2N4DA

Ec-nmr structure of agrobacterium tumefaciens atu1203 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target att10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
AGLSFHVEDMTCGHCAGVIKGAIEKTVPGAAVHADPASRTVVVGGVSDAAHIAEIITAAGYTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu1203
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Agrobacterium fabrum str. c58
molecule tags Structural genomics, unknown function
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n4dA00
3DXSX 1OQ3A 5B0CA 1KVIA 2ZDPA 3MCSA 1YJTA 2OKQA 1WD6A 2W4CA 2BJDA 1P6TA 1GXTA 2AW0A 3HHLD 2ACYA 2AJ1A 2GFFA 3BGUA 2OMOA 1CC8A 2QLWA 4Q2MA 2Q3PA 3MZIA 5B0FA 1APSA 2OFGX 4NPOA 2JDJA 4HI2A 3CJKB 2XMVA 2KYZA 5B0BA 1Y9OA 2GO8A 2K7JA 3K7RA 2OP5A 2FTRA 1TZ0A 4OJGA 2XMMA 2N4CA 2FHMA 2FIUA 5B0GA 3FGVA 1OSDA 2HFOA 2OAUA 4Y2IA 1X7VA 4Y2KA 2GGPA 5A6WA 2AP6A 4A4JA 1MWYA 4A46A 5KAKA 2RILA 1Y0HA 2QYCA 1YJRA 3DCAA 2BBEA 1FESA 4DPOA 1N5SA 2QIFA 2K1RA 1YG0A 3HDSA 1VQYA 1N5QA 2LDIA 3HHLC 2RU9A 2BUNA 1N5VA 2ASYA 2HLUA 2LQ9A 3LO3A 2K7KA 2L3MA 4OJ3A 1X8DA 3BF4A 3HF5A 1U7LA 4OJHA 1Q8LA 1CPZA 2XMJA 4ZA1A 1IUJA 5F0UA 5A6PA 1RJJA 2BJEA 1KQKA 1AW0A 3HFKA 4HH0A 5K9FA 1TL4A 2XMTA 2FB0A 4YDXA 1FE0A 2AJ0A 1YJUA 2GV1A 5T7LB 1Y3KA 2XMUA 3TOQA 4ZOSA 1SB6A 4FNHA 3LGMA 1N5TA 1QUPA 2HQIA 2QLXA 4A47A 1S6UA 2N4DA 1P8GA 1YRXA 1FVSA 2IYGA 2KKHA 2ROPA 3I9ZA 3BDEA 1OQ6A 1OPZA 1TUVA 3UDCA 1K0VA 2RMLA 3KG0A 1Q8BA 4HL9A 1SI9A 1S6OA 3T9NA 4A48A 3BB5A 2IYIA 2ROGA 4F67A 4Q2LA 1TR0A 2GGPB 2RSQA 2XMKA 4HH1A 1Q4RA 2KT2A 1SQEA 1Y3JA 3KNGA 3BR8A 1JK9B 2LQBA 3WDOA 3HHLA 1XBWA 2W4DA 4YEAA 5IXUA 1ULRA 3LGNA 2GA7A 1LQ9A 3BM7A 2EW9A 2HFNA 2HLTA 3VTIA 5B08A 2IFXA 1AFIA 3QGPA 1FD8A 1FVQA 2G9OA 2ROEA 3FMBA 3F44A 1GXUA 3E8OA 3HX9A 1YJVA 2K2PA 2PGCA 2CRLA 3KG1A 1MWZA 3FRYA 1Q53A 1FEEA 2OD6A 4OIXA 3CJKA 2LXFA 2VH7A 2ZDOA 4HI1A 4DL0C 4EFAC 1TL5A 1V3ZA 5T7LA 1JWWA 3TNVA 5F0WA 1KVJA 2BYCA 3KKFA 3IWLA 4OJ1A 1URRA 4Y2MA 2KT3A 5B0DA 2GCFA 3TRGA 1VQSA 3QMQA 1X0PA 2VV5A 2K1RB 2N7YA 4FNIA 5B0AA 1AFJA 2W4PA 4DN9A 5B09A 1FE4A 2OD4A 2OFHX 4QOTA 3IWXA 4NL5A 4U9RA 5B0EA 3GZ7A 2PD1A 1W2IA 3BN7A 1R6YA 2HIQA 3HHLB 2XMWA 1CC7A
chains in the Genus database with same CATH superfamily
2QSFA 1SJQA 2Z2MA 3EGZA 2B51A 2ERRA 5I42A 2DNNA 3OL6A 1PJ6A 2JL9A 1U2FA 2VONA 1KOHA 1JJ2R 3NCQA 4L73A 3M8ZA 3MM9B 2XMMA 2W7AA 3VGVA 1Q86T 2PMHA 3IRWP 2M7SA 3MM7A 1N5QA 4TLRA 1QLNA 1SJ3P 1FKAF 3SEOA 4DV4F 4DQIA 3ZNUA 2GHWA 2J9EA 1RI7A 2W2QP 1E6YA 4WF9Q 2ZVIA 3D1OA 3RGIA 2QFJA 5HBMB 3W8GA 5J2QB 3IAM9 1ZETA 2VOPA 5IS2A 4W92B 2IRUA 4OHXA 2VPWB 5KFYA 3POTA 3NWGA 5KFLA 3RR8A 5A8WA 1OSCA 3M6VA 3LAKA 4FYXB 2P9GA 4ZLJA 1Q78A 2DGWA 1OY6A 5F8IA 4ZCMA 1CC7A 4RUHA 4RUCA 1SIZA 3NGDA 3UFCX 3F41A 4ANEA 1Z2LA 4Q8EA 1IBCB 1P1TA 4RU9A 4FF3A 4IDKB 1NDPA 1LKZA 1VOMA 2PI5A 4F8RA 3AFGA 5DJBA 2DNHA 1XMOF 4QCLA 1RTHA 5GMDA 2C2KB 4F3OA 4DR4J 1CS4B 3A8JA 3K2YA 3HCXA 3PW2A 1B7FA 2E7WA 3JSYA 1D8ZA 3G8SA 2AJ0A 1YJUA 3PYGA 2M9KA 2RIJA 2ZEJA 1S6UA 4L3NA 2ZD1B 2FJXA 2OSRA 5DDPC 1NKCA 1M5SA 2DH8A 4C8KA 4F02A 2ZHBA 4X84A 2IJNA 3IG1B 1WELA 4I56A 5DGBA 4OYPA 3FCWA 1U1OA 2GQCA 2B0GA 1EP4A 3LP1B 3NP5A 4ZJLA 3CC2S 1RAIB 2R3VA 2WB1D 4OI4A 3OSNA 2MQOA 1RT6B 2GAGC 1BUXA 3D4JA 4CLWA 3QMQA 1UJ4A 1HI0P 3FCHA 4KH0B 2C2OB 4KE5A 4Z7YA 4OI6A 1ITPA 1RAAB 1WG1A 5CABA 3J81j 4Q8FA 1BMQB 1GFWB 3RBEA 2GMHA 4IOCQ 3BSOA 3THTA 1L3VA 4MFBA 2QFIA 4XDCA 4YOEA 5H1SV 4AL6A 4DG1A 2RU9A 1YJ7A 1EZZB 2CQIA 2B5JA 2CPZA 2R7XA 3AAWB 1Q1KA 3TWZA 3TVKA 4LR9A 2XMUA 3CCZA 4OYMA 2DGOA 2CUYA 4C8OA 1K0VA 4DX7A 2GQ2A 1VRUB 3G6VA 4P6QA 5HQLA 3KLIA 3BKFA 3PKMA 1DLOB 2YXLA 3PXGa 4DSEA 4KHRA 2MQ8A 2C28A 1F6TA 3U1MA 1JNRB 4F50A 1RP5A 3FBEA 2B56A 4KO0B 2X1BA 2LXFA 5LT5A 4TKTA 4Y2MA 1Q16B 3KTQA 1WWHA 3RB6A 3UDVA 3DOLB 2OELA 2HKEA 2IM0A 3DRRB 2PMZD 4RW4A 1YJTA 3K8VA 2AW0A 4ZPBA 2G0CA 2HURA 3G8QA 1VQ5S 3ILLA 3KK2A 3Q8PB 1TZ0A 2FVRA 3CO0P 2L48A 4PG8A 2V4QA 2PEHA 3LW5C 1NAQA 1SQFA 5C24B 1O5JA 4K7QA 4IG0A 2XCPA 3R5CA 1NPRA 2JRSA 2YQ0A 5GMKa 3C6UB 4YR2A 4HL9A 4JI1F 2XS2A 2W7OA 5IXUA 3CC7S 2JC0A 1HQEA 2EW9A 4DU8A 4CO0A 3C15A 2A2DA 2PMWA 1TL3A 5L9XA 4WP8A 3CJKA 2RE1A 3MURP 1U1LA 1JLEB 4OJ1A 5HQMA 7FDRA 2C2RA 3CJ4A 4JBCA 3DRSA 3I56S 4C3LA 4YB5A 2MKHA 2OMOA 1RADB 2GZOA 3BH7B 2Q3PA 3BBBA 2KTQA 3BGLA 2YKNB 1HWUA 4NASA 4CT8A 3H5UA 3CDAA 2ZBCA 3T19A 4NXMF 3T41A 3RRHA 2ASYA 2W25A 1N8RT 3CDBA 2IM2A 4MMOA 2FB0A 2WHOA 2DITA 2ZH1A 3SCIE 4B9TA 5KG0A 3IMQJ 4IG3B 4GO7X 1U6ZA 3CIZA 2QL7B 3IO1A 3BR8A 2W9CB 3PHEA 1FTRA 4DV0J 4K50A 2KJVA 3IGVA 4DS4A 4LRBA 4JP8A 1N34F 2OIHA 1VQ8S 3VV2B 4KGVB 3MEDA 2HK2A 1F0XA 4ID5A 3CJ0A 3NS5A 3THPA 1YITS 3M8WA 4PCQA 2YNHB 1U1NA 1IR1A 1F9EB 1UWAA 4P10A 2HMIA 3MM5A 1CQNA 3HKWA 3PVXA 3UN3A 2R7OA 5C25B 3US5A 5K20B 3KNAA 1RE1B 1VLOA 1RQ0A 1HI1A 2BKPA 4H4MA 2VFRA 4KHPJ 1HQ2A 3GSIA 2JEIA 2PDAA 2A0FB 2R9LA 1S48A 2KVQE 1EETB 3FDSA 2XY7A 2XEXA 2ZE2B 4FDFA 5L1KA 1BQMB 2UV8G 2DR6A 3KG0A 2XY5A 1V3SA 4NLYA 3K5LA 2B6AB 4KY3A 1FERA 2ZZTA 4IR9A 2FC9A 3ENQA 2GVZB 1G6BA 4EYIB 1C1BA 2J7WA 3NGTA 4DLEA 3QT6A 2G2YA 1JLAB 4C8MA 2QV6A 3BKUA 5ADZA 