2N55A

Structure of constitutively monomeric cxcl12 in complex with the cxcr4 n-terminus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Structural basis for chemokine recognition by a G protein-coupled receptor and implications for receptor activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2n55A00
1A15A 2KOLA 1DOMA 4U68A 5CBEE 1AP0A 3LWEA 2K04A 1HFNA 1HHVA 3GV3A 1S4ZA 3MWYW 5T1IA 1DOKA 1MSGA 2B2YC 2HUGA 1M8AA 3Q6SA 2L1BA 1WTQA 1WD1A 2B2WC 1EQTA 1SSOA 2Q8RE 2B2YA 1JICA 2JYOA 2CVRA 1F9SA 5EPJA 1PDQA 2B2WA 4LMQD 1WVLA 1BO0A 1WTPA 2NYZD 1RODA 1RJTA 2XIWA 1IL8A 3I90A 2DY7A 2L12A 1O7YA 2J7ZA 4MN3A 1IKLA 1PLFA 2RVLA 4NW2A 5EQ0A 3SVMA 4R8IA 2MGSA 2B2UA 1O7ZA 2MPMA 3FDTA 4XDXA 2Q8TA 1EL0A 1ML0D 1SAPA 2N55A 1B3AA 3F2UA 4HEDA 1JE4A 1U4PA 4X3TA 3P7JA 1TVXA 1AZPA 1B2TA 1X3QA 2HDLA 1VMPA 1WTWA 2SDFA 5CBAE 4XT3B 2B2TC 2EOTA 1WTRA 2B2TA 3N52A 4IUUA 4RAUC 2R3ZA 2FFKB 1G91A 4MHEA 4IURA 2K03A 1ILQA 2MP1A 4X3KA 3G7LA 4ZAIA 3DEOA 1BNZA 1PFMA 3KBXA 1AZQA 3IL8A 1QG7A 1G2SA 1F9QA 1XX8A 4OIKA 2X69A 1DONA 1X32A 2DY8A 3QO2A 2M2LA 1F9PA 1X3PA 2HDMA 3I8ZA 2JP1A 1MI2A 1CM9A 2K1BA 1NCVA 1HUMA 2HCCA 2KUMA 1G2TA 1KNAA 1F2LA 4OIJA 4XT1B 5D65A 4RWSC 1XYIA 5DNFA 5EPLA 1RTNA 3DEPA 1SDFA 4R9WA 3HP3A 5D14A 2NZ1D 1F9RA 1Q3LA 1ZXTA 3TZDA 1O80A 1B4OA 2L4NA 5AFWA 2FHTA 1U4MA 4RA8A 5T1GA 5E4XA 4DN4M 3I91A 1DZ1A 2FMMA 2FJ2A 5EPKA 1HRJA 2NWGA 1MSHA 4HSVA 5CMDA 4QUFA 1C8CA 4CJ1B 1IKMA 1LV9A 2D9UA 4O42A 2EPBA 2H1EA 1RHPA 4CJ2C 1NR4A 2KVMA 1GUWA 1QNKA 1VMCA 1WD0A 2MJ8A 2FINB 3MTSA 4HCSA 4IUTA 5CORA 1U4RA 3TN2A 2EE1A 2B2VC 4ZLTF 2K05A 1NAPA 1ICWA 3DM1A 4IUPA 1PFBA 4UAIA 2KEEA 3UI2A 2B2VA 1EIHA 5EKIA 3FPUB 3IFDA 2VXWA 2X6GA 1EIGA 1CA5A 2RSOA 4X3SA 2K28A 1ESRA 4QUCA 1WTOA 1ILPA 1EOTA 1BBXC 1CA6A 2HCIA 5EJWA 1WTVA 1J9OA 2KEDA 4ZKCB 2K01A 1MGSA 1WTXA 5E4WC 2N88A 3H91A 5COYA 4IUQA 5JJZA 1QE6A 4ZK9B 4ZKBB 2B2UC 1HUNA 4CJ0B 1DOLA 1NR2A 2RSNA 3D6WA 1B53A 1PFNA 1G6ZA 1HFGA 1HA6A 1RTOA 4X3UA 3ONAB 1KNEA 2L11A 3GV6A 3I3CA 4IUVA 1B50A 1J8IA 1BF4A 3KUPA 1U4LA 2KECA 1E0BA 2X6LA 4HAEA 2IL8A 2RA4A 2L9HA 3R93A 2BDNA
chains in the Genus database with same CATH superfamily
3HFZB 3PUYA 5C44G 1TS2A 2TMPA 4I7ZC 1KLGD 1HFNA 4PMBA 2B2YC 5C4HA 1M8AA 1QNUA 2R7FA 2JA8B 1MJCA 2Q8RE 1TXYA 2E2IH 4OO1H 4A3CH 4UHVA 2F0PA 4C1NK 2LKVA 3MXGA 3I73A 4A3KG 5M5WH 3M4OB 3SDZA 4ZRZA 1AZPA 3SEBA 3KDFB 4A3FH 1NNXA 4QIWB 2FMCA 1S3OA 3KJPA 1D1IA 1F2ZA 2B2TA 4B3TQ 3N52A 2AQ1B 3CQZH 2N49A 3TS0A 4A3KH 2HHHL 2JSOA 1KAWA 5C44B 1PA6A 3S2HB 3PO2G 1SJED 1E1OA 1I6HB 2JE6I 2J4XA 2F0EA 4TQUS 4DXGA 2HQEA 5J3BA 1J5EQ 3M3YB 3DEPA 3CC2A 1WCMG 4GZYC 2UXDQ 3TZDA 1B4OA 2KA7A 4V190 1CT1D 5FKAC 2E2HB 3IRBA 1JQYD 5IYCG 2F0DA 3RZDB 2NWGA 3GD7A 1HPCA 3CCMA 4JG2A 3NTKA 3PO2B 1E2VA 1I3QH 1STAA 2F0UA 5EBCA 5AJ3Q 2E2JH 2EY6A 3I4OA 1EY8A 1JT8A 1NMFA 1SMYD 3OMCA 3CCEA 2JJQA 1K8MA 5FLMH 2L15A 3TP8A 4L5TA 2ZJQA 1ZEQX 1YNND 1X9NA 4FP5D 3IAYA 5IIFA 3J80L 4QMGA 1WCMB 3EJIA 5NUCA 1WTXA 3C3LA 3N6RA 2VZAA 3I70A 4ME3A 2EDGA 2OQKA 3S1NB 3OIPA 4GKJQ 5I2YA 3U4ZA 1C48A 1E3PA 1TWAH 4QB4A 1P16A 1EQVA 5C6AA 3K5MA 1PH7A 4A3JG 3WOFA 1VQOA 4CKBA 3QB3A 5JEAG 4ZCKA 4DV7Q 4DR1L 2F0HA 3BDOA 3CCUA 4LUOA 2V4DA 4TKOB 2XGTA 4NW2A 5EQ0A 4JYAQ 2J7ZA 1N32L 1GUOA 5JAVA 2JN4A 4I65A 4DV5Q 3S17B 4CHTB 4K14A 1B3AA 4A3JH 4PQXA 2CW0D 1E24A 4YCVA 2SDFA 1TY2A 1JOQA 2EOTA 3FEWX 3VR5A 4NMZA 4OX9Q 4XTCS 3PF4A 2HIXA 3KLRA 4C2MH 1Y14B 2AWNA 1Q7YC 2K5VA 3DWQA 1PRTF 2G9DA 4PZ6A 3GP7A 3S15H 1A3VA 2RQXA 4KY6A 3J7AV 1HNXL 3K5LA 5ELFA 1CM9A 2VS1A 4BY1H 1VQHA 1Y1VH 4OIJA 1SYBA 2KBNA 4H7BA 4RWSC 2A5HA 1MD2D 2EYHA 2UXCL 3RLOA 1OXUA 1C4QA 3NBIA 5IP9H 3CPWA 5C4XG 5E4XA 4OGQC 3EFXD 1I6VC 3WOEA 2SEBD 3J81E 1UEAB 1NR4A 5ELEA 5JVG3 1WD0A 1JMCA 1SE2A 3VR4A 1LTID 4CBVA 3K6OA 4DV0Q 5C5MA 1B44D 4S3SA 3E0JA 1L1OA 1KD1C 2B2VC 3C1EA 5C4JH 4JV5L 5CV6A 1V43A 5HURA 2NVXB 1N34L 5CR3A 1WTOA 1BXTA 2RCFA 1PH8A 1VQKA 3NQIA 5C4XB 4N9PA 2F0JA 5CV9A 1KQSA 2RDGA 1HFGA 1UWVA 3HOYH 2O5JC 2UUBL 1Q82C 2L11A 3D3RA 1YEZA 1G51A 4MNOA 2LFNA 2VUMG 2A69C 1E0BA 1XTCD 2HIVA 1S40A 1SNDA 3GTGB 4BXXG 1NSNS 4A3LH 5E1FA 5I9OA 5JEAJ 3GV3A 2IJ0A 1MSGA 1BNZA 4DR2L 2R93H 2CWPA 4R4OA 4GS3A 3RLFA 5C0XG 2K5DA 1RJTA 1LT3D 3I90A 4X66L 2D2CC 5GAHC 4A3DG 4K6LA 3AFQA 1UNSA 3A5ZB 3PF5A 3URYA 2B3GA 3A8KE 3E9HA 1BCPC 4LJZC 1BOSA 1X3QA 1TKWB 2JA5G 2E74C 3BVMA 2B2TC 3L7ZC 3GTJH 1SLJA 5M3FG 2VUMB 1N36L 2R3ZA 1LO5D 4MHEA 1ILQA 1PFMA 3IL8A 2JA5H 2A6HC 4FF2A 2Z6KA 4Y7NH 5M3FH 3PV0A 4B9WA 3BYYB 4RGTA 5CYUA 3HOVB 1N32Q 3LNNA 1KLUD 2WAQE 2JQOA 5ELNA 4A3DB 2C5CA 2Z4IA 2QILA 3CCRA 2B63H 2PZTA 2DUDA 3M7NA 4JBJA 1O7IA 3NQTA 5CGKA 3UDXA 4DV6L 4BWGB 1D1KA 3U9OA 2R6GA 4RA8A 5M3FB 1JB7A 2KENA 1NJIC 3R2TA 2ZT9C 4JI0L 1EY7A 4AQYQ 1HRJA 4QUFA 2PCFB 4O42A 3Q8DA 1JE5A 1PH4A 4DAYB 2MJ8A 3KF6B 1XMQQ 1SE3A 2B39A 2G9HD 1ASZA 3J7AF 4P71A 4ZLTF 5ELOA 3L2PA 4JI2L 3MAQA 1IBKQ 3ERSX 4FNFA 1R9TH 4DKAC 1HZCA 2RSOA 4IOAA 3NP8A 2UXCQ 2H5XA 1B70B 1J9OA 3H6MA 3KLSA 4IUQA 3T4AC 1ZYRD 1TQOA 3MA2B 1H9SA 2F0GA 3J80E 4X3UA 1JCKB 4I7AA 1W3SA 3I3CA 5ISRA 3GTPB 3ZYYX 1IBLL 2KCNA 3DXJC 1FGUA 4PMWA 1PTOB 4GNXA 1BF4A 2JEBI 4HAEA 1LABA 1QVCA 2FJ2A 2KOLA 1YJNA 2PQAB 3TQYA 4NDXA 4GN5A 2GA4B 1N34Q 1WVLA 3EVQA 3RZOB 3SE0A 3E9IA 4JBKA 1VQGA 2F4VL 1O7YA 1KDAA 1IKLA 2PZWA 1BDOA 2H4OA 3VR6A 2UU9Q 1Y1WB 3SR1A 3RNUA 3TZUA 1HTPA 2PMZB 2E5LQ 4LFBQ 4WJ3M 4EQOA 1EWIA 2Q2IA 2LS01 2WB1G 2FFKB 2MO0A 5IODA 1I50H 4ZAIA 4YWMA 4L63B 3X3NA 5M5XB 5KYIA 5H1SE 2MNAA 1TWCH 1X3PA 4J8QA 4J1MA 4DUYL 1FR3A 4X66Q 2FXQA 3EN2A 1F2LA 1VQ6A 3I2ZA 2E75C 1E2ZA 2AMCB 5IGGA 4JI8L 1DM0B 1O80A 3BVGA 4LF6L 1NBWA 3NTIA 2UUAQ 5D3IB 5FOBB 4DV3L 1E7ZA 1EY9A 4UP9A 1LV9A 3J80i 4LF9L 5GAEC 1PRTD 4CJ2C 4GLVB 5M3MG 4LFCL 2CQOA 3I56A 4X64L 4C3IH 1Z9FA 1E1TA 5C3WA 3CW2C 1A2UA 3I72A 1NAPA 2R92H 1W2BA 3HZXA 4LF7Q 1SMYC 1CA5A 4LWCA 4KV6A 1JOOA 3K7AH 4FXGC 4N8FA 5GROA 4MIUA 4KHPQ 4YWLA 1MGSA 1Q8IA 5E4WC 4PNYA 4ZK9B 1EQQA 4A3EB 5FO9B 3J7YW 2K5HA 1ENCA 4KKUA 4H0LC 1SE8A 3GTOB 1QUQA 2WKCA 5M3MB 2RA4A 5CMDA 3A74A 1EY5A 3A55A 1Q46A 4A75A 2LMCB 3LWEA 1YHQA 1TWHH 4JI2Q 5E3FA 4A3IG 1IYJB 2KCTA 1VF7A 3NBHB 2JA6G 1MIUA 1CUKA 2PI2E 1IL8A 2XN9C 3J7ZC 3G4SA 2NN6H 3VYRA 1A63A 4P2CB 1ENAA 3AB9A 3H09A 3GTKH 3F2UA 5ELDA 4K8IA 1X3FA 1SYDA 4BBSB 4B3TL 1IBLQ 2TSSA 2JA6H 2A73B 3K57A 3I4NG 3H15A 4G4KA 4FVMA 4NXNL 3S1RH 1HZ9A 1LT5D 3K8AA 1Q90A 3PUVA 2QA4A 3T1YL 1VDZA 3CHBD 4A3IB 1VQPA 2MQHA 3SGIA 1EYDA 4HSPA 2B8FA 1BCPD 2F4VQ 3AEVA 1STHA 1XWEA 1STGA 3BG3A 1A3TA 5I6YA 2UXDL 5LL6S 1PTOF 1CFMA 3RUZA 1OXVA 4JPBW 4IPGA 4C3JG 3S2DH 4FXKC 1B9MA 4NB3A 3I4NB 5A2QL 4DAMA 1MJEA 1EYAA 3F8TA 1VQ7A 1QILA 1M1KC 4C3JH 1XNQL 3I4MH 3FPUB 4QL5A 4JI1Q 5IT9c 1Y8PB 3MFYA 4KKTA 4U673 1UUPA 1Z7TA 4JI8Q 4FYDA 3NWTA 1EOTA 1GUGA 5FJ8H 1B1ZA 1A6XA 4RKLA 1QE6A 4FO2A 1QB5D 1I4XA 2XNAC 2EYFA 4DPGA 4DF7A 2A8VA 2K5WA 3L3OC 1RCVD 4FF4A 1V1PA 2EY5A 4DUZQ 4GNXC 2NB0A 4LFCQ 2NVYH 4B3RL 2AQ3B 4EQPA 3A54A 3RN2A 3W1BA 1UE5A 4DV4Q 3MWYW 4DV7L 3KF8A 1WD1A 1ESFA 3GTQH 4Z9CB 1F9SA 3PMFA 2ZM6L 1LACA 5BN4A 2YTYA 3FMCA 1LUZA 1WI5A 4IALA 1PV4A 1OXXK 3STBD 1S72A 4XDXA 5GAGC 4E6IA 3NENA 4A3GH 4HEDA 1HXYD 3IFTA 1PZKD 4OO1G 2F03A 4DR5L 1I4RA 4A3CG 2VNUD 3I4LA 4RMFA 2E2DC 4GKKL 2WKDA 3K0YA 4OWWB 1LYLA 3K0XA 3S14B 4OHJA 4A3FG 1CTMA 1HR0L 1AZQA 1QG7A 4LK1C 2SNMA 4CDEC 2EVBA 1IYVA 5C4ZA 3OIQA 4IFDH 1TWGB 2K75A 1XXGA 4A93G 1JC7A 4Q5VA 2I5HA 3IKJA 4QJFA 1VCIA 3MVVA 5DNFA 4QIWE 4WJ4A 3HOWH 1FYCA 2E2IB 2G5DA 3P20A 1KRTA 3TRZA 4A93H 3MEHA 4XYOA 1GOZA 5KGUA 1PYBA 1DZ1A 5M5WB 1STBA 2CFMA 2F0KA 3OTOQ 3KFUA 1BBUA 1FGBD 4IJHA 4NXNQ 4PMCA 1SROA 4OL7A 1C8CA 2MO1A 4A3FB 2H1EA 5EKLA 3T1YQ 3FP9A 4DV0L 1GUWA 2DJFC 3M7GA 5IGBA 5C0XI 2PQEA 2Q2TA 4CKCA 3CCQA 3CQZB 3CU7A 1K0RA 4A3KB 4UAIA 4GOPC 4RGOS 5CV4A 5IWAQ 1HQRD 4X3SA 4JK1C 4ZUJA 2PO4A 1PH9A 5J22A 1KTKA 3TDQA 5IT9L 2YTVA 3BJUA 5FLMG 5L37A 4K5XA 3NEMA 1OO9B 4CJ0B 3VR3A 1ZYRC 4POGA 4A3MH 1RTOA 3CD6A 1CHQD 5JPMC 1ZKOA 5IGFA 1LT4D 4AIMA 4F87A 3D4WA 3R3OA 5HY6A 5IYBH 3KUPA 4DV1L 2IL8A 3A0JA 5C3XA 3DLLA 3ND9A 1XNQQ 2XWJB 1DOMA 2L5TA 2OCEA 1HHVA 4DFAA 4UY8C 1WTQA 3Q6SA 4BBRH 1I3QB 1TS4A 3UDIA 2E2JB 4KHVA 3TSSA 3NHHA 2NZOA 3MHBA 3OW2A 3W2DA 3RN5A 1JE4A 2Z1CA 4EQNA 1FNVA 4HJ9A 4DR7L 3EBEA 4QF4A 4WORA 4JI6Q 4XT3B 2BE5D 5KNBA 5M5YH 1QVGA 4IUUA 4B3RQ 3C46A 4IURA 3U4VA 2HD3A 2K03A 1B9NA 2BA1A 3DEOA 3DM3A 3CCJA 3KBXA 2M9VA 2X69A 3H3VI 1XPRA 3G48A 2ZM6Q 1JORA 1FVIA 1HUMA 1TWAB 1K3BC 1TR5A 4LF4Q 1N33L 3VR2A 1SRUA 4NP5A 1SDFA 1DYQA 