2N4DA

Ec-nmr structure of agrobacterium tumefaciens atu1203 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target att10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
AGLSFHVEDMTCGHCAGVIKGAIEKTVPGAAVHADPASRTVVVGGVSDAAHIAEIITAAGYTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Agrobacterium fabrum str. c58
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein Atu1203
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n4dA00
2BBEA 4Y2KA 3GZ7A 5F0WA 4YDXA 2BYCA 5IXUA 5F0UA 4HL9A 2IFXA 2K7JA 5T7LB 2FTRA 2OFHX 1AFIA 4F67A 1QUPA 4HI1A 1OSDA 2K1RB 3CJKA 1YJRA 4FNIA 5B0CA 1APSA 3VTIA 4NL5A 1FE0A 1R6YA 2RILA 3E8OA 2AJ0A 2GV1A 2XMWA 1YG0A 2AJ1A 3HHLA 3KG0A 3DXSX 3TOQA 3KG1A 3UDCA 1Y3KA 4OJ1A 4OJ3A 2LDIA 5B0AA 1K0VA 2G9OA 5B09A 3KKFA 4NPOA 3HHLB 3MZIA 5KAKA 3BB5A 1LQ9A 2HFNA 1URRA 2XMTA 3BF4A 3FRYA 1KVJA 1GXTA 5B0GA 2VV5A 1Q8LA 4YEAA 1SI9A 2K1RA 1FEEA 1X8DA 2ZDOA 5B0FA 1P8GA 2GCFA 2ROEA 1CC8A 2KKHA 5B0BA 1SB6A 3HHLD 2QYCA 1MWYA 1TL4A 1N5SA 5A6WA 1AW0A 1CC7A 3BM7A 1ULRA 3HHLC 1MWZA 2N7YA 5B08A 1JWWA 1VQSA 2W4DA 2FHMA 1VQYA 3BGUA 2N4DA 2KT2A 3BN7A 5A6PA 1OQ3A 4A46A 1KVIA 1IUJA 2ACYA 3IWXA 4FNHA 2QLXA 2LQ9A 2OAUA 2HIQA 4OIXA 2GGPB 5K9FA 4QOTA 2BJDA 3HFKA 4ZA1A 2KT3A 2VH7A 5B0EA 1S6OA 3BR8A 2OP5A 3LGMA 4U9RA 3TNVA 1YJTA 3HX9A 3T9NA 2OMOA 2W4PA 4HI2A 1GXUA 2HLTA 1TR0A 4OJHA 1CPZA 2L3MA 1YJUA 1RJJA 3QMQA 1YJVA 4EFAC 1Y3JA 1FD8A 3LO3A 2XMMA 3WDOA 4HH1A 2OKQA 1FE4A 1SQEA 1OPZA 1AFJA 2W4CA 1N5QA 2OD4A 2Q3PA 2GGPA 5B0DA 4HH0A 1FVQA 3DCAA 1YRXA 2LXFA 1XBWA 2LQBA 3FMBA 4Q2MA 2IYIA 1Q8BA 2FB0A 1Y9OA 2K7KA 2CRLA 2IYGA 1N5VA 3K7RA 1TL5A 2HLUA 2ROGA 2RSQA 3I9ZA 1TUVA 1X7VA 2GFFA 3F44A 1P6TA 2HFOA 2QLWA 1Q53A 4A48A 1Q4RA 2RU9A 5T7LA 1FESA 2JDJA 3KNGA 3QGPA 2K2PA 2EW9A 1KQKA 2N4CA 2XMJA 2PD1A 2FIUA 4A47A 3FGVA 4Y2IA 1U7LA 4OJGA 1WD6A 4ZOSA 2XMUA 2RMLA 1V3ZA 1X0PA 2ZDPA 3HDSA 1TZ0A 4DPOA 4A4JA 2KYZA 2ASYA 1FVSA 2BUNA 2PGCA 2QIFA 2AW0A 3LGNA 1S6UA 3TRGA 3IWLA 2OD6A 1W2IA 2GA7A 4Y2MA 1JK9B 2AP6A 2GO8A 3CJKB 2ROPA 3MCSA 2HQIA 2XMKA 4DL0C 2BJEA 3BDEA 1OQ6A 2OFGX 2XMVA 1Y0HA 1N5TA 4Q2LA 3HF5A 4DN9A
chains in the Genus database with same CATH superfamily
3M6XA 3DLJA 1M1HA 4K4XA 1VC6A 1IR2A 2KB2A 3O3LA 3ZZOA 4PXBA 5BYSA 1F9FA 1ZTTA 1U1LA 5E2QA 5A8RB 2AJ2A 4B3OB 3MEGB 2NUHA 2R2RA 4PWUA 2HVIA 1X9WA 3NCQA 2G1HA 3W8PA 4AL6A 1YRTA 2BJ9A 2HS0A 2XEXA 4FNIA 4C0BA 4DPYA 3NP5A 2DR8A 3KTQA 1DFDA 2FLPA 3LGHA 1YJWS 5AJ3F 2FJXA 4OV6A 2KXNB 1UKUA 2I6WA 3Q83A 1D8YA 1RKIA 5A0YB 5KFWA 2MY7A 3KLHA 3I5CA 1I5OB 4PXCA 4C8YA 3GCWP 3PZPA 4OI0A 3AD7C 3P8BB 1JLAB 1YK9A 2BKNA 4CQ1A 3MEDB 3O6QA 4ED2A 3EICA 2CQDA 3POTB 1FF2A 2J7UA 2YKNB 1CULA 1URRA 2ZBCA 2E7XA 3GTYX 2M0GB 2YKMB 3EVMA 1REGX 4ILRA 4ECYA 4NLGA 3DHXA 2EC2A 5B0FA 1HD0A 3JB9k 1N32J 1CC8A 2DK2A 2B4UA 2Q6BA 2QYCA 3EPIA 4DV2F 4KY3A 3N6MA 3D6HB 2B9WA 3CD0A 1GX5A 2H4WB 3E3XA 1LXNA 3ETMA 3HHKA 4M5JA 2N4DA 4PKDB 1RAOA 4B9VA 1OQ3A 4RR5A 1IBMJ 2B0GA 3I56S 2DEJA 3CMES 3TVKA 2YQ3A 4Z7CA 1LXJA 1RI7A 3TP2A 2LECA 3KLIA 3GYGA 1TMJA 4FPIA 2XYGB 3GJTB 1FWLA 4RW4A 2W9BA 2KT3A 3IN5A 2W7AA 4C3KA 1G4CA 2B51A 2E5IA 3U27A 5J2MB 5KG3A 4USMA 5CH7B 4DV3F 1SUQA 3MM7A 3PY8A 5CYMA 4OJHA 2DVIA 1C1BA 2BW7A 1WF0A 3ELHA 4OX6A 4RW9A 2XQCA 4DR2F 2NQPA 4BS2A 1RACB 1U1PA 1NKCA 2XMMA 2LXUA 1IQTA 3PRVA 3S7RA 1UEUA 2OKQA 4MKVA 3RYLA 1VC5A 4DUTA 1VHIA 2F8HA 5DDPC 2V9KA 1RWMB 1QM9A 4MK8A 2R8HA 1JJCB 4HH0A 1N6QA 2JFDA 1SV5B 4KHPF 3CJSA 3ZZYA 4MAKA 3WIVA 4Q2MA 2NXCA 3Q8YA 3R9LA 2NS1B 2IYIA 1C1CA 3MUTP 1NPRA 4A8WA 4DR4J 2GNKA 3DGVA 2MZQA 4G1QA 2DRBA 4A8QA 4ZLLA 2DO4A 5K8NA 4KFBB 4G3IA 3QLHA 3VQTA 2A0FB 2HFOA 1ZPVA 2UUAF 3FC9A 2COLA 4L75A 4JI8J 2JJ4D 4IG0B 2A10A 1SJFA 2MPUA 2G0CA 3M2RA 3T41A 4JI5J 2NUUG 2X1FA 1AFJA 4CLTA 7FDRA 3TQEA 2RMLA 2VD3A 1R8HA 1N36F 4RU2A 4PCQA 1F6TA 1P9YA 2FD2A 3D0IE 2YWKA 3MM6B 1BQMB 1X4HA 2RNEA 2RQKA 1M5HA 1NSKL 3P3DA 3ZTPA 2F63A 2RD5C 3LGNA 2MQPA 2KM8B 4N76A 1IKWA 3NMRA 3ZZTA 5GAHI 4AXIA 1RT6B 2F9DA 3W2WB 2DGTA 4Y2MA 1NCLA 2PSZA 1AZSA 4JI0F 2B4OA 3R1LA 2FYXA 4H4OA 3BDEA 2FVCA 4O3RA 4ZJOA 4X4VA 3OHBA 3V4IA 2ZBPA 2UV8A 1LWFB 2EKYA 4PEOA 3KUGA 2LDYA 3C15B 5HBMA 4DS5A 2BBEA 2BX6A 3MMCA 4Z7YA 2HMIB 1NNDA 2MSSA 4LIRA 2CVIA 5KFJA 4JI3J 2HSEB 4DSEA 5JVHQ 3TARA 2RRNA 1HARA 2UUBJ 2LLZA 2VC0A 4LQ9A 2OTJS 1VI7A 3CCVS 3M32B 4P7VA 3BV8A 2IM0A 2FC8A 4O3OA 2FJWA 2V2ZA 4USJC 4R8UA 3FSXA 2KL8A 1UZDA 4F4XA 2RKIB 1M5VC 1N0UA 3E8OA 3QSYB 1X4GA 4QYRA 2MSTA 1VS3A 1HQUA 4PXEA 2XCPA 3G8TA 3TOQA 2ZJRQ 3DXSX 2IM2A 1NB2A 2XYHB 3FNNA 3CDUA 3L7PA 2HK2A 1S6PB 1FX4A 3FMWA 5DZ7A 3I32A 5B09A 1CJKB 2ZKTA 3Q8PB 4J9PA 1KD1T 4KPYA 3QJJA 5KAKA 1HQUB 3BB5A 4CO5A 3KHLA 1DTTA 4URSA 2ZKUA 1BE4A 4HTIA 4DSKA 4ZVOB 5SUHA 1Q8LA 2CPJA 2X3GA 3M32A 4S0MA 1ITPA 2VU5A 3J7A1 4ELUA 5B0BA 2CG8A 1FKAF 5L1JA 1AW0A 2XSJA 2BABA 1SC3B 1RT2B 3MMCB 3D3CJ 3BGUA 2E29A 3NOGA 3N28A 2ZM6F 3R7SB 5A6PA 3DOKA 2I5JB 3JTNA 1RTJB 1RP5A 2HG4A 3LP2A 5DETA 4A46A 3RRHA 4DL7A 4K2JA 2ACYA 1K1SA 2DNRA 3FFIA 4OX9F 5IZHA 3ZTSA 5L39A 2J7WA 3H2LA 2ATLA 3ILLA 4KKOB 4HT5A 5L1KA 3BSNA 3MFIA 2FJEB 3W2WA 4DU7A 