5E41A 2AEFA 1YJVA 3KJFB 2DIVA 3TZYA 2YX4A 3KG4A 4U96A 1T05B 2QLFB 1CSJA 4DN9A 2G0IA 5FIIA 3KLEA 2EEYA 4DFMA 3PFEA 2IVFB 1E6VA 2V68A 4USIA 5D15A 3G8TA 1WUUA 2I38A 3B54A 4FXWA 2OHDA 2IA6A 1YGYA 1VQOS 2OP5A 3G82A 2EG2A 2HG4A 3RR7A 2AP6A 1NM2A 4I1TA 3KLFB 3LWLA 1H2VZ 3C14B 4ECXA 5KFTA 4EEYA 3W7BA 1R8CA 2FDNA 2MJUA 4QYRA 2BANA 4PXEA 1N0UA 2XMTA 2VD3A 1SKRA 2XGQA 3SDEA 1LXJA 2R7VA 1QVFR 1C2PA 2OPRB 3HJVA 3G4SS 1RT4B 3HZEA 2NPFA 3OL7A 3UD4P 4NRTA 5K14B 2YVSA 1N88A 1CVJA 2XG8A 5C42A 2EI5A 2PO4A 1CJVA 1Q53A 2H65B 2ZDOA 1DBDA 2YKPA 2JEGA 5F3TA 1HNWJ 4M5NA 2KXHA 2AGPA 3K0JA 5I3QA 3NBPA 3ZZRA 2KRBA 1JQGA 1NSQA 4C0HA 2ALZA 3D1QA 2CXEA 4UQTA 2KB2A 3PO5A 3AH6A 5JVGQ 1RT5A 2HIYA 3HP6A 5B0FA 4PZVA 4OJGA 4CTAB 1EIYB 5KG7A 5EGYA 1O51A 1WHXA 4USJC 1TL1A 3NS6A 4OX9F 1S10A 1FNXH 3VAKA 1CJUA 4NE9C 2XO7A 4NLTA 2R2TA 4Q2LA 4K59A 4RNNA 4CDIA 5L38A 4U7UD 4IRCA 2F4VJ 3GP9A 2DH7A 2F1FA 2UXCJ 3HT0A 2K2PA 3FK4A 3I96A 1DQAA 2YNIB 1W2BR 3SCKE 3CNQP 3HHKA 1WSVA 3FNNA 3CEDA 4UTGA 5HQ8A 1SJ4P 2MLXA 5D0GA 5KFUA 2KZZA 3VAFA 3E2EA 2HS4A 1WC5A 1KHWA 1XR5A 2FHOB 1M5KC 3ILOA 2W9BA 1RT2A 2XYGB 2ZBQA 4DPXA 2BMBA 2VG6B 3HZGA 3OHBA 5CD4H 3QSIA 1S1VA 4FYWB 1GNKA 4ZHRA 4F0KA 1UA1A 4C2MA 5EUHA 1YHQS 2CAJA 4CWBA 1MROB 3UNYA 2CKWA 4TYAA 2IRXA 5GAHI 2VASA 2VQEF 2BZ2A 1DURA 1NKEA 2F9JA 3AY0A 1QAJA 1NJZA 1SJFA 3CWJA 5KFWA 4CYUB 3BB5A 1SQEA 4ED7A 2ATCB 1Q0NA 3LGNA 1R8AA 2XLKA 4OZ5A 2OPSA 3MFHA 1QE1B 2E1CA 2CQ1A 2MPUA 3M2VB 4TQRA 3LP2B 5AXKA 2F8EX 4XDDA 3JTNA 2Z2LA 4JI8F 1S77D 4GVBA 4FYDA 4DFPA 2R8HA 2HVEA 4AE5A 1IN0A 2B4VA 4LREA 5F8JA 2O5DA 2A18A 2DNRA 2CPXA 1S79A 3NAHA 2MKSA 3EVWA 2W2NP 1FESA 2X1AA 3R7SB 5EX0A 3PR4A 1FTCA 4PUOA 4ES3A 1AYEA 3OSPA 2DCLA 3PDNA 4B17A 1IUJA 1K47A 4KV8B 5K9FA 1PJ7A 2LEAA 4LSZB 5IWAF 3W2VA 2XSJA 5EWFA 2WCXA 3UN2A 3M9MB 2QC3A 1RAFB 2HGNA 3DHWC 1U25A 2GJ2A 1C1CB 1G1XA 5HANA 2DR7A 3TP2A 2I6WA 1FD2A 1HNXJ 5F8HA 1YI2S 1IXKA 5DLGA 2GO9A 4JI4J 4LFAJ 4YS2A 3HPOA 4K0KF 2MQPA 1IWGA 4HHJA 1CULA 3H98A 1VFJA 3MDFA 3SCLE 2NXJA 2H3EB 4A8FA 1VJWA 4LQ3A 1JJHA 2HZCA 2IY5B 4V1Ak 3VAJA 3U1LA 2M8DB 2VG7B 3W64A 3UO0A 1P1LA 1FFSB 4WZQA 1NJYA 2Y8WA 3R97A 1YG0A 2VBWA 4QR1A 3RAMA 4ED2A 3KLHA 3L9ZA 4X4OA 4FBUA 1RHJB 3HHNB 1LNQA 1K0TA 4NYPA 5A8KA 2W9AA 2FJBB 2E66A 5FLXY 3MTKA 3H4BA 1KQSR 2YWHA 2V4RA 1F3FA 4HTJA 1MMNA 2QA1A 1SQGA 2W4DA 3QO9B 3BREA 5HP1A 4U67Q 3UCUP 3TZZA 5KT3A 3DOMA 2FQQB 2HHWA 2DNMA 2ZZMA 1TKTA 2CNOB 3H7HB 2AIRB 5E3RA 4JV0A 3D6TB 4QIWD 5B09A 1TL7A 4F0HA 3MUMP 4WE1A 4O4GB 4M94A 1W2IA 2FJWA 4L3KA 4HKQA 3SMZA 1JB0C 4R25A 3QGIA 4U6PA 1S7HA 2MJNA 1N33F 3NL0A 2AKWB 2KYZA 1MG7A 3NKYA 3K7RA 3OFHA 2IMOA 1M1GA 3I5CA 2DGSA 4RPFA 4N41A 2DNQA 4K0KJ 2RILA 5F8GA 1TUWA 2QYCA 4FF1A 3G6XA 3TUPA 4ZIVA 1RHMB 1HWKA 2UUCJ 5E3CA 4ZVEA 4B9UA 1WC3A 5K8MA 1PG5B 4IFYB 1QSYA 4LF4J 2RJZA 4TLQA 5M2RA 5GAEU 1I6JA 1YX2A 1ZM3A 8ATCB 1Y3JA 2HRUA 2CQHA 3BQ2A 4GC7A 1KHVA 1UFWA 2H5IB 5CH7B 1VR6A 2FLPA 4JV5F 2KU7A 5G0RB 2ZKUA 1KQGB 3NS7B 1U2CA 3JXOA 4CLSA 1SUQA 3V6DA 1HYSB 4J9UE 1HBOB 1TKXA 1N52B 2WBMA 2IDEA 2A2CA 4I2QB 1I94J 2FHJD 2NSCA 3W66A 4U9RA 1MNEA 3FEXB 2G1HA 1KWMA 5KT4A 4B9VA 3QSYB 1CBKA 3HSJA 3MM6B 3NNHA 1EKRA 1PCAA 4OX8A 5CAAA 3VF0B 1N5YA 2OPQA 3CCUS 3HSDA 4ETZA 3GIRA 2RDDA 3AJ1A 2ZWPA 5CYQA 3CCTA 4G3IA 1RU1A 4DPWA 5DO2A 2CWKA 4NLWA 2L3MA 2RS8A 1RAEB 2V69A 5A0YA 4J9KA 2DT9A 3EX7B 4ZP8A 4MIBA 1R3NA 4ERDA 1YJ9S 1N5TA 5C2CA 1BHNA 3EUNA 4M5DA 4UZCA 2XWYA 3ISZA 1QTNB 2HAIA 2MQQA 5H9EJ 4X64F 2OTJS 1ZOTA 4OI0A 4X66J 3SZ2A 4K4SA 2WBRA 5I42B 3R6GB 3FMBA 4DF8A 3VZHA 4ZPVR 3E8OA 4EU0A 2PGCA 4I6YA 1R89A 1JWWA 1YTYA 1U0SA 4ENOA 2D41A 1FE4A 4DL3A 3TARA 4LVNP 1RHRB 1HNIA 3D28A 1F5AA 2MQLA 4DV3F 4OYOA 4X4NA 3MCOA 2F4FA 4YN3B 4ATNA 5H9FK 1GQEA 3FFIA 1B7YB 3CCLS 1HPZA 3LAMA 3S1TA 4E98A 1IBLF 4YY3J 1UVKA 2UP1A 3GV5B 4HH0A 4DPYA 2EFOA 3S01A 4DUZJ 2LA6A 4EGLA 4ZVPB 2HQIA 5AXNA 4NLQA 1F5BA 5HVGA 5KOXA 4YFUA 4JOUA 3D54A 4TY9A 4K4YA 3IA0A 3CULA 3O3LA 4HH1A 1KKHA 4DR5J 3UN5A 3J7YI 2EK6A 2G2OA 3MPWA 5D78A 1GXLA 2VC1A 1DFDA 3FKBA 2PT0A 5JMNA 4OZ1A 1FX4A 2PI4A 2VQFF 2YX7A 1NPPA 2BM0A 3Q23A 4DSFA 2BQRA 3G87A 1CC8A 2HVHA 1S0NA 2FJVA 4ZP9A 2IBKA 1N48A 2UVWA 3U02A 1HWLA 2ZWOA 2NZCA 4NOHA 2DEJA 2YKAA 2BJ7A 4M63A 3H5SA 1VBXA 2ZUAA 3A3NB 1A9NB 2CVIA 1U7LA 1EP4B 3PEHA 4M5JA 1UZDA 2MHEA 4IQXA 3X1LB 3W5YA 4DV3J 4IO9Q 3AJ2A 4Y3CA 3Q8UA 3OL8A 2BDPA 2D3OR 3UW1A 4ED6A 2UXDF 5L1IA 3GR1A 4CLFA 1F9HA 2LQ5A 4IRDA 3V6JA 3ETOA 4M5KA 4I2PA 1MSWD 2CA9A 3EJMA 2MEWA 1IBKF 3IBWA 4PYDA 4RZRA 1GK8A 2OD6A 3LQVA 2DR9A 4DG1B 4TNOA 2XMAA 3DLEB 4LRFA 2DR8A 4L76A 2RVJA 3CSKA 1U47A 3AT1B 1SVDA 4P71A 2GFFA 2KVIA 3CT9A 1RZMA 3LP0B 3TEGA 3H20A 4BCAA 1T3OA 2R42A 2CNNB 1T7PA 4DV7F 2DRDA 1PYOB 1TAUA 1KP6A 2OJ3A 3VHQA 2FHMA 2IAJA 1H72C 4ES2A 3DLGB 1WOSA 3HDSA 2HLUA 4JYAF 2CNKB 3BH6B 1QAXA 2IC3B 4I7FB 4X4UA 1FE0A 5IC4B 3Q2SC 2DTJA 4OYZA 3N9UC 3JQJA 2V4JB 3GFYA 1S6OA 4ZCLA 4DFKA 3SBMA 3DGVA 3EGWB 4Y2CA 1MU2B 4RW4B 3FSIA 1R0AB 1S9EA 3LANA 2FVCA 4IQMA 2VICA 1XMQF 1LWFA 1NK7A 1PYSB 3KK2B 4LF7F 2GHPA 3ITHA 4ZPTR 2H5EA 2OH2A 2IJFA 2K06A 4X4PA 2HGMA 4JI0J 2MB0B 2DNPA 1SIWB 