5EKKA 1O7LA 4DR5Q 4EX5A 4ULLA 1AE2A 3VYTA 1EEID 4BY1G 1STEA 4LAAA 4GKKQ 1IW7D 1Y1VG 3T13A 4AQYL 4BS9A 1PH6A 3I91A 1XPUA 4HJ5A 2F0WA 4A3JB 1HR0Q 1AEXA 1H9MA 1RHPA 2ZTDA 1XMQL 1GO3E 1B3QA 1PRTC 2OQ0A 3HS0C 2I5LX 5IP9G 4FDBA 2I07B 5KIXA 4C2MB 2O5IC 4CKEA 1PFBA 5A2QE 2Z0SA 1IBKL 3M4PA 3SXHA 1EIGA 1EY0A 2VW9A 3BU2A 3HOZH 4LW1A 1R4QB 1YJWA 3Q24A 3S15B 2EY1A 1PTOD 1I4HA 1H95A 1U0LA 1JJCB 3ZJYC 1LT6D 2K01A 4R8NA 2WV6D 4BY1B 4B3SL 5JJZA 1Y1VB 1GUTA 4JBMA 1VQFA 4KD4A 1HNWL 4K5VA 1RF2D 1RIPA 2XTIA 3HKZG 2JK8A 5F2DA 1L2FA 4HR7B 2KECA 2EJFC 1PXUA 4J15A 3WDNA 2K5QA 3HOYG 3S1QH 4U68A 3OHXC 2K04A 2KHIA 3ER0A 2HUGA 3FHWA 3F2CA 1XNRL 5KYLA 1PDQA 1G8ZD 1WTPA 3KLWA 4RCOA 4KN7C 1SEBD 3SVMA 4A3LG 1PLFA 3OWEB 3FPPA 5C4JB 3BYTB 2Q8TA 1Q12A 2UU9L 1L0WA 2R93G 2UUCL 3S1MH 2SOBA 2E5LL 4BA2I 4LFBL 1K3RA 1CKMA 1YHBA 4JI4Q 1B8AA 4DR3Q 2AWOA 4DA2A 4QQBX 4DV1Q 1C9OA 2MP1A 3HOYB 1A0IA 4OWXB 2VL6A 4KK7A 3NTHA 2AKWB 5DM73 1SMXA 4JI7Q 4R4QA 2Z9HA 2JP1A 4G7HC 3DMUA 4OXPA 2F3IA 4DV2Q 1CKNA 5KEEA 2ZXPA 3U9SA 4M8AA 4DK3C 2R93B 5D14A 1CI3M 2VY3A 4DR7Q 3Q0AA 5K36H 2L4NA 1Q81C 2UUAL 3NSWA 1A3UA 4RCNA 5EAYA 4L5QA 1KL9A 1SNQA 3GTLH 4LFAQ 3OMGA 1L1OB 3F2BA 2B63G 2A68D 1KC8C 4HIDA 1I4GA 4ALPA 4HCEA 4KN4C 3BS1A 2EPBA 2DGYA 1VMCA 5ELCA 3GTJB 2VB2X 3D4RA 1KDBA 1SYFA 4KKSA 1C0AA 4LF7L 3G6EA 2F3WA 1M4VA 4POFA 2EJMA 1N33Q 3TS2A 3DHQA 3QJYA 3SK4A 1SBBB 2XSCA 4MTNA 2QEXA 4KHPL 2JA5B 2D5DA 5ELBA 4Y7NB 3HOUH 2F0SA 5JVH3 2O4XA 3BDCA 4H13C 1YNXA 2D0OA 2B63B 2F0FA 1PFNA 4AYBG 1S5BD 5LMNW 1KNEA 3J81j 1U9RA 2JA7H 3QOJA 1W6JA 3TP7A 2L9HA 1YITA 1KIXA 1SJHD 1SNMA 3A7AB 3S16H 5KRUA 4IOCA 1AP0A 4QCLA 3BVZA 2WINB 3D31A 4IZ8A 2JYOA 5EPJA 3UE0A 4L8JA 3K5NA 3QIAA 1BO0A 1ENFA 2MHVA 4MN3A 4B3SQ 1LTAD 1V1OA 1V8QA 2CH4W 3FDTA 1O7ZA 3GTMH 1TY0A 4KLKA 5LL6X 1ML0D 2YU9H 4UP8A 1HJPA 3H0GH 1CSQA 3STBC 4IO9A 4JC0A 1HNWQ 1R9TB 1TS3A 2PZUA 3SK8A 5JOBA 1GUSA 2F0VA 4M1UB 1LTTD 1TWFH 3CAMA 3A5UA 1HCZA 1N8RC 3QOLA 5C0XJ 1S5CD 2IX1A 4DR6Q 2NVTH 3SK6A 4UDUC 2EYOA 1WTHA 3KBGA 1XNRQ 4P73A 1H9KA 3P1HA 4L6TB 2HCCA 1SE4A 2K5NA 4KTAA 4BA1I 4ZUIA 3CMAA 2PMZE 2UUCQ 2HT1A 2WIIB 1F9RA 3MZ5A 3O13A 1JWSD 4LF5Q 4RGMA 4P75A 1M90C 1NY4A 1LTRD 5TSSA 4HJ7A 3VDYA 1IKMA 2YV5A 3A7LA 5HGQA 4HIOA 3DWPA 5A35A 2NUCA 4IUTA 3MXNA 2J0TD 2EE1A 4EQ5A 5CV5A 2K05A 4JI1L 1I50B 4UP7A 1EY4A 2CQAA 1H9SB 4K5WA 2EQSA 2JA9A 4OO1I 3KK7A 4C3IG 1TWCB 5IE8A 1F2MA 3T53B 1H9RA 4DNRB 2ASBA 2SNSA 2WB1E 4GNXB 2WB1B 5COYA 2R92G 4C56C 1QWYA 3OWFA 3T51B 1EWCA 1YZ6A 3E3XA 3TP6A 4F88A 2I0QA 3NPPA 1YHAA 4WJWA 4DUZL 4DAPA 1FNWA 1J8IA 3FKIG 4GN4B 1VQ9A 2KCCA 1A15A 4DV4L 1EUJA 1HZAA 5CBEE 2DN8A 4GOPA 3JC66 4PV1C 3OOCA 1DOKA 1Y8OB 3D6CA 4LUZA 3L9AX 5I9PA 4LMQD 1BKBA 5G3LF 4C3IB 3FKIH 2QDLA 3KJOA 3NWSA 2R92B 4BY7H 4L5SA 3A8JE 1EL0A 2OEOA 2K33A 4K8JA 4DK6C 2E8GA 3K7AB 2K14A 3PO3H 2K50A 5CBAE 4XXEA 1WFQA 1LTLA 2BE5C 2NN6G 2Z4HA 1CQVA 1X3EA 2JEAI 1JWUD 3V2TA 2MFIA 2ICIA 1G2SA 5CV7A 1DONA 2WACA 3QO2A 2F0OA 1ICFB 3HEJA 3ICEA 5GADC 3HOXG 4JI3Q 1EWHA 2K32A 1PMRA 3P75A 4X65Q 1TWHB 1X65A 3CC7A 4EVOA 3EIVA 3HOXH 3OTOL 3LGJA 2AUJD 3L0OA 4IPDA 4B9XA 1V1QA 1IW7C 3GTKB 5FO8B 1LTSD 3R8BA 1PH2A 4CJ1B 1J6QA 1W6KA 4XIGS 4R4CA 1SNOA 2KVMA 2VQFQ 3CC4A 2JA6B 3VYUA 1ASYA 2F52A 2KEEA 4RGNA 3UI2A 5IWAL 3S1RB 4F8MA 2NVQH 4JOIA 1HA5A 2KQ3A 3HG9A 2HCIA 1PH3A 1QUQB 1PTOC 3Q23A 1O78A 3I4MG 4GN3B 1UEBA 3V05A 5J39A 3CF5A 4JI5Q 4KMUC 1HNZL 1QOHA 1B53A 1G6ZA 5HGTA 4JBWA 1E22A 2C35B 1H9JA 3GV6A 5FJ8G 2R7ZG 4A3BH 2BOSA 1KRSA 3H3VC 1A62A 2X6LA 3S2DB 3GDEA 3HRZC 4V0BA 1G6PA 4OONA 3X3MA 1VQNA 2A6ED 5DAUA 1SSOA 4KY5A 4C3HG 1K83H 1CSPA 4EGVA 3CP0A 1SYGA 2R7ZH 2XIWA 4C3JB 2DY7A 3T1HL 2RVLA 3I4MB 3E0EA 2N55A 1WOCA 2UXBL 4JI6L 1B2TA 4C3HH 1SR3A 1STYA 1XTDA 2RDFA 1Q1EA 2ATWA 3D4DA 1G291 3M85A 2XVSA 4IN3A 4A3GG 3NK9A 4K2KA 1K8AC 3M9BA 4X3KA 1DCZA 1S5FD 4YHHL 5EBDA 2R61A 3KDFA 1SNPA 4P74A 2MUYA 5IGDA 4R4IA 1PH1A 1F9PA 2NVYB 3R2IA 5IYDH 2A19A 4ABNA 4LF4L 5LMUQ 1STNA 1SFOH 1R4PB 2KUMA 3K59A 1G2TA 1SXTA 1KNAA 4N9TA 5D65A 3OSOA 3U58A 2Q2UA 3UE1A 3GTQB 1PHJA 4IFDG 5E7NA 1UE1A 1PRTB 1FNUA 2RKSA 5FLXc 2CWAA 1X3GA 4A3GB 2VQEL 2A68C 3HOWG 1BQQT 2JA8H 2KJXA 2EYPA 2EYLA 4HCSA 2Q8IB 3HKSA 3PGZA 2PW5A 1U4RA 5BN3A 2P5ZX 4YY3Q 2QCPX 2YYZA 1EIFA 3DWAA 1D2BA 1HH2P 5LHY1 1HZBA 1UE7A 4G57A 3IFDA 5DLQE 3M4OH 2IY5B 3AQQA 1V1PB 1ILPA 1CA6A 3U50C 4GLXA 3AU7A 3M4YA 2PPBC 2KHJA 1X55A 3QWNA 3C1FA 2B2UC 4HN7A 5IGEA 4FF3A 1DOLA 3D6WA 2RSNA 4ZYSA 5C44H 3S2HH 4CDDC 3HOWB 1K0SA 1SNCA 3KF8B 3ONAB 4ZQ3A 1I94Q 1LM0A 1GM5A 1RKNA 1I6HH 2AHOB 4LNQA 4QGUA 4A93B 2ALYB 1YNJD 2K7VA 2BDNA 2RCNA 1NMGA 4A3MG 1MKHA 2AUKA 1FD7D 1VQCA 3M3YH 1A2TA 2WFWA 3GO5A 1K9MC 5IYBG 2ENBA 2Z8LA 2CHBD 2CCZA 2NYZD 1RODA 4KJOA 3W5OA 4APVA 4Q0FA 2IWHA 2E2HH 3RZDH 1HNZQ 1T5EA 3NXWA 5JJKA 4XQNA 4BBRG 4JI4L 4DR3L 3PO2H 4KI0A 1BR9A 1VMPA 2HDLA 3JAMi 1EFID 1ET9A 1WTRA 4DU9A 1EU3A 2D0PA 4RAUC 3G6JB 1QVFA 1QZGA 3SHLA 4RFBA 4RG1A 1IBML 1BCPB 3CCSA 4A3MB 4OIKA 4K6DA 4JI7L 4R4TA 1X32A 3BDLA 1FJGQ 3AMUA 1CK1A 1WCMH 5G3LD 1MI2A 5BN5A 4O0AA 3T1HQ 3K81C 4DV2L 1EIYB 4RKBA 4HJ8A 5EPLA 1VQEA 1RTNA 5IYCH 2UXBQ 3S1NH 4IFDJ 4BBRB 1OXSC 3DUZA 1PZID 4ID6A 1ZXTA 2LXJA 3TMEA 2E76C 4YCUA 4LFAL 2OTJA 4NKLA 2LY7A 5T1GA 1EYCA 3PUWA 4B3ML 4HSVA 4YHHQ 1K73C 1ET6A 1PYWD 5FLXL 4KY7A 1CQFA 2ZTCA 5M5YB 1T5XD 1D5ZC 1DJRD 4O1NA 1ICWA 3S17H 3GQBA 4JOIC 4OWTB 1EZ8A 2EJGC 1T9HA 4YIJA 2K28A 4HJAA 3VA7A 4QUCA 4PG3A 1VQ4A 3AFPA 2KEDA 4ZKCB 3CRKC 5BR8Q 3J7A5 2LSSA 1HUNA 3HOZG 2VQEQ 2DNEA 4DK1A 1U5KA 4IUVA 1PZJD 4X62L 5JEAH 1B50A 5LMNQ 1KDCA 1RL2A 1U4LA 1GKHA 4NPSA 1X56A 2OT2A 3EROA 5GQOA 1IZ6A 1Q1BA 4AH6A 1IL2A 3AYHB 1S4ZA 2OTLA 3D8GA 1CKOA 4N8X1 3FRPB 2IPKD 1UAPA 1D6EC 3CCLA 1VQLA 2N78A 3PIO3 3Q22A 3HOZB 3RLNA 2EXZA 1EQRA 2IHFA 2N3SA 4NXML 1RDPD 3FVQA 1NE3A 1I4QA 3MC0B 3A56A 2EY2A 5K5PA 4Y52H 1PFSA 1G91A 1C7YA 3A8IE 4RH6A 2L0CA 4XQQA 2K4KA 4F7XA 4DR6L 2HHHQ 3MEFA 1XX8A 4HTHA 2NVXH 1EOVA 1V9PA 2DNCA 2HDMA 1KHIA 4R1JA 3W1GA 4X6AH 2CH4A 5C4XH 3S1QB 2Z6BA 3MXPA 3CXCA 3LX0A 2RHQB 3HP3A 3HKZE 4LF5L 3HKZB 3KYHC 4K0KL 2ES2A 2RHSB 1S5DD 3JAMc 3ITPA 2F1MA 3GTGH 1EY6A 1K28A 1B7YB 2QDBA 1MSHA 1IBMQ 3S1MB 2OXPA 2PNRC 4DNTB 4FXDA 1LTGD 5K36G 1QJOA 2OF1A 1QNKA 2FINB 5CORA 2F0TA 3PIPA 2AQ2B 5C5LA 2EYJA 2CKZB 1TIID 2X6GA 3PUXA 1BBWA 1ESRA 1N9WA 4DAYA 4WRDA 3CMEA 2NBFA 3KF6A 1BBXC 5EJWA 1L0YB 1X54A 1Z6HA 2NN6I 1BUVT 2VUMH 1YI2A 3HOVG 2ZXRA 1BCPF 1CHPD 2IW3A 2WAQG 1NR2A 4C1NI 2BCOA 4BXXH 1AH9A 2EYMA 4B3MQ 3K7UC 1DGSA 4XQJA 3HOUG 2ZXOA 4KHZA 4K2LA 5C0XH 1OTCA 3C2PA 3GTLB 3T16A 5JJLA 2NZHA 3R93A 1GHJA 3HOVH 1S5ED 3PCOB 3QR8A 1UE6A 4TSSA 4A3DH 5T1IA 4QY7A 4G7OC 1EQTA 2A6EC 5CC4A 2LXKA 2RBMA 3J81i 2JA7G 2CVRA 4OEMB 2B2WA 2PNHA 2QW7A 5C3EG 2DJGC 4KD3A 1F77A 4DR1Q 1VQBA 1CZWA 3ULJA 4R8IA 2PQAA 2F3VA 2MPMA 4ILWA 1KXLA 4LF8L 1SAPA 3BZDB 1JR0D 2WAQB 4X3TA 4DGZA 1SYCA 1TVXA 2BA0A 4PZ8A 1I4PA 2NTTA 4X62Q 3TBIB 5IT9E 5I6WA 3HOUB 1XPOA 5C3EH 3ERQA 2KHSA 1HQMC 1VQIA 3H0GG 4DXFA 1HR0W 3ULLA 1CKNB 2L55A 2QGQA 1WJJA 2BDOA 4J6HA 1TS5A 3KLSX 2DY8A 4JI3L 4DR4L 2JA7B 3I8ZA 1WYDA 1NTGA 1F2YA 5C3EB 1TT2A 2K1BA 2K52A 1HNXQ 4X65L 2EIFA 3S16B 3RD4A 4AYBE 3M4QA 4AYBB 1P8LA 1EFWA 3SK5A 2A74C 2PW7A 2C9OA 5JPNC 4NXMQ 3GTPH 2I46A 1E2WA 1IYUA 1U4MA 1PTOH 4ME5A 2Y0SG 5J1ZA 3GTMB 2XRSD 3LWUA 1QZHA 4YCWA 2YU9B 4A4IA 3I7FA 3H0GB 4IPHA 2VQFL 3VYSA 4CDCC 1Y1WG 1JJGA 3H94A 3JAML 4O2DA 2R7DA 1BVSA 3RZOH 3H3VH 3TN2A 4A76A 4YWKA 1TWFB 4JCVE 1GVPA 3F1ZA 1I5FA 4JV5Q 1JJ2A 1Y1WH 3RMHA 5FLXE 2NVTB 1VQDA 1X6OA 1AE3A 2F0NA 3PQIA 1WTVA 2PYKA 4K0KQ 4JI5L 1VS0A 3S9WA 2B8GA 5I2XA 2Y0SE 2Y0SB 2M00A 2HQLA 5FO7B 5IGCA 5CV8A 4HIMA 5M5XH 2V1CC 1L0XB 3UDGA 2UUBQ 4HMJA 4FF1A 2I5MX 2K6AA 5IY0A 4CDFC 2IX0A 4G7ZC 1YNJC 3QG1A 3F2DA 4TRDA 2L1BA 2B2YA 4IFDI 4DR2Q 2RDHA 2RF4A 2L12A 1ONLA 2MGSA 2B2UA 3G71A 2QKIC 3UDFA 1U4PA 3P7JA 1K8GA 4MTKA 5IP7G 1JB3A 3NBHA 1WTWA 3ULPA 1SYEA 2PI2A 1A8VA 4BY7G 3KOJA 5M9OA 1II3A 1JWMD 4A3EG 1N36Q 4B08A 3PO3G 2VB3X 2QF7A 3HGBA 5IP7H 2YTXA 5LMUL 1SN8A 3J81c 4JW0A 2ZJRA 1DD2A 3ND8A 1L1OC 3CRLC 4ODGA 1D8LA 4A3EH 4XT1B 1PVOA 4XYQA 1Q86C 3EQLC 3PIOA 1XYIA 1EYGA 3V96A 2GVAA 4LF8Q 2XWBB 4R9WA 3T56B 1EEFD 1XMOL 3BZCA 2O2LD 2NZ1D 1MBYA 3FKIB 1YNNC 3GTOH 2Q2HA 5AFWA 5KNDA 5M3MH 4DV6Q 3MXNB 4IUNA 1RD9D 4BY7B 3NELA 4DN4M 1Q8KA 2NTSA 1AFPA 3TREA 5KNCA 4JI0Q 4UPAA 2D9UA 4TVAB 3PO3B 2B29A 3OYYA 4PZ7A 4BBSG 3MTSA 4DK0A 3EA6A 4IQZA 4DR4Q 3W3AA 4YY3L 1LLRD 3MFGA 1GJXA 2F0QA 1TU2B 2JXMB 1EIHA 4LUVA 1K8OA 5EKIA 2VXWA 4GLAC 3K5OA 1CZGA 1DXMA 3VA5A 1GUNA 5I4DA 1YIJA 4BBSH 1EZ6A 2N88A 2N8NA 2ID0A 2GVBA 3TP5A 2WP8J 1YVCA 5JJIA 2ZJPA 4GOPB 1AW7A 3S24A 1I94L 3K80C 1HA6A 1YJ9A 1PYSB 2A1AA 1GHKA 4RHSA 5DEHA 1VF5C 4A3IH 2A69D 2CW0C 1VQ5A 3HOXB 3WWVA 1EU4A 3TEHB 2IHEA 1AN8A 1NUCA 3B6YA 2EZVA 2B2WC 3CKIB 4A3BG 1JICA 1QCBD 2Z6KC 3PSIA 1J5EL 3I4NH 3CCVA 2NVQB 1D7QA 3OW7A 1KAAA 5DM63 1D5MC 1IHZA 1Z47A 3G7LA 5FK9C 4MZ9A 1FJGL 1Y8NB 3CPFA 3E5SA 1F9QA 2A6HD 1VQ8A 2ZTEA 5AJ3L 4JVZA 2BH2A 4A3BB 2M2LA 2F0MA 4OELB 4IPCA 4CGYB 4DUYQ 1NCVA 1GD7A 4RHRA 4HMIA 1VQJA 3MXUA 3BZKA 3J81L 5IOCA 1K83B 2ICEC 1Q3LA 5IYDG 2R7ZB 3I55A 1JOKA 2FHTA 4DNIA 3D0FA 1D5XC 1OXTA 4P72A 4LF6Q 2FMMA 3K58A 2GN5A 5EPKA 1Y69U 2QEJC 1MHWC 4DV3Q 4H02A 4C3HB 4KJNA 4GKJL 4WFN3 4LF9Q 3NE5B 1YBYA 3PIP3 4IJLA 3J80c 4X64Q 1VQMA 1FL0A 1HTLD 2F4IA 1PH5A 4IUPA 3DM1A 2OWOA 2F0IA 1GXDC 2B2VA 2JA8G 3JAME 1VQAA 1XMOQ 5BR8L 2BH8A 2EXDA 3E6ZX 2IX3A 1LTBD 5EGTA 1SFOB 4JYAL 3H91A 2KCMA 1IXRA 4H44C 2IT1A 4ZKBB 4DV5L 3S14H 3RR5A 3NUCA 2D62A 2XRQD 5LMNL 5D3DA 4L5RC 3PUZA 2F0LA 1KABA 3OPOA 4DAVA 1TWGH 4HIKA 4OX9L 1XJVA