1RT6A 1TKZB 4DR3J 4ELTA 1Q95G 2AIRB 2RAQA 4IH5A 1IKWB 4W98A 1FKOA 2XI3A 4OI3A 5L38A 1K0TA 3BGLA 4CI0B 3NGDA 4DS4A 3VQSA 2YPYA 1SQGA 3S6EA 2DY1A 1HBUB 4N47A 3JYTB 5AXMA 3JTOA 4EO6A 1BGXT 3OTOJ 1JJ4A 4PG4A 2OPPB 3L9ZA 2LVWA 3DYAA 3VAGA 2OH2A 1KFDA 5HMXA 1LK5A 2WK4A 3H2UB 5DG8A 2FB0A 1WC6A 2HBQB 3RW6A 2Z8QA 2NXUA 2R7QA 1S1UA 2HBYB 3N5FA 3BH7B 4A8FA 4UOHA 4EBDA 4A48A 4LT6A 3ILIA 4C2MA 4LBIA 5BR8J 3EGZA 3HFZB 1F0XA 1A7GE 2JDJA 2MKCA 1CSJA 2UU9J 4B9UA 1LV5A 1SPBP 2HNDA 2M9KA 2IBOA 2N4CA 2GW8A 5CD4A 3SYZA 5I42A 1K8AT 1P1LA 2DNQA 3FGVA 3EMTA 1K47A 3V6KA 1QVFR 5K8OA 1G2EA 3A12A 3QGGA 3HDSA 5IQQA 3VAKA 2NYHA 2OSQA 1NSAA 1C1BB 4P7TA 4YHHF 4DFJA 4LF4F 1HQEB 2FQQB 3W63A 1P9QC 1RAIB 3HPOA 3ISND 1NB7A 1UZHA 2G0IA 3PIOQ 3G96A 2ROPA 2P6SA 3DM2B 3ISNC 4NLYA 1VRTB 3C66A 4CLWA 3I55S 5KFHA 2RDJA 1L5UA 3NGRA 4OHYA 2KVQE 4JI6F 2QE5A 3HF5A 3KJQB 4P75A 3GFXA 3KUEA 5AXLA 4QIWD 2C2ZB 3VZHA 1G3OA 5DGAA 4CRJA 3OTBA 1VLYA 3V4IB 4WTYA 2RRAA 1U2FA 1KHVA 2C3OA 2K7JA 4M5GA 5CA5A 2LYVA 4NXMJ 1M5OC 5GMDA 4KO0A 4F7VA 1I1GA 5ADZA 4R5PB 4LF8F 5F8MA 1LFWA 2GIQA 2MJUA 1NH7A 3HULA 2IA6A 3NWGA 1JKHA 3N9UC 3H4DA 2WBMA 1R6YA 4IOBA 1RT4A 1BQMA 1KVKA 2XMWA 5F9LA 4QR0A 2DHGA 2LCWA 2R7UA 1PILA 5L46A 5HLFB 1JLAA 4DQQA 1LOUA 2XC9A 3V6DB 2OPRB 1S49A 2V0NA 4PYAA 4V19J 5SZTA 3IR7B 3PX4A 4IG0A 4NEZA 4GO7X 2MZJA 1TMMA 2QEXS 1TVRB 3QZ7A 4DQPA 3BKTA 4K4YA 1T95A 2PFDA 2I0XA 4USVA 3QLHB 3MR5A 2ZDOA 2JEFA 1YIJS 3MR3A 3KHGA 4X64J 4KRWA 3G9CA 2KG0A 3VALA 4WCEQ 4Q8EA 4NA3A 2W2PP 2ZC3A 4P74A 3US5A 3UD5A 4KH0B 3R1HA 3BZQA 1FA0A 1ULRA 2M8HA 3M8ZA 5CAAA 4DUYJ 4DFKA 4ES1A 2F9JA 3BYRA 1LEOA 3MFHA 4NLUA 3Q24A 3G82A 4TN2A 1FXLA 4ZK7M 1S59A 3IBCB 4OZJA 1SV5A 3A3PB 1CBKA 2OAUA 1AROP 3W5YA 4EO8A 5JMNA 3HT3A 3V6JA 2HNYB 1YRUA 3FEYB 1RK8A 1FRJA 4ZITA 2N7CA 2AGQA 1F1BB 4MH8A 2QL9B 2I38A 2FPHX 3NLCA 3DMJA 3LGMA 1VQ4S 2OHDA 2HFZA 2J6SA 4DR7J 1KHWA 1V3RA 4OYXA 2WZ1A 1B0PA 2R7RA 1LFPA 3RGIA 2DNHA 3J7YU 4PR6A 3CSKA 3OVAA 1CJVA 1TV6A 3NOCA 5HVFA 3GR1A 3ZTRA 4LVNP 1SUQB 1V5VA 1E6YA 3I9V9 3LO3A 1X4BA 3BBFA 4OLOA 1YBTA 4USWA 2V8VA 4DZ6A 4V19X 2QZ8A 1K44A 4FF3A 2FJBB 1UEKA 1TVRA 3BSAA 4LIWA 3BGRB 3MPWA 5KFQA 3VWSA 1U02A 5IWAJ 3R5DA 4DLGA 2VB6A 4M94A 3CF5Q 4P6QA 4JI7F 3D6FB 2OPRA 1FFGB 3EGWB 3FMBA 3V6DA 4ECUA 2DBBA 4N77A 4MK7A 3DLHA 2UXBJ 3NWRA 4P2SA 3ZZ0A 2LU2A 1MU2B 1Y9OA 4FXWA 5DRKA 3T1YF 4KPCA 1HI1A 1RCOB 1RT4B 3U7JA 1NJZA 1B64A 2JC0A 2FJDB 1GTEA 3PXGa 5EWGA 4PAAA 4C3MA 1D09B 3BN4A 5HQLA 4YDDB 2R8JA 2GQ2A 3OVBA 3D1HA 4KGXB 2OIHA 4TU7A 2A1BA 3EDQB 3QT5A 5T7LA 4TLRA 1CULB 4TLQA 4YP3A 1NKEA 4AE5A 3POTA 5HK4A 2Z56B 2PD1A 4C0OC 1T7PA 2PEHA 2BVZA 3KWMA 3AT1B 4KH1B 1NJWA 1QVGR 1HBMB 4ZOSA 4EEYA 3T19A 4RKUC 2DXFA 1R0AB 3UCZP 3UN2A 4A4JA 1QD1A 3TAPA 2RB7A 1N8RT 1JMTA 1JNZB 4YB5A 4LF5J 3HJFA 3DGPA 1GH8A 1HNWJ 1GMUA 1I51B 4QBUA 1QAXA 3RB0A 4C8OA 1NDKA 3IS9B 3WBZA 3KMQA 2DY9A 2GO8A 4MKAA 2WSFC 3PG9A 3MCSA 4NASA 4CP5A 3MPYA 4ID5B 1OQ6A 2QMWA 3SXLA 4U7CA 1PGZA 3I0SB 4XPCA 2MY8A 3H90A 2QA4S 1TL1B 3IXQA 4RW8A 3VAFA 2HHHF 1RBLA 1WNEA 1IBMF 1O6XA 4DPXA 1N33J 3SCKE 4CH0S 5K20B 4J9LA 3K5PA 2J0QD 2ZBRA 3R2DJ 3L95X 1T0TV 4PABA 1N54B 2QRRA 2RQMA 3HVWA 4HI1A 4ZIVA 4K8RA 2DNPA 3UCGA 2RJZA 4DMZA 3BO3A 1YJRA 2KDOA 1WTFA 4UZCA 2MLYA 2IIHA 5F8LA 4DF8A 2B7CB 2ZHBA 1S77D 3ADAC 4LR8A 1JLEB 3UDVA 1DTQA 1X5PA 3M1VB 2Q43A 2RDIA 4C7QA 1Q0NA 3VGUA 1VK3A 4OZNA 3D2WA 5ETOA 1OYEA 3HLUA 3QGIA 2KT5A 4M63A 2QTWA 1HR0J 1ZH5A 3KOAA 5CD4H 5LXYA 4HEA9 1RB0A 3MM5A 4DQRA 1HR0F 2B7BB 3NS7B 1CJUB 1H2VZ 3NEKA 3QATA 4IQMA 2Y1JA 3NNCA 1E6VB 1HNXJ 1KONA 1BC6A 2FJAB 1CLFA 3DRYA 1VIOA 1HBUA 1UCNA 2KYXA 5KFIA 2CAJA 4NLDA 2YKAA 4WFAQ 3OL6A 2OJ3A 4PUOB 1IKYB 3LWLA 4I64A 2V8PA 3B78A 3GYNA 1ZAVA 3N4WA 2R42A 2W01A 3SFUA 4U6PA 2PI5A 5E3PA 4X4TA 3VAHA 3M2VA 3RAQA 2AT1B 2FGOA 3GP9A 2WVBA 1IBKJ 2H5EA 3OSPA 2XCAA 5FDLA 4HYKA 4KKOA 2DGUA 2EBGA 2ZUGA 4OIXA 3C8YA 2BEFA 1U8WA 3BPSP 4KSEB 4DL3A 4LFBJ 4WK3A 3DRRA 2HS3A 3IWNC 5ITHA 1X31C 2I5JA 3L09A 1F5BA 4U9RA 5T41A 9RUBA 2J5AA 2W2QP 2FDNA 2EFVA 2QX0A 4D3GA 4DU8A 2XSJB 1M1KT 1XNRJ 3MMAB 4ZPWR 1TR0A 3CO0P 4GKJF 1B0VA 3RR7A 3VAMA 4DSIA 3EXYA 4KIAA 5DM7Q 3K8VA 3HKWA 4FDFA 3KLEA 3SSSA 4NRTA 3GILA 2FVRA 3MCMA 1X4EA 2JH3A 3M8WA 3OUYA 3H5YA 2HQDA 2NPFA 5AXKA 1YQHA 2B6AA 5JXSA 4C6AA 2X1GA 4CTAA 5HVGA 3KK1B 1CJKA 4P10A 5KG6A 2A2DA 1NBEB 4USKA 1B70B 1UJ4A 3C16B 2MHEA 4DX8H 4YB1P 4I68A 1NJIT 1FRMA 1Q8BA 1LWCA 2DH9A 3Q23A 1WEYA 3THPA 2H54B 2D3O1 5F9NA 2QL5B 4ATNA 3C3LA 2KHDA 2HKEA 3KJFB 3HCXA 3ZZUA 1GT8A 3MURP 2UXCJ 2DNOA 1Q53A 3AY0A 4MKYA 4EGLA 5CCLA 1BY9A 5HROA 3H59A 5KFLA 1TK8A 1RQ0A 2BW2A 2QN6B 4X4NA 4H54A 5KFVA 4DZDA 3C15A 5HBMB 3CB4A 5F41A 1SC6A 3KLFB 1NH8A 1LWFA 2BXJA 2OEJA 2D9PA 3M2UB 4Y28C 3RB4A 1S9EB 2JVOA 3GMGA 2XS2A 4GC6A 3QAUA 2ZH4A 1WI6A 4L76A 4H4OB 2KTQA 1UWAA 2DGOA 3FDSA 4CCHA 3IC1A 2W9AA 3DLLQ 3V6HA 2GA7A 3I31A 2XI2A 5HAOA 1U6BA 4KR0B 3H7HB 2CQGA 3CCUS 1NK5A 3JSBA 2L9NA 4OHXA 1QAJA 4JV1A 1RU2A 2GJIA 4ZCKA 1WDDA 2EK1A 4O4RA 2JZ5A 1KQFB 4EYIB 5LSLA 2ASDA 4OLPA 1XQIA 2J8SA 2B4PA 4RW7A 4EWTA 4YS2A 2VHGA 4ZPAA 4CYUA 3GFZA 5F0WA 