2N4DA

Ec-nmr structure of agrobacterium tumefaciens atu1203 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target att10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
b'AGLSFHVEDMTCGHCAGVIKGAIEKTVPGAAVHADPASRTVVVGGVSDAAHIAEIITAAGYTPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu1203
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Agrobacterium fabrum str. c58
molecule tags Structural genomics, unknown function
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n4dA00
3HX9A 4FNHA 3BR8A 3FGVA 1APSA 2BJDA 1CPZA 3HHLB 3TRGA 1YJUA 2PD1A 5KAKA 2AJ0A 1MWZA 2W4PA 2K2PA 1S6OA 4Q2MA 1P6TA 5B0FA 3HHLC 1P8GA 1YJRA 1YJVA 3IWLA 4Y2IA 1N5VA 2QLWA 1OPZA 3QGPA 2BUNA 4U9RA 1YRXA 1ULRA 1AW0A 2KKHA 5F0WA 4EFAC 1Q4RA 4DL0C 2QLXA 4NL5A 1JK9B 4HH1A 1TL5A 4A46A 1AFJA 3I9ZA 5A6PA 1FVQA 3DCAA 1U7LA 1Q8LA 2K7JA 2KT3A 1R6YA 3MCSA 2QIFA 1VQSA 1URRA 2OAUA 1X0PA 1Q8BA 1FESA 3KG1A 4Q2LA 1TR0A 1CC7A 2OD4A 1AFIA 2L3MA 1OQ3A 1RJJA 1MWYA 2W4CA 2LQBA 1Q53A 3BM7A 2OD6A 2HQIA 4HH0A 3TNVA 1FE0A 1LQ9A 1FVSA 3FMBA 3LO3A 1WD6A 5T7LB 5B0BA 2GCFA 1YG0A 1FD8A 2HFNA 3QMQA 3VTIA 4FNIA 2ZDPA 3IWXA 2ACYA 4OIXA 4A47A 2BJEA 2XMMA 3KNGA 4NPOA 1W2IA 5B0GA 4DPOA 1K0VA 3E8OA 2RU9A 4OJHA 2XMJA 2G9OA 3BDEA 5B0AA 2LQ9A 2W4DA 2IFXA 3DXSX 2OFGX 3T9NA 2JDJA 2CRLA 2ZDOA 2XMUA 2VV5A 4A48A 4HI2A 3KG0A 1V3ZA 1TL4A 3BGUA 5K9FA 1CC8A 1FEEA 2GGPB 3F44A 3HHLD 1QUPA 3HHLA 4YEAA 2IYGA 5T7LA 3TOQA 2FB0A 5B08A 2N4DA 4YDXA 2OKQA 2N4CA 3GZ7A 1TUVA 3HDSA 3BN7A 1VQYA 1KVIA 2PGCA 2GO8A 2BYCA 2HFOA 1GXUA 1S6UA 4OJGA 4ZA1A 2OFHX 3CJKB 2BBEA 4HI1A 1Y9OA 3BF4A 4A4JA 1SI9A 3KKFA 4Y2MA 3WDOA 2EW9A 2FHMA 2GV1A 2IYIA 2K1RB 2ROGA 3HFKA 3HF5A 1IUJA 1Y3JA 2KT2A 1N5QA 2XMWA 1Y0HA 2ROEA 2GGPA 2KYZA 3UDCA 4HL9A 1SB6A 2FTRA 1SQEA 5B0EA 4Y2KA 2XMKA 1X7VA 1GXTA 2ASYA 2Q3PA 1N5SA 1OQ6A 2XMVA 3K7RA 4ZOSA 2OMOA 1N5TA 1FE4A 3MZIA 1KQKA 5B09A 2OP5A 4OJ1A 4F67A 2RSQA 3LGMA 3CJKA 2LDIA 1XBWA 2GFFA 2HLUA 2VH7A 5B0CA 2RMLA 5F0UA 5A6WA 1TZ0A 1YJTA 4QOTA 4OJ3A 2K1RA 1Y3KA 2LXFA 5IXUA 1JWWA 2GA7A 2N7YA 5B0DA 2K7KA 2XMTA 4DN9A 1KVJA 1OSDA 1X8DA 2FIUA 2RILA 2AW0A 2HLTA 2HIQA 2ROPA 2QYCA 3BB5A 3FRYA 3LGNA 2AP6A 2AJ1A
chains in the Genus database with same CATH superfamily
4TKTA 1APSA 4ES2A 1SJFA 1HQUB 1W26A 2VG6A 1CJTB 1RT2B 2UUTA 1KOHA 4A8SA 1UL3A 2BX6A 3U02A 1RTHA 4OZ5A 1LWFA 3T6BA 2CNNB 2E9ZA 2ZDPA 4TLQA 4DPOA 4K5RA 1YJWS 3MMCA 5L1LA 1G1XA 4OV6A 2XGPA 3C16B 4MIWA 5KFCA 2MKJA 2AYMA 1VR6A 3OJUA 3BGUA 3UFCX 2ZH8A 4MIAA 2YKNA 2E5GA 4Q8FA 4NLVA 3Q89A 3D66A 1A0OB 4UY8T 2BQRA 2MEWA 4KFBA 2LKZA 4ZN3A 4ZMMA 3NS5A 2AGOA 3HF5A 1S4EA 2VIHA 2VQFF 2CPYA 4CNYA 2HW3A 4B3OA 2JVRA 2KYZA 2A2CA 3MEGA 4LRBA 2FTRA 3AD8C 5HL7Q 4DR6J 4OJ1A 1R0BG 1SUQB 5DDRC 3CDEA 4KPCA 2HNYA 1KN6A 5KFEA 1SJRA 5LSLA 3W2VA 3R7SB 5IT0A 3CWJA 2WZ1A 2A0FB 4F0MA 2BW2A 3C14B 5E3CA 1FFWB 3MEEA 1ITPA 2UVVA 1N34J 3HHLC 1CS4B 3OFHA 2ATLA 3OBIA 4GVLA 2HEKA 3MTKA 4YHHF 3C6UA 1CJKB 1DQAA 4TQSA 3T3FA 1C0UB 2FZKB 1AT1B 2LQBA 1FWKA 2DHXA 4DG1B 3PNIA 1RWOB 2QTWA 2VA3A 9RUBA 4E98A 2CQGA 4AT1B 3MR7A 2MY7A 4B9TA 3P49B 1WDTA 2I5JB 3MMAA 1U6ZA 4F4YA 3DC2A 1ROFA 4O0NA 3A12A 2QMWA 4NLSA 1ZBTA 5G0RA 3IP0A 2JC1A 3GILA 1VBYA 1HHSA 3BN7A 5DG9A 2FLPA 5RUBA 3O1LA 1EJ7L 2RRNA 2YWWA 3TZZA 1WORA 3HFKA 2DR9A 2OPSA 2GGPA 3ZZPA 4LRDA 1ZTTA 2XNQA 3O44A 2HHHJ 2QYGA 2Q6BA 2XHCA 2HIYA 1Z1ZA 1Y3KA 1ZM9A 3H40A 4CLTA 2HLTA 4ZHRB 1U0HB 2ZD1B 2XCPA 4J9KA 2EFQA 1OS5A 3H2VE 3BV8A 5B7WA 3D6MB 3IAM9 4NLDA 2FY1A 3OUYA 3IRXA 1DQ8A 4JBCA 5EWFA 1S9EA 4PPZA 1JLGB 2EK6A 4YOEA 4TVAB 1NLKL 1Q53A 4CLWA 4ILRA 1VHFA 3POTB 1VI7A 3WBZA 4JI7F 3IWXA 3FCHA 5L1JA 2CDRB 1SKWA 3HD2A 2E1AA 2Y1RI 2PGCA 2MQOA 4WP3A 4B9NA 2JH3A 4MK7A 3DGVA 3DRYA 2M0GB 3SI8A 3OL9A 1DTQB 1RT6A 2QC3A 4EO8A 3PO4A 4A8YA 3CCVS 2B9YA 3ZZRA 4DQPA 2GMJA 5IV4A 2ZH9A 3TVZA 3AD7C 1VBXA 3OTOF 1NEEA 3T1HJ 1CQMA 2MYFA 1DZ5A 5EDWA 3P6YC 3ZZ0A 3DOKB 3NG8A 1WJ9A 1RTDB 2AJFE 3KJVA 2OIHA 1SVDA 4DX5A 2C2KB 5HJXA 1KLMA 1TQLA 1IBCB 1JXEA 2IY5B 3MPYA 4IG3B 1XR7A 3GFXA 3L3CA 4LF8J 2DR5A 4OYBA 3KTQA 4O23A 5C25B 3EUNA 4HH0A 2FLLA 5CABA 4OLOA 3DMJB 1BUXA 3NGUA 2XMAA 2HRYA 1F0XA 5HJYA 2UUCF 4ETXA 1T9XA 1N54B 3J7YU 2B8QA 3M8QB 4ZA1A 1XNRJ 2CAJA 1Q1KA 3MPUB 1SB6A 1SQEA 1A7GE 5AE1A 3NBPB 3KK3A 2DJWA 2RIJA 2OPRB 2V63A 4MKAA 1FXRA 5B0DA 5KFUA 1PJ6A 4K4VA 3ZZYA 1YJNS 4B3TJ 2J6UA 3TVKA 5E33A 5HANA 2QA4S 1TFWA 5J2MB 1KDNA 4X62F 4DU7A 1CJVB 1Q8LA 2DIUA 1R6YA 2KFYA 3CCWA 3QAEA 2R2TA 4LQ9A 3I0SA 4RUHA 4EU0A 2LCWA 2QEXS 4ANCA 1XIQA 5CZVA 4OI0A 3NKYA 3EVOA 2CXEA 3MFHA 2DITA 1KVIA 2E5LJ 1EX8A 5D6GA 3DKDA 4ZVEA 2XMWA 2UVWA 2CJXB 2IC3A 3D67A 3BGLA 1AZSB 4E8UA 2R2RA 2QL7B 4Y34A 2W01A 1WC0A 4MKBA 3DDNA 3SYZA 3ILIA 1GAOA 3Q83A 4YB6A 4OZ2A 2BRKA 4HACA 5LJ5Y 4P2MA 3WIVA 2DPJA 2F9DA 3GJRB 2ZH2A 4Y6IA 3QT8A 5KFFA 1NZAA 3CJ4A 3T41A 3TAQA 3CVKA 2ASLA 1GMWA 3TA2A 1U2FA 1VIOA 3WHIA 2YH0A 3QIPA 3EE3A 1ICEB 4ZVOB 1X4BA 1Y5IB 3D4JA 3F44A 1T8EA 5L8RC 4Z7YA 1J5OA 2GO9A 3CDUA 4UUWA 4OJGA 2P9CA 2UP1A 4CYUB 4MMOA 2O01C 4ZP6A 2VFSA 2XS5A 4ECXA 4C8LA 3JYTA 5A8RB 4CH0S 2OP5A 4F67A 2JOQA 4P52A 3ET6A 2HNZB 