chains in the Genus database with same CATH topology
3PUYA 1TS2A 2TMPA 4I7ZC 1KLGD 1HFNA 4PMBA 2B2YC 5C4HA 1M8AA 1QNUA 2JA8B 2Q8RE 4OO1H 4C1NK 2F0PA 2LKVA 3MXGA 3I73A 3M4OB 3SDZA 4ZRZA 1AZPA 3SEBA 4QIWB 2FMCA 1D1IA 1F2ZA 2B2TA 3N52A 2AQ1B 2JSOA 5C44B 3S2HB 1SJED 1I6HB 2JE6I 2J4XA 2F0EA 4TQUS 4DXGA 2HQEA 3M3YB 3DEPA 4GZYC 3TZDA 1B4OA 2KA7A 4V190 1CT1D 5FKAC 2E2HB 1JQYD 2F0DA 3RZDB 2NWGA 3GD7A 1HPCA 3NTKA 3PO2B 1E2VA 1STAA 2F0UA 5EBCA 2EY6A 1EY8A 1SMYD 3OMCA 1K8MA 3TP8A 1ZEQX 1YNND 3IAYA 4FP5D 5IIFA 3J80L 4QMGA 1WCMB 3EJIA 5NUCA 1WTXA 3C3LA 3N6RA 3I70A 2EDGA 3S1NB 3OIPA 5I2YA 1C48A 4QB4A 1EQVA 5C6AA 3K5MA 3WOFA 4CKBA 3QB3A 5JEAG 2F0HA 3BDOA 2V4DA 4TKOB 4NW2A 5EQ0A 2J7ZA 1GUOA 5JAVA 4I65A 3S17B 4CHTB 4K14A 1B3AA 4PQXA 2CW0D 2SDFA 1TY2A 1JOQA 2EOTA 3FEWX 3VR5A 4NMZA 4XTCS 3KLRA 2AWNA 3DWQA 1PRTF 2G9DA 3GP7A 1A3VA 2RQXA 4KY6A 3J7AV 3K5LA 5ELFA 1CM9A 4OIJA 1SYBA 4H7BA 4RWSC 2A5HA 1MD2D 2EYHA 1OXUA 1C4QA 3NBIA 5E4XA 4OGQC 3EFXD 1I6VC 3WOEA 2SEBD 3J81E 1UEAB 1NR4A 5ELEA 5JVG3 1WD0A 1SE2A 3VR4A 1LTID 4CBVA 3K6OA 5C5MA 1B44D 4S3SA 3E0JA 2B2VC 3C1EA 5CV6A 1V43A 5HURA 2NVXB 5CR3A 1WTOA 1BXTA 3NQIA 5C4XB 4N9PA 2F0JA 5CV9A 2RDGA 1HFGA 2O5JC 2L11A 3D3RA 2LFNA 2A69C 1E0BA 1XTCD 1SNDA 3GTGB 1NSNS 5E1FA 5I9OA 5JEAJ 3GV3A 2IJ0A 1MSGA 1BNZA 3RLFA 5C0XG 2K5DA 1RJTA 1LT3D 3I90A 2D2CC 4K6LA 1UNSA 3URYA 3A8KE 1BCPC 4LJZC 1BOSA 1X3QA 1TKWB 2E74C 3BVMA 2B2TC 3L7ZC 2VUMB 2R3ZA 1LO5D 4MHEA 1ILQA 1PFMA 3IL8A 2A6HC 4FF2A 3PV0A 4B9WA 3BYYB 4RGTA 5CYUA 3HOVB 3LNNA 1KLUD 4A3DB 2C5CA 2Z4IA 2QILA 2PZTA 3M7NA 3NQTA 5CGKA 4BWGB 1D1KA 3U9OA 2R6GA 4RA8A 5M3FB 3R2TA 2ZT9C 1EY7A 1HRJA 4QUFA 2PCFB 4O42A 2MJ8A 1SE3A 2B39A 2G9HD 3J7AF 4ZLTF 3MAQA 4FNFA 2RSOA 3NP8A 1J9OA 3H6MA 3KLSA 4IUQA 3T4AC 1ZYRD 1TQOA 3MA2B 1H9SA 2F0GA 3J80E 4X3UA 1JCKB 5ISRA 3I3CA 3GTPB 3ZYYX 2KCNA 3DXJC 4PMWA 1BF4A 1PTOB 2JEBI 4HAEA 1LABA 2FJ2A 2KOLA 4NDXA 2GA4B 1WVLA 3EVQA 3RZOB 3SE0A 1O7YA 1KDAA 1IKLA 2PZWA 1BDOA 2H4OA 3VR6A 1Y1WB 3SR1A 3TZUA 1HTPA 2PMZB 4EQOA 2LS01 2FFKB 5IODA 4ZAIA 4L63B 3X3NA 5M5XB 5KYIA 1X3PA 4J8QA 4J1MA 1FR3A 1F2LA 2E75C 1E2ZA 5IGGA 1DM0B 1O80A 3BVGA 3NTIA 5D3IB 5FOBB 1EY9A 1LV9A 1PRTD 4CJ2C 5C3WA 1A2UA 3I72A 1NAPA 3HZXA 1SMYC 1CA5A 4KV6A 1JOOA 4FXGC 4MIUA 1MGSA 1Q8IA 5E4WC 4PNYA 4ZK9B 4A3EB 5FO9B 3J7YW 1ENCA 4KKUA 4H0LC 3GTOB 2WKCA 5M3MB 2RA4A 5CMDA 1EY5A 3A55A 2LMCB 3LWEA 5E3FA 1VF7A 1IL8A 2XN9C 2NN6H 3VYRA 4P2CB 1ENAA 3AB9A 3H09A 3F2UA 5ELDA 4K8IA 1SYDA 4BBSB 2TSSA 2A73B 3K57A 4G4KA 4FVMA 1LT5D 1Q90A 3PUVA 1VDZA 3CHBD 4A3IB 1EYDA 4HSPA 2B8FA 1BCPD 1STHA 1XWEA 1STGA 3BG3A 1A3TA 5I6YA 5LL6S 1PTOF 1CFMA 3RUZA 1OXVA 4C3JG 4FXKC 1B9MA 3I4NB 5A2QL 1EYAA 1QILA 3FPUB 1Y8PB 3MFYA 4KKTA 4U673 1UUPA 1Z7TA 4FYDA 3NWTA 1EOTA 1GUGA 1B1ZA 1A6XA 4RKLA 1QE6A 4FO2A 1QB5D 1I4XA 2XNAC 2EYFA 4DF7A 2K5WA 3L3OC 1RCVD 4FF4A 1V1PA 2EY5A 2NB0A 2AQ3B 4EQPA 3A54A 3MWYW 3KF8A 1WD1A 1ESFA 4Z9CB 1F9SA 3PMFA 1LACA 5BN4A 3FMCA 4IALA 1OXXK 4XDXA 4E6IA 4HEDA 1HXYD 3IFTA 1PZKD 4OO1G 2F03A 1I4RA 2VNUD 3I4LA 2E2DC 2WKDA 3K0YA 3S14B 4OHJA 1CTMA 1AZQA 1QG7A 4LK1C 2SNMA 2EVBA 1IYVA 5C4ZA 3OIQA 4IFDH 1TWGB 1XXGA 1JC7A 4Q5VA 3IKJA 1VCIA 3MVVA 5DNFA 1FYCA 2E2IB 3P20A 3MEHA 4XYOA 1GOZA 5KGUA 1DZ1A 5M5WB 1STBA 2F0KA 1FGBD 4PMCA 4OL7A 1C8CA 4A3FB 2H1EA 5EKLA 1GUWA 3M7GA 5IGBA 5C0XI 2PQEA 4CKCA 3CQZB 3CU7A 4A3KB 4UAIA 4RGOS 5CV4A 1HQRD 4X3SA 4JK1C 4ZUJA 2PO4A 5J22A 1KTKA 3TDQA 5IT9L 4K5XA 1OO9B 4CJ0B 3VR3A 1ZYRC 1RTOA 1CHQD 5JPMC 1ZKOA 5IGFA 1LT4D 4F87A 3D4WA 3R3OA 3KUPA 2IL8A 5C3XA 3ND9A 2XWJB 1DOMA 2L5TA 1HHVA 4DFAA 1WTQA 3Q6SA 1I3QB 1TS4A 2E2JB 4KHVA 3TSSA 3NHHA 3MHBA 3W2DA 1JE4A 2Z1CA 4EQNA 1FNVA 4QF4A 4WORA 4XT3B 2BE5D 5KNBA 4IUUA 3C46A 4IURA 2K03A 1B9NA 2BA1A 3DEOA 3KBXA 2M9VA 2X69A 1JORA 1HUMA 1TWAB 1TR5A 3VR2A 4NP5A 1SDFA 1DYQA 5EKKA 1O7LA 4ULLA 3VYTA 1EEID 1STEA 4LAAA 1IW7D 3T13A 4BS9A 3I91A 2F0WA 4A3JB 1AEXA 1H9MA 1RHPA 1PRTC 3HS0C 2I07B 5KIXA 4C2MB 2O5IC 4CKEA 1PFBA 5A2QE 3SXHA 1EIGA 1EY0A 1R4QB 3Q24A 3S15B 2EY1A 1PTOD 1I4HA 1LT6D 2K01A 4R8NA 2WV6D 4BY1B 5JJZA 1Y1VB 1GUTA 4KD4A 4K5VA 1RF2D 5F2DA 4HR7B 2KECA 2EJFC 1PXUA 3WDNA 2K5QA 4U68A 3OHXC 2K04A 2HUGA 5KYLA 1PDQA 1G8ZD 1WTPA 4RCOA 4KN7C 1SEBD 3SVMA 1PLFA 3OWEB 3FPPA 5C4JB 3BYTB 2Q8TA 1Q12A 2SOBA 4BA2I 2AWOA 4DA2A 2MP1A 3HOYB 4KK7A 3NTHA 5DM73 2JP1A 4G7HC 3DMUA 5KEEA 2ZXPA 3U9SA 4M8AA 2R93B 5D14A 1CI3M 3Q0AA 5K36H 2L4NA 3NSWA 1A3UA 4RCNA 1SNQA 3OMGA 2A68D 1I4GA 4HCEA 4KN4C 3BS1A 2EPBA 1VMCA 5ELCA 3GTJB 2VB2X 3D4RA 1KDBA 1SYFA 4KKSA 2F3WA 1M4VA 2EJMA 3DHQA 3QJYA 3SK4A 1SBBB 2XSCA 2JA5B 2D5DA 5ELBA 4Y7NB 2F0SA 5JVH3 2O4XA 3BDCA 4H13C 2B63B 2F0FA 1PFNA 1S5BD 1KNEA 1U9RA 3QOJA 1W6JA 3TP7A 2L9HA 1SJHD 1SNMA 3A7AB 5KRUA 1AP0A 4QCLA 3BVZA 2WINB 3D31A 4IZ8A 2JYOA 5EPJA 4L8JA 3K5NA 3QIAA 1BO0A 1ENFA 2MHVA 4MN3A 1LTAD 1V1OA 1V8QA 3FDTA 1O7ZA 1TY0A 5LL6X 1ML0D 1R9TB 1TS3A 2PZUA 3SK8A 5JOBA 1GUSA 2F0VA 4M1UB 1LTTD 1HCZA 3QOLA 5C0XJ 1S5CD 2IX1A 3SK6A 4UDUC 2EYOA 3KBGA 1H9KA 3P1HA 4L6TB 2HCCA 1SE4A 4KTAA 4BA1I 4ZUIA 2WIIB 1F9RA 3MZ5A 3O13A 1JWSD 4RGMA 1LTRD 5TSSA 1IKMA 3A7LA 3DWPA 5A35A 2NUCA 4IUTA 3MXNA 2J0TD 2EE1A 5CV5A 2K05A 1I50B 1EY4A 2CQAA 1H9SB 4K5WA 4OO1I 3KK7A 4C3IG 1TWCB 1F2MA 3T53B 1H9RA 4DNRB 2SNSA 2WB1B 5COYA 4C56C 1QWYA 3OWFA 3T51B 1EWCA 3TP6A 4F88A 3NPPA 4WJWA 4DAPA 1FNWA 1J8IA 2KCCA 1A15A 5CBEE 2DN8A 4PV1C 3OOCA 1DOKA 1Y8OB 3D6CA 3L9AX 5I9PA 4LMQD 5G3LF 4C3IB 3NWSA 2R92B 3A8JE 1EL0A 2OEOA 2K33A 4K8JA 3K7AB 5CBAE 4XXEA 2BE5C 2NN6G 2Z4HA 1CQVA 2JEAI 1JWUD 3V2TA 2ICIA 1G2SA 5CV7A 1DONA 2WACA 3QO2A 2F0OA 3HEJA 1EWHA 2K32A 1PMRA 3P75A 1TWHB 4EVOA 2AUJD 4B9XA 1IW7C 3GTKB 5FO8B 1LTSD 3R8BA 4CJ1B 1W6KA 4XIGS 1SNOA 2KVMA 2JA6B 3VYUA 2KEEA 4RGNA 3UI2A 3S1RB 4F8MA 1HA5A 2KQ3A 3HG9A 2HCIA 3Q23A 1PTOC 1O78A 3V05A 5J39A 4KMUC 1QOHA 1B53A 1G6ZA 5HGTA 4JBWA 1H9JA 3GV6A 2BOSA 3H3VC 2X6LA 3S2DB 3HRZC 4V0BA 3X3MA 2A6ED 5DAUA 1SSOA 4KY5A 4C3HG 4EGVA 1SYGA 2XIWA 4C3JB 2DY7A 2RVLA 3I4MB 2N55A 1B2TA 1STYA 2RDFA 1Q1EA 3D4DA 1G291 3M85A 2XVSA 4IN3A 3NK9A 4K2KA 4X3KA 1DCZA 1S5FD 5EBDA 2R61A 1SNPA 2MUYA 5IGDA 1F9PA 2NVYB 3R2IA 4ABNA 1STNA 1R4PB 2KUMA 3K59A 1G2TA 1SXTA 1KNAA 4N9TA 5D65A 3OSOA 3GTQB 4IFDG 1PRTB 1FNUA 2RKSA 4A3GB 2A68C 1BQQT 2KJXA 2EYPA 2EYLA 4HCSA 2Q8IB 2PW5A 1U4RA 5BN3A 2QCPX 2YYZA 3DWAA 1D2BA 5LHY1 4G57A 3IFDA 1V1PB 1ILPA 1CA6A 3AU7A 3M4YA 2PPBC 3QWNA 4FF3A 3C1FA 2B2UC 4HN7A 5IGEA 1DOLA 3D6WA 2RSNA 4ZYSA 3HOWB 1SNCA 3ONAB 4ZQ3A 1RKNA 4A93B 1YNJD 2K7VA 2BDNA 2AUKA 1FD7D 1A2TA 3GO5A 2ENBA 2Z8LA 2CHBD 2NYZD 1RODA 4KJOA 4Q0FA 2IWHA 1T5EA 3NXWA 4XQNA 4KI0A 1BR9A 1VMPA 2HDLA 1EFID 1ET9A 1WTRA 4DU9A 1EU3A 4RAUC 3G6JB 3SHLA 4RFBA 1BCPB 4A3MB 4OIKA 4K6DA 1X32A 3BDLA 3AMUA 1CK1A 5G3LD 1MI2A 5BN5A 4RKBA 5EPLA 1RTNA 4IFDJ 4BBRB 1OXSC 3DUZA 1PZID 4ID6A 1ZXTA 3TMEA 2E76C 4NKLA 2LY7A 5T1GA 1EYCA 3PUWA 4HSVA 1ET6A 1PYWD 5FLXL 4KY7A 1CQFA 5M5YB 1T5XD 1D5ZC 1DJRD 4O1NA 1ICWA 3GQBA 1EZ8A 2EJGC 4YIJA 2K28A 3VA7A 4QUCA 2KEDA 4ZKCB 3CRKC 1HUNA 2DNEA 4DK1A 4IUVA 1PZJD 5JEAH 1B50A 1KDCA 1U4LA 2OT2A 3EROA 1Q1BA 1S4ZA 3D8GA 3FRPB 2IPKD 1UAPA 1D6EC 3PIO3 3Q22A 3HOZB 2EXZA 1RDPD 3FVQA 1I4QA 3MC0B 3A56A 2EY2A 5K5PA 1G91A 3A8IE 4RH6A 2L0CA 4XQQA 4F7XA 1XX8A 4HTHA 2DNCA 2HDMA 3S1QB 3MXPA 3LX0A 3HP3A 3HKZB 1S5DD 3ITPA 2F1MA 1EY6A 2QDBA 1MSHA 3S1MB 2OXPA 2PNRC 4DNTB 4FXDA 1LTGD 5K36G 1QJOA 2OF1A 