3TAMA 3LH2S 3M8RA 3JSMB 1WF2A 2QV6A 4OL8A 4LMZA 1YZ6A 5EN1A 5ETQA 3OR2A 3QNWB 4LREA 1QTNB 1SKSA 3J80U 4CLUA 3GB0A 1DJ0A 3MEKA 1WC4A 1VBXA 4QWEA 2MKYA 2E9ZA 3Q8RB 3M8PA 3W5XA 2KU7A 3UR3C 4A8XA 2VPWB 2MGZB 1L3UA 1T03B 4OYMA 3TZWA 4QIVA 1VRQC 2C2KB 2V34A 4J37A 3CO9A 1Y5LB 2D41A 5EX3A 1S0NA 1JXLA 2DGVA 2P8IA 3NGTA 4NPOA 2CXEA 1HWLA 3MZIA 3PFEA 3W9IA 3PRBA 4C9DA 1DBDA 1GTHA 3W7BA 3BJYA 4DFMA 1REVA 2L9WA 5B0GA 1C0TB 1WC5A 3EE3A 4X62F 3MWBA 1TL3A 5ETLA 4QW8A 5BXIA 2V8HA 3J81j 5CYMB 1JLFB 3OJUA 2N7YA 3AFGA 3HFVA 3B4MA 4GVBB 4KBIA 1IBLJ 3S8SA 1VQLS 2B5JA 3G2XA 2HHQA 2GIRA 5KG1A 4RW4B 1R31A 4DUZF 3QBCA 4ZVFA 1D9AA 1LW0B 1X4CA 2HAFA 2HIQA 2OPSB 2WVEA 3HHDA 4M5MA 4DV1F 2MGZA 1U45A 3JS9A 2AZ1A 3U02A 3NL0A 1U09A 4F0HA 4KQZA 2ZZMA 2HHWA 4CLLA 1FRKA 2GS8A 4UUXA 4NCGA 2CQ4A 2JEJA 1MN9A 1ZYQA 3OL9A 1XEZA 2DYAA 3T5KA 1PG5B 2HVEA 4B3SJ 4OI6A 4DV0J 1Y3JA 3M30A 1MMNA 3GR0A 3HK2A 3PRDA 4YFUA 1PAEX 2UUWA 1Y11A 1NK6A 2W24A 3IG1A 2OPQA 3T9ZA 1S0MA 4X66J 1N52B 1N5QA 4EBEA 4IYQA 4NYZA 5G0RA 5C7PA 8RUCA 3DXBA 1U1QA 1FVQA 4A8YA 4DCPB 3QWUA 3W60A 3L7OA 1NHVA 1R8BA 4AYBD 4ED1A 4EI2A 4JI1J 4UUWA 1RTDB 1BWVA 3LA0A 2XZWA 3CULA 2DH7A 2QT7A 3MTKA 4DR6J 2DISA 3U1LA 4ANEA 4TQSA 3CMAS 1CEZA 3AJ2A 1NZAA 4JI0J 1EX8A 1AB8A 1TL5A 2HLUA 4LBHA 3GFHA 5E7OB 3SCIE 4DEZA 1BQNA 4CLZA 3G6ES 2W1BA 1GK8A 4DL2A 5U47A 4B3OA 2HHHJ 5A8RA 1FJGF 1IKXB 2EXUA 2W9CB 1EKRA 2F1FA 5IT4A 4X4OA 2RUSA 2HHVA 2XMJA 3GIKA 4URQU 2QA4G 3ULHA 4Y2IA 4DXLA 1YBUA 2X1BA 1XNQJ 2HQGA 3QT8A 4OJGA 3BO2A 4EBCA 4M8LA 1RTHB 4U7UD 4DQIA 3PEHA 3HZGA 2FLNA 2C2NA 3QYYA 3LPEA 4WKYA 3R5CA 4NA1A 2ASYA 1Y5NB 1S10A 3P5BP 3TRGA 4UOFA 5LMUF 3OV7A 1C4CA 2LQ5A 4RJVA 2IC3B 4USIA 1HI0P 1Q7LB 3P49B 3UO0A 4BWMA 6FDRA 2N3LA 2D3OR 3QAEA 3I5AA 3KK1A 3UDEA 1I94J 1TKXB 2B6AB 4K4WA 5A8WA 1XMQF 2XBPA 4RW6B 2QFIA 4WPAA 1EAYC 1DQAA 5EWEA 4GMKA 4XIUA 4M5HA 1D0EA 1N34F 5IC4B 1RT3A 2VL1A 1UJ6A 1HMVB 1KS2A 4QWAA 3GZ7A 4WP9A 2DNGA 2BYCA 3KLGA 2NSBA 1N5YB 1O51A 4J9SA 2R4FA 3H5UA 2K06A 4QIEA 4NLPA 1HKAA 3MD3A 2B8PA 2V5HG 5K5MA 5C42B 1GNKA 2LFVA 4FYWB 2KN4A 4WFXA 4ZMMA 2E5LJ 2PI4A 4HVZA 3TWZA 2JWNA 1XWLA 4LF4J 4ZP7A 2VA3A 5HQ8A 3C6UB 2F4VF 3CIZA 4QU6A 5IWAF 1TKTB 4WK1A 5CHCB 4ZVRB 5LM7E 4OJ1A 3PV8A 3W2VA 3EJMA 5FDLB 4ED4A 3DKDA 4ZHRB 5D8HB 1MWQA 3AJ1A 2ZVSA 1RT7A 4Q8FA 1CQNA 2VPYB 3L3CA 3M4XA 2CPDA 1RA6A 1FRIA 3QRPA 2VPXB 2UXDJ 2OEKA 3KHHA 3FEXB 4CO3A 1YBAA 3Q8VA 5C42A 2ASLA 1S97A 1DURA 1WC1A 2HYIB 2GC8A 3PYDA 3KK2B 2JVRA 2R2TA 2UUBF 2VOPA 1CC7A 3H20A 1N5YA 3H5XA 3WZ0A 1NU4A 2E7VA 1HMVA 1FNXH 4L74A 3MM5B 3AOBA 3BN7A 4DWIA 2YY3A 5GVQA 2OGUA 1NDCA 3T1AA 3S1TA 1BLUA 2ZOGA 4DBQA 1IUJA 2PDAA 4EZ6A 3H2VE 3UCUP 3LALA 3OBIA 3D1OA 1TKXA 2AJFE 4FYVB 5BYQA 2VQEJ 1TFWA 1HWIA 4HDHA 4M5LA 3JTPA 1YJTA 2IC3A 2MEWA 3RR8A 2W4PA 2FY1A 4ER8A 3TUZC 1FI4A 2P2CB 4ZP9A 3AODA 1RWWB 1U6FA 1Q5VA 1QSSA 1NK7A 2HVZA 2HHTA 1VIXA 3HSZA 2NLWA 4OMFG 2KFZA 3WDOA 5AE2A 5HN0A 4OX8A 1TL1A 4RW8B 2N82B 1KLNA 3D6MB 4C0HA 3LOUA 4IDKB 1OPZA 2GIFA 4ECWA 3PJWA 2R7SA 3KDNA 3IM9A 3M05A 1ZPWX 2JC1A 4OHWA 2AYGA 1KN6A 2LQJA 1WKJA 2XULA 2E9TA 4USUA 3D6TB 2U2FA 4CDIA 3P4UB 5D0HA 3CJ5A 1SXLA 2ZNZA 4WFZA 1IBLF 4F8RA 1S1VA 3PHTA 4RUAA 3MR6A 5FIIA 2H51B 3KDOA 4NXMF 4I4BA 2HVHA 4BC9A 1HLWA 1VR6A 2MKSA 2VC1A 3FBEA 3HMJG 4IRDA 2PIIA 3ZNUA 3SZ2A 4O23A 3CD5A 2QFJA 4OYPA 4ID8A 1X5OA 3MHYA 2J7KA 2EVZA 3O2IA 4NRUA 3QGPA 1KQKA 5J1EA 2OPQB 4WYLA 3FJ2A 4X4QA 1XNQF 3ZZRA 1ZOTA 3PX6A 2ZEJA 2CJBA 1FTRA 4Y34A 2FJVA 4B08A 1V3ZA 2B8QA 1TKTA 1NJYA 3R5JB 4IR1A 1D8ZA 4LFAF 1FVSA 2BUNA 3QT6A 4OX7A 3CEDA 3HVTB 3OL8A 2XY7A 1OJ4A 2CZ4A 3DU6A 1UEVA 1MROA 3IR6B 1WUUA 4NCGB 4QJVA 2M88A 3L4BC 2IJNA 3CJKB 1JK9B 5M2PA 2X1AA 3PO5A 1TUGB 2ZOFA 1KFSA 5D4LA 5DZ6A 5J2QB 1PO6A 1VHFA 4FYDA 3TJ9A 4JBCA 1FCAA 1S1WB 4L3NA 4B02A 4CH1A 3T1HJ 1N48A 4ILMA 1YKWA 3KLGB 1ZM2A 1H0HB 5LXRA 1X60A 4E98A 2KH9A 5A8KA 2J8AA 4FS1A 3IGVA 1PIEA 3X3UA 1EHWA 1S9GB 4B17A 1RT5A 4Y2KA 4GVBA 4OYZA 1T3NA 1FO1A 1U1KA 2A3JA 1RAFB 4KAIA 3IRWP 3K89A 4B9TA 2HWTA 4C8NA 2WOMA 1OSDA 3QFWA 1ZZNA 1NJXA 4DV0F 5B0CA 4QWCA 1HPZA 1IVZA 1F3FA 3NY0A 2UXDF 3D28A 4HLBA 2Z4PA 4LSLA 3M8QA 4IO9Q 1EQ0A 6FD1A 3UE2A 5CQGA 2BKPA 1UW4A 3KG1A 1Y3KA 4ZPDA 1DLOB 2F5GA 4TXSA 3TJ8A 3G82B 4W4MA 2FLOA 2GZOA 5E3QA 4N41A 2OSRA 3KKFA 4K4SA 3B6BA 5J1NA 1VLOA 2W25A 1RAGB 4JI4J 2W9CA 4H4KC 2UUAJ 4GC7A 3BF4A 4X65F 1VISA 2R3VA 2RRBA 2VV5A 2WVFA 1EZZB 3WHIA 4UF4A 1FD2A 1FEEA 1DQ8A 3C6TA 4Q44A 2NYIA 3GONA 1HNIA 1MWYA 2GMHA 3H4BA 1RWXB 2JLEA 4DL4A 3OD2A 2HHXA 4J9KA 4LUBA 2H4YB 1FWKA 3DOMA 3OPKA 3UW1A 3G6XA 3JXOA 1WHXA 3LAKA 4CYUB 4X62J 4K4TA 4DV4F 3OXFA 4NMXA 4RW7B 4F2RA 2J0SD 1RTDA 1GMWA 1CS4B 1JLCA 4KB7A 4ZVSB 5DQGA 1RLDA 3OXGA 4MIWA 1AUSL 4WP3A 4MIAA 1IR1A 2HBRB 2V2QA 5EHHA 3NKYA 2RS2A 1XMQJ 2BE2A 2Y1IA 1CS4A 1QY7A 3MR7A 1YDLA 4O44A 3HD2A 2LEBA 5C2GA 2UVUA 3T9NA 3N0VA 3M30B 2CPFA 3IRXB 1T11A 4J9MA 2GAGC 3SDEA 5JJBA 4DV7F 1XNRF 1Y7PA 5F8IA 3EZ5A 4K0KJ 4QPXA 3DHWC 3MEEA 1C0UB 5H9FK 3ET6A 4BHQA 3MUVP 5L8RC 5ETNA 2PA8D 3CIMA 2FHKA 2YPZA 4UY85 4LRBA 2CQ1A 3CC2S 4U67Q 1RCXB 4KE5A 1OPIA 1HIYA 1HWJA 4MIBA 5DG9A 