1DTQA 4NI2A 3GZ7A 4DMZA 4U95A 3U7JA 2W8KA 3RJMB 2F8MA 4M5MA 1RCXB 1IBKJ 1HBMA 2LLZA 2OEMA 3QGHA 1RB0A 3L3CA 3DLKA 2DVIA 2ZH8A 1HR0J 2AX1A 1HQEB 3VVTA 4ICLB 3OR2A 4G6VB 2H4YB 1TL3B 5HATA 1SH3A 2Z57B 3CDUA 2R8KA 1KTVA 4AYBD 1NLKL 2DKOB 2WVBA 2AYEA 4ZVGA 3UDCA 4RBTA 3DRSB 2AQ4A 2BR0A 2CYYA 2AMCB 3M8YA 1LW2B 4CCHA 2QGFB 1EQMA 2ZH9A 4CNZA 3GJQB 1SL1A 1IKYB 1JLBA 2QL9B 1WKKA 4OIXA 4R5PA 1NHVA 1SKSA 1WHWA 4AD6A 1ZA1B 4GMKA 4DL4A 1WF2A 4U7CA 2DGVA 2P5VA 1RT3A 2HQCA 3PYFA 3HD1A 1H2UX 3LPYA 4WIIA 1S9FA 2XCAA 5KG4A 2VBZA 2FY1A 2CPDA 5B0GA 3FUYA 3GB0A 4DCOB 1GAOA 3MGJA 3DGPA 4B3MJ 2R7WA 5KFPA 3BYRA 5IQQA 5DDQC 3NCRA 4OX6A 1Z4UA 4X65F 4WIQA 5F9LA 5D0RA 2JC1A 2EG1A 1WF0A 3HFVA 1GX5A 2I0XA 4LFCF 3M32B 3ISNC 4IKAA 1FRXA 1AXQA 1TVRA 1S6QB 2CIMA 5L46A 4AT1B 1T0TV 3PJXA 3M9NB 2MDAA 1Q82T 3CCMS 2VZ9A 2UUAJ 1B4SA 1IJFB 5DM6Q 4RWWA 4EFAC 3PHTA 4O3RA 2K3IA 5J2MB 3TX8A 4ZN3A 4OLOA 3HVAA 3TQEA 5CYMA 2X3GA 4NLPA 3AHPA 3N4WA 1PC5A 2LU1A 4O3SA 3M6XA 1TV6A 1K44A 3GE9A 4HI2A 1OMSA 3Q83A 3IAS9 5E2QA 2GGPA 2VODA 1D9FA 2CZ4A 4PKDB 1RK8A 2HAFA 1C1BB 2O01C 3CD5A 4QU7A 3MCNA 3GG0A 2CJXB 4V19J 2JVRA 1RBLA 4QW9A 1NDKA 1J5EJ 2RB7A 3UI3A 4KKOB 8RUCA 4ZP6A 3KLEB 2FVPA 3FBCA 3ZTPA 4PG7A 3NOCA 1ZBTA 5LJ3Y 4ITSA 2RDIA 5J2PA 4J5OA 1RABB 2DNKA 3B4DA 2HHHJ 3QWUA 2B4PA 2WSCC 3GCWP 3F0NA 3GYGA 4C4WA 4CLLA 2GCFA 4X4TA 4DQQA 1K8AT 4RR5A 3MECB 1SC1B 4FKYA 4UOFA 2BANB 3ENWA 4B3TF 2HQDA 2KDOA 4ANDA 3SDEB 2QLWA 2QA4G 2DB1A 2DGTA 3GYXB 4NCGA 2XZDB 1B0VA 3KLGB 4L74A 4LF9J 2UXBJ 4MAKA 4NYZA 3VAHA 3RW6A 2W7PA 4ILMA 4UW2A 1U26A 5AXLA 3D67A 3KK1A 4PYAA 2ASLA 4RW7A 5BYSA 1CJVB 2U2FA 4CO1A 1VBZA 4NCBA 4W90B 3QJLA 4YDXA 1DQ9A 5C7PA 2MZQA 2MSSA 1ZAVA 1I5OB 4JI7F 1VRTA 1SI9A 4X2BA 4FS2A 5EWEA 3TW0A 1FRKA 1R0BG 4I68A 3Q0AA 3EXYA 1RT5B 2ZH7A 1BE4A 2ROEA 3MEGA 2NYHA 2CJAA 1FKOB 4JUZA 3BGOP 5H9EK 3J80U 3TQ1A 3ADAC 1L3UA 3D0IE 1IKWA 4RJVA 4NLGA 3F56A 4DX5A 2ILYA 2P2CB 1T3NA 1IKVB 1TL1B 1L5UA 4K5RA 1OQ3A 3PW0A 4GO5X 5HLFA 1ZAWA 4Q45A 4NZ0A 3ZZTA 3BGUA 2J0SD 4YP3A 3D1HA 3PRBA 3EE3A 1PYTA 3Q8QB 3GR0A 3IS9A 4NA2A 4QR0A 2DR5A 4DSJA 3HKZD 3ZTSA 2J9CA 1T9TA 1LWEA 5E33A 1TK5A 1WORA 3GIKA 3T5KA 3C46A 1RTDB 1RBAA 1RKIA 2BJ1A 3B8HA 5FDLA 2M5YA 2BJEA 3R8YA 1CQMA 3MUTP 1BWEA 2BE7D 4YHHF 4AXJA 2FVQA 2KG1A 4DQSA 1WC1A 1S6PB 3C2PA 2C2NA 1T95A 3CJ2A 4RW9A 4YUDA 2E5LF 4NXNJ 2MYFA 1EX8A 2B9XA 3GFHA 4Z2XA 2DY1A 1VJQA 3BM7A 3PX6A 3QIPB 5AE2A 2KFNA 3FQLA 4ZHRB 4H4OB 5JVHQ 3DM2A 3GG1A 2ZH6A 2WVCA 1D9AA 4B9NA 1U2RA 8AT1B 2MTLA 3L7PA 4F25A 1XQIA 3UDLA 2FLOA 5EN1A 3EDRB 4L6V3 5GAGI 2UUBJ 3DLHA 5KFCA 3QWPA 3R7NB 4A8QA 3ZXWA 5BR8J 5JUMA 1V3RA 1S1UA 3FZ2A 3EXCX 4GVLA 1DZ5A 4D3HA 1VQMS 2HQGA 2OPSB 1VMBA 3P6YC 1AW0A 4USKA 3N0VA 3T3FA 1NBEB 5I3UB 1QUPA 2ZBPA 3I9ZA 4WBFA 2CG8A 2A6MA 4ZS6A 4CH7A 3J7ZT 4Q7AA 4JI5F 4GVBB 1GMWD 1OY9A 1OY8A 1ULRA 2VDIA 2DGXA 2AT1B 2HYIB 3SIPB 3I32A 3OUYA 3I31A 5CZXA 2B9YA 1H7WA 4WCEQ 2PC6A 4EMDA 2XI3A 1RT1A 5K8NA 5D77A 3W9HA 1VHIA 3T6JA 2OO4A 4JI6F 3RBDA 1GXTA 1FRMA 3R9LA 3W2VB 2QX0A 1J5OB 2HFVA 3I0SB 1UP1A 2GO8A 1ZA2B 3BGRA 5ETKA 4DUTA 2H1YA 3OFEA 4QWAA 3K5PA 1FJEB 4OI2A 2DNOA 4A46A 3D2WA 2XSFA 2IVMA 4DPOA 1RTJB 3HVTB 2C2EA 2K7KA 2R7TA 1CJTA 5J1EB 5E3PA 4BLGA 2VB6A 1C0TB 4PWUA 2VHGA 1AUDA 3LGMA 3NGUA 2GVDA 3R5JB 2QA2A 3BQ0A 1N0VC 2FGOA 1S1TA 4I0WA 2B7CB 4A8MP 2LQBA 4WU3A 2DNYA 1KS2A 3TJ9A 4RNFA 4DR1F 3K57A 3W60A 2M0GB 1BWVA 1W26A 4ETXA 1QVGR 2L9DA 4P73A 3TJAA 4F3MA 3KLHB 1FX2A 4ED1A 2QN6B 1QSLA 5A8KB 1X4HA 2I1RA 3PIOQ 3OXFA 2H48B 1U1RA 3AD8C 2CQDA 1S7IA 4HLBA 2HW3A 3D66A 3VQSA 5IT0A 4PPDA 3A1YG 5M2UA 1T02A 3DOMB 3M8QB 3MAAB 2FLLA 3MXHP 1TKTB 4JI6J 5AT1B 1GMVA 2QLXA 3AD9C 4OYBA 2J0XA 3M6WA 1RCOB 4ZKAA 1TK8A 4NLRA 1A7GE 3TO8A 4PQAA 1LW0A 3R1HA 5AJ3J 2OMLA 5E3QA 4QPTA 5DGAA 4K4VA 3UVJA 3EDQB 5F8MA 5F41A 1BGXT 5CQGA 4KJIA 1U0HA 5U47A 4HVZA 1D8YA 1FCAA 3R5AA 2DGQA 1RHUB 2R2RA 2RH3A 4EI2A 1UEUA 2WZ1A 2OFHX 4KB7A 3DNCA 2YNFA 3E01A 4DWIA 4DQRA 4DQPA 2FVSA 1JLQA 3CD0A 4XPCA 3KFWX 3TJ8A 1NMEB 4C48A 3ULHA 2RAQA 2ADBA 1X9SA 4A4JA 4OHWA 4C6AA 2KJWA 3MPUB 1RWWB 2M52A 1LWCA 1SUQB 4OJHA 2XNRA 3V6DB 3ZFVA 4ZVOB 2PE8A 1P9YA 4ECRA 3TOQA 1REGX 1DY3A 3JQKA 3C6TA 1OYDA 2C3OA 3MOZA 3W61A 4JB8B 2CNLB 3BYPA 1UVLA 1S12A 4ECVA 2B4OA 2OGUA 1KD1T 2UVRA 3MEEA 2P8IA 2WSFC 3W2WA 1JKHA 4WKRA 3Q22A 1RHKB 2IFXA 4X62F 4Y28C 2QYGA 4CZCA 1NZAA 5JJBA 1N5YB 2OPQB 3L7OA 4IH7A 3SQOP 3O5TB 2XY6A 4FNIA 2J8AA 3R5BA 3TUZC 5A0YB 3DKDA 2ABYA 1R6YA 3FBBA 1NNDA 3UR3C 3LTOA 3MR7A 1YIJS 3L95X 3VQTA 4HYKA 3TZWA 3KJNB 3JSMB 1XNRF 4IRKA 3ZZZA 2R8JA 4HDGA 3R5DA 1S0OA 2FZGB 4P2SA 3JB9k 1B70B 2KHCA 1QSSA 5HBMA 3QLHA 5J2QA 4FBTA 3CPWR 1YJWS 4UY8T 1KQKA 2NSBA 3OR1B 2LQJA 2GIRA 3KWMA 5AE1A 3CCJS 4PEOA 1UA0A 4ZK7M 3SV3A 1LXNA 3SQGB 2DEIA 3NLCA 1HNIB 2NUUG 2XQCA 3V4MA 4RNOA 5B08A 1EARA 4AQYJ 2G9OA 3FRZA 4IDKA 3MMAB 3KUGA 4BS2A 4ZMMA 3A12A 4B9LA 4DV1J 2CADA 2FD2A 2BKOA 1JLFB 4MT1A 1CS4A 3UD3P 3Q89A 3PYDA 1IQTA 1NH7A 4USHA 1LK7A 2M8HA 3J81Y 2EWHA 2ZD1A 1K1SA 5DG7A 3VGTA 4ZVUB 3TZXA 3HK2A 2CQCA 1X4BA 5GAHU 4ILRA 5KG3A 3F73A 1X5OA 3IG1A 4C8YA 5K8OA 3TA2A 4J9LA 2V2VA 