1QNKA 2FINB 5CORA 2F0TA 2AQ2B 5C5LA 2EYJA 1TIID 2X6GA 3PUXA 1ESRA 4DAYA 4WRDA 1BBXC 2NBFA 5EJWA 1L0YB 1Z6HA 2NN6I 1BUVT 2ZXRA 1BCPF 1CHPD 2IW3A 4C1NI 1NR2A 2BCOA 2EYMA 4XQJA 2ZXOA 4KHZA 4K2LA 5C0XH 3C2PA 3GTLB 3T16A 3R93A 1GHJA 1S5ED 4TSSA 5T1IA 4G7OC 1EQTA 2A6EC 5CC4A 2RBMA 2CVRA 2B2WA 4KD3A 1F77A 1CZWA 4R8IA 2F3VA 2MPMA 4ILWA 1SAPA 3BZDB 4DGZA 1JR0D 2WAQB 4X3TA 1SYCA 1TVXA 2BA0A 1I4PA 2NTTA 3TBIB 5IT9E 5I6WA 3HOUB 3ERQA 2KHSA 1HQMC 4DXFA 2L55A 2BDOA 4J6HA 1TS5A 3KLSX 2DY8A 2JA7B 3I8ZA 1F2YA 5C3EB 1TT2A 2K1BA 3S16B 3RD4A 4AYBB 3SK5A 2A74C 2PW7A 2C9OA 5JPNC 2I46A 1E2WA 1IYUA 1U4MA 1PTOH 4ME5A 5J1ZA 3GTMB 2XRSD 3LWUA 2YU9B 3H0GB 3VYSA 3H94A 3JAML 3TN2A 1TWFB 3RMHA 5FLXE 2NVTB 2F0NA 1WTVA 2PYKA 3S9WA 2B8GA 5I2XA 2Y0SB 2M00A 5FO7B 5IGCA 5CV8A 1L0XB 4HMJA 4FF1A 2K6AA 4G7ZC 2IX0A 1YNJC 3QG1A 4TRDA 2L1BA 2B2YA 4IFDI 2RDHA 2L12A 1ONLA 2MGSA 2B2UA 2QKIC 1U4PA 3P7JA 1JB3A 3NBHA 1WTWA 1SYEA 5M9OA 1II3A 1JWMD 4B08A 2VB3X 2QF7A 3HGBA 1DD2A 3ND8A 3CRLC 4ODGA 4XT1B 4XYQA 3EQLC 1XYIA 3V96A 2XWBB 4R9WA 3T56B 1EEFD 2O2LD 2NZ1D 1MBYA 3FKIB 1YNNC 5AFWA 5KNDA 4IUNA 1RD9D 4BY7B 4DN4M 2NTSA 1AFPA 5KNCA 2D9UA 3PO3B 3MTSA 4DK0A 3EA6A 4IQZA 3W3AA 1LLRD 3MFGA 1GJXA 2F0QA 1TU2B 2JXMB 1EIHA 1K8OA 5EKIA 2VXWA 3K5OA 1CZGA 1DXMA 3VA5A 1GUNA 5I4DA 1EZ6A 2N88A 2ID0A 3TP5A 2WP8J 1AW7A 1HA6A 1GHKA 4RHSA 5DEHA 1VF5C 2A69D 2CW0C 3HOXB 1EU4A 1AN8A 1NUCA 2EZVA 2B2WC 3CKIB 1JICA 1QCBD 2NVQB 3OW7A 1KAAA 5DM63 1D5MC 1IHZA 1Z47A 3G7LA 5FK9C 1Y8NB 3E5SA 1F9QA 2A6HD 4A3BB 2M2LA 2F0MA 4CGYB 1NCVA 4RHRA 4HMIA 3MXUA 3J81L 5IOCA 1K83B 2ICEC 1Q3LA 2R7ZB 1JOKA 2FHTA 1D5XC 1OXTA 2FMMA 3K58A 5EPKA 1Y69U 2QEJC 4C3HB 4KJNA 4WFN3 3NE5B 3PIP3 1HTLD 2F4IA 4IUPA 3DM1A 2F0IA 1GXDC 2B2VA 3JAME 3E6ZX 2IX3A 1LTBD 5EGTA 1SFOB 3H91A 4H44C 2IT1A 4ZKBB 3NUCA 2D62A 2XRQD 5D3DA 3PUZA 2F0LA 1KABA 3OPOA 4DAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A15 A;  2KOL A;  1DOM A;  4U68 A;  5CBE E;  1AP0 A;  3LWE A;  2K04 A;  1HFN A;  1HHV A;  3GV3 A;  1S4Z A;  3MWY W;  5T1I A;  1DOK A;  1MSG A;  2B2Y C;  2HUG A;  1M8A A;  3Q6S A;  2L1B A;  1WTQ A;  1WD1 A;  2B2W C;  1EQT A;  1SSO A;  2Q8R E;  2B2Y A;  1JIC A;  2JYO A;  2CVR A;  1F9S A;  5EPJ A;  1PDQ A;  2B2W A;  4LMQ D;  1WVL A;  1BO0 A;  1WTP A;  2NYZ D;  1ROD A;  1RJT A;  2XIW A;  1IL8 A;  3I90 A;  2DY7 A;  2L12 A;  1O7Y A;  2J7Z A;  4MN3 A;  1IKL A;  1PLF A;  2RVL A;  4NW2 A;  5EQ0 A;  3SVM A;  4R8I A;  2MGS A;  2B2U A;  1O7Z A;  2MPM A;  3FDT A;  4XDX A;  2Q8T A;  1EL0 A;  1ML0 D;  1SAP A;  2N55 A;  1B3A A;  3F2U A;  4HED A;  1JE4 A;  1U4P A;  4X3T A;  3P7J A;  1TVX A;  1AZP A;  1B2T A;  1X3Q A;  2HDL A;  1VMP A;  1WTW A;  2SDF A;  5CBA E;  4XT3 B;  2B2T C;  2EOT A;  1WTR A;  2B2T A;  3N52 A;  4IUU A;  4RAU C;  2R3Z A;  2FFK B;  1G91 A;  4MHE A;  4IUR A;  2K03 A;  1ILQ A;  2MP1 A;  4X3K A;  3G7L A;  4ZAI A;  3DEO A;  1BNZ A;  1PFM A;  3KBX A;  1AZQ A;  3IL8 A;  1QG7 A;  1G2S A;  1F9Q A;  1XX8 A;  4OIK A;  2X69 A;  1DON A;  1X32 A;  2DY8 A;  3QO2 A;  2M2L A;  1F9P A;  1X3P A;  2HDM A;  3I8Z A;  2JP1 A;  1MI2 A;  1CM9 A;  2K1B A;  1NCV A;  1HUM A;  2HCC A;  2KUM A;  1G2T A;  1KNA A;  1F2L A;  4OIJ A;  4XT1 B;  5D65 A;  4RWS C;  1XYI A;  5DNF A;  5EPL A;  1RTN A;  3DEP A;  1SDF A;  4R9W A;  3HP3 A;  5D14 A;  2NZ1 D;  1F9R A;  1Q3L A;  1ZXT A;  3TZD A;  1O80 A;  1B4O A;  2L4N A;  5AFW A;  2FHT A;  1U4M A;  4RA8 A;  5T1G A;  5E4X A;  4DN4 M;  3I91 A;  1DZ1 A;  2FMM A;  2FJ2 A;  5EPK A;  1HRJ A;  2NWG A;  1MSH A;  4HSV A;  5CMD A;  4QUF A;  1C8C A;  4CJ1 B;  1IKM A;  1LV9 A;  2D9U A;  4O42 A;  2EPB A;  2H1E A;  1RHP A;  4CJ2 C;  1NR4 A;  2KVM A;  1GUW A;  1QNK A;  1VMC A;  1WD0 A;  2MJ8 A;  2FIN B;  3MTS A;  4HCS A;  4IUT A;  5COR A;  1U4R A;  3TN2 A;  2EE1 A;  2B2V C;  4ZLT F;  2K05 A;  1NAP A;  1ICW A;  3DM1 A;  4IUP A;  1PFB A;  4UAI A;  2KEE A;  3UI2 A;  2B2V A;  1EIH A;  5EKI A;  3FPU B;  3IFD A;  2VXW A;  2X6G A;  1EIG A;  1CA5 A;  2RSO A;  4X3S A;  2K28 A;  1ESR A;  4QUC A;  1WTO A;  1ILP A;  1EOT A;  1BBX C;  1CA6 A;  2HCI A;  5EJW A;  1WTV A;  1J9O A;  2KED A;  4ZKC B;  2K01 A;  1MGS A;  1WTX A;  5E4W C;  2N88 A;  3H91 A;  5COY A;  4IUQ A;  5JJZ A;  1QE6 A;  4ZK9 B;  4ZKB B;  2B2U C;  1HUN A;  4CJ0 B;  1DOL A;  1NR2 A;  2RSN A;  3D6W A;  1B53 A;  1PFN A;  1G6Z A;  1HFG A;  1HA6 A;  1RTO A;  4X3U A;  3ONA B;  1KNE A;  2L11 A;  3GV6 A;  3I3C A;  4IUV A;  1B50 A;  1J8I A;  1BF4 A;  3KUP A;  1U4L A;  2KEC A;  1E0B A;  2X6L A;  4HAE A;  2IL8 A;  2RA4 A;  2L9H A;  3R93 A;  2BDN A; 
#chains in the Genus database with same CATH topology
 3HFZ B;  3PUY A;  5C44 G;  1TS2 A;  2TMP A;  4I7Z C;  1KLG D;  1HFN A;  4PMB A;  2B2Y C;  5C4H A;  1M8A A;  1QNU A;  2R7F A;  2JA8 B;  1MJC A;  2Q8R E;  1TXY A;  2E2I H;  4OO1 H;  4A3C H;  4UHV A;  2F0P A;  4C1N K;  2LKV A;  3MXG A;  3I73 A;  4A3K G;  5M5W H;  3M4O B;  3SDZ A;  4ZRZ A;  1AZP A;  3SEB A;  3KDF B;  4A3F H;  1NNX A;  4QIW B;  2FMC A;  1S3O A;  3KJP A;  1D1I A;  1F2Z A;  2B2T A;  4B3T Q;  3N52 A;  2AQ1 B;  3CQZ H;  2N49 A;  3TS0 A;  4A3K H;  2HHH L;  2JSO A;  1KAW A;  5C44 B;  1PA6 A;  3S2H B;  3PO2 G;  1SJE D;  1E1O A;  1I6H B;  2JE6 I;  2J4X A;  2F0E A;  4TQU S;  4DXG A;  2HQE A;  5J3B A;  1J5E Q;  3M3Y B;  3DEP A;  3CC2 A;  1WCM G;  4GZY C;  2UXD Q;  3TZD A;  1B4O A;  2KA7 A;  4V19 0;  1CT1 D;  5FKA C;  2E2H B;  3IRB A;  1JQY D;  5IYC G;  2F0D A;  3RZD B;  2NWG A;  3GD7 A;  1HPC A;  3CCM A;  4JG2 A;  3NTK A;  3PO2 B;  1E2V A;  1I3Q H;  1STA A;  2F0U A;  5EBC A;  5AJ3 Q;  2E2J H;  2EY6 A;  3I4O A;  1EY8 A;  1JT8 A;  1NMF A;  1SMY D;  3OMC A;  3CCE A;  2JJQ A;  1K8M A;  5FLM H;  2L15 A;  3TP8 A;  4L5T A;  2ZJQ A;  1ZEQ X;  1YNN D;  1X9N A;  4FP5 D;  3IAY A;  5IIF A;  3J80 L;  4QMG A;  1WCM B;  3EJI A;  5NUC A;  1WTX A;  3C3L A;  3N6R A;  2VZA A;  3I70 A;  4ME3 A;  2EDG A;  2OQK A;  3S1N B;  3OIP A;  4GKJ Q;  5I2Y A;  3U4Z A;  1C48 A;  1E3P A;  1TWA H;  4QB4 A;  1P16 A;  1EQV A;  5C6A A;  3K5M A;  1PH7 A;  4A3J G;  3WOF A;  1VQO A;  4CKB A;  3QB3 A;  5JEA G;  4ZCK A;  4DV7 Q;  4DR1 L;  2F0H A;  3BDO A;  3CCU A;  4LUO A;  2V4D A;  4TKO B;  2XGT A;  4NW2 A;  5EQ0 A;  4JYA Q;  2J7Z A;  1N32 L;  1GUO A;  5JAV A;  2JN4 A;  4I65 A;  4DV5 Q;  3S17 B;  4CHT B;  4K14 A;  1B3A A;  4A3J H;  4PQX A;  2CW0 D;  1E24 A;  4YCV A;  2SDF A;  1TY2 A;  1JOQ A;  2EOT A;  3FEW X;  3VR5 A;  4NMZ A;  4OX9 Q;  4XTC S;  3PF4 A;  2HIX A;  3KLR A;  4C2M H;  1Y14 B;  2AWN A;  1Q7Y C;  2K5V A;  3DWQ A;  1PRT F;  2G9D A;  4PZ6 A;  3GP7 A;  3S15 H;  1A3V A;  2RQX A;  4KY6 A;  3J7A V;  1HNX L;  3K5L A;  5ELF A;  1CM9 A;  2VS1 A;  4BY1 H;  1VQH A;  1Y1V H;  4OIJ A;  1SYB A;  2KBN A;  4H7B A;  4RWS C;  2A5H A;  1MD2 D;  2EYH A;  2UXC L;  3RLO A;  1OXU A;  1C4Q A;  3NBI A;  5IP9 H;  3CPW A;  5C4X G;  5E4X A;  4OGQ C;  3EFX D;  1I6V C;  3WOE A;  2SEB D;  3J81 E;  1UEA B;  1NR4 A;  5ELE A;  5JVG 3;  1WD0 A;  1JMC A;  1SE2 A;  3VR4 A;  1LTI D;  4CBV A;  3K6O A;  4DV0 Q;  5C5M A;  1B44 D;  4S3S A;  3E0J A;  1L1O A;  1KD1 C;  2B2V C;  3C1E A;  5C4J H;  4JV5 L;  5CV6 A;  1V43 A;  5HUR A;  2NVX B;  1N34 L;  5CR3 A;  1WTO A;  1BXT A;  2RCF A;  1PH8 A;  1VQK A;  3NQI A;  5C4X B;  4N9P A;  2F0J A;  5CV9 A;  1KQS A;  2RDG A;  1HFG A;  1UWV A;  3HOY H;  2O5J C;  2UUB L;  1Q82 C;  2L11 A;  3D3R A;  1YEZ A;  1G51 A;  4MNO A;  2LFN A;  2VUM G;  2A69 C;  1E0B A;  1XTC D;  2HIV A;  1S40 A;  1SND A;  3GTG B;  4BXX G;  1NSN S;  4A3L H;  5E1F A;  5I9O A;  5JEA J;  3GV3 A;  2IJ0 A;  1MSG A;  1BNZ A;  4DR2 L;  2R93 H;  2CWP A;  4R4O A;  4GS3 A;  3RLF A;  5C0X G;  2K5D A;  1RJT A;  1LT3 D;  3I90 A;  4X66 L;  2D2C C;  5GAH C;  4A3D G;  4K6L A;  3AFQ A;  1UNS A;  3A5Z B;  3PF5 A;  3URY A;  2B3G A;  3A8K E;  3E9H A;  1BCP C;  4LJZ C;  1BOS A;  1X3Q A;  1TKW B;  2JA5 G;  2E74 C;  3BVM A;  2B2T C;  3L7Z C;  3GTJ H;  1SLJ A;  5M3F G;  2VUM B;  1N36 L;  2R3Z A;  1LO5 D;  4MHE A;  1ILQ A;  1PFM A;  3IL8 A;  2JA5 H;  2A6H C;  4FF2 A;  2Z6K A;  4Y7N H;  5M3F H;  3PV0 A;  4B9W A;  3BYY B;  4RGT A;  5CYU A;  3HOV B;  1N32 Q;  3LNN A;  1KLU D;  2WAQ E;  2JQO A;  5ELN A;  4A3D B;  2C5C A;  2Z4I A;  2QIL A;  3CCR A;  2B63 H;  2PZT A;  2DUD A;  3M7N A;  4JBJ A;  1O7I A;  3NQT A;  5CGK A;  3UDX A;  4DV6 L;  4BWG B;  1D1K A;  3U9O A;  2R6G A;  4RA8 A;  5M3F B;  1JB7 A;  2KEN A;  1NJI C;  3R2T A;  2ZT9 