4ZVGA 2Q3PA 4F50A 2OPSA 1VQ5S 1LW0A 2MLXA 1UETA 1T05B 5CYQA 3N5BA 3DM2A 1VK8A 5J2PA 1T8EA 2YWHA 2ZFHA 4C8ZA 1DLOA 1BWEA 2KM8C 2FVSA 1HQEA 1XTZA 3CE8A 3LAMA 3JQKA 4RWXA 1JX4A 2CQ0A 3K7RA 1LWCB 1K1QA 3NRBA 2HZCA 4CLFA 4NEYA 4PQUA 1EP4A 2GJFA 1FJ7A 2K8GA 5ETMA 1RHRB 4CTAB 3AH6A 4RUBA 2RDDA 2K2PA 3R8YA 3W5ZA 2L9DA 5KT2A 3CW2C 2VODA 3AB2B 3GU0A 4CLSA 4XDDA 1RUSA 2W7OA 3GIJA 5A8KB 1JLQB 2J6TA 2YWFA 4WXWA 3HD1A 3GIMA 1S5ZA 4M5DA 2XLKA 4QZVB 3O1LA 4NXNJ 1HWUA 2IJFA 1S1UB 1T9TA 2EEYA 3ZFVA 4U95A 1M1GA 2G0JA 3MOJB 2V67A 2UXCF 4FF1A 3TUIC 5HO4A 4NYOA 3BQ0A 2OD6A 1N36J 5IT9U 1OMSA 1KC8T 1FRHA 1X9SA 1H72C 1B7FA 2E5HA 4QYZK 2DKOB 3FBCA 4LSNA 1H6KX 5HI7A 5IT0A 2H9ZA 4HT7A 1XJWB 2ZBQA 4I56A 2YKPA 1U0SA 2W2NP 3JAMY 2YWGA 2XHCA 4TU9A 3F0NA 3P96A 3B54A 2CPZA 1OSCA 5HANA 3QZ8A 3DOLA 3G8SA 1J5EF 1OY9A 1SVDA 2OFHX 4LF7J 1VQNS 4W90B 5CABA 4QWDA 1FKOB 3I87A 2DGSA 2C3MA 3SBMA 3TW0A 1AT1B 2WW4A 4R25A 3LW5C 4ZVPB 4LF5F 1HA1A 1CG2A 1SIZA 4RNHA 5DS7A 1IM6A 4DV5F 1FE0A 4R0JA 5I3PA 3OFHA 3WIUA 3QQCD 4ILLA 3LPYA 5LMNJ 4KHPJ 1CJUA 2V2KA 2HZVA 4O3SA 3UDCA 1TAUA 4Q45A 3LP2B 4TYBA 7AT1B 4NZ0A 4PWDB 3DOKB 1QE1A 4IRCA 2F65A 1FDAA 3IM8A 2AGPA 5F8NA 1JLBA 2XSFA 3MAQA 5H9EK 1VJWA 1S9FA 4MT1A 3LUYA 2YX4A 5G4DA 1WEXA 4NLVA 2CDRB 4B9SA 1HHTP 1IBKF 3KG4A 2CJQA 2VQFJ 3GQCA 1J5OA 2QMXA 3GJRB 3OR1A 2HVDA 2ZE2A 3J81Y 2MZSA 4NMLA 4C8LA 3A8JA 3PCOB 1MWZA 2ALYB 4N8NA 4ED7A 3CXCR 4LFBF 1V3SA 1S1TB 1VDHA 1FRXA 1PJ5A 2AEJA 2C2MB 2V8GA 2VFUA 4WXOA 4OYBA 4PZVA 1VRUB 2IVYA 4OQJA 5KT7A 2O01C 4WE1B 3R7BB 3SSRA 1S4EA 2ZHOA 3KXDA 4DPUA 1HNZF 3I4HX 4ID5A 1UFLA 3HFKA 2RKIA 2ZH7A 3X1LB 3MECA 4AUKA 1T02A 1R43A 1W26A 1RHKB 4WKRA 2DHAA 1N32F 4TKTA 4JP8A 3DGPB 1VBZA 1QTMA 3TA1A 2BANB 2Z0GA 5E5NA 4RNNA 1RJJA 3ZNJ1 4H4KA 1F60B 5L1LA 3QRRA 1JLGB 3OSNA 2CFXA 2MZRA 4OYAA 4C98A 1UFWA 2DB1A 2DIVA 2AYMA 5F8HA 4C48A 4ZLPA 4K2XA 4DSFA 3DRRB 2DD8S 2KFNA 2MZ1A 3D3BJ 3GG1A 4DR3F 1A9NB 4NLTA 4KHMA 1RT7B 4F0MA 4NX9A 1YRXA 1AZSB 2LEPA 4TY8A 1WG5A 4ZHRA 4F02A 4TY9A 4AFFA 4RBTA 3FEZA 3D7SB 3D66A 4DSLA 1RT1B 1TK0A 2VJVA 1IKVA 3MM6A 5AE1A 4K7QA 1PC4A 2HFUA 4MJKA 3UN5A 1FNOA 4BLGA 2R8IA 1KNZA 1IKYA 2GFFA 3BBBA 3W3SA 4DV6J 1N33F 1TAQA 3UD4P 3ENVA 1FDNA 2NXJA 4RNOA 4ZPBA 3E01B 3A8KA 5KFZA 2RHSB 5KFGA 2AQ4A 2BOAA 4ED0A 2DR9A 4W92B 3PKMA 5C24B 1FNMA 2RHQB 2XNRA 1WTBA 2CYYA 1OS5A 2QLBB 3C14A 1MMLA 5E3AA 4EMDA 2CQ2A 1T9VA 2Y1RI 3CCWA 5A76A 1CJVB 5LMNF 4DPOA 3AOCA 4UZBA 4G1QB 4K0KF 4ED5A 5GAEI 1S6UA 2DEIA 2XWXA 4LR7A 3K59A 2CJKA 1WDTA 1RAHB 2EK6A 3BH6B 5KFYA 4ED8A 4LF6F 4FVCA 1NAQA 3RAMA 5KG7A 4FKYA 1WC3A 3EDRB 1RISA 5GADI 3GWCA 4LF7F 2HNYA 2POKA 2EPIA 2GQCA 2F4FA 3EXCX 3T6BA 2XZDB 4DR5J 3R27A 5D3GA 5KOWA 2ABYA 2XWYA 4YB6A 1TK5A 1NM2A 2WW8A 4ECRA 4K4VA 5BYRA 3W66A 3CT9A 4CO0A 1S6QB 2VG5A 1YVFA 3VGTA 1Q7YT 1XIQA 5D6GA 4FF2A 3VGSA 4JI6J 3FQKA 2IFXA 1IKXA 1S57A 2B3TB 3T5LA 5THWA 2R7VA 2CNNB 4C11B 4DPTA 2KZMA 3RW7A 4WF9Q 2MQOA 3HZEA 1YI2S 2ZOMA 2W9BB 1R0BG 4OYWA 2VBYA 1M5PC 3AAWB 3BSOA 2PFFB 1VQMS 4U8VA 2KRBA 3LF0A 1FKPA 2G2YA 5LOQA 3ISZA 1N56A 3C19A 2AU0A 3RU0A 4NI2B 4QPTA 3M6WA 4NZ6A 3FCHA 3PW7A 4QYZJ 4YMEA 1LQ9A 1TU0B 1LW2A 2W2MP 1O5JA 2W2OP 3IG1B 5KFXA 1KKHA 1KVJA 4NWBA 3ZO7A 3BGFA 3G71S 4R5PA 3P6YC 3UN3A 2XS5A 2ROEA 2OELA 2HAIA 2XYPB 3FZ2A 3HKZD 2NZCA 2MKHA 3E51A 3KJNB 1LW2B 5AXNA 4UTGA 2QA2A 3PJXA 1JB0C 4PG5A 4QIGA 3TO8A 2V68A 3DLGA 1MU2A 2YQ1A 4EK2A 3BQ2A 3ZXWA 2ZWOA 2GX8A 2BZ2A 3CVKA 2CWXA 2W7PA 4DQSA 1FT8A 3DLEB 2ZUAA 5KFRA 2BJDA 2DHXA 2OO4A 4E0DA 1SKRA 4PG8A 1E6YB 5BJRA 5F3ZA 2YQ0A 1MW7A 5H9EJ 1RGVA 1F3VA 1KOHA 4NYPA 3EGNA 3Q0AA 3MPVA 3N79A 2C1EB 1N4LA 3Q22A 2KVIA 4EFAC 5KFKA 1ICEB 2CZVC 2D1CA 4ZLJA 2JLFA 5LJ5Y 4RUHA 1RWNB 4LJMA 1U1MA 2KG1A 4NCAA 2DPJA 1SQEA 1EKSA 3HHEA 4FZVA 1WACA 2IM3A 4NZ7A 2MKJA 2QYGA 4PWWA 2XM3A 5KOXA 1N34J 3K8WA 5EGYA 2ACMA 3TR5A 5HSPA 3MM8A 4U96A 2BA9A 2XY5A 2DJWA 1JNRB 2UUCJ 5KFNA 2IYGA 5D4NA 1T03A 1I94F 2DXEA 4K50A 2AJQA 1WORA 1KQGB 4WWSA 4P2XA 2HGNA 2AZ3A 5E3RA 4DF4A 2RSQA 1SH2A 1DZ5A 4I7FB 5M2UA 1CJTA 3PFOA 5C24A 1VQ8S 2GVZA 4HACA 4JI4F 1KP6A 2VBWA 1ZM9A 3B8HA 5LSOA 1RYRA 5KG4A 3VV2B 3HP6A 2KJVA 3BKUA 4N5SA 3G86A 4N7TA 2HFVA 1ZM3A 2FHJA 3MI7X 2OTLS 1Q5YA 2YNHA 4D3HA 4G6VB 3OW2R 2GHVC 1TFYA 1OYDA 3RB6A 1Z1ZA 1SL1A 2CKWA 1LNQA 1KWMA 5EWFA 1H7XA 1OY8A 1IKVB 2WVDA 1FJGJ 4BBYA 4U7UK 2ZITA 1FX2A 1FDDA 3CJTA 4MMOA 3GJSB 4O3QA 5BR8F 3TAQA 2BE9B 2XTJP 5ETVA 3FVYA 2Q66A 4X2BA 3QWPA 1NHUA 1VCTA 1WC0A 2CJXB 1LWEB 2B9EA 3CJRA 4KO0B 4TY8B 2MXYA 4DL0C 1MSWD 2FUG9 2OFGX 4J9UE 5KFBA 4ERDA 1L3VA 4ETZA 4LRCA 1Y0HA 2XHWA 5I3QA 4JI3F 3SQOP 4OI4A 1KSPA 3DLBA 1H74A 3SFGA 3VF0B 1WHWA 3R2CJ 2ADBA 2HHUA 1S12A 3KLFA 3LTOA 3ENQA 2D7SA 3CMQA 1RT2A 4RZRA 4FVMA 4OI2A 1JXEA 3T5JA 4LRFA 2VONA 4CO4A 4ZP6A 2BANA 3BGOP 1SIWB 5HROB 1HBOA 4X64F 2K1RB 3FZBA 4CLYA 1AXQA 1HNVA 2YNIA 3VGVA 2QGFB 1VBYA 5F8JA 2HIYA 3RRGA 1ZA2B 1P1TA 2DNKA 5IV4A 2ZJQQ 1UAWA 2MKIA 1JJHA 1RA7A 3DNCA 1BXNA 3KG0A 4F4WA 4J7CA 1S72S 4OV1A 1ZS6A 4IR9A 1K0VA 5E33A 2DXDA 4UOGA 1Q16B 5KG5A 4KT0C 4DV1J 2J9EA 2P6TA 5I42B 2HNDB 2CNLB 4J5OA 5D15A 4ZVEA 1UJ5A 