5HQ8A 2D41A 2Z0GA 4K8RA 4PXBA 3QZ7A 4NX9A 4M1KA 3PVXA 3KNAA 1UWAA 2Q1LA 3MMBA 5KFWA 1HWKA 1G2EA 1E6YA 2YQ3A 1DLOB 2EFOA 3KJFB 2J8AA 3QATA 4LRAA 2MHEA 1HQEB 3CO9A 4TY8A 2G9OA 3ENAA 2UXDF 3PDNA 1TAQA 5CYMB 4R25A 2DXEA 1S0MA 1Q7LB 2ALYB 1N8RT 5DRKA 4NE9C 3KLHB 1YJ7A 1S0NA 3DLGA 2P8IA 2HBQB 3CGIA 3MHYA 2X1BA 3PACA 1HNVB 4ZPTR 2V50A 2ZZTA 1FDNA 3MM9A 2EBGA 4F0KA 2W9BA 3EZ5A 3GYGA 4F3QA 3HJFA 4ECVA 1REVB 4H4MB 1ZM2A 3V5RA 2KM8C 1DTTA 2KVQE 4ZVSB 1HR0F 1PBAA 4O3OA 2UV8A 3RB3A 1BE4A 1L3VA 1WEXA 2DT9A 4NOHA 1PC4A 3M8PB 3TX0A 1FNMA 1TTHB 4QWCA 1T94A 2KT3A 4LF8F 5KFZA 2OAUA 2B6AA 2KTQA 2PA8D 5DQHA 4NXMF 2V69A 4ICLA 2CQCA 3IBCB 4HHJA 2N3LA 2DGOA 2MMYA 2LU2A 1SKSA 5H9EJ 4TYAA 1CJUB 5GADU 3D1HA 2YKAA 1LFPA 1Y7PA 3NLCA 1FKOB 1IUJA 3GSDA 1NSAA 1S7HA 2J0WA 1RWVB 3THTA 1O6XA 4KYZA 2PE8A 3T5KA 1ZPVA 3AJ1A 1B3TA 3MGJA 1IM6A 1JX4A 5KG6A 2MLYA 1JJHA 3DI6B 2XWXA 4B3TF 1VQ4S 4ED0A 4ZCIA 3BBBA 3RBDA 2YNHB 1P1LA 5U47A 3OVAA 2YWKA 4PXCA 4NLYA 1CC7A 2I0XA 1S97A 2G4BA 3DLEA 3LO3A 5I3UB 4I6AA 2ACYA 2BJEA 5AJ3J 1YBTA 2Z57B 2OH2A 4U7UD 3VAGA 5AXKA 4IOBA 2B5JB 3QFWA 1HPZB 3S8SA 1VBKA 3DU5A 2GVDB 3GJSB 1LFWA 2AEMA 4MAKA 4F3OA 4K0KF 2AEFA 2E5LF 4EO6A 3C2PA 4BWMA 4V1Ak 2FQQB 4U95A 2IYIA 2YY3A 3S6EA 3H59A 4USVA 1FRXA 2PSZA 3DRSB 3HPOA 2EFGA 2RT3A 3AB4B 5IT9U 3UW1A 3DOLB 4LF4F 2M5YA 1VJQA 3D6TB 3HP6A 1EKRA 2GHWA 4RUAA 3W61A 1CVJA 2DBBA 1SCJB 4O3NA 2YXLA 2GAHC 1SQFA 4KE5A 1S6QA 4FS1A 3FNNA 1BGXT 4PXEA 2FVRA 2MGZB 4NCAA 1VYAA 1OQ3A 1H38A 4K2XA 4KY3A 4NLGA 2D7SA 5A8KB 1RXOB 3KXDA 2NPIA 2HHWA 3G96A 1WC4A 3FJ2A 3TR5A 4RNNA 2MB0B 4YQWA 1HNZJ 5KT7A 5D0HA 3GCWP 2L9NA 5DZ7A 1D0EA 3R2DJ 2B4UA 2CPHA 4YR2A 1DARA 3CCMS 2EFNA 3CNQP 3DXBA 4C11A 3VQSA 2GZOA 4JV0A 3WQPA 4H4KC 3CJQA 3AHPA 4J37A 1JLBA 1N0VC 3PHTA 4B3SJ 3VHQA 2F4FA 1N6QA 3KUGA 4JP8A 4ECTA 1F6TA 4ZOSA 3HVTB 2FVQA 3CJKA 2A2DA 2HHSA 2W25A 3HZGA 4P2FA 1FJ7A 3SCKE 2JL9A 3G6ES 1TL3A 4NZ6A 3LUYA 3CJ5A 4CTAB 3IMQJ 1VQ5S 3D0HE 1T11A 2QLXA 1TL5A 1TMMA 2BE9B 1E6VA 5A6PA 4WU3A 1QAIA 4YMEA 3EYZA 2C2ZB 5KFRA 2C3MA 2O3DA 2R7QA 3MOZA 2B3TB 4ZITA 1T3NA 2BV3A 1IWAA 3PX0A 1RTJA 2GAGC 4UOHA 2FGOA 1VDHA 3FVYA 3LF0A 3AB2B 1V3ZA 3A8EA 3M9OB 1DFDA 2MXYA 5B08A 3B82A 2OKQA 5DJBA 2N4CA 5FIIA 4DV3J 4O4GB 1I1GA 1EB0A 4ZLJA 2IJNA 4F25A 3RYLA 1B7FA 3GIJA 5DG7A 3HO1A 2QSWA 1H72C 3ZFVA 1FXDA 1NK9A 3LPYA 4HDGA 2QLBB 4Z37A 2AQ4A 2HHVA 4DOZA 5GADI 3OHBA 4DR5J 4L73A 3CMES 2DGUA 4H54A 2NXEA 1UP1A 3IWLA 3FEZA 4CQ1A 4FKXA 1F5CA 1NB2A 4NZ0A 3NNAA 3M1VA 4KO0A 3I9ZA 2H9ZA 2L41A 1H74A 5ETMA 5F9LA 1Q0NA 3M6XA 2AF6A 3CUNA 2M4MA 2YNFB 1S1WB 3NAHA 4OX9J 4K4TA 3TAMA 2ZWPA 2R42A 2IM0A 2GNKA 3KLFA 1QVGR 4FZVA 1U48A 2HQ3A 3I56S 1KS2A 1EARA 4DV4J 2BA9A 4F4ZA 2DGWA 1LWEA 1J5EF 4OI3A 5HO4A 3WZ0A 5KFVA 3C6TB 4W98A 3C66A 2WVFA 3W9IA 3IGNA 4FYDA 1H3DA 1MN7A 2V68A 1FO1A 3FZBA 2ZBIA 5KFPA 3BGRA 3KLEA 1LK7A 2Y8WA 1KVJA 1VQKS 2JZ5A 2HIQA 3BB5A 5KFSA 1VQLS 3BR8A 2WB1D 3I0RA 3RR7A 1JLAA 1PILA 4KGZB 1XNQF 2E29A 2DNLA 3TQ1A 2DB1A 1H2VZ 2FC8A 2DY9A 2VJVA 3PZPA 2XZDB 4ZP9A 1R27B 3V2UC 2E5IA 3M2RA 3JAMY 3ZTPA 1NHVA 2WVDA 2JDJA 2NPFA 2HHQA 4PABA 2V4RA 3TOQA 3CCZA 9ATCB 3KK2B 5IS2A 2L9WA 3TI0A 2ZKUA 3R97A 2HVIA 1XC9A 3U27A 5DDQC 2DHGA 1G7CB 2HFVA 1HHTP 2MKHA 3BR9A 3FEXB 4IH6A 4M5KA 2UUAJ 2PA3A 4F4AA 4DR1J 2QX0A 2CVIA 3DRRA 5KG1A 2XQCA 1FCAA 2KHDA 3FBFA 5GMEA 4ALZA 2IHR1 3M8RA 2BUNA 2WOMA 3DDKA 4C4WA 2Z4PA 3L7PA 4C98A 1TU0B 3MCSA 2DPIA 2XTJP 4Q2LA 2QA4G 4M5MA 4USMA 4KSEB 2Y3YA 1WG1A 4TU9A 4S0MA 3M9MB 2RUGA 2VOOA 4DL2A 1HQUA 4K7QA 1CJTA 1RT2A 2YH1A 3IGVA 3DXSX 2CJQA 1PIEA 4JV1A 4CH1A 2D3O1 2BACA 2F8MA 2MHNA 2YWHA 2C2RA 3C16A 3OXGA 1P9QC 2MQNA 4DEZA 4LR9A 3EWGA 1D8YA 2PIIA 3QJJA 3PEHA 4P2SA 3MM7B 5F8JA 1XBWA 2CPJA 3MMCB 4LF7J 3JSRA 1YLXA 2VBZA 4NZ7A 1YBUA 3OD2A 4LBPA 3TQEA 3SQGB 5HMZA 2YNGB 3D0GE 4XTTA 3N9UC 3GR1A 1SUQA 1HNXJ 2KG1A 2RRBA 3KG4A 4X65F 1M5PC 2NZ4A 1UFLA 4I6WA 3Q23A 3TUJC 2XY7A 1URRA 3C14A 1KQSR 1RWUA 3VAFA 2HQCA 4RX6A 4RUCA 1CS4A 3IFEA 2HFSA 5E3AA 1PAUB 5CXTA 2B4VA 1CJKA 1QDUB 1C0UA 3SQOP 4IRDA 1GMVA 5AXLA 4DL5A 4DG1A 2VBWA 2B9WA 1VC0A 3TJ9A 3E2EA 4FYVB 1I94F 3W62A 4QQBA 2GQCA 4CP5A 2I5JA 4Y2MA 4FS2A 1S10A 1XTZA 5A8WB 4J9SA 4DV6J 1TFYA 3GFHA 2FC9A 2IBKA 1UVIA 1IKWB 3CJ8A 5IZHA 2MQ8A 2LXFA 4PYAA 4LF5F 2KYXA 4X4PA 4UQGA 4HLBA 2X1FA 5ETKA 3AJDA 1BQNB 1KOOA 3OTBA 4EFAC 3FDSA 4BC9A 1RHMB 4C0BA 1NHUA 4ZHRA 1U0HA 2ZD1A 1TELA 3L4BC 1M5KC 2LYVA 5KFIA 3T1YJ 1RQ0A 5KG7A 3SSQA 1RBAA 1AXQA 2OD6A 1K44A 2V8VA 3P96A 2XY6A 4ANEA 2ERRA 3KNGA 2RDIA 4E2FB 1GEHA 1TP7A 4RL1A 2W2PP 1JLGA 4NEYA 2RKIA 3SV4A 1MMDA 2BJ9A 5I3QA 2FVPA 4F4WA 2YKOA 3POTA 3IS9B 1H2UX 4RNMA 1IJEB 2HNDB 2UU9J 4DV4F 1SKUB 1K1QA 2EWHA 1VQ6S 1PAEX 4KB7A 1HWIA 1NH8A 1UKUA 2GVZB 1QSLA 2V4JB 3BPSP 3KDOA 8AT1B 1EHWA 1ZYQA 3E51A 2ZE2B 5F0UA 3LANA 1DTQA 1I51B 2N82B 5I4MA 2W2MP 3VZHA 2WSEC 1IVZA 1WKJA 2H48B 3BQ0A 2HMIB 3PTWA 4X4RA 2BR0A 1UVMA 3G9CA 4OI6A 2V34A 2OHDA 3DOKA 1X5SA 2AJQA 2DH9A 1RTDA 5GAEU 2BJ8A 2K3IA 1WTBA 1W25A 2HS4A 3K5LA 4IG3A 3UDLA 2V8PA 2FGCA 3CCTA 2QZ8A 4YP3A 3PYGA 1UEVA 5C25A 2HQDA 1CEZA 2XBPA 1IR1A 2HG4A 1R8AA 1TUVA 