2XZTB 3EPGA 3LP1A 1N32J 2KI2A 2CG4A 2XS7A 1RT6A 3MOJB 1FT8A 5LL6d 2YBVA 4QPXA 2OUGA 3CMQA 4F04B 4DR4F 3ZTOA 2V9WA 3HVRA 1ZAXA 5RUBA 1FVQA 3M2UB 1MLAA 1Q79A 2LP4A 5J2NA 4ZN1A 4MIAA 2ZZNA 4ECWA 1X0PA 5CZVA 4BWJA 1ZH5A 2MXYA 1KRPA 4B9MA 1UVJA 1IQZA 2JSXA 4WWSA 4MKAA 1XMBA 4WXWA 3MZIA 3CMES 2MZJA 4DR2J 2K7JA 2MKCA 3VGUA 4PR6A 4OL8A 2OAUA 4YDDB 4EBEA 4GKKJ 4I2PB 3QIDA 2QIFA 2EFNA 1DLOA 1QM9A 2H9ZA 2O67A 3HF5A 3PX4A 4N77A 1KEKA 1H7XA 2BW7A 3BR9A 3CJRA 4JI2J 3AXMA 4NX9A 3H25A 4K2XA 4HHHA 1URNA 3M2RB 1R8BA 1Q5YA 2V2KA 3DOLA 2YWFA 2LA4A 4DR7J 3MAQA 5LM7E 2K8GA 3DRRA 2KXFA 1AFIA 3QRQA 3PACA 2VH7A 4DV6J 4C0OC 5MLCV 5B0DA 2MQMA 3TAQA 4PPZA 4LT6A 1L3SA 5C24A 2VFSA 4QIGA 3J81U 1T8EA 3FEYB 1HNZJ 1DQ8A 4LBHA 1T03A 3O2IA 1DAXA 3ET6B 3C6UA 2DNLA 2Y0SD 3K17A 3QATA 1BQNA 3GJRB 2YY3A 1MN9A 4MK9A 2YWGA 3CO9A 4LF5F 1NKBA 2L9NA 3NEKA 2PFFB 7AT1B 2XYPB 4OJ3A 3LO3A 3TUIC 4QYZK 2XLIA 1MMLA 2AYGA 4PWDA 2YNGA 3OTCA 2VKZG 3UR0A 4F4XA 4RKUC 1N36J 2E5JA 2FHJA 1O6XA 4NI2B 3AOCA 3NRBA 1HHTP 4QR2A 4R0JA 2MMYA 4ZITA 3H4DA 2ZM6J 3Q8VA 5DS7A 3R2DJ 2ZNYA 5HVFA 3D3BJ 1P27B 2DXEA 3BSNA 4LSNB 4ZVHA 3DLKB 1TL5A 5T7LA 2YKNA 1M1HA 3D7SB 4XO0A 3IR5B 3HSGA 3G96A 4LBPA 2EBEA 1FEHA 4FKXA 1HMVB 5L8RC 2W2MP 1LFWA 4KR0B 3EZOA 3C16A 1UAWA 3QRPA 3H40A 3PCOB 4LF6J 1TKDA 4NWBA 2M70A 4RW6B 3C66A 1HQUA 2MY8A 2ZC3A 1AZSB 2W9CA 1JJCB 1X60A 2ZOFA 3W9JA 1JLBB 1KLMA 5BJRA 4R5PB 2IPOB 1SXLA 1P8GA 4MTPA 2XBPA 3CXCR 2N7CA 1TKZB 3QNWB 3IFEA 1RT3B 3IRXA 2IYIA 2MLZA 5A2QY 5HSPA 4LF5J 2YNHA 4FYVB 4NZ6A 4PXCA 3NOGA 3AA9A 2ZH3A 1GTHA 4O0NA 3OV7A 1NSAA 3R2CJ 4KRWA 4KT0C 2ZBRA 3MMBB 3R7BB 2ZFHA 1FXRA 1UWBA 4GKJJ 1U02A 1NEEA 2HHPA 1MWQA 4LFBJ 1S0MA 4QWCA 4CO5A 4DV0F 5HO4A 4LJMA 1EETA 2FJEB 3Q8RB 3A3PB 3V6KA 1PILA 1S0VA 1BQMA 4Z37A 1WJ9A 1Y5LB 1IBMJ 4H54A 3BGFA 1F2GA 4K4ZA 1TVRB 2J7UA 2B6AA 1D3WA 1FWPA 3JTPA 1GTEA 4K2JA 2IJRA 2GVZA 4DLGA 3OJSA 2LDIA 2V50A 4P2FA 4URQU 1KLNA 3W65A 2GS8A 1OIAA 1RA7A 3P45B 3A8KA 1YRXA 4RW8A 1T05A 1C0UB 1FRIA 4WPAA 4IH6A 3NGKA 1V5VA 3I6PA 4KHPF 5CYMB 1TMMA 4U8YA 5KFAA 1WC6A 3D3CJ 1S76D 5CHCB 2HNYB 3QPIA 3F44A 3HX9A 2DO0A 2PSZA 5C5JA 1HBNB 4YB1P 1V3ZA 2KM8C 2AYBA 2JZ5A 2AYMA 3KMQA 4KBIA 2B43A 5IFMA 3GCXP 3TVZA 5HI7A 2HIQA 5HJXA 5KFSA 2XNQA 1KVIA 2V63A 2FYXA 4ELTA 1RT7B 2DXDA 4LIWA 1C4CA 1NCLA 3EWGA 2HFOA 2ZH4A 2OPRA 2NXEA 2QA4S 3VCDA 2ZHOA 2NREA 5K14A 2CQ4A 4V19X 2GV1A 4HHUA 3EVOA 3GPAA 4D3GA 2AGQA 1VDHA 1K9MT 3OLBA 5E3AA 2HHTA 1KOOA 4C9DA 4PXDA 4QW8A 2B9WA 3CJSA 2JJ4D 4LUBA 2XZWA 3J7YU 3R1LA 2XS5A 1OS5A 1B3TA 4OZJA 1JNZB 1KN6A 2PA3A 1X0FA 2RS2A 2POKA 4XAKA 3WIUA 3IM8A 3GLJA 3IWLA 4CTAA 3DRYA 2VC0A 3V4IB 1O0PA 3IWXA 1QY7A 5A76A 4RW7B 2R8GA 3R3TA 2QSWA 2ALYB 3Q86A 3HHLB 4J9RA 2HFUA 2L9WA 1QTMA 4NLXA 1LV5A 4OV6A 1VQPS 4O44A 5D4NA 2JDJA 1RU2A 1HNWF 1A6LA 3DMJB 2FIUA 4F3QA 2G2ZA 2F63A 2RHQB 1WG4A 4I4BA 2BQUA 4FYYB 5JXSA 2HRYA 3IWNC 4J9NA 2QMWA 1YJRA 4P2XA 3QT5A 3ZTRA 3KMSA 2VDHA 3MEGB 9ATCB 2NQPA 2WRMA 3AJDA 2JVOA 5DRKA 1H73A 2BE9B 2BJ9A 2QEXS 1FDNA 2WVFA 2YNIA 3BSAA 4CNYA 1IKWB 2BEFA 1Q8IA 5E0OA 2M4MA 4G1QA 4CLUA 3FJ2A 2HEKA 3GFXA 2NYIA 1IR2A 2E44A 2BV3A 2GAHC 4OZNA 3W3SA 3IS9B 2VG6A 1EB0A 4CLPA 3K5MA 4B02A 4ECTA 4GC6A 3GIMA 3M9OB 1HNVB 4OZLA 3A3OB 3PYEA 1A0OB 2CZVC 1F5CA 1ZM9A 3MCSA 2XWXA 3GU0A 2F4VF 3RW7A 5KG6A 2UXCF 1FDDA 4IO1A 2Q6BA 4J9SA 1U09A 2XC9A 1RWOB 3IP0A 3PM9A 4CYUA 1DRZA 4K4XA 4CP5A 2O3DA 5DQIA 3ZZ0A 2VOOA 2RUSA 5CCLA 1QAIA 1R31A 1RAHB 4MYUA 4LRAA 4KPCA 1VIXA 4KFBB 1Y5NB 3R6LB 2Y1IA 2NZ4A 5IC6B 4EZ9A 1AROP 1QE1A 1NB2A 1VLYA 4P75A 4Q0BB 2DHGA 3IBFB 3M2VA 4FVCA 2BRKA 3EYZA 1H6KX 4Y6IA 4LR8A 4UOGA 5SZTA 3LALA 2HNDA 2A3JA 4L72B 5D4OA 4DZDA 2GIFA 2V5HG 1NRKA 3R27A 3CJ5A 3TUJC 4OI3A 2VJUA 3KUEA 3K5OA 4B3SJ 2UVUA 3P4UB 2X51A 2DHXA 2YPYA 3J7Z5 2RU3A 1EJ7L 5D4LA 5F8NA 4RBUA 1PIEA 4QIEA 4IR1A 3RB0A 2AF6A 4MKBA 2ADCA 3I55S 4YQWA 3IR6B 5SUHA 4DV5J 4LIRA 4X4VA 2N4CA 1TTHB 4C11A 1B64A 4A8OA 4FF2A 1PAEX 3KDNA 3WC2A 5KFXA 5BYQA 2RHSB 1EHWA 3DOKB 5KTQA 3OUYB 3QAEA 3FMWA 3PO4A 2LDYA 4BDPA 3DFEA 1SB6A 3C3LA 2PA8D 4A47A 3PW4A 2HNZB 4RUBA 4O23A 2Z8QA 4H4KA 2VF3A 5EX3A 2I2YA 4K4WA 2KRRA 2J7KA 3G9CA 2ACMA 1JK9B 1VQLS 4YEAA 1FK9B 1NH8A 4IOAQ 3BGRB 1H98A 1NK4A 1NK0A 3JAMY 2VG7A 3I0RB 5A8RB 4ZVRB 1Q5VA 2W01A 2HVIA 2V8PA 1CJTB 1HIYA 3N5FA 3CDWA 2ASJA 1OWXA 5GADI 3H90A 3FBFA 2WONA 2YKMB 2ACYA 3OFFA 1HNXF 2BE2B 4Q43A 1W25A 2GVDB 4NPOA 2JLGA 4RNHA 2CJ9A 4JI4F 5IOLA 4LF8F 4LFAF 2VG5A 1YZ6A 3NXZA 4K4UA 3QO9A 1UTAA 3DYAB 3M8PB 2Y8YA 3MD1A 3CIMA 3FCVA 3KLVA 3MMJA 1YSJA 3OVAA 3EVMA 1VRQC 2I8EA 2CQ3A 1RDRA 2GIQA 2ROPA 2IYGA 2DNGA 4OYIA 4LRCA 3H0PA 3ENAA 5CYJA 3KHHA 1VCTA 3ILIA 1FRLA 1Q81T 4QZVB 4DV2F 3M4XA 1WOOA 4Y34A 5F8LA 4G65A 2I9SA 5KT5A 3TNVA 1U8WA 4U8VA 1X9WA 3I5AA 3HULA 1DTTB 1JLCB 3VWSA 2D9OA 3SXLA 1NO8A 1H3DA 2XMWA 3PNIA 1UW9A 5I4MA 2HWHA 5KOWA 1HBUA 3CVKA 3KK3A 3T1AA 2ZOMA 5ETSA 1OO0B 2FTRA 1DJ0A 4H4KC 1JXEA 2CWXA 3I9V9 5B7WA 4J9VA 1XIQA 1ZTWA 3DCAA 2BBEA 2MGZA 1U45A 3V81B 3NMRA 5LMNJ 1XTZA 1RWNB 3HLUA 2RQ4A 5G0RA 3HXMA 2HPUA 4OZ2A 1HYSA 2LFVA 2I5JA 4O4RA 4B3OA 4I2QA 2YNFB 4LF8J 3ISND 3OLAA 