2I9SA 2F8MA 2RVJA 4TVAB 3NAHA 5E0OA 1GXTA 3RB3A 1YHQS 1HNVB 3OR1B 4FYXB 1VJQA 2H1YA 2K1RA 2ZM6J 4UT4A 2CQHA 5KG0A 1HBOB 3VVUA 5DLGA 5EX0A 3HHLD 2YH1A 4CNZA 2GVDB 3MMAA 3BM7A 3ENAA 4B3RJ 3HHLC 5B08A 3B82A 1U1OA 4FBUA 4OX9J 1RHUB 2W4DA 2BQRA 1DARA 2YH0A 4FPRA 3U1MA 4E8UA 1K73T 3UD3P 3TQ1A 1Q86T 5GAHU 2NREA 2AYEA 2WHOA 3QFHA 2VJUA 2OPPA 2V63A 2PMWA 3GV5B 1SL0A 4B3MF 3OFEA 4LFCF 2MJNA 3K58A 4I1TA 3VZIA 2Y3YA 2C2DA 4AT1B 3V81B 2DCUB 2OMOA 1RWUA 4DI6A 3HT0A 2HQ3A 5LMUJ 1J2VA 5J2NB 1RTIB 2ZH9A 4JI2J 2BMBA 2DCLA 2HLTA 2LQ8A 3M2VB 3GJQB 4P2MA 1F2HA 1YJUA 3BKFA 3GSDA 1YJVA 2V94A 4P72A 1KTVA 4CT9A 4EUVA 3EX7B 5J2NA 4F3OA 1TKZA 1U26A 1G6BA 1XMOJ 1I3OB 1FE4A 3OL7A 4WZQA 2ADCA 1FFWB 1KBRA 4G65A 2G1DA 5FD1A 2XMAA 4WFNQ 1QSLA 4HKQA 1JQGA 3FFIB 2C3UA 4ZLNA 1D3WA 3OTDA 4NA2A 1XBWA 4B9MA 3OLAA 1PJ6A 4KFBA 4OYOA 4WBFA 2B43A 5HVHA 4ZS6A 3PACA 2Q1LA 2JRSA 3IO1A 3VR1A 4A8KA 1R6VA 3CJ2A 2GHWA 4J9RA 4ECXA 1JLEA 2LMIA 4FXDA 2DO0A 3ICLA 1UA0A 1SCJB 4A8OA 1VYAA 3MM8B 2EFQA 5HJXA 3TUJC 4CNYA 2ZH3A 3F44A 2VG6B 3T3FA 1PBUA 4IFVB 4JI1F 1PYSB 3SCLE 1DTTB 2NXNA 4DX7A 1WELA 1TQLA 3PNIA 2XLJA 3P5TL 1S0VA 4X66F 4FS2A 2BOPA 4X84A 2O1PA 3GPAA 4KGKA 2E66A 1RXOB 2PEBA 3DU5A 1CVJA 2E1RA 3MOZA 4PQUB 2JOQA 2AMCB 1WKLA 5E41A 4CLKA 1M90T 4DX5A 3H25A 4RWWA 3D67A 5GAGI 2KYZA 5KFFA 1NK9A 5GMEA 3UVJA 3MM7B 4JI2F 5JVGQ 1ZETA 1TELA 1FHTA 2LA4A 4K5SA 1G1XA 5J2MA 2DR5A 4IKAA 5J2PB 1U49A 1T05A 2D74B 2DGQA 3DLEA 4F4AA 2UUCF 2Y0BB 2RT3A 3KLIB 3MM9A 4ECTA 4B3MJ 4JI8F 1Q82T 4DPWA 4LF1A 2CPEA 2HQFA 2HMIA 1Q8KA 5L1IA 2DHSA 1EETA 1U0HA 1RDRA 1FERA 2BM0A 2IRXA 2IVMA 3BS9A 3W9JA 3DLGB 1HW8A 5IC6B 4YDXA 5KFOA 3BYPA 1CQMA 3FRZA 2DTJA 2ZVIA 3GE9A 3CCMS 1R7IA 3NS5A 2F3JA 2GQQA 3PEJA 5T7LB 3SDEB 2C2RA 4B3TF 2CJAA 1V5IB 5IOLA 1QUPA 3EWGA 4U8YA 4F67A 1IWGA 1LWEA 1H3DA 2APOA 1F9HA 3DDKA 2CIMA 2AJ4A 2YBVA 2V6AA 4O44B 1IM4A 4YOEA 1RTZA 3SEOA 4ZVHA 3I0RA 4QR1A 3VTIA 2BE2B 1ACMB 2V4RA 5EUHA 4NOHA 4QR2A 1UP1A 1WSRA 2CQCA 3CJ0A 5HMZA 4NI2A 4OZ0A 4ZKAA 2BQ3A 3MXHP 3CCQS 3GIRA 1VOMA 1T9XA 2RS8A 2HWIA 4N8OA 4C8KA 2FVQA 1Y4ZB 5A0YA 1HHQA 1UMJA 2F7VA 2VFVA 4WP8A 3KLHB 1M5SA 2VF3A 5KT5A 3SQGB 1HNIB 1H2UX 3KNAA 5KFEA 1EB0A 4I7FA 3BEGB 4P71A 2RQCA 1X8DA 1S48A 2IM1A 2DR7A 4PPZA 1RABB 5A6WA 1TL4A 1FRLA 1EARA 2Y9HA 3EPGA 2VICA 2CDQA 3KMSA 2CVEA 4ZJLA 2D3UA 2M70A 1H7WA 1VQSA 1C1CB 3TVZA 2Z58B 4F36A 3CCZA 3W61A 3DMJB 4ALZA 2ZNYA 2MLZA 3ZTOA 2WONA 4R0EA 5D3GB 3IWXA 2KXFA 1HNXF 1X5TA 3PYFA 2AV5A 2LXIA 5K9FA 3UQSA 4J9NA 1H73A 3M8QB 1N6QB 4I6YA 1RAAB 1T9WA 2HURA 2CA9A 4LSLB 5DQIA 3GIIA 5DG7A 2OUGA 3W64A 3KFWX 1YX2A 5I4MA 2FHOB 4DCOB 3IR5B 3JSYA 5DO2A 4ZJQA 4V1Ak 2NCKL 5K8MA 3R3TA 2JFKA 3DI6A 4MK9A 4NLQA 1A0OB 1IQZA 3I96A 1OO0B 4Z37A 5C5JA 1Q79A 1R0CB 2XO6A 3C14B 2LU1A 3GLJA 3H8YA 3KK3A 1HL6A 3CPWR 3BR9A 3O5TB 3T5HA 4JI5F 5HJYA 3K5OA 2AHOB 3MAAA 3SQGA 4DOZA 1U6ZA 1YGYA 4YR3A 4LVOP 4Y00A 2F4VJ 1Q8IA 3AD8C 4WU2A 4KGZB 1EJ7L 2JEIA 4DCJB 2PN6A 3DRPB 2VIHA 3H0PA 2AX1A 3O8WA 2K7KA 4DR5F 4M95A 2ZH1A 1UPMB 3LQVA 2WB4A 1KLMB 5HATA 4JV0A 1GQEA 1SJRA 2VQFF 4WFYA 5FJ4A 1R8PA 2P9GA 3FCWA 4PXDA 1HW9A 3DLKA 2RU9A 1XR6A 1RYSA 1Z2ZA 2WTFA 1PYOB 1RWVB 2BJ7A 2YKNA 2DNNA 1ZAXA 3QO9B 3JQMA 4C8MA 5H9FJ 2IMWP 3MEDA 4ZPCA 4RUCA 1SKUB 3A3OB 1U7LA 3V4MA 3FUYA 1JLGA 4URGA 1U2CA 3W9HA 4DR1F 1FFSB 1NXIA 2HPUA 2WVCA 3CJ3A 3DN9A 3D5MA 1VRTA 2VPZB 3ZC4A 4DV6F 4A8SA 1GFWB 5CCMA 3RUBL 2ASJA 3F73A 1IXKA 2QSFA 3FSYA 3SMZA 4QW9A 1MG7A 2XMKA 3UVJB 4FN5A 4AXJA 3HM9A 4LF9J 3R5AA 3CJ4A 3K2YA 2KO1A 2HQCA 3ZZPA 4M5IA 2HFSA 3RBXA 3KUHA 5KFDA 5CZXA 4JI7J 4LF2A 4O3PA 1G7CB 3CNQP 2DRDA 1RHJB 3D4JA 4PQAA 3KJVA 5GMKa 3FQLA 5KT6A 1SKWA 3TZZA 2YWEA 1NO8A 4P52A 1RAJA 2CZ9A 4OZ5A 4MTPA 3TVYA 2VG6A 3I5BA 4I69A 2QJ3A 1RBAA 4HTJA 2EWHA 1N88A 5C25B 1YLXA 1APSA 5CYJA 2AF6A 1URNA 5HMYA 1FWPA 1S7HA 5D78A 1SH0A 2GV1A 1U1NA 1JLBB 2UZAA 1WKKA 2PO4A 2EBEA 3NGUA 3DYAB 3WC0A 4JV2A 3PJ9A 4USHA 5KFTA 2U1AA 2Z57B 3ONQA 3PM9A 3PTWA 5KFMA 1MN7A 2G13A 3HXMA 3TANA 1HNZJ 2VZ9A 2FY8A 4F2SA 4ZN3A 3JYTA 3KK2A 3G4SS 5D4OA 4B3SF 4IOCQ 1SJ3P 3IBFB 1X4AA 4K4UA 5A2QU 1KTQA 3MGJA 5DDQC 2Z2LA 4X4PA 1TTHB 2GCFA 4MKBA 4DUYF 1NK4A 5CZVA 2XO7A 1N5SA 4IUFA 3UNYA 3OVSA 4XTTA 3MPDA 1RTIA 3DOLB 1RT1A 2C2EA 2MQMA 2QSWA 1HWKA 1Q1KA 5K14A 1R89A 2OI2A 3M8SA 2HS4A 2ZH6A 3V81A 1B99A 4IO1A 4TNOA 3A4TA 3IP0A 3TX8A 4UQGA 1UW9A 1OIAA 2VKZG 1NPKA 4LSNB 4YY3F 2UUTA 3EGVA 4HHJA 4RNMA 1W2BR 4FKXA 2LEAA 3AHPA 2V50A 4DFPA 2YXLA 2A18A 1RTJA 3BR8A 3TZYA 4Y6IA 2G2OA 2R8KA 3UI3A 2N3OA 2R7XA 1UVJA 1GXUA 2QLJB 4NE9C 2GVDA 1MNEA 1U47A 1XK8A 3FK4A 3QMQA 4CT8A 2JLGA 4OYIA 1UVKA 2DH8A 1WG1A 2O5DA 2GMJA 3A3NB 3CJ8A 5IQ6A 1VQPS 3RZAA 1VC0A 4NLSA 1L3TA 4K4ZA 2DGWA 3GV8B 2V4JA 3LP1B 4YY3J 1TKDA 2E1MC 4ETXA 2AD9A 1RE1B 2CJ9A 2JNJA 4ZIWA 4EYHB 2HRYA 3QGHA 3MUMP 3CC4S 1S6PA 1D1UA 2M52A 4P9SA 3HHNB 1X5SA 3H42A 4LRDA 1XMBA 1S1TA 1SJ4P 3D0HE 2YNFA 2CRLA 1WOSA 5ETKA 1N5VA 2ZD1A 4IFYA 1AA1B 2YNIB 4WYWA 2M7SA 2NXEA 2RE1A 1QUVA 1J5OB 3MTJA 3IGNA 2RF2A 3LP0A 1TUVA 1X7VA 1J5EJ 3QJLA 2QLWA 4C97A 1KDNA 4IG3B 3Q2TC 1VQ7S 3AQPA 4F26A 1YWXA 4LBPA 4I2QB 2CQIA 