C;  4JI0 L;  1EY7 A;  4AQY Q;  1HRJ A;  4QUF A;  2PCF B;  4O42 A;  3Q8D A;  1JE5 A;  1PH4 A;  4DAY B;  2MJ8 A;  3KF6 B;  1XMQ Q;  1SE3 A;  2B39 A;  2G9H D;  1ASZ A;  3J7A F;  4P71 A;  4ZLT F;  5ELO A;  3L2P A;  4JI2 L;  3MAQ A;  1IBK Q;  3ERS X;  4FNF A;  1R9T H;  4DKA C;  1HZC A;  2RSO A;  4IOA A;  3NP8 A;  2UXC Q;  2H5X A;  1B70 B;  1J9O A;  3H6M A;  3KLS A;  4IUQ A;  3T4A C;  1ZYR D;  1TQO A;  3MA2 B;  1H9S A;  2F0G A;  3J80 E;  4X3U A;  1JCK B;  4I7A A;  1W3S A;  3I3C A;  5ISR A;  3GTP B;  3ZYY X;  1IBL L;  2KCN A;  3DXJ C;  1FGU A;  4PMW A;  1PTO B;  4GNX A;  1BF4 A;  2JEB I;  4HAE A;  1LAB A;  1QVC A;  2FJ2 A;  2KOL A;  1YJN A;  2PQA B;  3TQY A;  4NDX A;  4GN5 A;  2GA4 B;  1N34 Q;  1WVL A;  3EVQ A;  3RZO B;  3SE0 A;  3E9I A;  4JBK A;  1VQG A;  2F4V L;  1O7Y A;  1KDA A;  1IKL A;  2PZW A;  1BDO A;  2H4O A;  3VR6 A;  2UU9 Q;  1Y1W B;  3SR1 A;  3RNU A;  3TZU A;  1HTP A;  2PMZ B;  2E5L Q;  4LFB Q;  4WJ3 M;  4EQO A;  1EWI A;  2Q2I A;  2LS0 1;  2WB1 G;  2FFK B;  2MO0 A;  5IOD A;  1I50 H;  4ZAI A;  4YWM A;  4L63 B;  3X3N A;  5M5X B;  5KYI A;  5H1S E;  2MNA A;  1TWC H;  1X3P A;  4J8Q A;  4J1M A;  4DUY L;  1FR3 A;  4X66 Q;  2FXQ A;  3EN2 A;  1F2L A;  1VQ6 A;  3I2Z A;  2E75 C;  1E2Z A;  2AMC B;  5IGG A;  4JI8 L;  1DM0 B;  1O80 A;  3BVG A;  4LF6 L;  1NBW A;  3NTI A;  2UUA Q;  5D3I B;  5FOB B;  4DV3 L;  1E7Z A;  1EY9 A;  4UP9 A;  1LV9 A;  3J80 i;  4LF9 L;  5GAE C;  1PRT D;  4CJ2 C;  4GLV B;  5M3M G;  4LFC L;  2CQO A;  3I56 A;  4X64 L;  4C3I H;  1Z9F A;  1E1T A;  5C3W A;  3CW2 C;  1A2U A;  3I72 A;  1NAP A;  2R92 H;  1W2B A;  3HZX A;  4LF7 Q;  1SMY C;  1CA5 A;  4LWC A;  4KV6 A;  1JOO A;  3K7A H;  4FXG C;  4N8F A;  5GRO A;  4MIU A;  4KHP Q;  4YWL A;  1MGS A;  1Q8I A;  5E4W C;  4PNY A;  4ZK9 B;  1EQQ A;  4A3E B;  5FO9 B;  3J7Y W;  2K5H A;  1ENC A;  4KKU A;  4H0L C;  1SE8 A;  3GTO B;  1QUQ A;  2WKC A;  5M3M B;  2RA4 A;  5CMD A;  3A74 A;  1EY5 A;  3A55 A;  1Q46 A;  4A75 A;  2LMC B;  3LWE A;  1YHQ A;  1TWH H;  4JI2 Q;  5E3F A;  4A3I G;  1IYJ B;  2KCT A;  1VF7 A;  3NBH B;  2JA6 G;  1MIU A;  1CUK A;  2PI2 E;  1IL8 A;  2XN9 C;  3J7Z C;  3G4S A;  2NN6 H;  3VYR A;  1A63 A;  4P2C B;  1ENA A;  3AB9 A;  3H09 A;  3GTK H;  3F2U A;  5ELD A;  4K8I A;  1X3F A;  1SYD A;  4BBS B;  4B3T L;  1IBL Q;  2TSS A;  2JA6 H;  2A73 B;  3K57 A;  3I4N G;  3H15 A;  4G4K A;  4FVM A;  4NXN L;  3S1R H;  1HZ9 A;  1LT5 D;  3K8A A;  1Q90 A;  3PUV A;  2QA4 A;  3T1Y L;  1VDZ A;  3CHB D;  4A3I B;  1VQP A;  2MQH A;  3SGI A;  1EYD A;  4HSP A;  2B8F A;  1BCP D;  2F4V Q;  3AEV A;  1STH A;  1XWE A;  1STG A;  3BG3 A;  1A3T A;  5I6Y A;  2UXD L;  5LL6 S;  1PTO F;  1CFM A;  3RUZ A;  1OXV A;  4JPB W;  4IPG A;  4C3J G;  3S2D H;  4FXK C;  1B9M A;  4NB3 A;  3I4N B;  5A2Q L;  4DAM A;  1MJE A;  1EYA A;  3F8T A;  1VQ7 A;  1QIL A;  1M1K C;  4C3J H;  1XNQ L;  3I4M H;  3FPU B;  4QL5 A;  4JI1 Q;  5IT9 c;  1Y8P B;  3MFY A;  4KKT A;  4U67 3;  1UUP A;  1Z7T A;  4JI8 Q;  4FYD A;  3NWT A;  1EOT A;  1GUG A;  5FJ8 H;  1B1Z A;  1A6X A;  4RKL A;  1QE6 A;  4FO2 A;  1QB5 D;  1I4X A;  2XNA C;  2EYF A;  4DPG A;  4DF7 A;  2A8V A;  2K5W A;  3L3O C;  1RCV D;  4FF4 A;  1V1P A;  2EY5 A;  4DUZ Q;  4GNX C;  2NB0 A;  4LFC Q;  2NVY H;  4B3R L;  2AQ3 B;  4EQP A;  3A54 A;  3RN2 A;  3W1B A;  1UE5 A;  4DV4 Q;  3MWY W;  4DV7 L;  3KF8 A;  1WD1 A;  1ESF A;  3GTQ H;  4Z9C B;  1F9S A;  3PMF A;  2ZM6 L;  1LAC A;  5BN4 A;  2YTY A;  3FMC A;  1LUZ A;  1WI5 A;  4IAL A;  1PV4 A;  1OXX K;  3STB D;  1S72 A;  4XDX A;  5GAG C;  4E6I A;  3NEN A;  4A3G H;  4HED A;  1HXY D;  3IFT A;  1PZK D;  4OO1 G;  2F03 A;  4DR5 L;  1I4R A;  4A3C G;  2VNU D;  3I4L A;  4RMF A;  2E2D C;  4GKK L;  2WKD A;  3K0Y A;  4OWW B;  1LYL A;  3K0X A;  3S14 B;  4OHJ A;  4A3F G;  1CTM A;  1HR0 L;  1AZQ A;  1QG7 A;  4LK1 C;  2SNM A;  4CDE C;  2EVB A;  1IYV A;  5C4Z A;  3OIQ A;  4IFD H;  1TWG B;  2K75 A;  1XXG A;  4A93 G;  1JC7 A;  4Q5V A;  2I5H A;  3IKJ A;  4QJF A;  1VCI A;  3MVV A;  5DNF A;  4QIW E;  4WJ4 A;  3HOW H;  1FYC A;  2E2I B;  2G5D A;  3P20 A;  1KRT A;  3TRZ A;  4A93 H;  3MEH A;  4XYO A;  1GOZ A;  5KGU A;  1PYB A;  1DZ1 A;  5M5W B;  1STB A;  2CFM A;  2F0K A;  3OTO Q;  3KFU A;  1BBU A;  1FGB D;  4IJH A;  4NXN Q;  4PMC A;  1SRO A;  4OL7 A;  1C8C A;  2MO1 A;  4A3F B;  2H1E A;  5EKL A;  3T1Y Q;  3FP9 A;  4DV0 L;  1GUW A;  2DJF C;  3M7G A;  5IGB A;  5C0X I;  2PQE A;  2Q2T A;  4CKC A;  3CCQ A;  3CQZ B;  3CU7 A;  1K0R A;  4A3K B;  4UAI A;  4GOP C;  4RGO S;  5CV4 A;  5IWA Q;  1HQR D;  4X3S A;  4JK1 C;  4ZUJ A;  2PO4 A;  1PH9 A;  5J22 A;  1KTK A;  3TDQ A;  5IT9 L;  2YTV A;  3BJU A;  5FLM G;  5L37 A;  4K5X A;  3NEM A;  1OO9 B;  4CJ0 B;  3VR3 A;  1ZYR C;  4POG A;  4A3M H;  1RTO A;  3CD6 A;  1CHQ D;  5JPM C;  1ZKO A;  5IGF A;  1LT4 D;  4AIM A;  4F87 A;  3D4W A;  3R3O A;  5HY6 A;  5IYB H;  3KUP A;  4DV1 L;  2IL8 A;  3A0J A;  5C3X A;  3DLL A;  3ND9 A;  1XNQ Q;  2XWJ B;  1DOM A;  2L5T A;  2OCE A;  1HHV A;  4DFA A;  4UY8 C;  1WTQ A;  3Q6S A;  4BBR H;  1I3Q B;  1TS4 A;  3UDI A;  2E2J B;  4KHV A;  3TSS A;  3NHH A;  2NZO A;  3MHB A;  3OW2 A;  3W2D A;  3RN5 A;  1JE4 A;  2Z1C A;  4EQN A;  1FNV A;  4HJ9 A;  4DR7 L;  3EBE A;  4QF4 A;  4WOR A;  4JI6 Q;  4XT3 B;  2BE5 D;  5KNB A;  5M5Y H;  1QVG A;  4IUU A;  4B3R Q;  3C46 A;  4IUR A;  3U4V A;  2HD3 A;  2K03 A;  1B9N A;  2BA1 A;  3DEO A;  3DM3 A;  3CCJ A;  3KBX A;  2M9V A;  2X69 A;  3H3V I;  1XPR A;  3G48 A;  2ZM6 Q;  1JOR A;  1FVI A;  1HUM A;  1TWA B;  1K3B C;  1TR5 A;  4LF4 Q;  1N33 L;  3VR2 A;  1SRU A;  4NP5 A;  1SDF A;  1DYQ A;  5EKK A;  1O7L A;  4DR5 Q;  4EX5 A;  4ULL A;  1AE2 A;  3VYT A;  1EEI D;  4BY1 G;  1STE A;  4LAA A;  4GKK Q;  1IW7 D;  1Y1V G;  3T13 A;  4AQY L;  4BS9 A;  1PH6 A;  3I91 A;  1XPU A;  4HJ5 A;  2F0W A;  4A3J B;  1HR0 Q;  1AEX A;  1H9M A;  1RHP A;  2ZTD A;  1XMQ L;  1GO3 E;  1B3Q A;  1PRT C;  2OQ0 A;  3HS0 C;  2I5L X;  5IP9 G;  4FDB A;  2I07 B;  5KIX A;  4C2M B;  2O5I C;  4CKE A;  1PFB A;  5A2Q E;  2Z0S A;  1IBK L;  3M4P A;  3SXH A;  1EIG A;  1EY0 A;  2VW9 A;  3BU2 A;  3HOZ H;  4LW1 A;  1R4Q B;  1YJW A;  3Q24 A;  3S15 B;  2EY1 A;  1PTO D;  1I4H A;  1H95 A;  1U0L A;  1JJC B;  3ZJY C;  1LT6 D;  2K01 A;  4R8N A;  2WV6 D;  4BY1 B;  4B3S L;  5JJZ A;  1Y1V B;  1GUT A;  4JBM A;  1VQF A;  4KD4 A;  1HNW L;  4K5V A;  1RF2 D;  1RIP A;  2XTI A;  3HKZ G;  2JK8 A;  5F2D A;  1L2F A;  4HR7 B;  2KEC A;  2EJF C;  1PXU A;  4J15 A;  3WDN A;  2K5Q A;  3HOY G;  3S1Q H;  4U68 A;  3OHX C;  2K04 A;  2KHI A;  3ER0 A;  2HUG A;  3FHW A;  3F2C A;  1XNR L;  5KYL A;  1PDQ A;  1G8Z D;  1WTP A;  3KLW A;  4RCO A;  4KN7 C;  1SEB D;  3SVM A;  4A3L G;  1PLF A;  3OWE B;  3FPP A;  5C4J B;  3BYT B;  2Q8T A;  1Q12 A;  2UU9 L;  1L0W A;  2R93 G;  2UUC L;  3S1M H;  2SOB A;  2E5L L;  4BA2 I;  4LFB L;  1K3R A;  1CKM A;  1YHB A;  4JI4 Q;  1B8A A;  4DR3 Q;  2AWO A;  4DA2 A;  4QQB X;  4DV1 Q;  1C9O A;  2MP1 A;  3HOY B;  1A0I A;  4OWX B;  2VL6 A;  4KK7 A;  3NTH A;  2AKW B;  5DM7 3;  1SMX A;  4JI7 Q;  4R4Q A;  2Z9H A;  2JP1 A;  4G7H C;  3DMU A;  4OXP A;  2F3I A;  4DV2 Q;  1CKN A;  5KEE A;  2ZXP A;  3U9S A;  4M8A A;  4DK3 C;  2R93 B;  5D14 A;  1CI3 M;  2VY3 A;  4DR7 Q;  3Q0A A;  5K36 H;  2L4N A;  1Q81 C;  2UUA L;  3NSW A;  1A3U A;  4RCN A;  5EAY A;  4L5Q A;  1KL9 A;  1SNQ A;  3GTL H;  4LFA Q;  3OMG A;  1L1O B;  3F2B A;  2B63 G;  2A68 D;  1KC8 C;  4HID A;  1I4G A;  4ALP A;  4HCE A;  4KN4 C;  3BS1 A;  2EPB A;  2DGY A;  1VMC A;  5ELC A;  3GTJ B;  2VB2 X;  3D4R A;  1KDB A;  1SYF A;  4KKS A;  1C0A A;  4LF7 L;  3G6E A;  2F3W A;  1M4V A;  4POF A;  2EJM A;  1N33 Q;  3TS2 A;  3DHQ A;  3QJY A;  3SK4 A;  1SBB B;  2XSC A;  4MTN A;  2QEX A;  4KHP L;  2JA5 B;  2D5D A;  5ELB A;  4Y7N B;  3HOU H;  2F0S A;  5JVH 3;  2O4X A;  3BDC A;  4H13 C;  1YNX A;  2D0O A;  2B63 B;  2F0F A;  1PFN A;  4AYB G;  1S5B D;  5LMN W;  1KNE A;  3J81 j;  1U9R A;  2JA7 H;  3QOJ A;  1W6J A;  3TP7 A;  2L9H A;  1YIT A;  1KIX A;  1SJH D;  1SNM A;  3A7A B;  3S16 H;  5KRU A;  4IOC A;  1AP0 A;  4QCL A;  3BVZ A;  2WIN B;  3D31 A;  4IZ8 A;  2JYO A;  5EPJ A;  3UE0 A;  4L8J A;  3K5N A;  3QIA A;  1BO0 A;  1ENF A;  2MHV A;  4MN3 A;  4B3S Q;  1LTA D;  1V1O A;  1V8Q A;  2CH4 W;  3FDT A;  1O7Z A;  3GTM H;  1TY0 A;  4KLK A;  5LL6 X;  1ML0 D;  2YU9 H;  4UP8 A;  1HJP A;  3H0G H;  1CSQ A;  3STB C;  4IO9 A;  4JC0 A;  1HNW Q;  1R9T B;  1TS3 A;  2PZU A;  