2EVZA 2VASA 3DMJA 2W2NP 2JNJA 1CSJA 2NXNA 3SCIE 2MKYA 1JLEA 5KFNA 1BLUA 3NCQA 1A6LA 3DLLQ 3M8QA 1NJZA 2HLUA 2IVFB 2Q6CA 2UVUA 3DLKB 1S99A 2I9SA 2IRUA 2CYYA 2UUAF 5CYJA 1RUSA 4DS4A 3CDBA 3BYRA 1NXIA 3NBPA 3ITHB 3OLBA 2YWEA 2MKKA 2KKHA 5CCMA 2HFZA 4ECWA 4B3MF 4ZVPB 4ECSA 3Q0AA 4OYAA 3D0IE 2B7CB 2JWNA 1SH0A 3DGPB 2RNEA 5J2MA 2FY8A 1CJVA 5M2PA 4QWBA 2KDOA 5C24B 5IWAF 2CADA 1RZMA 3L7OA 2KU7A 1AUSL 3S01A 2XLJA 2EI5A 4AXIA 4LVNP 5KG0A 1QY7A 2D74B 5CHCB 4WZMA 3SMZA 1W2BR 1GX5A 4Q0BB 2F4VJ 2OFHX 4OYOA 4BWJA 2J8SA 1VRQC 4RWXA 1WC5A 3LOUA 3N6NA 5C2CA 1KQFB 1NM2A 1ZTWA 2PMZD 3Q2TC 1OYEA 3MURP 1N5YB 2PFFB 4AL6A 2GFFA 3VGSA 1VRUB 4LF7F 4M5IA 1VQ7S 4NLOA 3IR7B 5DQIA 2FIUA 3H20A 4YDDB 2CG4A 2RQ4A 4Y2CA 4OI1A 3T1AA 1AZSA 1R31A 2ALZA 4NI2B 5HP1B 4M5GA 4RZRA 1Q4RA 3UO0A 4XAKA 3CIZA 4RU9A 4P10A 2RF2B 2HWTA 2ZOMA 1U1NA 1RYRA 1FK9B 5H9FK 2YKMB 3A8KA 3RTVA 4ED1A 1UVKA 3R1LA 4JB8B 2UVRA 4NLQA 1RAIB 4C0OC 4O3SA 5CH7B 2GX8A 5BYSA 1WG4A 1WHVA 3FK4A 2IFXA 2LA6A 2OFGX 4KR0B 3RW6A 2XI3A 1YBAA 3FSYA 3ZTQA 1JLFB 1HBMA 3AOBA 3QZ8A 1KQGB 2CZ9A 3IO1A 3BO3A 4U6PA 2CPDA 2RHSB 3BSCA 3JQMA 4ED8A 4OYXA 4WXOA 3TA0A 1VRTB 5AE2A 2MSTA 1N5SA 2F8EX 4KIAA 1IWGA 3VAJA 1RKIA 4CYUA 4IKAA 5HN0A 4GKJF 1HKAA 2ZBCA 2VFRA 1HWUA 3H25A 2BABA 5A8RA 1EKSA 2B9EA 1RP5A 4G65A 3R3TA 2RS2A 2ZH4A 3CW2C 1S48A 3MI7X 4HT7A 2HNZA 3Q8SB 5ETVA 2SXLA 3CJ3A 4ELVA 4M63A 4ECUA 3V81B 1UA1A 2O67A 3DHXA 3MECB 4KAIA 2CQIA 3TW0A 4OMFG 3NMRA 1YSJA 4IH5A 1RABB 4AQYJ 2XSJB 1F9HA 1FEHA 4BBYA 5FD1A 2HVHA 1DLOA 2LFVA 5ITHA 6AT1B 4C9DA 1CC8A 3GYNA 1FX2A 3KJQB 1F2GA 2M3DA 3L95X 2E1MC 4ILMA 2LEPA 1HQEA 2RAQA 3WX4A 3UN5A 2Z2MA 3D2WA 3K5OA 5CYMA 4J9VA 2JVOA 1IM4A 1U45A 1X9WA 3UI3A 3KLHA 1BMQB 2DO0A 2G13A 5BR8F 2XI2A 1UA0A 2HGLA 4NMXA 4GKKJ 3MCOA 4TQRA 1HNVA 1QE1B 2LA4A 2ZBQA 2MZQA 4CO5A 2LEBA 4NRUA 5DLGA 4J91A 1R89A 4YB7A 5LT5A 4OYIA 3LGNA 5DM7Q 1Y10A 1NNDA 4DV5F 3TP2A 1MWZA 4B9SA 3DU6A 1P6TA 4WJBA 2B7BB 3H2UB 1D9DA 1REVA 4H4MA 2DEIA 1Z2LA 1KHWA 2OUGA 3TA1A 4GVBB 3CCRS 3BO2A 3M8PA 2DNOA 3ZO7A 5LMUJ 1OY8A 2VHGA 3UDEA 3GFYA 1MMLA 3OTEA 3GONA 1NJYA 3HHLA 5AXNA 3K5MA 1RBOB 1VJWA 5KFGA 1K9MT 4RNOA 4FF2A 2KG0A 3BGOP 2WVCA 5F41A 4WKYA 1GH8A 4DR2J 3QRQA 1LWCB 2FHMA 1M1GA 4QIEA 1YX2A 4N76A 2VOPA 4CZCA 3W8PA 1CJUA 3OXLA 3N6LA 4RBTA 1UZHA 3OLAA 2RMLA 3NGRA 1FKOA 2EFPA 4DI6A 2DNYA 2ROPA 2J5AA 1OJ4A 4OFZA 3CEDA 5E41A 2NLWA 4KRWA 1XMQJ 2DVIA 3RAMA 4LQ3A 4V19J 1TK5A 1BXNA 3DCAA 4XPCA 3LAKA 3IRWP 5DQGA 4LREA 4RW9B 2R8KA 4IR1A 5F3TA 4NA1A 4ZK7M 3D68A 4ZPBA 4C3LA 1DAXA 2YNHA 5E7OB 4CI0B 1GMWD 5DGAA 5B0GA 2QA1A 2CPIA 1OY6A 2JEIA 4ZVRB 2XZWA 1L3UA 3N28A 4OHVA 4WCEQ 1YWXA 1KP6A 2PEBA 1RADB 1X60A 2PI5A 4Q44A 5I3UA 4IUFA 1O0PA 3G6XA 5HVGA 2KT2A 2B5JA 1HPZA 2R4FA 2GVDA 5EWEA 2V6AA 1Q8IA 2Q3PA 4EZ9A 2QV6A 1R6VA 1SC4B 3HHKA 1NK4A 4WFXA 5LM7E 1FFGB 3SZ2A 3C46A 2A10A 2ZFHA 4DWIA 2RB7A 4DS5A 1UFKA 4DFKA 2ATCB 4I7FB 3DRSA 1T95A 1RWNB 2QO3A 3DLJA 1U09A 2F65A 4GO5X 1I5OB 1HNIB 4JI6J 3K5NA 4LF6F 3DOLA 4CH7A 3Q2SC 3EX7B 1MWYA 1RI7A 1Z2ZA 4LFAJ 4F3MA 4JI0J 3I55S 3DN9A 1NKCA 3NWGA 4F36A 1RAGB 2X7IA 2MGZA 3KHHA 4XPEA 1TK8A 2ZNYA 2G1DA 4CRJA 4LRFA 1NK6A 2UZAA 2A1BA 3KHRA 2N4DA 4DR7F 5A8KA 2Y1LB 1S6UA 1F5AA 2KRRA 1NO8A 5C7PA 2OPQB 4WTOB 4WIQA 3GCXP 3ZTRA 3ZZUA 2HS0A 4AD6A 4MTPA 1V5IB 2BOAA 2EKNA 2AGQA 2DRDA 2KH9A 5D0RA 1Q95G 4MT1A 3H42A 4USIA 2KVIA 3ZTSA 4CNZA 3FGVA 3CC7S 2VL1A 2XSFA 3HVTA 1ACMB 2QT7A 3QGPA 1J27A 1N36F 2HGNA 4HH1A 1FD2A 2CUYA 1WC1A 5ETSA 5I42A 1L5UA 1FF2A 2OI2A 3A3OB 1S1TB 4JI4F 4QYRA 2RRAA 4CTAA 4ECYA 1QSYA 2WBRA 3H90A 4DMZA 2LXIA 1PC5A 3CE8A 2Y1JA 1HWJA 3OFGA 3E01B 1H7XA 4ZIWA 3BN4A 1RHJB 5F8GA 1R8PA 4IOCQ 3W9HA 1FRJA 1HYSB 3GLJA 1E6VB 4ENOA 2V8HA 3HLUA 3GIKA 2NXUA 2W9CB 1S57A 4FYXB 3UDCA 4ED6A 4O4GA 3D3BJ 3EDQB 2DO4A 4GKKF 5HSPA 5B0CA 3I31A 4YHHJ 2ACMA 3HCXA 1NUEA 3R5BA 2DRBA 4EGLA 2E1PA 4Q45A 1RACB 2K2PA 2DH7A 5D4NA 2V2KA 1FRHA 3KLIA 3QBCA 2ZOGA 2F7VA 1KVKA 1WTFA 1YKWA 1U24A 4ERDA 3HVWA 1PSDA 2AX0A 3DLBA 4ELUA 4ZIVA 8RUCA 1HL6A 4OI4A 3AODA 3I87A 2J6SA 4OL8A 2PT0A 2CQ2A 2QLFB 4WPAA 3NNHA 2EG1A 4F8RA 2MZRA 4OJHA 2XMJA 5L39A 2OMLA 1LW0B 5LMUF 2ASDA 4G1PA 2VPXB 2KFNA 1YRUA 4RW4B 1H7WA 2YNFA 1S1WA 4JI8F 1GMUA 5KFDA 1C0TB 1GXUA 5KFKA 3LWLA 4YR0A 3SXLA 3HJVA 2V8DA 3NS7B 1YIJS 2FJEB 2RH3A 2R7RA 3UNYA 4C8ZA 4A8QA 5DDPC 5IC6B 1XERA 2KXNB 2VG7B 4PEOA 3J7A1 2FDNA 4C8YA 3PIOQ 4QPTA 3BH6B 4K5SA 2FLOA 2MJUA 1PCAA 3LP2B 1RWPB 1WOOA 2HK3A 4C8NA 4I2PB 2CPFA 3PJWA 4ILLA 3C6TA 3IBWA 4FNHA 2DCLA 4JI7J 5HQLA 2DD8S 5DO2A 4QJVA 3O6QA 1NJXA 1SKRA 3KUHA 3FZ2A 3MR5A 1VK3A 1OYDA 2R9LA 1S6PB 2HK2A 4QYZJ 2YX4A 2J76E 3PR5B 4MH8A 4C97A 4LF2A 2CPZA 2FJVA 2JC0A 5LOQA 3FMBA 2BE7D 2AJ2A 5LXRA 3K5PA 4G1QB 5B0AA 2H3EB 2C28A 2XO6A 3QRPA 2VICA 2W8KA 5F8NA 4ZN1A 3VR1A 3M9NB 3I9V9 3OTOJ 2I1RA 3EXCX 3EVMA 3BZQA 1JLAB 1SJ1A 4HI1A 1NK5A 2IMOA 1R0AB 3MCMA 1UPMB 2RJZA 1O8BA 1XR6A 4WIIA 1Y0HA 2AKWB 4DQSA 1HW8A 3HMJG 2DHHA 1GXTA 1LW2B 2G2OA 3P5BP 2MQPA 3UR0A 3KK2A 3G86A 4NLTA 3BPDA 5F8HA 2V94A 1V9OA 4UY85 4HHUA 4IR9A 4ZCLA 3TUIC 4ZVUB 2DNMA 3M30B 2QL9B 4Y2IA 3UPFA 1XMOJ 3R5DA 1VIXA 3QGGA 