4YHHJ 2VA2A 4JYAF 1S1XA 1H2TZ 2IAJA 3Q8UA 3NNHA 2Z2MA 3NS6A 1RAEB 1SJ1A 4PG7A 2MMYA 3R97A 4CM0A 1WD6A 5DGBA 1NEEA 2XMUA 3PO4A 4B9NA 2ZDPA 1VQ6S 4QCLA 2H65B 1TZ0A 1JIHA 2E1PA 1ROFA 2DIUA 2EG2A 2QIFA 2PGCA 2YNGA 3GSIA 3G8QA 1C4AA 1KEKA 4DR7F 2HW3A 4JOUA 3N6LA 1RLCL 1F5AA 2AWZA 2HRTA 5LJ3Y 1FJCA 2O67A 3MPUB 4ZCIA 4O0NA 2AGOA 2HHSA 2NR0A 3W65A 3RBZA 3Q89A 4K59A 2XGPA 1S4FA 2B9YA 1YITS 2GMLA 2QMUB 2YNHB 3THTA 3JQJA 2MYFA 4BCAA 2C2OB 2H5JB 1XC9A 4ZPVR 3UPFA 2ZZTA 3DOMB 3HSJA 2CQPA 2WB1D 5F0UA 3BREA 2GVZB 3NG8A 4RX6A 1IJEB 2UP1A 3OTCA 2D69A 2IA0A 1FK9B 3C6TB 1S76D 3I82A 1HNWF 2MQNA 3WX8A 1VQOS 2E5GA 5ETPA 1WHVA 2RILA 2QG9B 3K5MA 2AJ0A 4DR1J 1D9DA 2J0XA 3HHLA 3MMJA 1NRKA 2IRUA 4M5DB 4H4MB 1RBOB 2RH3A 4DG1A 3EYZA 1NK0A 1HBNA 2B5JB 2JX2A 1R8CA 1SJQA 1JLFA 4PG6A 4GKJJ 2YWWA 1ZBTA 3H98A 3FRYA 2E5JA 4KC5A 4DV5J 4DV7J 1HPZB 4DLEA 3MDFA 1EP4B 4YEAA 5IM0A 2V69A 2WOMB 2JSXA 2UVVA 3HSGA 3QIPB 3CUNA 2ZZNA 3SI8A 3R5GA 4RW9B 4I6WA 3JAMU 4YR0A 1UA1A 4FXVA 1EIYB 2VKRA 2YVSA 4L72B 1VQYA 2KT2A 1HBNB 4O0IA 5JUMA 1QAYA 1BHNA 1V9OA 4H4MA 4MYTA 9ATCB 5L9NA 4WIQA 1M5KC 3J7AN 1F2GA 5LSRA 2ZH2A 4DV4J 3R5BA 2BQUA 3PW0A 1HQ2A 3M8PB 4ZP8A 1S6OA 5IV3A 3PW5A 4HHUA 2HEKA 1L3KA 3HX9A 1MROB 7FD1A 3AA8A 2BDPA 3ET6B 3IBWA 3HVTA 1C0UA 3OR2B 4HI2A 3CD7A 3MEEB 2GHPA 4G1PA 3K5NA 5DLFA 1HHSA 1WI8A 1YSJA 3GYXB 4USTA 2HNZB 3CWJA 2GO9A 3HJVA 1AUDA 1Y5IB 3IRXA 4WU3A 2BE7D 5MAOA 1T94A 4QIFA 2V2VA 2YKMA 1X0FA 2CPYA 5J1EB 1NKBA 2KI2A 2EFNA 1U48A 4NCBA 3LANA 2FC9A 2LXFA 2LQBA 3AB4B 3GFYA 1IBCB 1FKPB 4NLXA 2ZH5A 2I8EA 1S99A 2FHJD 4I2PB 3J80Y 2ZJPQ 2DNZA 4GRSA 3ILJA 3AJDA 1SH3A 2YNGB 2G2ZA 4Q5VA 3NMAA 2ZH8A 1HD1A 2ROGA 1VFJA 2GAHC 2J9DE 4L73A 4C11A 3CCJS 1GAOA 1RSCA 3MEGA 4MYUA 3SCJE 2C3YA 4LFAJ 2CADA 2V9WA 2AEMA 2NSCA 4Q7AA 1WHYA 1FESA 3FKBA 3IMQJ 3OTOF 3BO4A 4DL5A 4IDKA 1H38A 4IG3A 1S6QA 1FXDA 2VG5B 3H5SA 4ES2A 3MM9B 1ELOA 1X4DA 2E44A 2RUGA 4DX6A 3T6JA 5D0EA 2EC0A 3I4PA 3MCNA 5IS2A 1NK8A 4X4UA 2ALZA 2ZD1B 4Y0FA 3AA9A 1LWXA 4KHRA 1KRPA 4HR2A 3OJSA 1Y10A 3AXKA 3TEGA 1W2IA 2Z2ZA 1NSQA 4ZN1A 2XLIA 2ZHAA 3NGKA 5DDOC 2NZ4A 1PSDA 1FDBA 1WSVA 3DFEA 4MFBB 4P73A 2XMVA 2L48A 3WC2A 1W7WA 4Q2LA 1RT5B 3W8GA 1JJ2R 3OLBA 2IDLA 1XR5A 1FEHA 1WEZA 1VQ9S 1O8BA 2ILZA 1Z2LA 5GAEU 3NBPA 2BACA 3FCVA 5IXUA 3E2EA 3OFGA 3G6YA 3E01A 3FBBA 4CZCA 1AFIA 2FTRA 1KOOA 3SV4A 1R8AA 4Y2AA 2Z2YB 5ETRA 5LL6d 1OWXA 2RIJA 3ETOA 4JUZA 4CO1A 3CJKA 5DDRC 2ILYA 5KFAA 1XERA 1YZ7A 3M9OB 2K3IA 3G87A 4OZ3A 2MHNA 1TL7B 3TX0A 4ANDA 4X65J 3RBEA 2EFGA 2CPHA 3WX4A 2L41A 2AJ1A 3SV3A 1T3OA 4KV8B 1RKJA 3KLVA 1DY3A 3CTRA 2NPIA 5B0AA 3K5LA 2VQEF 2FZGB 3QIDA 1VQKS 4GKKF 1IR0A 2JL9A 2WBRA 2LA6A 2VDHA 4KV8A 4XDCA 2CG4A 3QPIA 4XO0A 3NCRA 4JV5J 1UVLA 2Y1LB 3F56A 4EZ9A 3IA0A 2EFPA 2B4VA 2FGCA 4AL7A 3RRKA 4WZMA 4RPFA 1P8GA 3AQOA 4ZCMA 5HL7Q 3HVRA 4PUOA 3NCPA 2VOOA 1SB6A 4ECSA 1UL3A 4DV2J 4Q0BA 5KFCA 4M5KA 1C2PA 3OQ2A 2Y8WA 1JWWA 2DITA 4DR6F 5FLXU 2HK3A 3TZXA 1S1VB 3PX0A 3D54A 4KYZA 2CJYB 2R2UA 3MECB 3ITHB 4FP9A 5GAGU 2QLXA 4JV5F 5HP1A 2GGPB 5A8WB 3EZUA 1QSYA 3T1HF 2WSEC 2DPIA 3J81U 5J1PA 1T9UA 4WE1A 4ZA1A 2VH7A 1NMEB 5B0EA 2XNQA 3TEHB 5GADU 1VRUA 1SC1B 2L08A 5AT1B 4A8MP 2XGQA 2E1AA 5A2QY 3PW2A 1NLKL 3VVTA 1BMQB 2IDEA 3RAXA 4ECZA 2I2YA 2WAQD 1I6JA 3TI0A 2ZE2B 4BC7A 3A8IA 1FD8A 2ERRA 2VASA 3IFEA 2IVFB 4CH7A 5DQHA 5F8GA 2H3EB 3IAS9 2BRKA 4I6AA 3UWTA 2MQQA 3PDNA 1RZMA 3DRSB 3CJQA 2W4CA 5D77A 2FVPA 4IRKA 2E9RX 2GGPA 4ED6A 4RL1A 5HP1B 1UVMA 4M5NA 3ENWA 3R6LB 2QC3A 2BM1A 2M3DA 4XK8C 1QE1B 5E3CA 4CO2A 4C3LA 4PWDA 2E5LF 1BQNB 4IH7A 3S01A 4LF8J 1FTCA 2PMHA 4KGMA 3J7Z5 1YJ9S 1SL2A 1F9EB 2AX0A 5IFMA 1R0AA 3HSDA 5M2RA 1X4FA 4I2PA 5DM6Q 3K57A 2A6MA 5KT3A 1HBMA 4F3QA 1P6TA 2E1CA 3G6VA 1Q4RA 4TYAA 2IY5B 1NSPA 5D4PA 3VCDA 5HMWA 3OTEA 2RQ4A 3IAM9 2SXLA 3DLKB 2D9OA 4TQRA 3CCRS 3CCSS 1S7IA 2HBZB 4ZCLA 1FJEB 3Q8SB 3QT7A 2J0WA 1ZTWA 2CPXA 3RJMB 2IBKA 1X0PA 2FZKB 6AT1B 3RBDA 4DR2J 2HNZA 3MD1A 1UTAA 1H98A 1R3NA 3C6UA 2PT0A 3C2PA 5KT4A 2AW0A 3QSIA 1PKUA 4K5RA 4YUDA 4TU8A 1A6LA 3PYGA 2P9EA 4DV3J 3MCOA 2K3KA 2Q79A 4UOCA 4YR2A 2BR0A 1NDLA 5L9XA 5I3UA 1PC5A 2O3DA 3N01A 3ILOA 3FSIA 2UU9F 3J7YI 3MAAB 4UW2A 2EFOA 3NBPB 1D9FA 4CWBA 1PBAA 5C2CA 4DN9A 3D9BA 1JLQA 1L3SA 2MQ8A 1HYSB 2DGXA 2CNOB 3V2UC 1UVNA 4J90A 2X3DA 1F5CA 1DQ9A 1TV6B 1ZM4A 2C3PA 2V4QA 4MFBA 4DHVA 1OY6A 3CCTA 1TL3B 3PHEA 3BSCA 4O4GA 4ZDNA 1C0TA 4P2FA 2JHEA 2J9DA 4NLOA 5IM0B 1REVB 1VMBA 3M9NB 4NL5A 1WOPA 4Y2CA 2VDIA 3SIPB 2DHHA 3KYLA 2H48B 4J9QA 4DSJA 3TUPA 1YG0A 4NLRA 1SBRA 5KG2A 3UNGC 2WONB 1RTHA 4OJ3A 2MDAA 4GKKJ 2G9OA 1LKZA 1O0PA 2CUYA 2IMOA 5CYQB 2EKNA 4X4RA 1XMOF 3HHLB 4DG1B 2KXHA 3D1QA 4ECQA 1EQMA 4RNFA 3NNAA 2BRLA 2HFNA 2XMTA 3I6PA 3MMBA 4OZLA 4OZ1A 1WF1A 3ZZZA 1UWBA 4WFBQ 2QO3A 2VFTA 4YB7A 4OHZA 1WG4A 5KFSA 2B56A 2P9CA 3HO1A 1NHKL 1PCAA 2KKHA 3EZOA 3UR0A 4LRAA 1BQXA 1U4BA 2CWKA 2FLLA 2VG7A 4ICLB 4OI1A 2BJ3A 3R6GB 4J9OA 3CDEA 2QA1A 8ATCB 5IT9Y 3AOAA 3DC2A 3U1NA 4M1KA 2W8KA 2UVRA 4KJIA 2OLWA 1N0VC 1KR4A 3GV7B 5HLFA 1KVIA 1W25A 4ED3A 2Y0SD 3B4DA 4L6V3 1S79A 2LQ9A 2ATCB 5G0RB 5KFUA 4AD6A 4OFZA 1K9MT 2CQBA 