3SK8 A;  5JOB A;  1GUS A;  2F0V A;  4M1U B;  1LTT D;  1TWF H;  3CAM A;  3A5U A;  1HCZ A;  1N8R C;  3QOL A;  5C0X J;  1S5C D;  2IX1 A;  4DR6 Q;  2NVT H;  3SK6 A;  4UDU C;  2EYO A;  1WTH A;  3KBG A;  1XNR Q;  4P73 A;  1H9K A;  3P1H A;  4L6T B;  2HCC A;  1SE4 A;  2K5N A;  4KTA A;  4BA1 I;  4ZUI A;  3CMA A;  2PMZ E;  2UUC Q;  2HT1 A;  2WII B;  1F9R A;  3MZ5 A;  3O13 A;  1JWS D;  4LF5 Q;  4RGM A;  4P75 A;  1M90 C;  1NY4 A;  1LTR D;  5TSS A;  4HJ7 A;  3VDY A;  1IKM A;  2YV5 A;  3A7L A;  5HGQ A;  4HIO A;  3DWP A;  5A35 A;  2NUC A;  4IUT A;  3MXN A;  2J0T D;  2EE1 A;  4EQ5 A;  5CV5 A;  2K05 A;  4JI1 L;  1I50 B;  4UP7 A;  1EY4 A;  2CQA A;  1H9S B;  4K5W A;  2EQS A;  2JA9 A;  4OO1 I;  3KK7 A;  4C3I G;  1TWC B;  5IE8 A;  1F2M A;  3T53 B;  1H9R A;  4DNR B;  2ASB A;  2SNS A;  2WB1 E;  4GNX B;  2WB1 B;  5COY A;  2R92 G;  4C56 C;  1QWY A;  3OWF A;  3T51 B;  1EWC A;  1YZ6 A;  3E3X A;  3TP6 A;  4F88 A;  2I0Q A;  3NPP A;  1YHA A;  4WJW A;  4DUZ L;  4DAP A;  1FNW A;  1J8I A;  3FKI G;  4GN4 B;  1VQ9 A;  2KCC A;  1A15 A;  4DV4 L;  1EUJ A;  1HZA A;  5CBE E;  2DN8 A;  4GOP A;  3JC6 6;  4PV1 C;  3OOC A;  1DOK A;  1Y8O B;  3D6C A;  4LUZ A;  3L9A X;  5I9P A;  4LMQ D;  1BKB A;  5G3L F;  4C3I B;  3FKI H;  2QDL A;  3KJO A;  3NWS A;  2R92 B;  4BY7 H;  4L5S A;  3A8J E;  1EL0 A;  2OEO A;  2K33 A;  4K8J A;  4DK6 C;  2E8G A;  3K7A B;  2K14 A;  3PO3 H;  2K50 A;  5CBA E;  4XXE A;  1WFQ A;  1LTL A;  2BE5 C;  2NN6 G;  2Z4H A;  1CQV A;  1X3E A;  2JEA I;  1JWU D;  3V2T A;  2MFI A;  2ICI A;  1G2S A;  5CV7 A;  1DON A;  2WAC A;  3QO2 A;  2F0O A;  1ICF B;  3HEJ A;  3ICE A;  5GAD C;  3HOX G;  4JI3 Q;  1EWH A;  2K32 A;  1PMR A;  3P75 A;  4X65 Q;  1TWH B;  1X65 A;  3CC7 A;  4EVO A;  3EIV A;  3HOX H;  3OTO L;  3LGJ A;  2AUJ D;  3L0O A;  4IPD A;  4B9X A;  1V1Q A;  1IW7 C;  3GTK B;  5FO8 B;  1LTS D;  3R8B A;  1PH2 A;  4CJ1 B;  1J6Q A;  1W6K A;  4XIG S;  4R4C A;  1SNO A;  2KVM A;  2VQF Q;  3CC4 A;  2JA6 B;  3VYU A;  1ASY A;  2F52 A;  2KEE A;  4RGN A;  3UI2 A;  5IWA L;  3S1R B;  4F8M A;  2NVQ H;  4JOI A;  1HA5 A;  2KQ3 A;  3HG9 A;  2HCI A;  1PH3 A;  1QUQ B;  1PTO C;  3Q23 A;  1O78 A;  3I4M G;  4GN3 B;  1UEB A;  3V05 A;  5J39 A;  3CF5 A;  4JI5 Q;  4KMU C;  1HNZ L;  1QOH A;  1B53 A;  1G6Z A;  5HGT A;  4JBW A;  1E22 A;  2C35 B;  1H9J A;  3GV6 A;  5FJ8 G;  2R7Z G;  4A3B H;  2BOS A;  1KRS A;  3H3V C;  1A62 A;  2X6L A;  3S2D B;  3GDE A;  3HRZ C;  4V0B A;  1G6P A;  4OON A;  3X3M A;  1VQN A;  2A6E D;  5DAU A;  1SSO A;  4KY5 A;  4C3H G;  1K83 H;  1CSP A;  4EGV A;  3CP0 A;  1SYG A;  2R7Z H;  2XIW A;  4C3J B;  2DY7 A;  3T1H L;  2RVL A;  3I4M B;  3E0E A;  2N55 A;  1WOC A;  2UXB L;  4JI6 L;  1B2T A;  4C3H H;  1SR3 A;  1STY A;  1XTD A;  2RDF A;  1Q1E A;  2ATW A;  3D4D A;  1G29 1;  3M85 A;  2XVS A;  4IN3 A;  4A3G G;  3NK9 A;  4K2K A;  1K8A C;  3M9B A;  4X3K A;  1DCZ A;  1S5F D;  4YHH L;  5EBD A;  2R61 A;  3KDF A;  1SNP A;  4P74 A;  2MUY A;  5IGD A;  4R4I A;  1PH1 A;  1F9P A;  2NVY B;  3R2I A;  5IYD H;  2A19 A;  4ABN A;  4LF4 L;  5LMU Q;  1STN A;  1SFO H;  1R4P B;  2KUM A;  3K59 A;  1G2T A;  1SXT A;  1KNA A;  4N9T A;  5D65 A;  3OSO A;  3U58 A;  2Q2U A;  3UE1 A;  3GTQ B;  1PHJ A;  4IFD G;  5E7N A;  1UE1 A;  1PRT B;  1FNU A;  2RKS A;  5FLX c;  2CWA A;  1X3G A;  4A3G B;  2VQE L;  2A68 C;  3HOW G;  1BQQ T;  2JA8 H;  2KJX A;  2EYP A;  2EYL A;  4HCS A;  2Q8I B;  3HKS A;  3PGZ A;  2PW5 A;  1U4R A;  5BN3 A;  2P5Z X;  4YY3 Q;  2QCP X;  2YYZ A;  1EIF A;  3DWA A;  1D2B A;  1HH2 P;  5LHY 1;  1HZB A;  1UE7 A;  4G57 A;  3IFD A;  5DLQ E;  3M4O H;  2IY5 B;  3AQQ A;  1V1P B;  1ILP A;  1CA6 A;  3U50 C;  4GLX A;  3AU7 A;  3M4Y A;  2PPB C;  2KHJ A;  1X55 A;  3QWN A;  3C1F A;  2B2U C;  4HN7 A;  5IGE A;  4FF3 A;  1DOL A;  3D6W A;  2RSN A;  4ZYS A;  5C44 H;  3S2H H;  4CDD C;  3HOW B;  1K0S A;  1SNC A;  3KF8 B;  3ONA B;  4ZQ3 A;  1I94 Q;  1LM0 A;  1GM5 A;  1RKN A;  1I6H H;  2AHO B;  4LNQ A;  4QGU A;  4A93 B;  2ALY B;  1YNJ D;  2K7V A;  2BDN A;  2RCN A;  1NMG A;  4A3M G;  1MKH A;  2AUK A;  1FD7 D;  1VQC A;  3M3Y H;  1A2T A;  2WFW A;  3GO5 A;  1K9M C;  5IYB G;  2ENB A;  2Z8L A;  2CHB D;  2CCZ A;  2NYZ D;  1ROD A;  4KJO A;  3W5O A;  4APV A;  4Q0F A;  2IWH A;  2E2H H;  3RZD H;  1HNZ Q;  1T5E A;  3NXW A;  5JJK A;  4XQN A;  4BBR G;  4JI4 L;  4DR3 L;  3PO2 H;  4KI0 A;  1BR9 A;  1VMP A;  2HDL A;  3JAM i;  1EFI D;  1ET9 A;  1WTR A;  4DU9 A;  1EU3 A;  2D0P A;  4RAU C;  3G6J B;  1QVF A;  1QZG A;  3SHL A;  4RFB A;  4RG1 A;  1IBM L;  1BCP B;  3CCS A;  4A3M B;  4OIK A;  4K6D A;  4JI7 L;  4R4T A;  1X32 A;  3BDL A;  1FJG Q;  3AMU A;  1CK1 A;  1WCM H;  5G3L D;  1MI2 A;  5BN5 A;  4O0A A;  3T1H Q;  3K81 C;  4DV2 L;  1EIY B;  4RKB A;  4HJ8 A;  5EPL A;  1VQE A;  1RTN A;  5IYC H;  2UXB Q;  3S1N H;  4IFD J;  4BBR B;  1OXS C;  3DUZ A;  1PZI D;  4ID6 A;  1ZXT A;  2LXJ A;  3TME A;  2E76 C;  4YCU A;  4LFA L;  2OTJ A;  4NKL A;  2LY7 A;  5T1G A;  1EYC A;  3PUW A;  4B3M L;  4HSV A;  4YHH Q;  1K73 C;  1ET6 A;  1PYW D;  5FLX L;  4KY7 A;  1CQF A;  2ZTC A;  5M5Y B;  1T5X D;  1D5Z C;  1DJR D;  4O1N A;  1ICW A;  3S17 H;  3GQB A;  4JOI C;  4OWT B;  1EZ8 A;  2EJG C;  1T9H A;  4YIJ A;  2K28 A;  4HJA A;  3VA7 A;  4QUC A;  4PG3 A;  1VQ4 A;  3AFP A;  2KED A;  4ZKC B;  3CRK C;  5BR8 Q;  3J7A 5;  2LSS A;  1HUN A;  3HOZ G;  2VQE Q;  2DNE A;  4DK1 A;  1U5K A;  4IUV A;  1PZJ D;  4X62 L;  5JEA H;  1B50 A;  5LMN Q;  1KDC A;  1RL2 A;  1U4L A;  1GKH A;  4NPS A;  1X56 A;  2OT2 A;  3ERO A;  5GQO A;  1IZ6 A;  1Q1B A;  4AH6 A;  1IL2 A;  3AYH B;  1S4Z A;  2OTL A;  3D8G A;  1CKO A;  4N8X 1;  3FRP B;  2IPK D;  1UAP A;  1D6E C;  3CCL A;  1VQL A;  2N78 A;  3PIO 3;  3Q22 A;  3HOZ B;  3RLN A;  2EXZ A;  1EQR A;  2IHF A;  2N3S A;  4NXM L;  1RDP D;  3FVQ A;  1NE3 A;  1I4Q A;  3MC0 B;  3A56 A;  2EY2 A;  5K5P A;  4Y52 H;  1PFS A;  1G91 A;  1C7Y A;  3A8I E;  4RH6 A;  2L0C A;  4XQQ A;  2K4K A;  4F7X A;  4DR6 L;  2HHH Q;  3MEF A;  1XX8 A;  4HTH A;  2NVX H;  1EOV A;  1V9P A;  2DNC A;  2HDM A;  1KHI A;  4R1J A;  3W1G A;  4X6A H;  2CH4 A;  5C4X H;  3S1Q B;  2Z6B A;  3MXP A;  3CXC A;  3LX0 A;  2RHQ B;  3HP3 A;  3HKZ E;  4LF5 L;  3HKZ B;  3KYH C;  4K0K L;  2ES2 A;  2RHS B;  1S5D D;  3JAM c;  3ITP A;  2F1M A;  3GTG H;  1EY6 A;  1K28 A;  1B7Y B;  2QDB A;  1MSH A;  1IBM Q;  3S1M B;  2OXP A;  2PNR C;  4DNT B;  4FXD A;  1LTG D;  5K36 G;  1QJO A;  2OF1 A;  1QNK A;  2FIN B;  5COR A;  2F0T A;  3PIP A;  2AQ2 B;  5C5L A;  2EYJ A;  2CKZ B;  1TII D;  2X6G A;  3PUX A;  1BBW A;  1ESR A;  1N9W A;  4DAY A;  4WRD A;  3CME A;  2NBF A;  3KF6 A;  1BBX C;  5EJW A;  1L0Y B;  1X54 A;  1Z6H A;  2NN6 I;  1BUV T;  2VUM H;  1YI2 A;  3HOV G;  2ZXR A;  1BCP F;  1CHP D;  2IW3 A;  2WAQ G;  1NR2 A;  4C1N I;  2BCO A;  4BXX H;  1AH9 A;  2EYM A;  4B3M Q;  3K7U C;  1DGS A;  4XQJ A;  3HOU G;  2ZXO A;  4KHZ A;  4K2L A;  5C0X H;  1OTC A;  3C2P A;  3GTL B;  3T16 A;  5JJL A;  2NZH A;  3R93 A;  1GHJ A;  3HOV H;  1S5E D;  3PCO B;  3QR8 A;  1UE6 A;  4TSS A;  4A3D H;  5T1I A;  4QY7 A;  4G7O C;  1EQT A;  2A6E C;  5CC4 A;  2LXK A;  2RBM A;  3J81 i;  2JA7 G;  2CVR A;  4OEM B;  2B2W A;  2PNH A;  2QW7 A;  5C3E G;  2DJG C;  4KD3 A;  1F77 A;  4DR1 Q;  1VQB A;  1CZW A;  3ULJ A;  4R8I A;  2PQA A;  2F3V A;  2MPM A;  4ILW A;  1KXL A;  4LF8 L;  1SAP A;  3BZD B;  1JR0 D;  2WAQ B;  4X3T A;  4DGZ A;  1SYC A;  1TVX A;  2BA0 A;  4PZ8 A;  1I4P A;  2NTT A;  4X62 Q;  3TBI B;  5IT9 E;  5I6W A;  3HOU B;  1XPO A;  5C3E H;  3ERQ A;  2KHS A;  1HQM C;  1VQI A;  3H0G G;  4DXF A;  1HR0 W;  3ULL A;  1CKN B;  2L55 A;  2QGQ A;  1WJJ A;  2BDO A;  4J6H A;  1TS5 A;  3KLS X;  2DY8 A;  4JI3 L;  4DR4 L;  2JA7 B;  3I8Z A;  1WYD A;  1NTG A;  1F2Y A;  5C3E B;  1TT2 A;  2K1B A;  2K52 A;  1HNX Q;  4X65 L;  2EIF A;  3S16 B;  3RD4 A;  4AYB E;  3M4Q A;  4AYB B;  1P8L A;  1EFW A;  3SK5 A;  2A74 C;  2PW7 A;  2C9O A;  5JPN C;  4NXM Q;  3GTP H;  2I46 A;  1E2W A;  1IYU A;  1U4M A;  1PTO H;  4ME5 A;  2Y0S G;  5J1Z A;  3GTM B;  2XRS D;  3LWU A;  1QZH A;  4YCW A;  2YU9 B;  4A4I A;  3I7F A;  3H0G B;  4IPH A;  2VQF L;  3VYS A;  4CDC C;  1Y1W G;  1JJG A;  3H94 A;  3JAM L;  4O2D A;  2R7D A;  1BVS A;  3RZO H;  3H3V H;  3TN2 A;  4A76 A;  4YWK A;  1TWF B;  4JCV E;  1GVP A;  3F1Z A;  1I5F A;  4JV5 Q;  1JJ2 A;  1Y1W H;  3RMH A;  5FLX E;  2NVT B;  1VQD A;  1X6O A;  1AE3 A;  2F0N A;  3PQI A;  1WTV A;  2PYK A;  4K0K Q;  4JI5 