1HBOB 4RR5A 4LFAF 2XMMA 2YNIB 4RKUC 3FBCA 2D69A 3WC2A 2RU9A 1P27B 3V4IB 3ENWA 2W8LA 4LSLB 3T5LA 4I69A 3KMSA 4QR0A 3I96A 4ZPVR 3B6BA 4DV7F 3ZZTA 4L72B 2BYCA 2WOMB 1Y9OA 4A8OA 3LQVA 1XMBA 3LA0A 5FDLB 1SH2A 1U1PA 8ATCB 3PM9A 3M7VA 3ULHA 3UQSA 1B7YB 2QA2A 3W2WB 4PPDA 1S1UB 5BYRA 2AD9A 4WK1A 1SPBP 3FBEA 4KGMA 3QQCD 4QOTA 4X62J 3OJSA 4K4YA 4BCAA 5D15A 3N5FA 2IJRA 5GMDA 3U1LA 3MM7A 4JI5J 4DCPB 2OELA 5L46A 4X4VA 2UXCJ 2VZ9A 3GV7B 1CQNA 1RK8A 2WVEA 3SQGA 2YNGA 1S1XB 2HAIA 1S49A 3JQJA 6FDRA 1I3OB 2PFDA 2CNOB 4QR2A 4KKOB 4QW8A 3NNCA 2VV5A 3CJ2A 3W5ZA 3PYEA 4KV8B 1ZA2B 3W1YC 3ADAC 4RBVA 1X4GA 3WC0A 4J9MA 1WSRA 2R7TA 2IDEA 2MLZA 5EGYA 2FHJA 4ELTA 3GR0A 4NASA 3CCQS 4PXDA 3Q8QB 1X5OA 4TU7A 4CIOA 3JTPA 1RCOB 2FHOB 2HKEA 1MNEA 2H51B 3DOMB 3TJAA 1M5VC 2X3DA 3HK2A 3G82B 4IO1A 2DNGA 5A8WA 4CLPA 4X4TA 2KHCA 3GJQB 1YRTA 2CJBA 5KT4A 1IBKJ 1IKWA 4R0EA 1UFWA 4RW8B 3EZUA 4G6VB 1RHKB 1KONA 1N4LA 4B9MA 5D0EA 1JLCB 2XULA 1AROP 3AFGA 1X4HA 3OPKA 3K8WA 1B0TA 1HBNB 5F8LA 1BQNA 3KLVA 4ER8A 4U67Q 1SBRA 3R7NB 1DJ0A 1YJ9S 2D3ZA 3PX4A 5CZXA 2DNPA 3C19A 2BM0A 3M6VA 4MFBB 3SIPB 5KG4A 2MZJA 2Z2YB 1WNEA 4QIWD 3HSDA 1S72S 1Q16B 2WRMA 1HNWF 1JJ4A 2BANB 4LIRA 3BF4A 3AXMA 1C1CB 3IS9A 2DIVA 2IMWP 2HNDA 3M32B 3BS9A 5KTQA 2CFXA 2NZCA 5L38A 2RKIB 1ZH5A 2QYCA 2GVZA 2ZH3A 3PW4A 1FX4A 2V4JA 1GXLA 1LK5A 2DH8A 3GIRA 4OI2A 5K8OA 2AYBA 3F73A 4KHPF 2QLWA 4ZVQB 2ZE2A 2UXDJ 3R6LB 1M90T 4CLYA 4F4XA 2M8DB 4NWBA 5IFMA 4DFJA 3FFIB 2ZKTA 2P9EA 4DJBA 3VAHA 2HMIA 4HHHA 1K0VA 3E3XA 4PZVA 2ZBPA 5ETRA 3JAMU 5GVQA 3BBCA 2DRAA 2OPPB 3T9NA 1ZA1B 1AUDA 4WFYA 3M2VB 3THPA 4Y0FA 3V6KA 2MKCA 4XIUA 3H2LA 5JVHQ 3ILLA 4U7UK 1OO0B 4KHRA 4LBIA 2F3JA 2ZNZA 4MK8A 3AY0A 4CO0A 1HR0J 1R7IA 4HTJA 5HROB 4J9RA 4N41A 2VU5A 4CCHA 4USKA 5D8HB 1PG5B 5E2QA 1KQKA 3K7RA 3ZNUA 2VDHA 4PCQA 1IKXB 2V4QA 2CQHA 5KG5A 4CLZA 1FNOA 4CT8A 1Q78A 5DDOC 2YVSA 3U7JA 3RB4A 3C8YA 4NXMJ 3R5AA 3UR3C 4DL4A 3DLKA 1JK9B 3EGWB 3VF0B 1XMOF 2JRSA 2LQ5A 1RLDA 1JLEB 2CZVC 3I82A 5DLFA 1A9NB 1HI1A 2YTCA 3MM5B 4ZJLA 4YS2A 2HGMA 3ITHA 1MW7A 5A2QU 5CCLA 4YR3A 4KGVB 2B4OA 3E8OA 1MN9A 3W5XA 4LT6A 1QAYA 3SSSA 4PWUA 1QUVA 2DGSA 2Y0SD 1WEZA 2MTLA 2FLNA 3JXOA 3BBFA 2PMWA 2E66A 1ZOTA 3DGPA 1HI8A 5C24A 2EW9A 4XDCA 3V6JA 4EMDA 2OEMA 1P9YA 4ECRA 4Q0BA 1VC6A 1RT4B 5BYQA 3N79A 3ONQA 3T5JA 2WVBA 1EETB 4IFYB 3RG6A 1D1UA 3RAQA 4NRTA 2MQLA 3OFFA 1N5YA 4JI5F 3EMTA 3KHLA 1VRUA 1WWHA 2UXCF 3QPIA 4HTIA 3HFZB 2DR8A 4K4UA 3H5XA 3QLHB 3BEGB 4I4BA 4YB1P 4NI2A 5HP1A 1S5ZA 3SDEB 4K0KJ 3NGDA 2FVCA 4ZLPA 3HI9A 1WHWA 3GV5B 2HVZA 4DBQA 3K57A 1FDAA 1C2PA 2RF2A 1MG7A 1FK9A 2O5DA 2AV5A 2YKMA 3PG9A 3C3LA 1ZAXA 3HDSA 4N47A 2LQJA 5F9NA 1U6BA 4LF4J 4YY3F 4DSJA 1CULB 4QW9A 1SJQA 3OL7A 2PEHA 1UPPA 1B64A 2ROEA 4IG0B 1JLFA 4ED2A 4BHQA 2DCUB 3M6WA 5KFBA 3QGHA 3D7SB 5A6WA 3HM9A 5KOWA 4QWEA 2HHTA 1JWWA 1VRTA 1LXJA 2DGQA 1U47A 1IBKF 2IA6A 1BC6A 1HBMB 1OPIA 3NEKA 4P72A 3IAS9 5L9XA 5CAAA 1GT8A 3UVJB 4GRSA 1WF0A 4A8KA 4OX6A 1RISA 2BKNA 3VV2B 4Y2AA 5J1PA 1SC6A 3V81A 2J9EA 5C5JA 2FJXA 4J7CA 4N77A 1HD0A 3MECA 4PUOB 4NXNF 2XSJA 2C2DA 2RQCA 2BZ2A 2CDQA 4HYKA 4M5LA 2HZAA 2CWXA 1B70B 3SBMA 2XO7A 1WKKA 4M5DB 3EPGA 4U96A 3NOGA 2I2YA 4BLGA 1JIHA 3OTCA 1OIAA 2CQBA 4LUBA 5J2NB 2B8PA 1VC5A 4OZNA 1KBRA 3EZOA 1QE1A 4DZ6A 5JJBA 5K14B 3TO8A 4K2JA 4UF4A 2QRRA 2HQIA 3QMQA 3QFHA 3PKMA 1U25A 5J1NA 4ZVGA 3MD3A 3FSIA 1OSCA 2QE5A 1RB0A 2LQ8A 2KL8A 4C3KA 3TUZC 2QSFA 1UVLA 3FC9A 3BKFA 5ETQA 4GVBA 2Z58B 1NJIT 4F2RA 1ZZFA 2MDAA 4PAAA 4RPFA 2KN4A 3FEYB 4QWDA 2MQMA 2Y1IA 2RDDA 2GIFA 1T9YA 3OXFA 1UCNA 5EHHA 3A3NB 4WTYA 3BO4A 1KEKA 4ES1A 2EKYA 4DV0J 2D9PA 3J7YI 3IR5B 5B09A 1S79A 2G0JA 3W66A 1U8SA 7FD1A 5K8NA 3OSNA 1LWCA 4RUBA 2OJ3A 2BOPA 1OSDA 4YFUA 2AP6A 2MZTA 2NUUG 1TMJA 3HHLB 1MU2B 2C2MB 2W7OA 1T05B 4X4OA 1S7IA 1ZAWA 3MR3A 2L48A 5M2RA 4L76A 4ZVHA 3PW0A 3ZZZA 4TLRA 2ZZMA 5KT3A 4DX8H 1F1BB 3TZWA 2NXCA 3VALA 4I68A 1SL2A 3KHGA 4TY9A 1G6BA 1JQGA 4OYWA 4B3RJ 1J5EJ 4IH7A 4RW9A 4JI2F 2VD3A 4PWDB 1RAOA 2MLXA 3VGVA 3R5CA 3MM8B 1M5HA 3AA8A 3GQCA 1FJGJ 4WP8A 3MAAB 3RAXA 3J7ZT 2V2ZA 4X64J 3FUYA 1FE4A 3HULA 1TUGB 1XNQJ 3M2UB 5EX0A 1S59A 3VZIA 3OR2B 4DR4F 3CJTA 2Q66A 4MYUA 3HX9A 1PBUA 3MUTP 2GW8A 1N56A 2MQQA 4GMKA 2CJYB 3GIIA 1ULRA 1FWPA 3QT7A 3W63A 1RHQB 2ZEJA 1BQMB 2ZM6F 4I7FA 2RDJA 4ZPDA 5IM0A 1UJ5A 3Q8VA 5ETNA 3Q22A 1HNIA 2ZZNA 4ZP7A 5T14A 4UT4A 5BJRA 2LEAA 3ZZOA 3K17A 3LALA 2D3UA 3FKBA 3KG0A 4OHYA 4JI1F 4I2QB 4AL5A 3GU0A 2HFOA 5L9NA 4DU8A 2WSFC 5KFMA 2D3OR 4O3QA 1UWBB 4FF3A 3K89A 2VFVA 4LF9J 2MY8A 1U6FA 2JFDA 2H5EA 3DFEA 2WONA 1TL7B 2ZOFA 5CD4A 2F40A 1Q79A 1M1HA 2VDIA 1EQMA 2OPQA 1QVFR 4Q2MA 3TZYA 1RTIB 3TRGA 3FMWA 5B0FA 2XGQA 2CJAA 4BC7A 4P74A 2F5GA 1ZPWX 5FLXY 2HHXA 1FVQA 4OLPA 2XLIA 3DLHA 1NPPA 3EVWA 2AX1A 1S9GB 2GCFA 5GAGU 4DF8A 3MD1A 4LF1A 4DX6A 2HBYB 4O44B 2EPIA 5A76A 2UUBJ 3KJNB 1X4AA 2C3PA 4WF9Q 3HVAA 3M05A 1S1TA 2G0CA 4MKYA 3HHLD 4FBTA 2G2ZA 2DNKA 2E7VA 2VQEF 2BBEA 1JMTA 4ECZA 1MROB 5M2UA 2GJFA 4KTQA 5I42B 3E01A 3MR2A 5I3PA 3DYAA 4FF4A 4ANDA 1N33F 1KTVA 3ILOA 2YWFA 3U1NA 4C8OA 1KC8T 4X65J 3I5CA 1HYSA 1RYSA 4KJIA 4DCOB 2W9CA 1CLFA 