3E01B 2CJKA 4FZVA 1HWJA 2GQQA 3TI0A 2MY7A 4DX8H 4HACA 5DZ6A 3U27A 5ETVA 3M30A 2UUCF 3QGPA 1JLGA 1U24A 4OI1A 3MM6A 1F2HA 4ZVFA 3QYYA 1HHQA 2GX8A 1S9GA 4LF4F 2DHHA 4J37A 4UF4A 2N7YA 3BZQA 3SYZA 1M5PC 4W4MA 3AQPA 3NMAA 2V94A 5LXRA 4CLZA 2V8HA 4DV2J 4KYZA 5D8HB 3VALA 3OPKA 3W2WB 1JKHB 3EGNA 1I94F 1BXNA 1FHTA 2K1RA 1S1WB 5ETNA 2YKOA 2J5AA 3D6FB 2Z30B 2W24A 3PW7A 4PG4A 4KQZA 3RRGA 4J9PA 3VZIA 5AXMA 4Y2AA 2NR0A 4OV1A 2XM3A 2ZJQQ 4P52A 4YR3A 4LBIA 1DHMA 1SV5A 3ETMA 3I4HX 2B9EA 4UY85 4CIOA 1VIOA 2C3PA 2GJFA 1VBKA 1FRJA 3FEZA 3RU0A 5KFGA 3TRGA 3A8EA 3QLHB 4Q5VA 3C8YA 3OTOJ 1RWVB 2VIHA 1NZ8A 4X66F 1K1QA 5HROA 1XNQJ 4I6WA 4CT9A 3DDKA 4BBYA 2AJ1A 2E1AA 4URGA 1WHYA 1VISA 2HS3A 2BVZA 3D68A 3KJVA 2F65A 4QJVA 1GMWA 4CH1A 1SC3B 5MAOA 1SC6A 4OQJA 3MPYA 4ZA1A 4B3RJ 2P6TA 3H2UB 1FXDA 3SSSA 2IA0A 1IKXA 4RL1A 1YVFA 1N6QB 2EK1A 3S8SA 4M8LA 4MH8A 4R8UB 5KFOA 3KOAA 4CQ1A 1CJKB 4YY3F 1YLXA 2CJBA 1AB8A 2QMXA 4DUZF 4DL0C 4EO8A 3AA8A 2OEJA 5HMZA 4YR0A 3DRPB 2D9PA 3PFOA 2HBYB 4C8NA 3CD6S 5GAGU 5ETOA 4DR5F 2VUGA 3UPFA 2RF2B 5GVQA 3FSYA 3HD2A 1R27B 2DXFA 5FLXU 3CMAS 4DV4J 4LSLB 3MPVA 3TAMB 1M90T 1N56A 3GILA 2AEJA 1HD1A 4F4KA 4NEYA 1WSRA 2LQ9A 4ZDNA 5J2NB 1ZYQA 3PG9A 3MUVP 1U6FA 2GMLA 5HMXA 5HVHA 3G71S 4WFNQ 1VI7A 4ZPDA 3SCJE 1OPIA 2Y1RI 3DLEA 3MM8A 2YH1A 2VPYB 3MM7B 3HMJG 2GA7A 4TU8A 2HLTA 3LP0A 1TUGB 4KC5A 3CCVS 5F0WA 1E6YB 1XR6A 2R7QA 3S7RA 1GH8A 3GJSB 1XMOJ 3GIJA 1J2VA 2W4PA 2CPYA 3DLGA 3FSXA 1R43A 4TN2A 3RB3A 2ZNZA 2IC3A 4I7FA 3HHLD 5CD4A 1APSA 3POTB 2KG0A 2N3LA 5A8WB 3MF5A 2V4JA 3WIVA 1FRHA 3HT3A 4KH1B 1MU2A 1R0AA 3W5XA 4N56A 1AFJA 5A6PA 1H0HB 1RXOB 2FY8A 2X3DA 4FNHA 2D74B 2NS1B 3W8PA 3OVBA 4KGZB 2V8VA 1YBAA 4ZPAA 1RTHB 2WVEA 3BQ1A 1T03B 4IUFA 3S6EA 2BM1A 3NGRA 4XTTA 3VTIA 3LWMA 1RWXB 3KJQB 1BQNB 2ATLA 6FDRA 2OPPA 1EKSA 3C19A 2V8GA 2B8PA 1UL3A 2VA2A 4I64A 3OHAA 4ICLA 5LXYA 4PWDB 5GMEA 2YNGB 1X4GA 3H5XA 3MEKA 1PO6A 4TQSA 3NGSA 3DI6A 3DXBA 1KSPA 2VPXB 5IV4A 2H4WB 4JI0F 2W1BA 2QG9B 1WTFA 4WP9A 1VQYA 1FO1A 5B0AA 1LW2A 1PJ5A 2JX2A 5THWA 1IKYA 5T7LB 4HT7A 3RZAA 4CRJA 1B0PA 4DL7A 2FPHX 2LEPA 4MFBB 3C16B 1RAGB 2X1FA 2XMKA 4RWXA 1WKJA 1HR0F 5DLFA 1UFKA 4ALZA 3OW2R 2B5JB 1X4FA 1XERA 1U8SA 1YQHA 2KM8B 4DEZA 1HQUB 2GW8A 2LXIA 1RACB 1ZS6A 3KKFA 2BXJA 2AZ3A 3H8YA 4NL5A 3M8SA 1NHUA 4ID8A 1FNMA 3KLIB 3K5NA 3L09A 2HZVA 1KLMB 5ETQA 1T11A 1UCNA 5DG8A 5KT6A 4MK7A 3QFWA 3AODA 1FWLA 2Z4PA 4YMEA 3DN9A 2BX6A 1Z2ZA 4Q44A 1WTBA 3GV8B 2NPIA 3IRXB 4C8LA 3ILJA 4JI1J 3M32A 4Y2KA 4EYHB 1S6QA 5DM7Q 2EKNA 1WDTA 4I6AA 2CQGA 3IBCB 3K89A 2ASDA 1SPBP 1UWBB 5KT7A 2HFSA 3OFGA 3H42A 5KFDA 3M6UA 1KQFB 1ROFA 5J2MA 2HHXA 4CO3A 1LEOA 1YK9A 3PTWA 2HBRB 3SFUA 4IG0B 4QQBA 4AUKA 4B3MF 2A1BA 4XK8C 3BPDA 2J6UA 4E8UA 4JV2A 1GXUA 3JSBA 2VPZB 1YBUA 3MR6A 4HT5A 4PRFA 3D9BA 4NXMJ 4ZLPA 3P5BP 4UUWA 2V6AA 3QJPA 1HW9A 1ELOA 1RHQB 3C15B 1RTZA 4RW8B 5ETPA 3AOAA 2UUAF 3CJKB 4OZ0A 2F3JA 4DCPB 1RSCA 1HHSA 4KKOA 2R4FA 1N4LA 5KFZA 5H9FJ 4C3MA 4X4SA 2YWKA 1GT8A 2DNZA 2UUTA 3PRDA 2LYVA 2DH9A 1B0TA 2CZ9A 1RISA 1SCJB 1N34J 2RNEA 2J0QD 4UT4A 3B78A 1DARA 2V9KA 2MZRA 2F9DA 1O8BA 3MECA 2WOMA 3ZO7A 5EWGA 1FFWB 2EVZA 5KFHA 5ETTA 3AXKA 1UEVA 1KFSA 4NA3A 4WTOB 2FJAB 4NMXA 2HQFA 2C22A 2KT5A 3UE2A 1KBRA 2HSEB 3KLGA 4ZPWR 1J5EF 1URRA 4WYWA 2KT3A 1AUSL 1HL6A 1RLCL 4QWBA 3EM1A 1PBAA 2DIUA 3ZZYA 5D0HA 4NCAA 4NA1A 1VK8A 2FZKB 3VAGA 4FXVA 4PQUA 2V2QA 1P6TA 3ICLA 1Y00A 4Z7CA 4UUXA 2HHHF 3J7A1 3TVYA 1WKLA 3MEDB 1WI6A 2ILZA 1SC4B 2FC8A 4ID5B 1T9XA 5L1JA 2EFQA 5A6WA 2RKIA 1CLFA 2LECA 3M1VA 2HGLA 2ZJRQ 3QGGA 2HMIB 1YWXA 3MM5B 4DXLA 2B3TB 5KFEA 2A10A 3T5JA 1D09B 4KIAA 3AD7C 2RUGA 2EKYA 4NLSA 2YH0A 2D1CA 1FKOA 4M95A 1LK5A 2WVDA 2KFZA 1OQ6A 3JSRA 4LF9F 1X5PA 4DHVA 1R8PA 2UXBF 1TR0A 2NXNA 4H4MB 1JMTA 1U6BA 3NNAA 1IKVA 2MKKA 1S99A 1XC9A 2HK3A 4O44B 2XTJP 2E7XA 2BACA 4FP9A 3ENVA 3LPEA 1KNZA 3N6NA 1FWKA 3H59A 1WC0A 4N47A 2CQBA 3QRRA 4G1PA 2WK4A 1WACA 2CJYB 4PWWA 2ZC4A 4QU6A 1RTDA 2D69A 1Q7LB 3DLLQ 1EQ0A 2P9CA 1UETA 2R7RA 2BJDA 2CJQA 1TQLA 3HO1A 1S57A 1S6PA 3TAPA 5T41A 3DDNA 4MK8A 4G1QB 1VC6A 4LVOP 2OI2A 2JFDA 4A8XA 3Q8YA 4F4AA 4OLPA 1NK6A 2E5IA 4O0IA 3M8RA 4WZMA 2YQ3A 2Z2YB 1E6VB 3QIPA 3O8WA 4H4OA 2JLEA 3WC0A 4TU7A 3G82B 1OPZA 2X1GA 3CJQA 4USUA 4ECYA 2VBXA 5KT2A 5KFBA 2KHDA 4ES1A 3CF5Q 3N28A 1GMUA 3DU5A 3HHEA 4DBQA 4NMLA 4NLVA 5F9NA 2YPZA 3CJ3A 4P7VA 2CDQA 4USMA 4URSA 4AL7A 4XPEA 2BYCA 4ZVQB 3T9ZA 2DBBA 3B6BA 5G4DA 3JYTA 2VV5A 5KFKA 4ED0A 4NXNF 1KC8T 4IYQA 3W5ZA 2OTLS 3WBZA 4UQGA 2FZCB 4DX6A 3UCGA 1FJCA 2OKQA 2YTCA 5C42B 4OX9J 5I3UA 2AJQA 2E5HA 4J9MA 2DISA 4IFVA 4KGKA 1ACMB 2HNDB 3NBPB 3VR1A 5KFRA 1RTIA 4LRDA 1MW7A 3N5BA 2LXUA 4E0DA 4DOZA 4MKYA 1S72S 1QAYA 1Y3KA 1KR4A 4O3OA 2UUBF 4OHYA 4NYOA 4ELVA 5BR8F 2ROGA 3KDOA 1Q4RA 4KGXB 1Y7PA 3BSCA 3MPDA 3B4MA 1J5OA 1SBRA 4ZIWA 2IBOA 3I0SA 4QBUA 1UPPA 1CJUB 2MKJA 4WFZA 4C11B 3PW5A 3N79A 3MR3A 5D0EA 4ED8A 4OFZA 5DZ7A 4LF1A 1WOPA 1HI8A 3AB4B 1REVA 3TYTA 1R6VA 4FPIA 1VQKS 5LSRA 2KL8A 1IWAA 1RTJA 4G1IA 3HVTA 1UJ6A 5J1EA 2VQEJ 3UCZP 1WD6A 3N01A 3PKYA 1C0TA 2ZOGA 1IVZA 4DI6A 5IZHA 2RQMA 4YB6A 5HJYA 1Y9OA 3VAIA 1NU4A 3GMGA 