 1N34F 3QLHA 3DLEB 1S76D 2YKMB 4TY8B 5DGAA 3R1LA 3TR5A 4DSIA 5HROB 1FRHA 3ZZ0A 1JLQA 3AA9A 1SJQA 3C46A 3HM9A 2DGUA 1S1TA 1UETA 1HBMB 2E5HA 3F56A 2R2UA 3CCJS 1VQ6S 4O4GB 4C8LA 2CPZA 1QJHA 2ACYA 2ZDOA