2NS1B 1BHNA 3I4HX 3MWBA 5K8MA 5KFLA 3WX8A 1YJVA 3BREA 5HI7A 1B99A 2DHAA 1UEKA 2AZ3A 4F04B 2YQ0A 3O5TB 4PG7A 4RO0A 1RE1B 1GK8A 5E3RA 3HT3A 1SC3B 2HFNA 4P7VA 1I94J 3LPEA 4OHXA 1EZZB 3CC2S 1TL1B 4D3GA 3NY0A 2ABYA 3IN5A 2E5HA 1LXNA 2H4YB 2AU0A 3OQ2A 4LFBF 2YPYA 2CQ0A 1BQXA 3KLIB 2DR6A 3W64A 4C3MA 5JXSA 3J81Y 1PKUA 1LW0A 1SJ3P 4A4JA 4LF5J 1NK7A 2IM2A 4RW4A 3RR8A 4L3NA 1IQZA 1FA0A 2ZH5A 5LMNF 4DV0F 1RT5B 1NZ8A 3X1LB 4V19X 1C0TA 2O66A 4DFMA 2G1HA 4ZKAA 2H54B 3ZNJ1 3J80Y 5J2PB 2P6TA 1S0OA 1UAWA 4M5HA 3GSIA 5ETTA 2V9KA 1SL1A 1P1TA 2VG7A 4X66F 4QWAA 1SIZA 4FKYA 2HBZB 4I0WA 3PRDA 4YB5A 3VCDA 3LP2A 1U7LA 4I2PA 4PRFA 5EN1A 4DUZF 5K8PA 2DNHA 1SC1B 3MPVA 3PX6A 2HRTA 2KXHA 1XEZA 2F9JA 4A8WA 1FVSA 1NB7A 2R7SA 2IRYA 1V5VA 3LP0B 1KRPA 4F7VA 4KH1B 5E5NA 4P6QA 3AJ2A 2IIHA 1GQEA 5E0OA 2EXUA 4U8VA 4B3RF 1R0CB 1S6PA 4PR6A 1ZETA 2C2EA 1FNXH 4JI3J 1NDKA 3SV3A 2IYGA 1SV5B 4J9LA 3M4XA 4G1QA 3GB0A 3QT5A 1T9WA 3MEKA 1HLWA 1FJGF 4ZLLA 1L3SA 5KG2A 1NDPA 2JLGA 4RW7A 4X64F 5B0EA 1NK0A 3H7HB 3LWMA 1FTRA 3KK1B 1GTEA 3UN2A 1R0AA 4IDKB 4C6AA 2EK1A 2EEYA 2KO1A 4DLEA 4BS2A 4J9UE 4DN0A 2IAJB 2H5IB 1LW2A 4ED4A 2AHOB 5LJ3Y 2HSEB 3DHWC 2HQFA 5KFTA 3IA0A 5J1EB 4NCGB 3TEGA 4X4UA 3KLGB 4QIGA 4DUYF 4DL6A 3ISND 2COLA 1RJJA 1RT1B 3M30A 3R27A 3KUEA 3UNGC 5K5MA 1RAAB 1F60B 5H1SV 5MLCV 4ZJOA 1NDLA 1KR4A 1QAJA 1VFJA 1QTMA 3GE9A 3CMQA 4PG4A 1NSPA 2IVMA 4J90A 1C4CA 1HBOA 3JSMB 1SH3A 4N8OA 3G4SS 3NGTA 2YNIA 1I6JA 4Y65A 3V4IA 3NOCA 3G6YA 4LSLA 2MKIA 1SJ4P 1RU2A 3HHDA 1HMVB 1Y3JA 1T9UA 2V9WA 4NLXA 5K20B 3IWNC 4LF9F 1SL0A 1WHYA 3BKTA 4C0HA 1WF2A 5GAGI 1X4FA 2A6OA 4K4XA 2KM8B 1TZ0A 1KLNA 4UZBA 3S7RA 5FDLA 4DN9A 1T0TV 4B3MJ 2AYGA 3OL8A 3UCUP 3W2WA 3THVA 3US5A 4JYAJ 4RW6B 1S1UA 5A2QY 1N5VA 1OPZA 1HIYA 4MYTA 2FVSA 3TAPA 2QL5B 2EC0A 2ZITA 5IWAJ 2PMHA 2ADCA 4ZCKA 3KG1A 1BWEA 3V4MA 2ZH6A 1WDDA 4OIXA 2B43A 1F9EB 3RZAA 3GP9A 3UN3A 1LV5A 4FPIA 2UUBF 1B4SA 4HT5A 1IKVB 1S1XA 4DQQA 4QIVA 1MLAA 1LEOA 2K8GA 2EC2A 4TN2A 4URGA 3GZ7A 5IQ6A 4DDFA 4WFNQ 4KKOA 2YQ1A 2CJ9A 3A4TA 3K0JA 3JS9A 3LH2S 4IFVB 4KV8A 4HL9A 4Q43A 3H0PA 3KYLA 1N52B 1NH7A 3BQ1A 3HHEA 2D9OA 5DGBA 2W7AA 3A13A 3DOMA 4GO7X 2W4PA 4A8XA 3KOAA 3ISNC 3H4DA 3BQ2A 2XEXA 3G82A 3MM6A 3L09A 3MUMP 3GIMA 3S1TA 2K7JA 2H4WB 2BDPA 4PG8A 2F1FA 4AXJA 5DETA 4I1TA 2CQ3A 4RW8A 5T7LB 1JNZB 5CA5A 4A47A 2V67A 3D1QA 4KGXB 4OZ1A 1TAUA 4CLSA 3W3SA 1JLCA 3C15B 1WSVA 1VQMS 4BDPA 4WU2A 1HBNA 4LJMA 3LAMA 3CF5Q 2RD5C 1IXKA 4KPYA 1R8HA 5AE3A 3I5AA 1ZAVA 3K59A 3DNCA 4GKJJ 1RWXB 3A8IA 2R7OA 4ZLNA 4KH0B 1CG2A 3NAIA 4MFBA 4WXWA 2H1YA 3JQKA 2W1BA 4QIFA 1Q86T 4UW2A 5KT2A 4K4ZA 2VA2A 1N5TA 2N7CA 2RQKA 2BANA 3NGSA 4R5PB 5IXUA 4CO2A 5C42B 3FBBA 1RT3B 2KZZA 2ZH7A 1M5SA 1C1CA 4C7QA 5KFQA 3G2XA 3ETOA 3AT1B 3M32A 4DR6F 3LP1B 4TXSA 3G71S 4DL0C 1AFJA 2RHQB 1FKPB 5HMWA 2JHEA 1J2VA 2VB6A 2WTFA 2VODA 2W4CA 4H4OB 3TNVA 2BW7A 1N34F 7FDRA 2L08A 5F8IA 2ZWOA 3LTOA 1H6KX 2ZDOA 1KD1T 3FFIA 3K2YA 1NPKA 3PO5A 2GMLA 1IKYB 4JI3F 3VVTA 3BSOA 5DS7A 1W7WA 5BR8J 2K3KA 1TKDA 4D3HA 3V6DB 4EEYA 4YUDA 2OPPA 1KSPA 3AOCA 3M2VA 4GC6A 3PW2A 1WELA 3CJRA 4USUA 3AA9A 4DV5J 5HBMB 1PJ5A 2EBEA 3BJYA 3GMGA 3T5HA 1UTAA 2NYHA 1DY3A 1S0VA 3LW5C 1M1KT 1U0SA 3R8YA 5J2QB 2LXUA 4P73A 2A18A 5D4OA 5HROA 2RVJA 2CQ1A 4NEZA 2WB4A 2JJ4D 1IKXA 3G8TA 3H4BA 3O8WA 2HHHF 1V3RA 3ZC4A 2NYIA 3GG0A 2IJFA 5BXIA 2Y8YA 3OR1B 2ZH1A 4LSNB 5AXMA 1FE0A 2UXBJ 2VG5B 5CYQB 2CKWA 1HBUB 1YK9A 3AXKA 4KC5A 1FERA 2W4DA 4ECQA 4AL7A 2B56A 4HI2A 1NMEB 5JMNA 3MM5A 3JTOA 1T02A 4YEAA 3PXGa 4Y3CA 3UWTA 1XK8A 4USJC 2G0IA 1EP4B 2FHJD 5KG3A 5H9FJ 1NPRA 3CD0A 1NSQA 3RRHA 2NQPA 2DEJA 3PJXA 3OVSA 3A8JA 2ASYA 1WUUA 4ZVFA 2VC1A 4G3IA 4UUXA 2J7UA 3G8QA 3K8VA 2VPWB 2C42A 4I67A 5HAOA 2IRXA 1RSCA 2BMBA 4Q5VA 2FUG9 4JYAF 2R8GA 1RT4A 4NCBA 2E1CA 3GFZA 2APOA 4EBEA 5EWGA 3PY8A 3T1HF 4NA3A 1EETA 4IFYA 2KZMA 1FESA 3VVUA 2HURA 3BM7A 3PFEA 3CCLS 4DZDA 4EUVA 2LLZA 1Q8KA 2CZ4A 4QBUA 4B08A 2CA9A 4EYHB 1G3OA 2HWHA 3PHEA 5HLFB 4M5NA 3CPWR 3TJ8A 2WW4A 2RUSA 3QLHA 1FTCA 1NHKL 1RAEB 3SDEA 2R7WA 3ISZA 3PRBA 1VHIA 2A6MA 5IOLA 2XB2D 1TKTB 3MPDA 1VCTA 3AQPA 4R8UB 3HVRA 3IXQA 5HQMA 4P2XA 4LF6J 1CULA 1XNRF 1FRMA 2R2UA 4IG0A 2I6WA 2BJ7A 1N48A 3MDFA 3PFOA 1OWXA 3KMQA 2W2QP 1KFSA 4HVZA 4O0IA 3MCNA 2L3MA 3VQTA 4DR7J 1L3KA 3CCSS 2DISA 2H65B 5D3GB 3UVJA 1KKHA 3DM2B 2GHPA 1WOSA 5IQQA 2IVYA 4JV5J 3B4MA 5D0GA 4EBCA 1RDRA 4IQMA 3WIUA 4ZVTB 2BQ3A 3SEOA 3WDOA 3UE2A 3X3UA 2M2BA 3EXYA 1FDDA 2HVDA 3RB0A 4PUOA 4DCJB 1K1SA 1X5TA 3F41A 3DRPB 4FDFA 4CO4A 5D78A 1N36J 3B4DA 4PQUB 3IC1A 2Y9HA 2HS3A 3BKUA 1PYSB 4PWWA 1GX6A 3RRKA 4JI4J 1RGVA 2HHUA 2MZ1A 5CD4H 4WYWA 4M5DA 2VBYA 4IO9Q 1XN9A 5H9EK 2U1AA 5F0WA 2CIMA 1IBLJ 2J0QD 1X4EA 4QU6A 3CD7A 3P8BB 1HFEL 1Q5YA 1U49A 2MZSA 2DHSA 4J9QA 4DQIA 2R8IA 5J2NA 2QGFB 3O3LA 1W2IA 1WC6A 1VQNS 1YZ7A 3ICLA 4OX7A 2Q43A 5EUHA 5KT5A 2KB2A 3PR4A 5K14A 1U1MA 2W2OP 2J7KA 2X3GA 4USHA 1TL4A 2ZVSA 5ETOA 5GAEI 3CCJS 3R6GB 3MMJA 4F0HA 3QRRA 3T19A 3UD3P 2BE2B 2HZCA 4NYZA 1U1LA 3N01A 4WZQA 2ROGA 4B17A 5IT4A 3IG1B 1LWXA 2K06A 4KGKA 1TKZB 1VS3A 3MR6A 2VBXA 5HATA 3QWPA 2IM1A 2RSQA 2LDIA 2VH7A 2W24A 