3MFIA 3RTVA 1RYRA 3ZZPA 1X7VA 2HFZA 1YJNS 1MWYA 1NUEA 3ZZOA 2DCUB 1TAQA 3N6MA 2O1PA 1BC6A 1PKUA 2GNKA 2BOPA 3HFKA 2DPJA 2W9BB 3BO2A 4AXIA 1RT2B 3P5TL 4F4YA 3WX8A 4TY8A 1HWIA 2QO3A 4YB7A 2RQCA 1S1VB 4ED4A 2K3KA 1S49A 5IQ6A 3T6BA 4F2RA 1XR7A 4NLOA 2FUG9 2Z56B 2CQ0A 2IM1A 1WDDA 4S0MA 5IM0A 4JI8J 2WONB 3IN5A 1LQ9A 1X9MA 1NK5A 4ECZA 3IM9A 1RA6A 3J7AN 4A8WA 3GTYX 1NDLA 2VG5B 3G6YA 5D3GA 1X4EA 2W2OP 4W98A 4DS5A 1HARA 2DYAA 4MIWA 3QQCD 4PG5A 4TXSA 2D7SA 3LA0A 5EDWA 3M8QA 2PEBA 3MAAA 2YX1A 1WEXA 5IWAJ 2R7UA 2DD8S 3NWRA 4K4TA 2QT7A 4RX6A 1SH2A 3E51A 2XHCA 2XYHB 1JIHA 2YKQA 2ZBIA 1RUSA 1N5SA 1WEZA 3ONQA 2MKIA 1FJ7A 4M1KA 3PIPQ 2XI2A 2HVDA 3MMCA 3CTRA 2O66A 2VFTA 1ZM4A 4U7UK 2KT2A 2B8QA 1D0EA 5KG5A 3D0GE 4PUOB 4P9SA 3BS9A 1HBUB 2G13A 3IC1A 3OTDA 3TA1A 3V2UC 3LOUA 1UKUA 3W62A 3KK3B 1FXLA 2QMUB 2EPIA 3LUYA 2XSJB 4ECQA 1HW8A 2APOA 4GRSA 1CEZA 1KVJA 3Q24A 3HFZB 4KAIA 5AJ3F 2MGZB 1UFLA 1PBUA 1NJXA 5I3PA 1T94A 4C98A 1U49A 2BQ3A 2KN4A 1U1PA 2I5JB 1U48A 3BPSP 1S5ZA 1SKUB 1NSKL 2Z58B 3HI9A 1H38A 3GIIA 2DK2A 3O44A 4B3OB 3K8WA 3FQKA 1NSPA 3FGVA 1U1MA 2QRRA 4HACB 1CULB 3GFZA 3CJ8A 3M30B 2BUNA 3V5RA 1TFWA 1JLGB 4F0MA 3DLBA 1S9GB 4FPRA 1M5VC 1TK0A 3CW2C 3T5LA 4FVMA 1SJRA 3BDPA 2EBGA 2J9DA 1RWUA 5HN0A 2E1MC 1S97A 1SJ1A 3CJTA 1X4AA 2RRBA 4JI3F 2HBZB 2JEFA 1V6HA 3SV4A 2DPIA 1N33J 2DJWA 4Y0FA 4O3QA 3JSMA 4UOHA 2KO1A 4C8ZA 3G2XA 2ZUGA 5HAOA 2K1RB 4OX7A 1N54B 2AZ1A 2F8HA 2L08A 1H74A 5KFJA 2WW8A 4BC9A 2HHSA 2IVYA 5HP1B 3OR1A 5D4PA 1I1GA 2AJ2A 1XK8A 4QIFA 4KSEB 1BLUA 1SV5B 3SQGA 1TL7B 1Y0HA 3RYLA 4NZ7A 4J9QA 4WE1B 1ZZNA 4JV5J 1VYAA 1CPZA 3GYNA 1EAYC 5CA5A 1BQXA 2RD5C 4ZOSA 3MMAA 1S4EA 3JQMA 4IOBA 4DL6A 2ZH2A 3BDEA 2YWEA 1M5OC 1M0SA 2RMLA 3D0HE 1QD1A 3VGSA 1JLFA 1RKJA 1W7WA 5HROB 5LMUF 1RBOB 1MN7A 4F2SA 2WAQD 5KFMA 4CH0S 5IT9Y 2U1AA 3KJVB 2Y1JA 2BJ3A 3KHRA 2CVEA 2PFDA 1WF1A 4QOTA 3QFHA 1FFGB 1V5IB 1S1XA 2E29A 2UZAA 1SL0A 4JI3J 1UVIA 2NCKL 2GMJA 1M1KT 1NXIA 1R7IA 4AQYF 1IKXB 3NNCA 2E1PA 2AGOA 2JH3A 5K5MA 2ZVSA 1F9FA 3QBCA 1PC4A 1TKXB 4P74A 4DV1F 2NUHA 1V9OA 2YQ1A 2Q43A 4DCJB 2GC8A 2RQKA 4X64J 1G3OA 1FKPA 3EPIA 2HQ3A 3ZZUA 3MR5A 2C1EB 3AQOA 3M2UA 5KFVA 1Q8BA 1RAOA 2VU5A 3MM9A 5CYQB 3OD2A 3A4TA 1JJ4A 4N7TA 4PABA 3TX0A 2MKYA 1IM4A 4M5HA 4ED3A 2VFVA 2Z0GA 1G2EA 4C3KA 3D6HB 1N32F 1T9YA 3B82A 5J1NA 3RRKA 3GONA 4ECUA 4USVA 4WXOA 3RBZA 4M5DB 3RAXA 3RB4A 4MJKA 3QJJA 1IBLJ 2EFGA 2QZ8A 3O6QA 2CPHA 2V67A 1BD6A 2QJ3A 4Y65A 1RGVA 4EBCA 1ZTTA 2JWNA 2EXUA 2WTFA 5LMUJ 3V6HA 4HDHA 2KXNB 5L9NA 4F4WA 4CLYA 2RRNA 3Q2TC 6FD1A 4RBVA 3GV7B 3M2RA 2MSTA 4K5SA 1PSDA 3MM8B 2ZKTA 4ZVTB 3MHYA 3M7VA 1KVKA 2J6SA 1GX6A 5LOQA 3PZPA 1JXLA 2E7VA 1VK3A 2ZH5A 2FLNA 4WFBQ 4O3NA 1NK9A 1X4DA 2C3YA 2BOAA 4DR2F 3CCRS 2KKHA 1HKAA 3FFIB 2Q66A 1HPZB 4GKKF 1P9QC 5IT9U 3HSZA 3OTEA 4IH5A 2B4UA 1XBWA 2VQFJ 2J6TA 3QT7A 7FD1A 2OEKA 2LEBA 2L41A 3FZBA 3ET6A 4OZ3A 4QWEA 2QTWA 4EUVA 5KFNA 2CRLA 3KG1A 2JNJA 4JI2F 3OXLA 5FJ4A 4ANCA 1G4CA 3NY0A 1ZPVA 5E7OB 2V34A 5GADU 2W8LA 2F40A 5B0EA 3U1NA 2NXCA 4DR7F 2BABA 1UJ5A 2IIHA 1FI4A 2QLBB 2LKZA 5LJ5Y 4DV6F 4P2MA 4PG6A 2UXDJ 2AJFE 2C2MB 1AT1B 3BV8A 4LF2A 3I82A 2M88A 5BXIA 1HNZF 3Q8SB 2OPPB 5IV3A 2E9TA 4LSNA 1RYSA 3L4BC 1HMVA 3OQ2A 5LSLA 3IGNA 2D3O1 3LH2S 3P49B 3WDOA 4AL5A 4HEA9 1RAJA 1WC4A 3E3XA 2C3UA 3DI6B 1UVNA 2J76E 2PIIA 2HRTA 3OJUA 3P3DA 5FD1A 3PJ9A 3WHIA 4NEZA 4DV7J 1S4FA 4HI1A 4RW6A 3HM9A 1N36F 1FDBA 2BKNA 4DF4A 2M2BA 1VQSA 2Q1LA 4DL2A 4EZ6A 3OXGA 1AZSA 5HMYA 5M2PA 3KUHA 3H5YA 1VRUA 2ZM6F 2NXUA 3DRXA 4JYAJ 1KFDA 1SL2A 4QIVA 1VQ6S 2ZDPA 2VBYA 1IR0A 2G1DA 2MZSA 4F7VA 1WEYA 4DPUA 3RG6A 4K8RA 3RAQA 4CO2A 4KO0A 2HHUA 2EC2A 2Y9HA 2R2UA 1TKZA 1OSDA 2R2SA 2KH9A 2XULA 2MHNA 2BJ8A 3HVWA 2HWTA 3THVA 1XMQJ 1RWMB 4BHQA 3CCWA 5BYRA 4J90A 4KTQA 4LF6F 4LF7J 3MMBA 2HVZA 4OYAA 2DRBA 4B9SA 1RWPB 5KG1A 1TUVA 4ELUA 2IAJB 1QJHA 1R0CB 1VGYA 1NHKL 1U1KA 3MCMA 4CI0B 1QUVA 4CM2A 5E5NA 2V0NA 2C42A 3H2VE 4I67A 3TA0A 4LQ9A 5DQGA 4J91A 1VBYA 3UNGC 4KHMA 4Y00A 4WFXA 3I87A 1VHFA 2OD4A 3NCPA 2PD1A 4EK2A 4HR2A 3QAUA 1S9EB 2P6SA 2OSQA 2WW4A 3PEJA 1LWFB 1YBTA 2N3OA 4LR7A 2IRYA 2Z2ZA 3ITHB 3MI7X 1WHVA 2J0WA 3DLJA 4GKJF 3PJWA 3PV8A 1C0UA 1ZPWX 1HLWA 2KFYA 2JOQA 4ZCIA 1JLEA 3BO3A 2H54B 4OYXA 3J80Y 1DTQB 2AU0A 2EC0A 4LFBF 2R7SA 2RRAA 3BN4A 3HJFA 1RJJA 4RO0A 2HNYA 2V8DA 3CDEA 4WTYA 4C0BA 1HBNA 4DDFA 2IMWP 5ETRA 2XHWA 1HBMB 4FS1A 4CO4A 1IBMF 4F26A 1FJGF 1Q8KA 1T9WA 4E2FB 3OR2B 4NLDA 3O1LA 1ZM2A 5HMWA 4N8NA 1PGZA 2W2PP 3TEHB 2XLJA 1RT7A 5HK4A 1D1UA 4IG3A 4M5GA 3SFGA 2D3ZA 1HD0A 3BKTA 1SKWA 1UZHA 3DXSX 2WB4A 4OMFG 4X65J 3ZTQA 4ZLNA 4MYTA 4QWDA 1L3KA 1X31C 3QZ8A 4ZPCA 5B0BA 3VAMA 3PY8A 4LFCJ 2WOMB 1VQ7S 4DR3F 3K59A 3L7UA 4XIUA 2V2ZA 4CM0A 3BF4A 2CPIA 4DZ6A 3DU6A 3SI8A 9RUBA 2MQNA 4PAAA 4MKVA 2MZ1A 5C25A 3GQCA 4A48A 1WNEA 2RSQA 3V4IA 4DR6F 2IDLA 3CGIA 1S59A 2Q6CA 3HHLA 1NB7A 3CC4S 3DGPB 4PQUB 1XWLA 4BC7A 2HFNA 3BEGB 2LMIA 4NLUA 2CQ2A 3DHXA 3KHLA 3JTOA 2RKIB 2ZE2A 3DMJA 3GJTB 2A6OA 1SH0A 3M1VB 3ELHA 3I4PA 1FJGJ 5DQHA 5F3ZA 4KPYA 4EBDA 3TR5A 5K8PA 1TMJA 5CXTA 4WKYA 1XN9A 2OFGX 1JLAA 2UU9F 3A8IA 4A8YA 3UQSA 1F3VA 5L39A 