L;  1VS0 A;  3S9W A;  2B8G A;  5I2X A;  2Y0S E;  2Y0S B;  2M00 A;  2HQL A;  5FO7 B;  5IGC A;  5CV8 A;  4HIM A;  5M5X H;  2V1C C;  1L0X B;  3UDG A;  2UUB Q;  4HMJ A;  4FF1 A;  2I5M X;  2K6A A;  5IY0 A;  4CDF C;  2IX0 A;  4G7Z C;  1YNJ C;  3QG1 A;  3F2D A;  4TRD A;  2L1B A;  2B2Y A;  4IFD I;  4DR2 Q;  2RDH A;  2RF4 A;  2L12 A;  1ONL A;  2MGS A;  2B2U A;  3G71 A;  2QKI C;  3UDF A;  1U4P A;  3P7J A;  1K8G A;  4MTK A;  5IP7 G;  1JB3 A;  3NBH A;  1WTW A;  3ULP A;  1SYE A;  2PI2 A;  1A8V A;  4BY7 G;  3KOJ A;  5M9O A;  1II3 A;  1JWM D;  4A3E G;  1N36 Q;  4B08 A;  3PO3 G;  2VB3 X;  2QF7 A;  3HGB A;  5IP7 H;  2YTX A;  5LMU L;  1SN8 A;  3J81 c;  4JW0 A;  2ZJR A;  1DD2 A;  3ND8 A;  1L1O C;  3CRL C;  4ODG A;  1D8L A;  4A3E H;  4XT1 B;  1PVO A;  4XYQ A;  1Q86 C;  3EQL C;  3PIO A;  1XYI A;  1EYG A;  3V96 A;  2GVA A;  4LF8 Q;  2XWB B;  4R9W A;  3T56 B;  1EEF D;  1XMO L;  3BZC A;  2O2L D;  2NZ1 D;  1MBY A;  3FKI B;  1YNN C;  3GTO H;  2Q2H A;  5AFW A;  5KND A;  5M3M H;  4DV6 Q;  3MXN B;  4IUN A;  1RD9 D;  4BY7 B;  3NEL A;  4DN4 M;  1Q8K A;  2NTS A;  1AFP A;  3TRE A;  5KNC A;  4JI0 Q;  4UPA A;  2D9U A;  4TVA B;  3PO3 B;  2B29 A;  3OYY A;  4PZ7 A;  4BBS G;  3MTS A;  4DK0 A;  3EA6 A;  4IQZ A;  4DR4 Q;  3W3A A;  4YY3 L;  1LLR D;  3MFG A;  1GJX A;  2F0Q A;  1TU2 B;  2JXM B;  1EIH A;  4LUV A;  1K8O A;  5EKI A;  2VXW A;  4GLA C;  3K5O A;  1CZG A;  1DXM A;  3VA5 A;  1GUN A;  5I4D A;  1YIJ A;  4BBS H;  1EZ6 A;  2N88 A;  2N8N A;  2ID0 A;  2GVB A;  3TP5 A;  2WP8 J;  1YVC A;  5JJI A;  2ZJP A;  4GOP B;  1AW7 A;  3S24 A;  1I94 L;  3K80 C;  1HA6 A;  1YJ9 A;  1PYS B;  2A1A A;  1GHK A;  4RHS A;  5DEH A;  1VF5 C;  4A3I H;  2A69 D;  2CW0 C;  1VQ5 A;  3HOX B;  3WWV A;  1EU4 A;  3TEH B;  2IHE A;  1AN8 A;  1NUC A;  3B6Y A;  2EZV A;  2B2W C;  3CKI B;  4A3B G;  1JIC A;  1QCB D;  2Z6K C;  3PSI A;  1J5E L;  3I4N H;  3CCV A;  2NVQ B;  1D7Q A;  3OW7 A;  1KAA A;  5DM6 3;  1D5M C;  1IHZ A;  1Z47 A;  3G7L A;  5FK9 C;  4MZ9 A;  1FJG L;  1Y8N B;  3CPF A;  3E5S A;  1F9Q A;  2A6H D;  1VQ8 A;  2ZTE A;  5AJ3 L;  4JVZ A;  2BH2 A;  4A3B B;  2M2L A;  2F0M A;  4OEL B;  4IPC A;  4CGY B;  4DUY Q;  1NCV A;  1GD7 A;  4RHR A;  4HMI A;  1VQJ A;  3MXU A;  3BZK A;  3J81 L;  5IOC A;  1K83 B;  2ICE C;  1Q3L A;  5IYD G;  2R7Z B;  3I55 A;  1JOK A;  2FHT A;  4DNI A;  3D0F A;  1D5X C;  1OXT A;  4P72 A;  4LF6 Q;  2FMM A;  3K58 A;  2GN5 A;  5EPK A;  1Y69 U;  2QEJ C;  1MHW C;  4DV3 Q;  4H02 A;  4C3H B;  4KJN A;  4GKJ L;  4WFN 3;  4LF9 Q;  3NE5 B;  1YBY A;  3PIP 3;  4IJL A;  3J80 c;  4X64 Q;  1VQM A;  1FL0 A;  1HTL D;  2F4I A;  1PH5 A;  4IUP A;  3DM1 A;  2OWO A;  2F0I A;  1GXD C;  2B2V A;  2JA8 G;  3JAM E;  1VQA A;  1XMO Q;  5BR8 L;  2BH8 A;  2EXD A;  3E6Z X;  2IX3 A;  1LTB D;  5EGT A;  1SFO B;  4JYA L;  3H91 A;  2KCM A;  1IXR A;  4H44 C;  2IT1 A;  4ZKB B;  4DV5 L;  3S14 H;  3RR5 A;  3NUC A;  2D62 A;  2XRQ D;  5LMN L;  5D3D A;  4L5R C;  3PUZ A;  2F0L A;  1KAB A;  3OPO A;  4DAV A;  1TWG H;  4HIK A;  4OX9 L;  1XJV A; 
#chains in the Genus database with same CATH homology
 3PUY A;  1TS2 A;  2TMP A;  4I7Z C;  1KLG D;  1HFN A;  4PMB A;  2B2Y C;  5C4H A;  1M8A A;  1QNU A;  2JA8 B;  2Q8R E;  4OO1 H;  4C1N K;  2F0P A;  2LKV A;  3MXG A;  3I73 A;  3M4O B;  3SDZ A;  4ZRZ A;  1AZP A;  3SEB A;  4QIW B;  2FMC A;  1D1I A;  1F2Z A;  2B2T A;  3N52 A;  2AQ1 B;  2JSO A;  5C44 B;  3S2H B;  1SJE D;  1I6H B;  2JE6 I;  2J4X A;  2F0E A;  4TQU S;  4DXG A;  2HQE A;  3M3Y B;  3DEP A;  4GZY C;  3TZD A;  1B4O A;  2KA7 A;  4V19 0;  1CT1 D;  5FKA C;  2E2H B;  1JQY D;  2F0D A;  3RZD B;  2NWG A;  3GD7 A;  1HPC A;  3NTK A;  3PO2 B;  1E2V A;  1STA A;  2F0U A;  5EBC A;  2EY6 A;  1EY8 A;  1SMY D;  3OMC A;  1K8M A;  3TP8 A;  1ZEQ X;  1YNN D;  3IAY A;  4FP5 D;  5IIF A;  3J80 L;  4QMG A;  1WCM B;  3EJI A;  5NUC A;  1WTX A;  3C3L A;  3N6R A;  3I70 A;  2EDG A;  3S1N B;  3OIP A;  5I2Y A;  1C48 A;  4QB4 A;  1EQV A;  5C6A A;  3K5M A;  3WOF A;  4CKB A;  3QB3 A;  5JEA G;  2F0H A;  3BDO A;  2V4D A;  4TKO B;  4NW2 A;  5EQ0 A;  2J7Z A;  1GUO A;  5JAV A;  4I65 A;  3S17 B;  4CHT B;  4K14 A;  1B3A A;  4PQX A;  2CW0 D;  2SDF A;  1TY2 A;  1JOQ A;  2EOT A;  3FEW X;  3VR5 A;  4NMZ A;  4XTC S;  3KLR A;  2AWN A;  3DWQ A;  1PRT F;  2G9D A;  3GP7 A;  1A3V A;  2RQX A;  4KY6 A;  3J7A V;  3K5L A;  5ELF A;  1CM9 A;  4OIJ A;  1SYB A;  4H7B A;  4RWS C;  2A5H A;  1MD2 D;  2EYH A;  1OXU A;  1C4Q A;  3NBI A;  5E4X A;  4OGQ C;  3EFX D;  1I6V C;  3WOE A;  2SEB D;  3J81 E;  1UEA B;  1NR4 A;  5ELE A;  5JVG 3;  1WD0 A;  1SE2 A;  3VR4 A;  1LTI D;  4CBV A;  3K6O A;  5C5M A;  1B44 D;  4S3S A;  3E0J A;  2B2V C;  3C1E A;  5CV6 A;  1V43 A;  5HUR A;  2NVX B;  5CR3 A;  1WTO A;  1BXT A;  3NQI A;  5C4X B;  4N9P A;  2F0J A;  5CV9 A;  2RDG A;  1HFG A;  2O5J C;  2L11 A;  3D3R A;  2LFN A;  2A69 C;  1E0B A;  1XTC D;  1SND A;  3GTG B;  1NSN S;  5E1F A;  5I9O A;  5JEA J;  3GV3 A;  2IJ0 A;  1MSG A;  1BNZ A;  3RLF A;  5C0X G;  2K5D A;  1RJT A;  1LT3 D;  3I90 A;  2D2C C;  4K6L A;  1UNS A;  3URY A;  3A8K E;  1BCP C;  4LJZ C;  1BOS A;  1X3Q A;  1TKW B;  2E74 C;  3BVM A;  2B2T C;  3L7Z C;  2VUM B;  2R3Z A;  1LO5 D;  4MHE A;  1ILQ A;  1PFM A;  3IL8 A;  2A6H C;  4FF2 A;  3PV0 A;  4B9W A;  3BYY B;  4RGT A;  5CYU A;  3HOV B;  3LNN A;  1KLU D;  4A3D B;  2C5C A;  2Z4I A;  2QIL A;  2PZT A;  3M7N A;  3NQT A;  5CGK A;  4BWG B;  1D1K A;  3U9O A;  2R6G A;  4RA8 A;  5M3F B;  3R2T A;  2ZT9 C;  1EY7 A;  1HRJ A;  4QUF A;  2PCF B;  4O42 A;  2MJ8 A;  1SE3 A;  2B39 A;  2G9H D;  3J7A F;  4ZLT F;  3MAQ A;  4FNF A;  2RSO A;  3NP8 A;  1J9O A;  3H6M A;  3KLS A;  4IUQ A;  3T4A C;  1ZYR D;  1TQO A;  3MA2 B;  1H9S A;  2F0G A;  3J80 E;  4X3U A;  1JCK B;  5ISR A;  3I3C A;  3GTP B;  3ZYY X;  2KCN A;  3DXJ C;  4PMW A;  1BF4 A;  1PTO B;  2JEB I;  4HAE A;  1LAB A;  2FJ2 A;  2KOL A;  4NDX A;  2GA4 B;  1WVL A;  3EVQ A;  3RZO B;  3SE0 A;  1O7Y A;  1KDA A;  1IKL A;  2PZW A;  1BDO A;  2H4O A;  3VR6 A;  1Y1W B;  3SR1 A;  3TZU A;  1HTP A;  2PMZ B;  4EQO A;  2LS0 1;  2FFK B;  5IOD A;  4ZAI A;  4L63 B;  3X3N A;  5M5X B;  5KYI A;  1X3P A;  4J8Q A;  4J1M A;  1FR3 A;  1F2L A;  2E75 C;  1E2Z A;  5IGG A;  1DM0 B;  1O80 A;  3BVG A;  3NTI A;  5D3I B;  5FOB B;  1EY9 A;  1LV9 A;  1PRT D;  4CJ2 C;  5C3W A;  1A2U A;  3I72 A;  1NAP A;  3HZX A;  1SMY C;  1CA5 A;  4KV6 A;  1JOO A;  4FXG C;  4MIU A;  1MGS A;  1Q8I A;  5E4W C;  4PNY A;  4ZK9 B;  4A3E B;  5FO9 B;  3J7Y W;  1ENC A;  4KKU A;  4H0L C;  3GTO B;  2WKC A;  5M3M B;  2RA4 A;  5CMD A;  1EY5 A;  3A55 A;  2LMC B;  3LWE A;  5E3F A;  1VF7 A;  1IL8 A;  2XN9 C;  2NN6 H;  3VYR A;  4P2C B;  1ENA A;  3AB9 A;  3H09 A;  3F2U A;  5ELD A;  4K8I A;  1SYD A;  4BBS B;  2TSS A;  2A73 B;  3K57 A;  4G4K A;  4FVM A;  1LT5 D;  1Q90 A;  3PUV A;  1VDZ A;  3CHB D;  4A3I B;  1EYD A;  4HSP A;  2B8F A;  1BCP D;  1STH A;  1XWE A;  1STG A;  3BG3 A;  1A3T A;  5I6Y A;  5LL6 S;  1PTO F;  1CFM A;  3RUZ A;  1OXV A;  4C3J G;  4FXK C;  1B9M A;  3I4N B;  5A2Q L;  1EYA A;  1QIL A;  3FPU B;  1Y8P B;  3MFY A;  4KKT A;  4U67 3;  1UUP A;  1Z7T A;  4FYD A;  3NWT A;  1EOT A;  1GUG A;  1B1Z A;  1A6X A;  4RKL A;  1QE6 A;  4FO2 A;  1QB5 D;  1I4X A;  2XNA C;  2EYF A;  4DF7 A;  2K5W A;  3L3O C;  1RCV D;  4FF4 A;  1V1P A;  2EY5 A;  2NB0 A;  2AQ3 B;  4EQP A;  3A54 A;  3MWY W;  3KF8 A;  1WD1 A;  1ESF A;  4Z9C B;  1F9S A;  3PMF A;  1LAC A;  5BN4 A;  3FMC A;  4IAL A;  1OXX K;  4XDX A;  4E6I A;  4HED A;  1HXY D;  3IFT A;  1PZK D;  4OO1 G;  2F03 A;  1I4R A;  2VNU D;  3I4L A;  2E2D C;  2WKD A;  3K0Y A;  3S14 B;  4OHJ A;  1CTM A;  1AZQ A;  1QG7 A;  4LK1 C;  2SNM A;  2EVB A;  1IYV A;  5C4Z A;  3OIQ A;  4IFD H;  1TWG B;  1XXG A;  1JC7 A;  4Q5V A;  3IKJ A;  1VCI A;  3MVV A;  5DNF A;  1FYC A;  2E2I B;  3P20 A;  3MEH A;  4XYO A;  1GOZ A;  5KGU A;  1DZ1 A;  5M5W B;  1STB A;  2F0K A;  1FGB D;  4PMC A;  4OL7 A;  1C8C A;  4A3F B;  2H1E A;  5EKL A;  1GUW A;  3M7G A;  5IGB A;  5C0X I;  2PQE A;  4CKC A;  3CQZ B;  3CU7 A;  4A3K B;  4UAI A;  4RGO S;  5CV4 A;  1HQR D;  4X3S A;  4JK1 C;  4ZUJ A;  2PO4 A;  5J22 A;  1KTK A;  3TDQ A;  5IT9 L;  4K5X A;  1OO9 B;  4CJ0 B;  3VR3 A;  1ZYR C;  1RTO A;  1CHQ D;  5JPM C;  1ZKO A;  5IGF A;  1LT4 D;  4F87 A;  3D4W A;  3R3O A;  3KUP A;  2IL8 A;  5C3X A;  3ND9 A;  2XWJ B;  1DOM A;  2L5T A;  1HHV A;  4DFA A;  1WTQ A;  3Q6S A;  1I3Q B;  1TS4 A;  2E2J B;  4KHV A;  