4UQTA 3FSXA 1F9FA 3ENVA 1M0SA 1JNRB 2CQDA 4DQRA 1IBMJ 1HARA 1YJRA 2DYAA 3FQKA 2EFVA 2GIRA 4NL5A 4NYOA 1Y5LB 1D9FA 3T6JA 4DL7A 1LKZA 4DX7A 2XWYA 3DDIA 4J5OA 1RLCL 3CD5A 3I4PA 2PC6A 4JI8J 1MU2A 4OZ0A 1TVRA 1T05A 3NS6A 4ZP8A 2UXBF 3VTIA 2VJUA 4FNIA 4LBHA 3NCPA 3ENQA 2OGUA 2FPHX 4OYPA 1NSKL 2BKOA 2AJ4A 4GC7A 3GPAA 1FEEA 1B0PA 1U1OA 2C22A 2WBMA 1GFWB 1WOPA 2M52A 3CSKA 4DPYA 2L9DA 3NMAA 3MEDB 4Y28C 1GTHA 3I6PA 4LR7A 2K1RB 2GV1A 1TKXB 3H5UA 1PYOB 4PWDA 2FJWA 2VFUA 5KT6A 3CDAA 2KI2A 1REGX 3MM8A 3LGMA 4M5JA 3MAAA 3RGIA 3RB6A 1X0FA 4ATNA 3PEJA 1X5PA 3TARA 4OQJA 1Y00A 3UDVA 2R8HA 1Q7YT 4O3PA 1PYTA 2ZBRA 2F8HA 2FJAB 1SXLA 3M2UA 3VAKA 3OR2A 3NP5A 2EG2A 4X4SA 1N0UA 4WP9A 1YTYA 7AT1B 4CO1A 2CVEA 1WD6A 4OYZA 3W7BA 1C1BB 2KT5A 5T41A 1XQIA 2GHVC 2M70A 2YKQA 4P71A 1IN0A 1BQMA 2V8GA 3SSRA 4F4KA 4FXVA 5K9FA 2ZC4A 2Q79A 5A0YB 5THWA 2FYXA 4WE1B 2JLEA 1QD1A 4ID5B 4USTA 2AWZA 5LSRA 1TV6B 2GQ2A 2XNRA 2FJDB 4I2QA 5IM0B 1FRKA 1H2TZ 3IBFB 3MUVP 3MTJA 1FI4A 2LVWA 1Q5VA 1YJTA 4X4NA 1NK8A 1UWBA 4J9PA 1DRZA 1UZDA 1S1VA 1MMNA 2R7VA 3QNWB 4M94A 1JKHB 1TL7A 2IA0A 3CCES 2FZCB 2NSCA 1FHTA 2E7WA 3EJMA 3D3CJ 5HVFA 2R7UA 2DR7A 3W9JA 2ILZA 1WF1A 1RTIA 2FD2A 1N88A 2OD4A 4DV7J 2WONB 1IR0A 3CO0P 3AQOA 3VGUA 3EM1A 4TU8A 2KJWA 5IV3A 2LQ9A 4JV5F 4IQXA 4DSIA 4JV2A 1S9GA 2FB0A 5DM6Q 2BRLA 4TYBA 2E7XA 1WI6A 2WCXA 4O44A 1U26A 5AJ3F 1WACA 1OY9A 2AGPA 3CJSA 3EDRB 1RAFB 1RWKB 4W92B 4F50A 4KT0C 3SCLE 4XDDA 1Z4UA 2WHOA 2XMVA 3OVBA 2U2FA 3G6VA 2V2VA 4ITSA 2IDLA 2C2OB 1MROA 1VLOA 2AMCB 3QO9B 2HQGA 1RT7B 2K7KA 2J7WA 5F3ZA 2LECA 4ZS6A 2OTJS 4ZPAA 1FXLA 4DSKA 2ZUGA 2V5HG 3GJTB 1JLQB 2J9DE 2HHPA 1T03B 2DGXA 2MPUA 2HYIB 1AA1B 1IBLF 2DXFA 4DLGA 3RBXA 3CD6S 1X0PA 3DYAB 1T3OA 5KAKA 2XC9A 3TANA 4KQZA 2BEFA 3HT0A 4LFCJ 4U7CA 2GIQA 2B9XA 4EYIB 4EWTA 3QT6A 4CLFA 1NJWA 1TL1A 1S4FA 4NLPA 2VC0A 3QYYA 1HNZF 2XYPB 3D1OA 1VISA 2LDYA 1KTQA 4P7TA 1X7VA 2HFUA 3ILJA 3HSJA 4QU7A 4KHMA 1TK0A 1SQGA 1K47A 3SFGA 1LOUA 2VG6B 3M6UA 3HSZA 2AW0A 4B3SF 4IRCA 2MKSA 1RT5A 2J6TA 1RTHB 1LWFB 4Z2XA 1IBMF 1P8GA 3AAWB 4U9RA 2MSSA 2GJ2A 1RWWB 1XWLA 5J2PA 1U1QA 2ZUAA 4FF1A 3PIPQ 4ZJQA 4AFFA 1AFIA 1YHQS 4EI2A 4XK8C 1S76D 2RQMA 5F8MA 2YKNB 1JJ2R 5D4LA 1HNWJ 4ZPWR 2CPXA 4KFBB 4ZCMA 1QLNA 3AH6A 4B3OB 3JB9k 2QJ3A 5LXYA 3MEGB 3KWMA 5MAOA 3LP0A 2GO8A 4WBFA 3EGNA 4OZLA 4LVOP 1JXLA 2HNYB 2HZVA 4OHZA 2PI4A 2VUGA 1ZM3A 3W2VB 2W9AA 2DTJA 4C8KA 2BXJA 4P9SA 1SV5A 1BD6A 3R9LA 3MEEB 4KHPJ 2P5VA 4PQAA 4DV3F 2DNRA 3CXCR 2GA7A 3C6UB 1JXVA 4NLRA 2XYGB 3JTNA 3MOJB 3AD9C 3PRVA 3KK1A 3ZXWA 5IC4B 5ETPA 4AYBD 1JB0C 2ZHBA 4IDKA 4ID8A 2PN6A 1FT8A 1S12A 4DSLA 3J7AN 2X1AA 1UW9A 2I8EA 2IAJA 3MMAB 1RA7A 3M8YA 2J9DA 2XM3A 3K58A 4RW7B 1RAHB 5G0RB 5C2GA 4DR5F 3PCOB 2RU3A 2QG9B 1DHMA 1YZ6A 4DSFA 5J1EA 2Z30B 4NCGA 2C3UA 3KLGA 4LMZA 4B9VA 3PW7A 1RT1A 4PG6A 2JX2A 2OPSB 2GGPB 4MK9A 4URQU 2AEJA 4WFZA 1R43A 2GJIA 4CWBA 2P9GA 3ZTOA 4O4RA 1WI8A 4OHWA 4OX9F 4WFAQ 2I38A 3TZXA 1HQ2A 3JSMA 3W8GA 3VGTA 4L75A 1YQHA 1FRLA 1U2RA 3OUYB 3IRXB 4FN5A 4TNOA 1HMVA 2LU1A 2XMTA 2LMIA 2B51A 4AUKA 1S9EB 4UOFA 4USWA 2C1EB 3Q8YA 4HEA9 2GC8A 4DFPA 2E9TA 2P6SA 4I6YA 1YJUA 2PD1A 2ASJA 1AB8A 2CG8A 1Q82T 4RWWA 3RU0A 5FLXU 3VAIA 4L3KA 2HAFA 2ZJQQ 4UOCA 4DV2J 3P45B 1F5BA 4LSZB 4AE5A 3RUBL 1NBEB 4RW6A 2M7SA 2O1PA 4QR1A 1D09B 1YVFA 4QCLA 5JUMA 4A48A 4K50A 1RT6B 2YKPA 2D1CA 3FRZA 3GV8B 3ETMA 2OEKA 3CTRA 2DK2A 4WFBQ 1H98A 1X31C 1IKVA 1N5QA 5KFOA 1EIYB 3L9ZA 2KRBA 2BJ3A 2XMKA 4NLWA 3KJVB 2BJ1A 1TUWA 1KLMB 2CJKA 3KDNA 4DV1J 4OZJA 1X9MA 3CJ0A 4IFVA 1KWMA 1EQ0A 1CPZA 1K73T 2AZ1A 4J9NA 1X9SA 3H5SA 1IQTA 4Q8EA 1Q8BA 4OV1A 2VONA 4DR1F 2BM1A 4NYPA 3V6HA 4NPOA 4YY3J 2OPRA 3UD5A 1NRKA 4Z7CA 5DZ6A 2NR0A 4LFCF 4DSEA 3D6HB 2W7PA 3O2IA 1BWVA 5T7LA 3PJ9A 4K4WA 1H0HB 4RJVA 2M88A 3MM6B 3J81U 3KK3B 2Z56B 4LIWA 5GAHU 3C15A 3FCWA 3R5GA 1U8WA 3MAHA 1QSSA 4O3RA 2KFZA 3QJLA 5SZTA 1K8AT 2J0SD 2E1RA 2YX7A 4CM0A 2ILYA 2NCKL 4WK3A 4ED7A 1NU4A 3T9ZA 4DPXA 4OZ3A 4B9UA 3J80U 3PYFA 4NMLA 1SI9A 1UJ4A 4OX8A 2FZGB 1U4BA 2BQUA 2OO4A 3I0SB 2XS7A 2CPEA 1AW0A 4R5PA 3W60A 5C42A 2DNNA 1RT3A 2FHKA 4PG5A 4ETZA 5EX3A 1UETA 1YGYA 1B0VA 4NXNJ 1LQ9A 3LP1A 3Q8PB 3TVYA 1HNXF 1FKPA 3A1YG 4MJKA 3BYPA 1T9TA 4KBIA 4H4OA 4A8MP 4JOUA 3SCJE 2IC3B 2JEGA 2DY1A 1VGYA 2Y0BB 2PO4A 4B02A 3N5BA 1WKLA 3TX8A 1IKYA 2QN6B 3J81j 1MWQA 2BKPA 4RNHA 1R3NA 3NXZA 3B8HA 2ZVIA 1FJCA 4H4KA 4I56A 2HPUA 1SIWB 2G2YA 5ETLA 3V6DA 3QIDA 4HACB 5IT9Y 4R0JA 5HBMA 4DV6F 2CNLB 1HD1A 4B9LA 2AJ0A 3RBZA 1S6OA 3NWRA 1MSWD 2B0GA 4DPWA 5J2QA 4RNFA 1NAQA 3QIPB 2NSBA 2E5JA 1VQSA 4FVMA 2NXJA 4HDHA 4DPUA 1QTNB 4M95A 3EGZA 1D8ZA 1J5OB 2M9KA 2VPZB 2WSCC 1Q81T 2OSQA 3Q8RB 3OR1A 2UUWA 4W4MA 4LSNA 3VAMA 1UEUA 2JEJA 1RWMB 3T1YF 3BSAA 2VG5A 5CYQA 2J9CA 1HBUA 3FCVA 3JYTB 1URNA 1WHXA 1XR5A 2P2CB 4DR3J 1K0TA 3ET6B 3G8SA 2XG8A 4ES3A 2XLKA 1FDBA 1UJ6A 3D5MA 4RLEA 3MZIA 2UU9F 1EP4A 1PO6A 2DGVA 3MMBB 1E6YB 1U2CA 4NLUA 2IBOA 2BJDA 2NREA 4OYMA 1KNZA 2QLJB 2POKA 1VQPS 2C2NA 4ZDNA 4TY8B 3D54A 3BSNA 3ELHA 2GS8A 4DV2F 4UZCA 4JI2J 3QSIA 4YN3B 4URSA 2WAQD 3DLGB 4Y00A 5D77A 4FP9A 1XJWB 2E44A 3R5JB 4LRCA 1KFDA 2XMUA 2XS2A 