4O3NA 4L3KA 4CM2A 1JKHB 1QJHA 2PA3A 1JLCB 3I0RB 2OP5A 3TNVA 1NDPA 5DJBA 1AYEA 1GXLA 1DAXA 4PYDA 3PR5B 4ES3A 3O44A 4ICLA 2VG7B 2H5IB 3CDWA 2M4MA 3PIPQ 3EM1A 3W1YC 2DRAA 1IN0A 2X51A 2HHPA 3CGIA 4QQBA 2G4BA 1EETB 1U0HB 2VFRA 2ZBIA 1UWBB 4HH1A 4RBVA 3N6NA 5ETTA 4ZVTB 1SQFA 2DNLA 1S1XB 2IAJB 3MMBB 4C4WA 2O66A 2R7TA 3CCLS 3TA0A 2OD4A 4I2QA 5H1SV 4ITSA 5B0DA 2JEGA 4ELVA 3Q2SC 4NLWA 1RHMB 1U8SA 3DRXA 4LQ3A 2BJ1A 2XZTB 2X7IA 2R8GA 3PW4A 2WCXA 3PYEA 4X4SA 4HDGA 2KHCA 3HI9A 2F8EX 1HFEL 4IFYB 3VAIA 3C46A 2LP4A 5CXTA 1LK7A 4F04B 3BBCA 4OZ2A 1NUEA 4ZPTR 1WJ9A 2CQ3A 3QIPA 1FXRA 2M2BA 5F3TA 3LWMA 3I9ZA 5MLCV 2P5VA 4O4GB 4J9VA 4KGVB 3EUNA 3JSRA 3OXLA 4NXNF 2HGLA 2V4JB 3KNGA 4FBTA 2BKOA 3OUYB 1T9YA 4I0WA 1S9GA 4Y65A 4IFVA 1U25A 1PJ7A 2EI5A 3M7VA 4GVLA 4YQWA 3RTVA 1HYSA 2R9LA 3TA2A 1U2RA 2VFSA 4ZVQB 1ZZFA 1QAIA 1S1WA 2CPIA 4G1IA 4FYYB 1RWPB 4Y3CA 5J2QA 3EVWA 2BJ8A 3NGSA 1BD6A 1RWKB 3CDBA 5I3UB 2DT9A 2YKOA 4LR9A 3V5RA 1X9MA 3IWLA 5HQMA 1PAUB 1FK9A 3NAIA 8AT1B 2YX7A 3M8YA 1ZAWA 4DL6A 5KTQA 3KHRA 3BPDA 1U1RA 2BJEA 3M6UA 1PYTA 3M6VA 4WJBA 3JSMA 2UVWA 2Z30B 3TAMB 2MQLA 3D68A 4DUZJ 3OT9A 3K17A 3DDNA 3CD6S 2D3ZA 5K14B 1B3TA 1WOOA 2MZTA 2AYBA 1HI8A 4EU0A 2J6UA 2MKKA 4HL9A 2WSCC 4LF9F 1DHMA 2DNMA 4Z2XA 2KFYA 1GMWD 2DNYA 2J76E 4DR4F 4UY8T 3AXMA 3AD9C 2MTLA 2R7OA 4F4YA 3QJPA 2KRRA 1YJNS 4E2FB 3F41A 3OHAA 1BUXA 3CCES 1S9EA 3FBFA 1Q78A 2LDIA 3M2UA 4XPEA 1SC4B 2F40A 2KJWA 4JB8B 4PRFA 3D0GE 1UFKA 3Q8QB 2R7WA 3P45B 4OHVA 3L7UA 5K8PA 1DTQB 3M1VA 4F25A 3DRSA 4HHHA 3J7ZT 2YTCA 4DJBA 4CLPA 3NXZA 3W62A 3MR2A 3BQ1A 2E7WA 1SI9A 1YTYA 2RF2B 3LP0B 2C42A 4ANCA 2V8DA 1B7YB 2OEMA 2IRYA 4DN0A 4B9LA 3UFCX 2W8LA 3ZTQA 2AEFA 4I67A 4QU7A 2YNFB 2R2SA 2CNKB 4ECVA 2IPOB 2FHMA 1DRZA 3C16A 4ZVUB 4F3MA 5RUBA 2PE8A 2DR6A 1WWHA 1KQSR 4WTOB 4FNHA 4LSZB 1VBKA 1VGYA 1XR7A 3I0SA 3LP1A 3THVA 3SSQA 4QOTA 2MB0B 2PC6A 3M9MB 1RHQB 1GMVA 2HRUA 2VBXA 3ITHA 4R8UB 5EDWA 1NPPA 3IS9A 2XS7A 3KLEB 4F4ZA 4ENOA 3BDPA 3QRQA 5T14A 4GO5X 3RG6A 3GCXP 1S0OA 1CPZA 3PR4A 2L3MA 5KFPA 2YX1A 4Q0BB 5ETSA 1GX6A 3GG0A 3OFFA 1UVIA 5FLXY 1U24A 5B7WA 1ZA1B 4Q43A 2C28A 1XN9A 2HWHA 4RLEA 2PMZD 2IJRA 4B3RF 2A2CA 2A6OA 5D0RA 3CDAA 3MF5A 3QO9A 1QLNA 1V6HA 4JYAJ 1Z4UA 1JXVA 1P27B 2M8DB 2LKZA 1TUWA 3DCAA 4PPDA 4RO0A 5AJ3J 3VHQA 5LT5A 2XB2D 4BDPA 2Y8YA 5D0GA 1IJFB 3Q86A 3W2VB 2ZWPA 1Y00A 1RADB 2YKQA 4YN3B 2Q6CA 1KLMA 1J27A 4BWJA 1GEHA 1TL7A 2B9XA 3K0JA 4QWBA 1MMDA 3DDIA 3WQPA 2XY6A 2M5YA 3DRPA 4DDFA 4F4KA 1IWAA 2UV8G 2HGMA 4KTQA 2IHR1 2VBZA 1Q81T 2QL7B 3M2RB 2BV3A 4IQXA 1RWOB 2AKWB 1B0TA 4RU9A 1E6VA 2EW9A 3BGRA 3A8EA 1YJ7A 4HACB 4IH6A 4UQTA 4CIOA 2FIUA 1RU1A 4A47A 1CJTB 3VAJA 1RT3B 2OMLA 3CC7S 2I1RA 3A1YG 4F0KA 2J9CA 4RBUA 4J91A 2FZCB 2GJ2A 3HVAA 3PKYA 3KK3B 2XG8A 1R27B 4LF6J 4FF4A 3DI6B 4AQYJ 4RW6A 1NZ8A 3TYTA 4XAKA 1TP7A 3UDLA 4WIIA 3H40A 4AQYF 3PVXA 1MLAA 5C25A 2QLFB 2WRMA 2KZZA 2AP6A 5AE3A 1B4SA 3MAHA 2HZAA 1QDUB 2HQIA 2VUGA 2RU3A 1UPPA 3EVOA 4B3TJ 4IOAQ 3T1YJ 3A13A 4N56A 4AL5A 3R7NB 2C22A 1N5TA 2EG1A 4LFCJ 2ZC4A 3KJVB 2UXBF 1M0SA 3TJAA
chains in the Genus database with same CATH topology
3M6XA 3DLJA 4K4XA 1VC6A 2KB2A 3O3LA 3ZZOA 4PXBA 5BYSA 1F9FA 1ZTTA 1U1LA 5E2QA 5A8RB 4B3OB 3MEGB 2NUHA 2R2RA 4PWUA 2HVIA 1X9WA 3NCQA 4AL6A 1YRTA 2HS0A 2XEXA 4FNIA 4C0BA 2DR8A 3KTQA 3NP5A 1DFDA 2FLPA 1YJWS 5AJ3F 2FJXA 2KXNB 1UKUA 1D8YA 1RKIA 5A0YB 5KFWA 2MY7A 3KLHA 3I5CA 4PXCA 4C8YA 4OI0A 1JLAB 4CQ1A 3MEDB 3O6QA 4ED2A 3POTB 2CQDA 1FF2A 2J7UA 2YKNB 1URRA 2ZBCA 2E7XA 2M0GB 2YKMB 4ILRA 4ECYA 4NLGA 3DHXA 5B0FA 1HD0A 3JB9k 1CC8A 2DK2A 2B4UA 2Q6BA 2QYCA 3EPIA 4DV2F 3N6MA 3E3XA 2B9WA 3CD0A 1GX5A 4PKDB 1LXNA 4B9VA 3HHKA 2N4DA 1OQ3A 2B0GA 3I56S 3CMES 3TVKA 2YQ3A 1LXJA 1RI7A 3TP2A 2LECA 3KLIA 4RW4A 2W9BA 2KT3A 3IN5A 2W7AA 4C3KA 2E5IA 2B51A 3U27A 5J2MB 5KG3A 4DV3F 5CH7B 1SUQA 3MM7A 3PY8A 5CYMA 4OJHA 2DVIA 1C1BA 4OX6A 1WF0A 4RW9A 2NQPA 4DR2F 4BS2A 1NKCA 2XMMA 2LXUA 1IQTA 3S7RA 1VC5A 1UEUA 2OKQA 3RYLA 2F8HA 5DDPC 2V9KA 1QM9A 4MK8A 2R8HA 1N6QA 4HH0A 4KHPF 2JFDA 1SV5B 3ZZYA 4MAKA 4Q2MA 2NS1B 2IYIA 1C1CA 3MUTP 4A8WA 2GNKA 2MZQA 4G1QA 2DRBA 4A8QA 2DO4A 5K8NA 4KFBB 4G3IA 3QLHA 3VQTA 2HFOA 1ZPVA 2UUAF 2COLA 2JJ4D 4IG0B 2A10A 2MPUA 2G0CA 3M2RA 2NUUG 2X1FA 7FDRA 2RMLA 2VD3A 1R8HA 1N36F 4RU2A 4PCQA 2FD2A 3D0IE 3MM6B 2YWKA 1BQMB 1X4HA 2RNEA 2RQKA 1M5HA 3P3DA 2KM8B 2MQPA 2RD5C 3LGNA 4N76A 3NMRA 1IKWA 3ZZTA 5GAHI 4AXIA 1RT6B 2F9DA 3W2WB 2DGTA 4Y2MA 2PSZA 4JI0F 2B4OA 3R1LA 4H4OA 3BDEA 2FVCA 4O3RA 4X4VA 3OHBA 3V4IA 2UV8A 1LWFB 2EKYA 2LDYA 5HBMA 4DS5A 2HMIB 2BBEA 3MMCA 1NNDA 2MSSA 4LIRA 2CVIA 5KFJA 4DSEA 5JVHQ 3TARA 2RRNA 1HARA 2LLZA 2VC0A 4LQ9A 1VI7A 3CCVS 3M32B 4P7VA 4O3OA 2IM0A 2FC8A 2FJWA 4USJC 4R8UA 3FSXA 4F4XA 1M5VC 2RKIB 1N0UA 3E8OA 1X4GA 4QYRA 2MSTA 1VS3A 1HQUA 4PXEA 2XCPA 3G8TA 3TOQA 2ZJRQ 3DXSX 2IM2A 3FNNA 3CDUA 3L7PA 1S6PB 3FMWA 5B09A 4J9PA 3I32A 3Q8PB 1KD1T 2ZKTA 4KPYA 3QJJA 5KAKA 1HQUB 3BB5A 4CO5A 3KHLA 1DTTA 4URSA 2ZKUA 4HTIA 4DSKA 5SUHA 1Q8LA 2CPJA 2X3GA 3M32A 3J7A1 4ELUA 5B0BA 1FKAF 5L1JA 1AW0A 2XSJA 2BABA 1RT2B 3MMCB 3BGUA 2E29A 2ZM6F 3N28A 5A6PA 