4EO6A 4PXBA 4Y2IA 4TVAB 4CLTA 1X5SA 4P7TA 4O3PA 1X8DA 1OYEA 2X7IA 5F0UA 3EICA 5L1LA 2HHVA 4JV1A 1TV6B 2Y1LB 2FGCA 2YWWA 3K58A 2GGPB 4DR3J 1HNVA 1UW4A 5GAEI 2AJ4A 3CCES 1LFPA 4B3TJ 5DDOC 3KLFA 3C14A 1FD8A 4OYWA 1F1BB 3KYLA 4WU2A 3OTBA 3RBXA 3SSQA 3N6LA 4F4ZA 4J7CA 4DSIA 1YKWA 4WYLA 1VQNS 2G0JA 1BY9A 1I51B 4ZP7A 3BN7A 3CE8A 3MR2A 1U1QA 4DR6J 1FDAA 1RT4A 3T1HF 3TANA 2EFVA 4KFBA 5KFFA 5CCMA 3PX0A 5J2PB 4X4QA 2VL1A 4JI7J 2D3UA 2E9RX 3BO4A 5A2QU 5AE3A 4Q0BA 2ZITA 1R8HA 3A13A 3GSDA 2F7VA 2RT3A 3HHLC 4N5SA 4UZBA 4DL5A 3BBFA 2PN6A 1KDNA 1WG5A 4ZCKA 3T5HA 2CPJA 3LGHA 4QYZJ 3GWCA 2QL5B 3PRVA 4NCGB 2Y3YA 2N4DA 2CDRB 3JYTB 2UU9J 1QDUB 4HTIA 5ITHA 3OT9A 2AHOB 2AWZA 3CB4A 4RUAA 3KK1B 1Q7YT 5DG9A 2HZAA 1L3TA 3QT8A 1NK8A 2ZHAA 2CPEA 1FA0A 4IFVB 1FEEA 2FJDB 4B08A 1YRUA 1TFYA 1KTQA 1VRTB 4A8SA 2UUWA 1RTIB 4M5LA 4ZJQA 5IT4A 3MTJA 3DOKA 2CPFA 1ICEB 2Q79A 5B0CA 5T14A 3EMTA 4YHHJ 2COLA 1FF2A 4Q2MA 4C7QA 1K73T 5HL7Q 2HNZA 2DY9A 3FC9A 2BA9A 2E5LJ 4B3SF 4R0EA 2JLFA 3X3UA 4RLEA 1Q95G 2HBQB 1JXVA 4ECSA 1FK9A 1NJIT 4FXDA 3NAIA 1Q8LA 5HLFB 3T1HJ 3W63A 1NDCA 2MZTA 3EGVA 1D9DA 4WJBA 3I0RA 2CQPA 1UMJA 4DV5F 2NLWA 5A8RA 1REVB 4WFAQ 4EWTA 3IXQA 2C3MA 5EHHA 1LWEB 3KNGA 2E1RA 4A8KA 2LCWA 3T1YF 1MROA 1YDLA 5FDLB 2YKMA 2LVWA 1C4AA 3AB2B 4DU7A 2BE2A 4KGMA 4AFFA 2G4BA 3IR7B 1LOUA 1AA1B 3WX4A 1HFEL 1VC0A 4BWMA 4RW9B 2C2DA 3CUNA 1GEHA 2N82B 1XEZA 1YRTA 3DYAA 3M8PA 4TY8B 3QZ7A 2W4CA 4DN0A 2VKRA 6AT1B 1NPKA 4TYBA 5ETLA 4C97A 1Y4ZB 3DM2B 4I69A 2LU2A 3P8BB 4WK1A 4J9OA 5IM0B 3I5BA 1TELA 1TP7A 4JI5J 3LP2A 2QLJB 3DDIA 1N5VA 2XO6A 2P9EA 2JEJA 3BJYA 1J27A 1TL4A 4ER8A 2HHQA 1WI8A 2JFKA 5D3GB 5DDRC 3G86A 1YZ7A 2R8IA 2IM3A 3ZC4A 3P96A 1VQ4S 1S1UB 1DTTA 1JLCA 5KFIA 2H51B 1VQ9S 2KZMA 1UEKA 2IHR1 3CCSS 2BRLA 2M3DA 2VFUA 1KONA 1TU0B 5J1PA 4FF4A 3RUBL 4KV8A 4UOCA 2VA3A 3WZ0A 1G7CB 4X4RA 2AV5A 2F5GA 3V81A 1CG2A 5LSOA 1RLDA 2XGPA 1C1CA 2UV8A 3T1YJ 4TU9A 3MMCB 3G6ES 5KG2A 4FN5A 3LF0A 2VJVA 4OHVA 2XMVA 3R5GA 2OLWA 1Y11A 1RT1B 1Y5IB 4DR1J 3OVSA 5DETA 2E9ZA 3EZUA 3W9IA 2MLYA 4P72A 4DSLA 2AEMA 2HS0A 1FVSA 4L75A 2J8SA 3UD5A 1UPMB 2DHSA 4DSKA 3JS9A 5LMNF 3BBCA 1I3OB 4M5IA 1U4BA 3FRYA 2DGUA 4N76A 2FHKA 2H5JB 1OJ4A 3CCQS 3D5MA 2WSEC 5KFQA 3KHGA 5C2GA 1RWKB 1S1TB 1S1WA 4F36A 2UVVA 4LMZA 4RNMA 4WK3A 1HA1A 4USTA 3MAHA 3H2LA 3HHDA 1X4CA 2LQ8A 2ZJPQ 3FVYA 4DUYF 1LWXA 3OL9A 3CD7A 1PAUB 5KAKA 4OHZA 2DRAA 2KYXA 1H2TZ 4O4GA 2XMJA 2GJIA 2AX0A 1B99A 4ZJOA 2SXLA 3SSRA 3UWTA 4ZLLA 1IJEB 1M5HA 1FNOA 4F67A 3NG8A 4DPTA 4DJBA 3D6MB 1Z1ZA 3UDEA 3KXDA 2E5GA 3W1YC 1LW0B 3MWBA 4IFYA 4ILLA 4WFYA 1VS3A 1ZZFA 3OBIA 4USWA 3UVJB 2JHEA 1U0HB 2B7BB 5ETMA 5D6GA 1N6QA 3ZNJ1 2BW2A 4ED5A 4R8UA 3VVUA 2DHAA 4N8OA 2EFPA 1HBOA 1T9UA 2GHVC 3DC2A 2CFXA 3MD3A 3AOBA 1T9VA 2RDJA 3OTOF 1CJKA 3JAMU 3M05A 4ZVSB 4X62J 1JLQB 1X5TA 1XNQF 2HWIA 2AD9A 4DFJA 1JX4A 1UVMA 1VC5A 4DUYJ 3DRPA 3T9NA 1S1XB 1IM6A 3WQPA 2XB2D 4NRUA 4WP3A 1LWCB 1XJWB 2RF2A 2Y0BB 4B3RF 3PR5B 2C2ZB 4LSLA 3TAMA 1F60B 1MWZA 4CLKA 1XNRJ 2DO4A 4RU2A 3C6TB 3EZ5A 1NJWA 1FKPB 2J9DE 1MMDA 3MEEB 2QE5A 1Y10A
chains in the Genus database with same CATH topology
1QTMA 2L9WA 2D7SA 4NLXA 3U7JA 5EDWA 2QSFA 2W8KA 3M8QA 1LV5A 1SJQA 2YX1A 1VQPS 1WEXA 4O44A 2Z2MA 2F8MA 2R7UA 2DD8S 4K4TA 3EGZA 2B51A 2ERRA 2QT7A 5I42A 5D4NA 2DNNA 2JDJA 3OL6A 2JL9A 1U2FA 2VONA 1KOHA 1HBMA 2LLZA 1JJ2R 3NCQA 4RX6A 3MM9B 1HNWF 1SH2A 1A6LA 2XMMA 3QGHA 3DMJB 2FIUA 2W7AA 3E51A 3DLKA 4F3QA 3L3CA 1Q86T 2PMHA 3IRWP 2DVIA 1WG4A 4I4BA 2BQUA 5JXSA 1JIHA 2YKQA 2HRYA 3IWNC 4J9NA 2QMWA 2ZBIA 2ZH8A 2M7SA 2AX1A 1HQEB 1YJRA 4ICLB 1N5SA 3OR2A 4G6VB 3MM7A 1N5QA 4TLRA 1WEZA 1QLNA 3KMSA 1TL3B 3ONQA 2MKIA 3MEGB 1SJ3P 2NQPA 2WRMA 1FKAF 1SH3A 2JVOA 3CDUA 3SEOA 5DRKA 2R8KA 1KTVA 4M1KA 1FJ7A 4AYBD 3WC2A 4DV4F 4DQIA 3PIPQ 2XI2A 3MMCA 2QEXS 1FDNA 2YNIA 4CNYA 3BSAA 2GHWA 1IKWB 2J9EA 2AYEA 1RI7A 3CTRA 4ZVGA 2O66A 1E6YA 1Q8IA 3UDCA 4WF9Q 5E0OA 2M4MA 4RBTA 2VFTA 4G1QA 3DRSB 2AQ4A 3D1OA 1ZM4A 4U7UK 3FJ2A 2KT2A 3GFXA 1D0EA 2QFJA 2NYIA 2BR0A 5HBMB 5KG5A 3D0GE 2CYYA 5J2QB 1LW2B 2E44A 4CCHA 4PUOB 2BV3A 3IAM9 3BS9A 2ZH9A 4CNZA 1HBUB 1ZETA 2VOPA 2G13A 3IC1A 3OTDA 4OZNA 3TA1A 3V2UC 3LOUA 1UKUA 3W3SA 5IS2A 1SL1A 4W92B 1IKYB 2IRUA 3KK3B 1FXLA 4OHXA 3IS9B 2EPIA 2VPWB 1JLBA 5KFYA 2VG6A 3POTA 4OIXA 4R5PA 3K5MA 3LUYA 3NWGA 2XSJB 5KFLA 4ECQA 3RR8A 5A8WA 1HW8A 2APOA 1OSCA 3M6VA 1CEZA 3LAKA 1KVJA 1NHVA 1SKSA 1WHWA 2P9GA 4B02A 3Q24A 4KAIA 4ECTA 4GC6A 3GIMA 5AJ3F 2MGZB 1Q78A 3M9OB 4GMKA 1UFLA 4DL4A 1WF2A 4U7CA 2DGWA 2DGVA 2P5VA 1HNVB 4OZLA 1NJXA 1RT3A 5I3PA 5F8IA 1T94A 4C98A 4ZCMA 1CC7A 1U49A 2BQ3A 2CZVC 1F5CA 4RUHA 4RUCA 1SIZA 2KN4A 1ZM9A 1H2UX 3NGDA 1U1PA 3LPYA 4WIIA 3MCSA 2I5JB 3F41A 3UFCX 2XWXA 1U48A 2F4VF 3RW7A 1Z2LA 4Q8EA 5KG6A 1P1TA 2UXCF 1S9FA 2XCAA 3HI9A 5KG4A 4RU9A 4FF3A 1H38A 1FDDA 4IDKB 3GIIA 2DK2A 2VBZA 4IO1A 1LKZA 2Q6BA 3O44A 2FY1A 1VOMA 4B3OB 3K8WA 4J9SA 2PI5A 1U09A 3FQKA 2XC9A 4F8RA 2CPDA 3PM9A 3FGVA 5B0GA 5DJBA 2DNHA 3GB0A 1U1MA 1XMOF 4QCLA 1DRZA 1RTHA 4K4XA 2QRRA 2O3DA 5DQIA 4F3OA 3ZZ0A 2VOOA 3GFZA 1GAOA 3K2YA 3MGJA 5CCLA 1QAIA 1R31A 3DGPA 3M30B 