2C3OA 3MM9B 4WYLA 2YBVA 2W9BB 1O5JA 3FQLA 1FWLA 2XYHB 3EPIA 2CNKB 3OTDA 4DR4J 1D9AA 5HLFA 1F3FA 1JJCB 2B4PA 2V0NA 4FVCA 1DTTB 4F02A 3HSGA 2R3VA 4CDIA 2JSXA 2QMXA 3R2CJ 4C48A 1YITS 3HXMA 1TKTA 2XHWA 1UW4A 2DXDA 4DV1F 2ZM6J 1C4AA 3FRYA 2XZTB 4R8UA 2DKOB 1QM9A 2B6AB 1HW9A 3TWZA 2Z2ZA 1NKBA 1ZM4A 5GAHI 2A3JA 2ZC3A 4ICLB 4A46A 3CC4S 1WG5A 3IM9A 4C8MA 4JI1J 4MKVA 4NA2A 4DUTA 1KHVA 1DBDA 5CQGA 5SUHA 2R2SA 3HD1A 2ZJPQ 2CWKA 4WWSA 2CRLA 4JUZA 2J0XA 3NGKA 1RKJA 3DI6A 5HMYA 1X4CA 4X84A 5D3GA 4ZPCA 1PJ7A 3IR6B 3DM2A 2C3YA 4ED3A 4Q7AA 3KKFA 1EAYC 1N32J 4HKQA 1ZS6A 3JSBA 4CT9A 3M8WA 2R7XA 3RBEA 4IOAQ 4DPTA 5KOXA 3N6MA 1T7PA 1RHRB 1Y11A 2F4VF 3P5TL 3UCZP 2KJVA 1RCXB 1U1KA 2AJ1A 2YPZA 4ED5A 1RTZA 1YI2S 3DLEB 5LSOA 4UOGA 1FFSB 3DRPA 1RU1A 3PV8A 4PQUA 2R8JA 3H5YA 2NUHA 4F2SA 4X4QA 3P3DA 2ZHAA 2M8HA 2ZHOA 3H8YA 2KXFA 3BH7B 4CM2A 1H73A 3NRBA 1U02A 1HWLA 1FD8A 3NL0A 3UCGA 4EK2A 3I32A 2VQEJ 4N56A 3OFEA 3BDEA 3MFIA 3M8SA 1N33J 1QUPA 3MXHP 5DG8A 2JFKA 5D4PA 5L1IA 2VPYB 2N3OA 3RRGA 3UD4P 3TEHB 4LR8A 2RS8A 3N0VA 2PDAA 1UVNA 3GTYX 5E3QA 1UMJA 4F26A 4M8LA 4N5SA 2BE2A 1F2HA 1O51A 1S6QB 2HBRB 4UTGA 3D9BA 2XCAA 3PW5A 2DGTA 4PKDB 3IG1A 2N7YA 2JLFA 1TKZA 1CBKA 1X8DA 4RU2A 2AT1B 3CDWA 4K59A 4FYWB 2OSRA 1VLYA 3HFVA 4MIBA 3J7Z5 4G1IA 4K4SA 4L74A 1R8BA 1QJHA 1IJFB 4DL3A 3BGFA 5HMXA 3TYTA 1YDLA 1FRIA 4WKRA 2QIFA 1G4CA 1TR0A 3CMAS 4LFBJ 2DNZA 3A3PB 1V3SA 4CLKA 3RJMB 3NCRA 1Y4ZB 4C11B 3CB4A 3W65A 2OTLS 3KFWX 3QSYB 1JLBB 4IYQA 1ELOA 4CLLA 5LMNJ 4IRKA 3R1HA 1NKEA 2VF3A 1N6QB 5LL6d 4FXDA 4QZVB 3CJKB 4AQYF 4DR3F 2ZJRQ 2HVEA 3CULA 2HRUA 2YX1A 2VQFJ 3GWCA 4FBUA 4EBDA 3PKYA 1QAXA 3Q24A 1TL3B 4Y2KA 4X66J 1TVRB 1M5OC 1RAJA 1UVJA 4RBUA 3MEDA 1HHQA 4OJ3A 2K1RA 1TKXA 4E0DA 4DUZJ 1T9VA 2X51A 3RW7A 2XY5A 2CQ4A 3OSPA 3SFUA 3OHAA 2VKRA 1S77D 1RTJB 5GMKa 2F63A 1V6HA 3W5YA 4QPXA 2IPOB 1OMSA 3AOAA 2FJBB 3I5BA 1VQ9S 1WEYA 4PYDA 3U1MA 3HZEA 1NDCA 1D3WA 5HVHA 3OT9A 3VWSA 4YDXA 5ADZA 1C1BA 2Z8QA 2VKZG 3R7BB 3L7UA 4N8NA 5KFJA 2MJNA 3P4UB 1FJEB 2V2QA 1DURA 2DNQA 1RBLA 5A0YA 4L6V3 4WE1A 1OQ6A 2IM3A 4ID5A 4N7TA 2OMOA 2WW8A 1F3VA 1PGZA 1FKAF 1TV6A 3B78A 3CT9A 4HR2A 3Q86A 3M1VB 4KO0B 1AYEA 3MF5A 4DR2F 2LP4A 4W90B 4DUYJ 1VK8A 2RILA 3QWUA 1L3TA 3EICA 1VMBA 3HHNB 5FJ4A 3DRXA 1Y5NB 2JEFA 4DF4A 3TAMB 4C2MA 3QJPA 4J9OA 4EZ6A 2H5JB 5KFAA 2QFJA 3KLFB 5KFYA 1JKHA 1RA6A 5B0BA 2X1GA 1BY9A 1XMQF 4FYYB 4DHVA 4CO3A 1LWEB 1R8CA 2ADBA 1S1VB 2Z2LA 4FXWA 6FD1A 4A8FA 2OEJA 1IR2A 1VBZA 3EGVA 3BGRB 3LGHA 1N32F 3BDPA 3KLEB 1HI0P 1ZZNA 1U1RA 2GQQA 3OL6A 3IM8A 3GYXB 4P75A 3OW2R 3I0RB 4FPRA 3OV7A 3QGIA 3GG1A 2WK4A 2QFIA 3N4WA 1VOMA 1HA1A 3CCUS 3F56A 1RHUB 3D28A 5L1KA 3JSYA 4X2BA 1YRXA 3QO9A 4U8YA 3M2RB 1RT7A 2QMUB 5G4DA 3MAQA 3HKWA 1WC3A 2CQPA 1JLQA 3D6FB 1T03A 3MPWA 1X4DA 3CIMA 1GNKA 1YG0A 2HWIA 5JVGQ 2E9RX 4JI6F 3QAUA 3PYDA 2AYEA 2BVZA 3M8ZA 5KFHA 4CLUA 2AIRB 5KFXA 2UUCJ 1S9FA 4JI0F 1DQ9A 1VQYA 3TUPA 4I64A 1NCLA 2YWGA 5E3PA 5HK4A 4XO0A 3HKZD 2UV8G 2OLWA 5AT1B 1VQ8S 2GMHA 1VQOS 3DRRB 3Q8UA 4QYZK 4DXLA 3F0NA 1LNQA 3H98A 2VFTA 3B54A 2RE1A 3G87A
chains in the Genus database with same CATH topology
2R8HA 2WSEC 1Q7YT 1LXJA 4TKTA 2DGQA 1U47A 1IBKF 4O3PA 2IA6A 3BQ0A 1APSA 1BC6A 1HBMB 2HMIB 4ES2A 1SJFA 1OPIA 2F8HA 2FJAB 3IAS9 1SXLA 5L9XA 3M2UA 3VAKA 1GT8A 1HQUB 2VG6A 1WF0A 3OR2A 4X4RA 3NP5A 1RT2B 2EG2A 4X4SA 4A8KA 4OX6A 2BR0A 1UVMA 3G9CA 2UUTA 1KOHA 1N0UA 4OI6A 4A8SA 1YTYA 1UL3A 3DOKA 1X5SA 1RISA 3U02A 2AJQA 2DH9A 1RTHA 4OZ5A 1RTDA 4CO1A 1LWFA 3T6BA 2CVEA 5GAEU 2E9ZA 1WD6A 4Y2AA 2K3IA 2ZDPA 3W7BA 1C1BB 1W25A 1WTBA 4TLQA 4DPOA 4K5RA 2HS4A 2KT5A 1YJWS 3K5LA 5T41A 2GHVC 3MMCA 2M70A 2YKQA 5L1LA 1G1XA 4IG3A 2XGPA 3UDLA 1IN0A 1BQMA 2V8GA 4MIWA 2FGCA 2MKJA 3SSRA 5J1PA 5KFCA 4F4KA 2AYMA 3CCTA 1SC6A 2QZ8A 4YP3A 2J9EA 5C5JA 3OJUA 4FXVA 3V81A 2FJXA 3BGUA 4N77A 5K9FA 3UFCX 1UEVA 2ZH8A 5C25A 1HD0A 2ZC4A 4MIAA 3MECA 2Q79A 5A0YB 2YKNA 4PUOB 2E5GA 4Q8FA 4NLVA 1CEZA 5THWA 2XBPA 4NXNF 4WE1B 2HG4A 4UY8T 2JLEA 1R8AA 1TUVA 2EVZA 4ID5B 4KFBA 2BQRA 2LKZA 2VASA 3DMJA 2XSJA 1CSJA 3SCIE 4ZMMA 2AWZA 5LSRA 2C2DA 1TV6B 2RQCA 2GQ2A 3NS5A 2AGOA 2BZ2A 2CDQA 4HYKA 2FJDB 2XNRA 3HF5A 1JLEA 2VQFF 2CPYA 4CNYA 2HW3A 5KFNA 4B3OA 2JVRA 2KYZA 4I2QA 5IM0B 2A2CA 3MEGA 2FTRA 1FRKA 1BLUA 3NCQA 2XO7A 1A6LA 5HL7Q 1H2TZ 3MUVP 4OJ1A 3MTJA 4M5DB 3DLLQ 3M8QA 1NJZA 2HLUA 1SUQB 2IVFB 3EPGA 2LVWA 2Q6CA 5DDRC 2UVUA 3CDEA 3DLKB 1YJTA 1S99A 2HNYA 2I9SA 1KN6A 5KFEA 1SJRA 2I2YA 1NK8A 1UWBA 2IRUA 5LSLA 2CYYA 4J9PA 2UUAF 3W2VA 5CYJA 1DRZA 1S1VA 1MMNA 2R7VA 4DS4A 5IT0A 3CWJA 4M94A 1JIHA 3CDBA 3OTCA 1OIAA 2BW2A 5E3CA 3MEEA 2CQBA 1JKHB 2UVVA 2IA0A 3NBPA 4LUBA 3HHLC 3CCES 5J2NB 2NSCA 3ITHB 3OFHA 3OLBA 1FHTA 2E7WA 2YWEA 2MKKA 2ATLA 3OBIA 1VC5A 2KKHA 5CCMA 4OZNA 2R7UA 2HFZA 3MTKA 1QE1A 4YHHF 3C6UA 2DR7A 1DQAA 4TQSA 2ILZA 5JJBA 5K14B 4ECWA 3T3FA 1WF1A 1C0UB 3TO8A 1RTIA 2FD2A 4B3MF 1N88A 2OD4A 2LQBA 2QRRA 4ECSA 2HQIA 3Q0AA 2DHXA 3QMQA 2WONB 1IR0A 4DG1B 3PNIA 3PKMA 3D0IE 2VA3A 3AQOA 1U25A 2B7CB 5J1NA 4ZVGA 4E98A 2JWNA 2CQGA 1SH0A 2KJWA 4TU8A 2RNEA 3MD3A 5J2MA 3FSIA 2MY7A 5M2PA 4QWBA 2LQ9A 2KDOA 