3DOKA 2I5JB 3JTNA 1RTJB 1RP5A 2HG4A 3LP2A 5DETA 4A46A 3RRHA 4DL7A 3X1LB 2ACYA 1K1SA 2DNRA 3FFIA 4OX9F 5IZHA 5L39A 2J7WA 3H2LA 2ATLA 4KKOB 4HT5A 5L1KA 3BSNA 3MFIA 2FJEB 3W2WA 1RT6A 1TKZB 4ELTA 4IH5A 1IKWB 1FKOA 2XI3A 4OI3A 5L38A 1K0TA 3BGLA 4CI0B 3NGDA 4DS4A 3VQSA 3S6EA 1HBUB 4N47A 3JYTB 5AXMA 3JTOA 4EO6A 1BGXT 1JJ4A 4PG4A 2OPPB 2LVWA 3DYAA 3VAGA 2OH2A 1KFDA 5HMXA 1LK5A 2WK4A 3H2UB 5DG8A 2FB0A 3RW6A 2Z8QA 2NXUA 2R7QA 1S1UA 3N5FA 4A8FA 4EBDA 4A48A 4LT6A 4C2MA 3EGZA 1F0XA 1A7GE 2JDJA 2MKCA 1CSJA 4B9UA 1LV5A 2HNDA 2M9KA 2N4CA 2IBOA 3SYZA 2GW8A 5I42A 1K8AT 2JEJA 1P1LA 2DNQA 3FGVA 3V6KA 1QVFR 5K8OA 1G2EA 3QGGA 3HDSA 5IQQA 3VAKA 2OSQA 4P7TA 4YHHF 1C1BB 4DFJA 4LF4F 1HQEB 1P9QC 1NB7A 3HPOA 3ISND 3PIOQ 3G96A 2ROPA 2P6SA 3DM2B 3ISNC 4NLYA 1VRTB 3C66A 3I55S 2RDJA 5KFHA 1L5UA 4OHYA 4JI6F 2QE5A 3HF5A 3GFXA 5AXLA 4QIWD 3VZHA 1G3OA 5DGAA 3OTBA 1VLYA 3V4IB 4WTYA 2RRAA 1U2FA 1KHVA 2C3OA 2K7JA 5CA5A 2LYVA 1M5OC 4KO0A 5ADZA 1I1GA 4LF8F 4R5PB 5F8MA 1LFWA 2GIQA 2MJUA 1NH7A 2IA6A 3NWGA 1JKHA 3N9UC 3H4DA 2WBMA 1R6YA 4IOBA 1RT4A 1BQMA 2XMWA 5F9LA 4QR0A 2DHGA 2LCWA 2R7UA 1PILA 5HLFB 1JLAA 4DQQA 1LOUA 2XC9A 3V6DB 2OPRB 1S49A 2V0NA 4V19J 5SZTA 3IR7B 3PX4A 4IG0A 4GO7X 2MZJA 2QEXS 1TVRB 3QZ7A 4DQPA 4K4YA 1T95A 3MR5A 2I0XA 3QLHB 2JEFA 2ZDOA 3G9CA 1YIJS 3MR3A 3KHGA 4KRWA 2KG0A 3VALA 4WCEQ 4Q8EA 4NA3A 2ZC3A 3US5A 3R1HA 3BZQA 1FA0A 1ULRA 2M8HA 4DFKA 4ES1A 2F9JA 3MFHA 4NLUA 3Q24A 4TN2A 1FXLA 4ZK7M 4OZJA 1SV5A 4EO8A 2OAUA 1AROP 3HT3A 1ZZNA 3V6JA 1YRUA 2HNYB 3FEYB 1RK8A 1FRJA 2AGQA 2N7CA 4MH8A 2I38A 2FPHX 3NLCA 3DMJA 3LGMA 1VQ4S 2HFZA 2J6SA 1KHWA 1V3RA 1B0PA 2R7RA 1LFPA 3OVAA 2DNHA 3J7YU 4PR6A 3CSKA 5DM7Q 1U1PA 1TV6A 3GR1A 4LVNP 1SUQB 1E6YA 3I9V9 3LO3A 1X4BA 4OLOA 4V19X 2V8VA 2QZ8A 4FF3A 2FJBB 1TVRA 3BSAA 4LIWA 3BGRB 3MPWA 5KFQA 3VWSA 3R5DA 4DLGA 2VB6A 4M94A 3CF5Q 4P6QA 4JI7F 3EGWB 2OPRA 3FMBA 3V6DA 4ECUA 2DBBA 4N77A 4MK7A 3DLHA 4P2SA 3ZZ0A 2LU2A 1MU2B 1Y9OA 4FXWA 5DRKA 3T1YF 1NJZA 1HI1A 1RT4B 3U7JA 1B64A 2JC0A 2FJDB 1GTEA 3PXGa 5EWGA 2R8JA 4C3MA 3BN4A 4YDDB 2GQ2A 3OVBA 3D1HA 2OIHA 4TU7A 2A1BA 5T7LA 4TLRA 4TLQA 4YP3A 1NKEA 4AE5A 3POTA 2PD1A 4C0OC 1T7PA 2PEHA 2BVZA 3KWMA 1NJWA 1QVGR 1HBMB 4ZOSA 4EEYA 3T19A 4RKUC 1R0AB 3UCZP 4A4JA 3TAPA 2RB7A 1N8RT 1JMTA 1JNZB 4YB5A 3HJFA 3DGPA 1GH8A 4QBUA 1QAXA 3RB0A 4C8OA 3WBZA 3IS9B 3KMQA 2GO8A 4MKAA 2WSFC 3MCSA 3MPYA 4ID5B 1OQ6A 2QMWA 3SXLA 4U7CA 1PGZA 3I0SB 4XPCA 2MY8A 2QA4S 1TL1B 3IXQA 4RW8A 3VAFA 2HHHF 1WNEA 1IBMF 3SCKE 4CH0S 4J9LA 3K5PA 2J0QD 3L95X 1N54B 2QRRA 2RQMA 3HVWA 4HI1A 3UCGA 2DNPA 4DMZA 2RJZA 3BO3A 1YJRA 2KDOA 1WTFA 5F8LA 4DF8A 2B7CB 2ZHBA 1S77D 1JLEB 1DTQA 1X5PA 3M1VB 2Q43A 2RDIA 4C7QA 1VK3A 4OZNA 3D2WA 3HLUA 3QGIA 2KT5A 4M63A 3KOAA 1ZH5A 5CD4H 5LXYA 4HEA9 3MM5A 4DQRA 1HR0F 2B7BB 2Y1JA 1H2VZ 4IQMA 2DPJA 3NNCA 1E6VB 1KONA 1BC6A 2FJAB 1CLFA 3DRYA 1VIOA 1HBUA 2KYXA 5KFIA 3OL6A 4WFAQ 4NLDA 2YKAA 2OJ3A 4PUOB 1IKYB 3LWLA 4I64A 3B78A 3GYNA 1ZAVA 3N4WA 4U6PA 3SFUA 2PI5A 5E3PA 4X4TA 3VAHA 3M2VA 3RAQA 2FGOA 2H5EA 3OSPA 2XCAA 5FDLA 4HYKA 4KKOA 2DGUA 2EBGA 2ZUGA 4OIXA 3C8YA 4DL3A 4KSEB 4WK3A 3DRRA 2HS3A 3IWNC 5ITHA 2I5JA 3L09A 1F5BA 4U9RA 5T41A 2J5AA 2FDNA 2EFVA 4D3GA 2XSJB 1M1KT 3MMAB 4ZPWR 1TR0A 4GKJF 1B0VA 3RR7A 3VAMA 4DSIA 3EXYA 4KIAA 3K8VA 3HKWA 3KLEA 3SSSA 4NRTA 3GILA 2FVRA 1X4EA 2JH3A 3OUYA 3H5YA 2NPFA 5AXKA 1YQHA 2B6AA 5JXSA 4CTAA 2X1GA 3KK1B 5KG6A 2A2DA 1UJ4A 2MHEA 4DX8H 4YB1P 4I68A 1NJIT 1FRMA 1Q8BA 1LWCA 2DH9A 3Q23A 1WEYA 3THPA 5F9NA 4ATNA 3C3LA 2KHDA 3ZZUA 1GT8A 3MURP 2DNOA 1Q53A 3AY0A 4MKYA 4EGLA 5CCLA 1BY9A 5HROA 3H59A 5KFLA 1TK8A 1RQ0A 2BW2A 4X4NA 4H54A 5KFVA 5HBMB 3CB4A 5F41A 1SC6A 3KLFB 1NH8A 1LWFA 2BXJA 2D9PA 3M2UB 4Y28C 3RB4A 1S9EB 2JVOA 3GMGA 2XS2A 4GC6A 3QAUA 2ZH4A 1WI6A 4H4OB 2KTQA 2DGOA 3FDSA 4CCHA 3IC1A 2W9AA 3DLLQ 3V6HA 2GA7A 3I31A 2XI2A 1U6BA 4KR0B 1NK5A 2CQGA 3CCUS 1QAJA 3JSBA 2L9NA 4OHXA 4JV1A 4ZCKA 2GJIA 2EK1A 4O4RA 2JZ5A 1KQFB 4EYIB 5LSLA 2ASDA 4OLPA 4EWTA 2B4PA 4RW7A 4ZPAA 3GFZA 5F0WA 3TAMA 3LH2S 3M8RA 3JSMB 1WF2A 2QV6A 4OL8A 4LMZA 5EN1A 3OR2A 1SKSA 3GB0A 1DJ0A 3MEKA 1VBXA 4QWEA 2E9ZA 3Q8RB 3M8PA 1L3UA 2KU7A 3UR3C 4A8XA 2VPWB 2MGZB 1T03B 4QIVA 4J37A 3CO9A 1Y5LB 2D41A 5EX3A 1S0NA 1JXLA 2DGVA 4NPOA 1HWLA 3MZIA 3PFEA 3PRBA 4C9DA 1DBDA 1GTHA 3W7BA 3BJYA 4DFMA 1REVA 2L9WA 5B0GA 1C0TB 4X62F 3MWBA 1TL3A 4QW8A 2V8HA 5CYMB 1JLFB 3OJUA 2N7YA 3B4MA 4KBIA 3S8SA 1VQLS 2B5JA 2HHQA 2GIRA 5KG1A 4RW4B 1R31A 4DUZF 4ZVFA 1D9AA 1LW0B 1X4CA 2HIQA 2OPSB 3HHDA 4DV1F 1U45A 2MGZA 3NL0A 3U02A 1U09A 2ZZMA 4KQZA 2HHWA 1FRKA 4UUXA 4NCGA 2CQ4A 1ZYQA 3OL9A 1XEZA 3T5KA 4OI6A 1Y3JA 3M30A 1MMNA 3GR0A 3HK2A 3PRDA 4YFUA 2UUWA 1NK6A 2W24A 3IG1A 2OPQA 3T9ZA 1S0MA 1N52B 1N5QA 4EBEA 4IYQA 4NYZA 5G0RA 1U1QA 4C4WA 3DXBA 1FVQA 4A8YA 3QWUA 3L7OA 1NHVA 1R8BA 4AYBD 4ED1A 4UUWA 1RTDB 2XZWA 2DH7A 2QT7A 3MTKA 2DISA 3U1LA 4TQSA 3CMAS 1CEZA 3AJ2A 1NZAA 1TL5A 2HLUA 3GFHA 5E7OB 3SCIE 4DEZA 1BQNA 4DL2A 5U47A 4B3OA 5A8RA 1FJGF 1IKXB 2W9CB 2F1FA 5IT4A 4X4OA 2HHVA 2XMJA 3GIKA 4URQU 2QA4G 3ULHA 4Y2IA 2X1BA 4OJGA 3BO2A 4EBCA 4M8LA 1RTHB 4DQIA 3PEHA 3HZGA