4MYUA 2BUNA 3V5RA 1TFWA 1JLGB 2R7WA 1VIXA 4KFBB 1Y5NB 5KFPA 3PW2A 3DLBA 1B7FA 2E7WA 5IQQA 5DDQC 3NCRA 4OX6A 1Z4UA 4X65F 2Y1IA 1S9GB 3JSYA 1D8ZA 4FPRA 3G8SA 2AJ0A 1TK0A 1YJUA 1M5VC 2NZ4A 2M9KA 2RIJA 5F9LA 3T5LA 1AROP 4FVMA 4EZ9A 1QE1A 2JC1A 2EG1A 1SJRA 1S6UA 1WF0A 3BDPA 2EBGA 1VLYA 4L3NA 1GX5A 4Q0BB 2DHGA 2I0XA 2ZD1B 3M2VA 2FJXA 2J9DA 4LFCF 2OSRA 4FVCA 1RWUA 5HN0A 5DDPC 2E1MC 1S97A 2BRKA 3M32B 3ISNC 3EYZA 1NKCA 1SJ1A 1M5SA 4IKAA 1H6KX 2DH8A 1FRXA 4Y6IA 5SZTA 1X4AA 1AXQA 2RRBA 4JI3F 1TVRA 3LALA 2HNDA 1S6QB 2JEFA 4C8KA 2CIMA 4F02A 2ZHBA 1V6HA 2A3JA 4X84A 2IJNA 3IG1B 3PJXA 1WELA 4I56A 4L72B 3M9NB 5D4OA 2MDAA 5DGBA 3SV4A 1Q82T 1U1OA 2GQCA 3CCMS 2DPIA 2V5HG 1NRKA 2B0GA 3R27A 2VZ9A 1EP4A 3LP1B 2DJWA 3CJ5A 3TUJC 3NP5A 1IJFB 4OI3A 5DM6Q 4Y0FA 4RWWA 4O3QA 4EFAC 3CC2S 4O3RA 3K5OA 3JSMA 2WB1D 4OI4A 2K3IA 2KO1A 3OSNA 4C8ZA 2ZUGA 5J2MB 2MQOA 2UVUA 1RT6B 3TX8A 3QMQA 2K1RB 4OX7A 2X51A 1UJ4A 1HI0P 2DHXA 3J7Z5 3FCHA 2RU3A 4OLOA 3HVAA 5D4LA 5F8NA 4RBUA 1N54B 4KE5A 2F8HA 2L08A 4OI6A 5KFJA 1WG1A 5CYMA 4QIEA 2X3GA 2WW8A 4BC9A 4IR1A 4NLPA 3RB0A 2HHSA 2IVYA 2AF6A 5HP1B 4Q8FA 4MKBA 3OR1A 3RBEA 2GMHA 2ADCA 3AHPA 3I55S 3N4WA 4YQWA 1PC5A 2LU1A 4O3SA 3M6XA 1TV6A 5D4PA 4IOCQ 3GE9A 1I1GA 3IR6B 4HI2A 5SUHA 3BSOA 3THTA 1XK8A 4LIRA 4QIFA 1L3VA 4X4VA 4MFBA 3IAS9 4KSEB 2N4CA 4XDCA 1BLUA 4C11A 4YOEA 5E2QA 1SV5B 1B64A 4A8OA 4FF2A 2GGPA 3SQGA 5H1SV 2VODA 1D9FA 1Y0HA 2CZ4A 4PKDB 4NZ7A 1RK8A 4WE1B 5BYQA 3RYLA 5KFXA 4J9QA 4AL6A 1C1BB 4DG1A 2O01C 3CD5A 1ZZNA 3DOKB 2RU9A 4QU7A 5KTQA 3OUYB 2CQIA 2B5JA 2CPZA 1CPZA 2R7XA 3GYNA 3QAEA 3FMWA 3AAWB 1Q1KA 3TVKA 3PO4A 3GG0A 5CA5A 2JVRA 1BQXA 2LDYA 4V19J 2XMUA 4BDPA 2RD5C 3CCZA 3DFEA 1SB6A 4ZOSA 4QW9A 3C3LA 2DGOA 2PA8D 3MMAA 4A47A 3PW4A 4IOBA 4DL6A 2HNZB 2ZH2A 4O23A 4C8OA 2RB7A 3BDEA 2YWEA 3UI3A 2Z8QA 4H4KA 1M0SA 1M5OC 1K0VA 2RMLA 4KKOB 5EX3A 2I2YA 3D0HE 4K4WA 2KRRA 2J7KA 4ZP6A 1JLFA 3KLEB 2GQ2A 1VRUB 3G6VA 1RKJA 2FVPA 3G9CA 1JK9B 4P6QA 1VQLS 3KLIA 3PKMA 1DLOB 4PG7A 5HROB 4YEAA 1FK9B 3PXGa 4DSEA 4KHRA 5LMUF 2C28A 1ZBTA 5LJ3Y 4ITSA 3U1MA 1JNRB 4F2SA 2RDIA 2WAQD 5J2PA 5KFMA 4J5OA 4CH0S 4F50A 2DNKA 1NH8A 3B4DA 4IOAQ 1RP5A 2B4PA 2WSCC 3QWUA 5IT9Y 3BGRB 2U1AA 1H98A 2B56A 4KO0B 3KJVB 1NK4A 1NK0A 2X1BA 3JAMY 2VG7A 2LXFA 3I0RB 2Y1JA 5LT5A 3KHRA 5A8RB 4TKTA 4Y2MA 4C4WA 2CVEA 2HVIA 2GCFA 1Q16B 4X4TA 4DQQA 1K8AT 3KTQA 3MECB 1WF1A 1WWHA 4QOTA 3RB6A 3DOLB 3N5FA 3CDWA 1S1XA 2ASJA 2BANB 1OWXA 5GADI 2IM0A 3ENWA 2UZAA 2E29A 3DRRB 1SL0A 4B3TF 2PMZD 4RW4A 1YJTA 3K8VA 2KDOA 2WONA 1UVIA 1M1KT 2GMJA 2AW0A 2YKMB 2ACYA 3SDEB 1R7IA 4ZPBA 4AQYF 3OFFA 1IKXB 2G0CA 1HNXF 2QLWA 3NNCA 2QA4G 2DB1A 2DGTA 2BE2B 4Q43A 1W25A 3G8QA 4NPOA 3GYXB 4NCGA 2AGOA 1VQ5S 2JLGA 3KK2A 1B0VA 2JH3A 5K5MA 3KLGB 4RNHA 2ZVSA 1F9FA 2CJ9A 4JI4F 3Q8PB 1TZ0A 1PC4A 4LF8F 1TKXB 2FVRA 4LFAF 2VG5A 2L48A 4DV1F 2NUHA 4PG8A 2V4QA 1V9OA 2PEHA 4MAKA 2Q43A 4NYZA 3VAHA 3RW6A 2W7PA 4ILMA 2GC8A 3LW5C 1NAQA 4UW2A 1U26A 2RQKA 5C24B 4K4UA 5AXLA 3QO9A 1O5JA 4IG0A 2XCPA 3KK1A 1G3OA 3R5CA 2ASLA 1FKPA 3EPIA 2HQ3A 3ZZUA 3MR5A 4RW7A 5BYSA 2JRSA 3DYAB 3M8PB 2U2FA 4CO1A 3MD1A 3CIMA 3AQOA 3M2UA 1VBZA 4NCBA 4W90B 5GMKa 4YDXA 3QJLA 1DQ9A 3C6UB 2MZQA 2MSSA 1ZAVA 3KLVA 3MMJA 1YSJA 3OVAA 4JI7F 2I8EA 2CQ3A 1RDRA 5KFVA 2GIQA 2ROPA 2IYGA 1VRTA 4YR2A 1Q8BA 4HL9A 1SI9A 4X2BA 4JI1F 3MM9A 2XS2A 5CYQB 2DNGA 2W7OA 4FS2A 5EWEA 3TW0A 1FRKA 4I68A 3Q0AA 3EXYA 1JJ4A 5IXUA 3CC7S 2JC0A 1HQEA 5CYJA 2EW9A 3KHHA 1RT5B 1IM4A 2ZH7A 4CO0A 4ED3A 2ROEA 2A2DA 2VFVA 1FRLA 1TL3A 1Q81T 5L9XA 2Z0GA 4QZVB 4DV2F 3MEGA 3M4XA 1G2EA 4C3KA 1N32F 2CJAA 4Y34A 3CJKA 2RE1A 5F8LA 1FKOB 4JUZA 2I9SA 5KT5A 3MURP 1U1LA 3TNVA 3B82A 3TQ1A 1JLEB 1X9WA 1L3UA 5J1NA 4OJ1A 3D0IE 3RRKA 3I5AA 4ECUA 1IKWA 4WXOA 3RAXA 4M5DB 1DTTB 4NLGA 1JLCB 7FDRA 3RB4A 2C2RA 3F56A 4MJKA 2ILYA 3VWSA 3QJJA 2D9OA 1T3NA 3CJ4A 4JBCA 2EFGA 3DRSA 1IKVB 1TL1B 3I56S 3SXLA 1NO8A 2XMWA 1H3DA 2QZ8A 3PNIA 3O6QA 4C3LA 2CPHA 1L5UA 1BD6A 4K5RA 1OQ3A 4YB5A 3PW0A 4Y65A 1RGVA 4EBCA 4GO5X 5HLFA 1ZAWA 4Q45A 2MKHA 4NZ0A 3ZZTA 1ZTTA 2JWNA 5I4MA 2WTFA 2HWHA 3BGUA 2OMOA 3V6HA 5KOWA 2J0SD 4HDHA 1HBUA 4YP3A 3D1HA 3PRBA 2KXNB 2Q3PA 5L9NA 2KTQA 4F4WA 3CVKA 3Q8QB 3KK3A 3GR0A 3T1AA 3IS9A 4NA2A 3BGLA 2RRNA 2ZOMA 4QR0A 3Q2TC 1OO0B 2FTRA 2YKNB 1DJ0A 6FD1A 2DR5A 4DSJA 1HWUA 3HKZD 4RBVA 4H4KC 1JXEA 3GV7B 3M2RA 2J9CA 2MSTA 3I9V9 4K5SA 5B7WA 1PSDA 3MM8B 2ZKTA 1LWEA 3MHYA 1ZTWA 5E33A 4CT8A 3H5UA 3DCAA 1TK5A 2BBEA 2MGZA 3CDAA 3GIKA 2ZBCA 1U45A 3T5KA 3T19A 3V81B 3C46A 4NXMF 2J6SA 3NMRA 3RRHA 1RTDB 2ASYA 2W25A 1GX6A 1XTZA 1N8RT 3PZPA 1JXLA 1RKIA 3HLUA 3CDBA 3B8HA 2RQ4A 5FDLA 5G0RA 2M5YA 2BJEA 2IM2A 3HXMA 2HPUA 1CQMA 4MMOA 3MUTP 1BWEA 1VK3A 4YHHF 4AXJA 2FVQA 2FB0A 2KG1A 2ZH5A 2FLNA 2WHOA 4DQSA 1HYSA 2DITA 2I5JA 4WFBQ 2ZH1A 4O3NA 1NK9A 1S6PB 1X4DA 3C2PA 4O4RA 2C3YA 3SCIE 4B9TA 5KG0A 4DR2F 3CCRS 2KKHA 3FFIB 1T95A 4IG3B 3CJ2A 4GO7X 4RW9A 4YUDA 2E5LF 2Q66A 4B3OA 1U6ZA 3CIZA 4I2QA 1HPZB 2YNFB 2MYFA 4GKKF 3IO1A 1P9QC 3ISND 3OLAA 3E01B 2CJKA 3OTEA 4FZVA 4IH5A 3BR8A 2B4UA 2B9XA 2W9CB 3PHEA 1HWJA 2GQQA 3GFHA 1FTRA 1XBWA 4Z2XA 3TI0A 4K50A 2MY7A