4B9TA 5C24B 3P49B 4JV5F 4IQXA 5IWAF 4DSIA 2I5JB 1OSCA 3MMAA 2QE5A 1U6ZA 3L7OA 2KU7A 4F4YA 4C3KA 3DC2A 3TUZC 2QSFA 3S01A 1UVLA 1ROFA 2QMWA 4JV2A 4NLSA 1S9GA 2XLJA 2EI5A 1ZBTA 4AXIA 5G0RA 1NJIT 4F2RA 1ZZFA 4LVNP 5KG0A 1QY7A 2FB0A 2JC1A 2D74B 5CHCB 3GILA 1VBYA 4WZMA 1HHSA 2MDAA 3SMZA 5DM6Q 1W2BR 2BRLA 3BN7A 4TYBA 5DG9A 2E7XA 1GX5A 2FLPA 2KN4A 3FEYB 1WI6A 4Q0BB 2WCXA 2OFHX 3O1LA 4O44A 4QWDA 2MQMA 1U26A 5AJ3F 2Y1IA 1WACA 4BWJA 2RRNA 2AGPA 4RWXA 3HFKA 3OXFA 5EHHA 2DR9A 4W92B 4F50A 3LOUA 4KT0C 3SCLE 4WTYA 4XDDA 3BO4A 3N6NA 2OPSA 1KEKA 2GGPA 3ZZPA 4ES1A 2EKYA 1KQFB 1Z4UA 2WHOA 2D9PA 1ZTTA 3J7YI 1ZTWA 2PMZD 3Q2TC 2XMVA 3IR5B 5B09A 3MURP 1S79A 2XNQA 3OVBA 2U2FA 3O44A 3G6VA 1N5YB 2PFFB 4AL6A 2GFFA 4ITSA 1U8SA 2Q6BA 7FD1A 5K8NA 3OSNA 1VRUB 1MROA 4LF7F 1Z1ZA 3QO9B 1LWCA 1Y3KA 1VQ7S 1RT7B 1ZM9A 3H40A 1T05A 2OJ3A 4NLOA 2BOPA 2K7KA 3IR7B 5DQIA 2J7WA 5F3ZA 1OSDA 2LECA 4ZS6A 2OTJS 2FIUA 2HLTA 3H20A 4ZPAA 4YDDB 4YFUA 1FXLA 4ZHRB 2CG4A 2AP6A 2RQ4A 2ZD1B 2XCPA 4J9KA 2MZTA 4DSKA 2ZUGA 2EFQA 4Y2CA 1OS5A 2NUUG 3H2VE 4OI1A 3T1AA 2V5HG 1R31A 1JLQB 1MU2B 2J9DE 3HHLB 5B7WA 2ALZA 2HHPA 3IAM9 2W7OA 4NLDA 1T03B 5HP1B 1T05B 2FY1A 4X4OA 2DGXA 2MPUA 2HYIB 1ZAWA 3MR3A 4RZRA 3OUYA 3IRXA 2L48A 5M2RA 1DQ8A 1Q4RA 4XAKA 4ZVHA 3CIZA 4RU9A 4JBCA 1IBLF 3PW0A 3ZZZA 1S9EA 5EWFA 4PPZA 4DLGA 4TLRA 1JLGB 2EK6A 2ZZMA 4YOEA 2RF2B 2HWTA 3CD6S 2ZOMA 1X0PA 5KT3A 1U1NA 3DYAB 1RYRA 1FK9B 1Q53A 4ILRA 2YKMB 1VHFA 3POTB 4DX8H 3RTVA 4ED1A 1T3OA 5KAKA 1UVKA 1VI7A 3WBZA 2XC9A 4JI7F 3IWXA 3VALA 4I68A 1SL2A 3R1LA 2UVRA 4NLQA 4C0OC 4O3SA 3KHGA 4TY9A 1G6BA 3FCHA 3TANA 4KQZA 5CH7B 2GX8A 5L1JA 5BYSA 1WG4A 1WHVA 2IFXA 2LA6A 2OFGX 4IH7A 4RW9A 4KR0B 4U7CA 3RW6A 2XI3A 4JI2F 2VD3A 4PWDB 1YBAA 3FSYA 1SKWA 1JLFB 1HBMA 2GIQA 2B9XA 2E1AA 2Y1RI 3QZ8A 4EYIB 3R5CA 1KQGB 2PGCA 3IO1A 3MM8B 4EWTA 2MQOA 1M5HA 3AA8A 3GQCA 3BO3A 4B9NA 2JH3A 4U6PA 4MK7A 1NJWA 1TL1A 1S4FA 3DRYA 4NLPA 2CPDA 2VC0A 2M0GB 3SI8A 3OL9A 1DTQB 3QYYA 1HNZF 1RT6A 3RAXA 3BSCA 3D1OA 4EO8A 4ED8A 3PO4A 3J7ZT 4A8YA 3CCVS 2B9YA 2LDYA 3ZZRA 4DQPA 1KTQA 2GMJA 4WXOA 3TA0A 1VRTB 2ZH9A 4P7TA 3TVZA 5AE2A 1X7VA 2MSTA 1N5SA 4QU7A 2F8EX 1FE4A 4KHMA 1TK0A 4KIAA 1VBXA 3VAJA 3OTOF 1RKIA 1NEEA 3M2UB 4IKAA 1LOUA 3SFGA 5HN0A 1CQMA 5EX0A 4GKJF 2VG6B 2MYFA 3VZIA 3OR2B 3M6UA 4DR4F 2Q66A 4MYUA 1DZ5A 2AW0A 4B3SF 5EDWA 3P6YC 2ZBCA 2VFRA 1HWUA 3ZZ0A 4IRCA 2MKSA 3HX9A 3DOKB 3NG8A 1RT5A 3H25A 2BABA 2J6TA 1RTHB 5A8RA 1RTDB 2AJFE 1LWFB 3MUTP 1RP5A 2GW8A 4Z2XA 1N56A 1IBMF 3KJVA 2OIHA 1P8GA 3AAWB 2MQQA 3R3TA 4GMKA 2RS2A 2ZH4A 4U9RA 2MSSA 2GJ2A 1KLMA 3GIIA 1XWLA 1ULRA 1TQLA 1JXEA 1S48A 3MI7X 4HT7A 3MPYA 2HNZA 4IG3B 1XR7A 3GFXA 5J2PA 1U1QA 1BQMB 3Q8SB 3L3CA 2ZM6F 2DR5A 4FF1A 2SXLA 3CJ3A 4I7FA 4ELVA 4M63A 3PIPQ 4ECUA 3V81B 4AFFA 2RDJA 1AFIA 4ZPDA 4O23A 1UJ5A 5IM0A 1UA1A 1YHQS 3KTQA 2O67A 3DHXA 3Q22A 5C25B 3EUNA 4XK8C 3MECB 4KAIA 1S76D 2RQMA 4HH0A 2YKNB 5F8MA 1HNIA 2FLLA 2CQIA 4ZP7A 4OMFG 3TW0A 5T14A 1JJ2R 2ZZNA 3NMRA 5D4LA 4ZPWR 1YSJA 4IH5A 2CPXA 4KFBB 4OLOA 4ZCMA 5BJRA 2LEAA 3DMJB 2XSJB 3ZZOA 1FEHA 4BBYA 1QLNA 3LALA 5FD1A 2D3UA 1DLOA 2HVHA 3KG0A 4OHYA 2HRYA 5ITHA 1F0XA 4C9DA 3AH6A 1CC8A 4B3OB 3JB9k 4JI1F 5LXYA 3GYNA 4I2QB 1F2GA 2M3DA 3MEGB 3KWMA 3L95X 2UUCF 4ETXA 5MAOA 4AL5A 2E1MC 4ILMA 1N54B 2LEPA 3J7YU 3LP0A 1HQEA 2GO8A 3M8QB 2HFOA 3EGNA 4ZA1A 3WX4A 5L9NA 2Z2MA 4OZLA 3D2WA 2WSFC 5KFMA 3K5OA 5CYMA 4LVOP 2JVOA 2D3OR 1JXLA 2HNYB 4O3QA 4OHZA 2PI4A 2VUGA 1UWBB 1IM4A 1ZM3A 4FF3A 3W2VB 2W9AA 2DTJA 4C8KA 1Q1KA 2BXJA 2VFVA 1U45A 2MY8A 1X9WA 1SB6A 1SQEA 3UI3A 3KLHA 1U6FA 2DO0A 2JFDA 1SV5A 1BD6A 2H5EA 1A7GE 3DFEA 3MEEB 2WONA 2G13A 5AE1A 5BR8F 2XI2A 2P5VA 3NBPB 4PQAA 3KK3A 1UA0A 2DJWA 2ZOFA 4DV3F 2HGLA 2RIJA 2DNRA 2F40A 2OPRB 1Q79A 3CXCR 4TQRA 1HNVA 4MKAA 1FXRA 1QE1B 2LA4A 2GA7A 2MZQA 2OPQA 3C6UB 5B0DA 4CO5A 2LEBA 1QVFR 4NRUA 5DLGA 4NLRA 1R89A 4YB7A 3JTNA 5KFUA 3MOJB 5LT5A 3LGNA 5DM7Q 4Q2MA 4K4VA 1RTIB 3ZZYA 1NNDA 4DV5F 1YJNS 3NNAA 3TP2A 3TRGA 3FMWA 3KK1A 1MWZA 4B9SA 3DU6A 1P6TA 5B0FA 2J6UA 3TVKA 4AYBD 5E33A 1JB0C 2XGQA 4WJBA 2B7BB 3H2UB 2CJAA 1REVA 1D9DA 4H4MA 4BC7A 2ZHBA 4IDKA 2QA4S 4ID8A 1ZPWX 2PN6A 5FLXY 1FT8A 2HHXA 4DSLA 1TFWA 5J2MB 1Z2LA 2X1AA 1KHWA 1FVQA 4X62F 2I8EA 1Q8LA 4OLPA 2XLIA 2DIUA 1R6YA 3DLHA 2IAJA 2KFYA 3MMAB 1RA7A 3CCWA 2AX1A 2J9DA 3TA1A 3K58A 3QAEA 2R2TA 4RW7B 1S9GB 5G0RB 4DR5F 4LQ9A 3CCRS 2GCFA 3I0SA 2RU3A 3BO2A 5GAGU 4DF8A 4RUHA 3M8PA 1DHMA 3MD1A 4EU0A 2LCWA 4DSFA 5J1EA 4O44B 4NCGA 2DNOA 2QEXS 2EPIA 2C3UA 3KLGA 4LMZA 1X4AA 2C3PA 4B9VA 3GFYA 4WF9Q 3HVAA 3PW7A 3M05A 1MMLA 1RT1A 1S1TA 3OTEA 4PG6A 2JX2A 5CZVA 2G0CA 2OPSB 1NJYA 4MKYA 2GGPB 2KTQA 4OI0A 3HHLD 4MK9A 3NKYA 4URQU 3HHLA 5AXNA 3MFHA 4FBTA 4WFZA 3K5MA 1VJWA 1K9MT 1R43A 5KFGA 4RNOA 2GJIA 4FF2A 2DNKA 2KG0A 2DITA 2P9GA 1KVIA 5F41A 4O4RA 4WKYA 1WI8A 4OHWA 2BBEA 2VQEF 4OX9F 1JMTA 4ECZA 4WFAQ 1GH8A 1MROB 5D6GA 5M2UA 1LWCB 2FHMA 4QIEA 4ZVEA 2I38A 4KTQA 4N76A 2XMWA 5I42B 3E01A 4CZCA 3MR2A 2VOPA 5I3PA 3DYAA 3JSMA 2UVWA 4FF4A 1N33F 1KTVA 2IC3A 3N6LA 2YWFA 3OXLA 4RBTA 3U1NA 3BGLA 1KC8T 4C8OA 4E8UA 2R2RA 3OLAA 1YQHA 1FRLA 1U2RA