3TSS A;  3NHH A;  3MHB A;  3W2D A;  1JE4 A;  2Z1C A;  4EQN A;  1FNV A;  4QF4 A;  4WOR A;  4XT3 B;  2BE5 D;  5KNB A;  4IUU A;  3C46 A;  4IUR A;  2K03 A;  1B9N A;  2BA1 A;  3DEO A;  3KBX A;  2M9V A;  2X69 A;  1JOR A;  1HUM A;  1TWA B;  1TR5 A;  3VR2 A;  4NP5 A;  1SDF A;  1DYQ A;  5EKK A;  1O7L A;  4ULL A;  3VYT A;  1EEI D;  1STE A;  4LAA A;  1IW7 D;  3T13 A;  4BS9 A;  3I91 A;  2F0W A;  4A3J B;  1AEX A;  1H9M A;  1RHP A;  1PRT C;  3HS0 C;  2I07 B;  5KIX A;  4C2M B;  2O5I C;  4CKE A;  1PFB A;  5A2Q E;  3SXH A;  1EIG A;  1EY0 A;  1R4Q B;  3Q24 A;  3S15 B;  2EY1 A;  1PTO D;  1I4H A;  1LT6 D;  2K01 A;  4R8N A;  2WV6 D;  4BY1 B;  5JJZ A;  1Y1V B;  1GUT A;  4KD4 A;  4K5V A;  1RF2 D;  5F2D A;  4HR7 B;  2KEC A;  2EJF C;  1PXU A;  3WDN A;  2K5Q A;  4U68 A;  3OHX C;  2K04 A;  2HUG A;  5KYL A;  1PDQ A;  1G8Z D;  1WTP A;  4RCO A;  4KN7 C;  1SEB D;  3SVM A;  1PLF A;  3OWE B;  3FPP A;  5C4J B;  3BYT B;  2Q8T A;  1Q12 A;  2SOB A;  4BA2 I;  2AWO A;  4DA2 A;  2MP1 A;  3HOY B;  4KK7 A;  3NTH A;  5DM7 3;  2JP1 A;  4G7H C;  3DMU A;  5KEE A;  2ZXP A;  3U9S A;  4M8A A;  2R93 B;  5D14 A;  1CI3 M;  3Q0A A;  5K36 H;  2L4N A;  3NSW A;  1A3U A;  4RCN A;  1SNQ A;  3OMG A;  2A68 D;  1I4G A;  4HCE A;  4KN4 C;  3BS1 A;  2EPB A;  1VMC A;  5ELC A;  3GTJ B;  2VB2 X;  3D4R A;  1KDB A;  1SYF A;  4KKS A;  2F3W A;  1M4V A;  2EJM A;  3DHQ A;  3QJY A;  3SK4 A;  1SBB B;  2XSC A;  2JA5 B;  2D5D A;  5ELB A;  4Y7N B;  2F0S A;  5JVH 3;  2O4X A;  3BDC A;  4H13 C;  2B63 B;  2F0F A;  1PFN A;  1S5B D;  1KNE A;  1U9R A;  3QOJ A;  1W6J A;  3TP7 A;  2L9H A;  1SJH D;  1SNM A;  3A7A B;  5KRU A;  1AP0 A;  4QCL A;  3BVZ A;  2WIN B;  3D31 A;  4IZ8 A;  2JYO A;  5EPJ A;  4L8J A;  3K5N A;  3QIA A;  1BO0 A;  1ENF A;  2MHV A;  4MN3 A;  1LTA D;  1V1O A;  1V8Q A;  3FDT A;  1O7Z A;  1TY0 A;  5LL6 X;  1ML0 D;  1R9T B;  1TS3 A;  2PZU A;  3SK8 A;  5JOB A;  1GUS A;  2F0V A;  4M1U B;  1LTT D;  1HCZ A;  3QOL A;  5C0X J;  1S5C D;  2IX1 A;  3SK6 A;  4UDU C;  2EYO A;  3KBG A;  1H9K A;  3P1H A;  4L6T B;  2HCC A;  1SE4 A;  4KTA A;  4BA1 I;  4ZUI A;  2WII B;  1F9R A;  3MZ5 A;  3O13 A;  1JWS D;  4RGM A;  1LTR D;  5TSS A;  1IKM A;  3A7L A;  3DWP A;  5A35 A;  2NUC A;  4IUT A;  3MXN A;  2J0T D;  2EE1 A;  5CV5 A;  2K05 A;  1I50 B;  1EY4 A;  2CQA A;  1H9S B;  4K5W A;  4OO1 I;  3KK7 A;  4C3I G;  1TWC B;  1F2M A;  3T53 B;  1H9R A;  4DNR B;  2SNS A;  2WB1 B;  5COY A;  4C56 C;  1QWY A;  3OWF A;  3T51 B;  1EWC A;  3TP6 A;  4F88 A;  3NPP A;  4WJW A;  4DAP A;  1FNW A;  1J8I A;  2KCC A;  1A15 A;  5CBE E;  2DN8 A;  4PV1 C;  3OOC A;  1DOK A;  1Y8O B;  3D6C A;  3L9A X;  5I9P A;  4LMQ D;  5G3L F;  4C3I B;  3NWS A;  2R92 B;  3A8J E;  1EL0 A;  2OEO A;  2K33 A;  4K8J A;  3K7A B;  5CBA E;  4XXE A;  2BE5 C;  2NN6 G;  2Z4H A;  1CQV A;  2JEA I;  1JWU D;  3V2T A;  2ICI A;  1G2S A;  5CV7 A;  1DON A;  2WAC A;  3QO2 A;  2F0O A;  3HEJ A;  1EWH A;  2K32 A;  1PMR A;  3P75 A;  1TWH B;  4EVO A;  2AUJ D;  4B9X A;  1IW7 C;  3GTK B;  5FO8 B;  1LTS D;  3R8B A;  4CJ1 B;  1W6K A;  4XIG S;  1SNO A;  2KVM A;  2JA6 B;  3VYU A;  2KEE A;  4RGN A;  3UI2 A;  3S1R B;  4F8M A;  1HA5 A;  2KQ3 A;  3HG9 A;  2HCI A;  3Q23 A;  1PTO C;  1O78 A;  3V05 A;  5J39 A;  4KMU C;  1QOH A;  1B53 A;  1G6Z A;  5HGT A;  4JBW A;  1H9J A;  3GV6 A;  2BOS A;  3H3V C;  2X6L A;  3S2D B;  3HRZ C;  4V0B A;  3X3M A;  2A6E D;  5DAU A;  1SSO A;  4KY5 A;  4C3H G;  4EGV A;  1SYG A;  2XIW A;  4C3J B;  2DY7 A;  2RVL A;  3I4M B;  2N55 A;  1B2T A;  1STY A;  2RDF A;  1Q1E A;  3D4D A;  1G29 1;  3M85 A;  2XVS A;  4IN3 A;  3NK9 A;  4K2K A;  4X3K A;  1DCZ A;  1S5F D;  5EBD A;  2R61 A;  1SNP A;  2MUY A;  5IGD A;  1F9P A;  2NVY B;  3R2I A;  4ABN A;  1STN A;  1R4P B;  2KUM A;  3K59 A;  1G2T A;  1SXT A;  1KNA A;  4N9T A;  5D65 A;  3OSO A;  3GTQ B;  4IFD G;  1PRT B;  1FNU A;  2RKS A;  4A3G B;  2A68 C;  1BQQ T;  2KJX A;  2EYP A;  2EYL A;  4HCS A;  2Q8I B;  2PW5 A;  1U4R A;  5BN3 A;  2QCP X;  2YYZ A;  3DWA A;  1D2B A;  5LHY 1;  4G57 A;  3IFD A;  1V1P B;  1ILP A;  1CA6 A;  3AU7 A;  3M4Y A;  2PPB C;  3QWN A;  4FF3 A;  3C1F A;  2B2U C;  4HN7 A;  5IGE A;  1DOL A;  3D6W A;  2RSN A;  4ZYS A;  3HOW B;  1SNC A;  3ONA B;  4ZQ3 A;  1RKN A;  4A93 B;  1YNJ D;  2K7V A;  2BDN A;  2AUK A;  1FD7 D;  1A2T A;  3GO5 A;  2ENB A;  2Z8L A;  2CHB D;  2NYZ D;  1ROD A;  4KJO A;  4Q0F A;  2IWH A;  1T5E A;  3NXW A;  4XQN A;  4KI0 A;  1BR9 A;  1VMP A;  2HDL A;  1EFI D;  1ET9 A;  1WTR A;  4DU9 A;  1EU3 A;  4RAU C;  3G6J B;  3SHL A;  4RFB A;  1BCP B;  4A3M B;  4OIK A;  4K6D A;  1X32 A;  3BDL A;  3AMU A;  1CK1 A;  5G3L D;  1MI2 A;  5BN5 A;  4RKB A;  5EPL A;  1RTN A;  4IFD J;  4BBR B;  1OXS C;  3DUZ A;  1PZI D;  4ID6 A;  1ZXT A;  3TME A;  2E76 C;  4NKL A;  2LY7 A;  5T1G A;  1EYC A;  3PUW A;  4HSV A;  1ET6 A;  1PYW D;  5FLX L;  4KY7 A;  1CQF A;  5M5Y B;  1T5X D;  1D5Z C;  1DJR D;  4O1N A;  1ICW A;  3GQB A;  1EZ8 A;  2EJG C;  4YIJ A;  2K28 A;  3VA7 A;  4QUC A;  2KED A;  4ZKC B;  3CRK C;  1HUN A;  2DNE A;  4DK1 A;  4IUV A;  1PZJ D;  5JEA H;  1B50 A;  1KDC A;  1U4L A;  2OT2 A;  3ERO A;  1Q1B A;  1S4Z A;  3D8G A;  3FRP B;  2IPK D;  1UAP A;  1D6E C;  3PIO 3;  3Q22 A;  3HOZ B;  2EXZ A;  1RDP D;  3FVQ A;  1I4Q A;  3MC0 B;  3A56 A;  2EY2 A;  5K5P A;  1G91 A;  3A8I E;  4RH6 A;  2L0C A;  4XQQ A;  4F7X A;  1XX8 A;  4HTH A;  2DNC A;  2HDM A;  3S1Q B;  3MXP A;  3LX0 A;  3HP3 A;  3HKZ B;  1S5D D;  3ITP A;  2F1M A;  1EY6 A;  2QDB A;  1MSH A;  3S1M B;  2OXP A;  2PNR C;  4DNT B;  4FXD A;  1LTG D;  5K36 G;  1QJO A;  2OF1 A;  1QNK A;  2FIN B;  5COR A;  2F0T A;  2AQ2 B;  5C5L A;  2EYJ A;  1TII D;  2X6G A;  3PUX A;  1ESR A;  4DAY A;  4WRD A;  1BBX C;  2NBF A;  5EJW A;  1L0Y B;  1Z6H A;  2NN6 I;  1BUV T;  2ZXR A;  1BCP F;  1CHP D;  2IW3 A;  4C1N I;  1NR2 A;  2BCO A;  2EYM A;  4XQJ A;  2ZXO A;  4KHZ A;  4K2L A;  5C0X H;  3C2P A;  3GTL B;  3T16 A;  3R93 A;  1GHJ A;  1S5E D;  4TSS A;  5T1I A;  4G7O C;  1EQT A;  2A6E C;  5CC4 A;  2RBM A;  2CVR A;  2B2W A;  4KD3 A;  1F77 A;  1CZW A;  4R8I A;  2F3V A;  2MPM A;  4ILW A;  1SAP A;  3BZD B;  4DGZ A;  1JR0 D;  2WAQ B;  4X3T A;  1SYC A;  1TVX A;  2BA0 A;  1I4P A;  2NTT A;  3TBI B;  5IT9 E;  5I6W A;  3HOU B;  3ERQ A;  2KHS A;  1HQM C;  4DXF A;  2L55 A;  2BDO A;  4J6H A;  1TS5 A;  3KLS X;  2DY8 A;  2JA7 B;  3I8Z A;  1F2Y A;  5C3E B;  1TT2 A;  2K1B A;  3S16 B;  3RD4 A;  4AYB B;  3SK5 A;  2A74 C;  2PW7 A;  2C9O A;  5JPN C;  2I46 A;  1E2W A;  1IYU A;  1U4M A;  1PTO H;  4ME5 A;  5J1Z A;  3GTM B;  2XRS D;  3LWU A;  2YU9 B;  3H0G B;  3VYS A;  3H94 A;  3JAM L;  3TN2 A;  1TWF B;  3RMH A;  5FLX E;  2NVT B;  2F0N A;  1WTV A;  2PYK A;  3S9W A;  2B8G A;  5I2X A;  2Y0S B;  2M00 A;  5FO7 B;  5IGC A;  5CV8 A;  1L0X B;  4HMJ A;  4FF1 A;  2K6A A;  4G7Z C;  2IX0 A;  1YNJ C;  3QG1 A;  4TRD A;  2L1B A;  2B2Y A;  4IFD I;  2RDH A;  2L12 A;  1ONL A;  2MGS A;  2B2U A;  2QKI C;  1U4P A;  3P7J A;  1JB3 A;  3NBH A;  1WTW A;  1SYE A;  5M9O A;  1II3 A;  1JWM D;  4B08 A;  2VB3 X;  2QF7 A;  3HGB A;  1DD2 A;  3ND8 A;  3CRL C;  4ODG A;  4XT1 B;  4XYQ A;  3EQL C;  1XYI A;  3V96 A;  2XWB B;  4R9W A;  3T56 B;  1EEF D;  2O2L D;  2NZ1 D;  1MBY A;  3FKI B;  1YNN C;  5AFW A;  5KND A;  4IUN A;  1RD9 D;  4BY7 B;  4DN4 M;  2NTS A;  1AFP A;  5KNC A;  2D9U A;  3PO3 B;  3MTS A;  4DK0 A;  3EA6 A;  4IQZ A;  3W3A A;  1LLR D;  3MFG A;  1GJX A;  2F0Q A;  1TU2 B;  2JXM B;  1EIH A;  1K8O A;  5EKI A;  2VXW A;  3K5O A;  1CZG A;  1DXM A;  3VA5 A;  1GUN A;  5I4D A;  1EZ6 A;  2N88 A;  2ID0 A;  3TP5 A;  2WP8 J;  1AW7 A;  1HA6 A;  1GHK A;  4RHS A;  5DEH A;  1VF5 C;  2A69 D;  2CW0 C;  3HOX B;  1EU4 A;  1AN8 A;  1NUC A;  2EZV A;  2B2W C;  3CKI B;  1JIC A;  1QCB D;  2NVQ B;  3OW7 A;  1KAA A;  5DM6 3;  1D5M C;  1IHZ A;  1Z47 A;  3G7L A;  5FK9 C;  1Y8N B;  3E5S A;  1F9Q A;  2A6H D;  4A3B B;  2M2L A;  2F0M A;  4CGY B;  1NCV A;  4RHR A;  4HMI A;  3MXU A;  3J81 L;  5IOC A;  1K83 B;  2ICE C;  1Q3L A;  2R7Z B;  1JOK A;  2FHT A;  1D5X C;  1OXT A;  2FMM A;  3K58 A;  5EPK A;  1Y69 U;  2QEJ C;  4C3H B;  4KJN A;  4WFN 3;  3NE5 B;  3PIP 3;  1HTL D;  2F4I A;  4IUP A;  3DM1 A;  2F0I A;  1GXD C;  2B2V A;  3JAM E;  3E6Z X;  2IX3 A;  1LTB D;  5EGT A;  1SFO B;  3H91 A;  4H44 C;  2IT1 A;  4ZKB B;  3NUC A;  2D62 A;  2XRQ D;  5D3D A;  3PUZ A;  2F0L A;  1KAB A;  3OPO A;  4DAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...