2N55A

Structure of constitutively monomeric cxcl12 in complex with the cxcr4 n-terminus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKCKWCQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for chemokine recognition by a G protein-coupled receptor and implications for receptor activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
molecule keywords Stromal cell-derived factor 1
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2n55A00
2L9HA 1RJTA 2DY8A 4X3UA 1HRJA 3DM1A 4XDXA 1E0BA 1IKMA 2SDFA 1ZXTA 2HCCA 2EPBA 1ILPA 1EIHA 4CJ0B 2X6LA 2L11A 3I90A 2KECA 1KNAA 1NR4A 3KBXA 4UAIA 1C8CA 2IL8A 3DEPA 2MGSA 1EIGA 3FDTA 5EPLA 3GV3A 4HSVA 1AZPA 2X69A 4IUVA 5AFWA 3MWYW 2M2LA 1G2SA 1U4LA 2Q8TA 2JP1A 1ESRA 1VMPA 2JYOA 2KVMA 3Q6SA 2B2VC 3GV6A 1MGSA 5EPKA 4ZAIA 1DOLA 1BO0A 2K1BA 1CA6A 1HUMA 1GUWA 1QE6A 4O42A 1U4MA 1F2LA 1B50A 3IFDA 3I3CA 3I91A 4X3SA 2FHTA 2H1EA 4NW2A 1J9OA 1NR2A 1MI2A 1O7ZA 2B2WC 2FINB 1B4OA 1PDQA 1PFBA 1Q3LA 1X3PA 2KUMA 2MP1A 2XIWA 3D6WA 4RAUC 4IUPA 3TZDA 4MN3A 1F9RA 2B2TA 2X6GA 4U68A 1DZ1A 2MPMA 1M8AA 2K05A 4HEDA 4MHEA 1WD0A 3H91A 1F9SA 1SSOA 4ZLTF 1A15A 4OIKA 2BDNA 3FPUB 1G2TA 2HDMA 5CBEE 4R8IA 5JJZA 3IL8A 5EJWA 1LV9A 2FFKB 3QO2A 5EPJA 2RA4A 3I8ZA 2Q8RE 5CORA 1DONA 4DN4M 1HFNA 1F9QA 5CBAE 2K28A 4IURA 3TN2A 2K03A 1RODA 3MTSA 3G7LA 4XT3B 1WTXA 1J8IA 1WTVA 1CA5A 1ICWA 2B2UA 2L1BA 3LWEA 1G6ZA 1IL8A 1PLFA 1X32A 2KEEA 2DY7A 2MJ8A 3KUPA 1RTOA 2CVRA 1U4RA 1HFGA 1HHVA 1B53A 2N55A 1QG7A 2L4NA 1MSGA 2K01A 2L12A 5EKIA 4QUFA 2NYZD 4QUCA 1WTWA 1AZQA 2B2WA 1WVLA 1KNEA 1DOMA 1TVXA 2EE1A 5COYA 1AP0A 1HUNA 2HCIA 2B2UC 2RSNA 1O7YA 3ONAB 1ML0D 4X3KA 4IUUA 4HCSA 1U4PA 4RWSC 1WTOA 1RTNA 1CM9A 5D65A 1BBXC 1WD1A 1PFNA 2EOTA 4CJ1B 1RHPA 4IUTA 1X3QA 2N88A 3DEOA 4ZK9B 4CJ2C 1JE4A 5DNFA 1NAPA 5T1GA 1B3AA 4ZKCB 2NZ1D 2NWGA 1XYIA 1O80A 1WTPA 2KEDA 4LMQD 1XX8A 2K04A 1G91A 1EL0A 5CMDA 2RSOA 2D9UA 1WTQA 4X3TA 2KOLA 2HDLA 4IUQA 2FJ2A 4R9WA 3HP3A 5E4WC 5D14A 1SDFA 1IKLA 2J7ZA 1VMCA 2R3ZA 3SVMA 3R93A 1DOKA 1EQTA 1S4ZA 3P7JA 5EQ0A 5T1IA 1BF4A 1ILQA 2VXWA 2B2VA 4HAEA 1NCVA 2B2YC 2RVLA 4OIJA 5E4XA 1SAPA 2HUGA 2FMMA 1HA6A 1QNKA 4XT1B 1WTRA 1B2TA 3N52A 2B2YA 4ZKBB 1JICA 1F9PA 3F2UA 1PFMA 4RA8A 1EOTA 1BNZA 1MSHA 3UI2A 2B2TC
chains in the Genus database with same CATH superfamily
3A5ZB 3KJPA 1HRJA 3PF4A 1UNSA 3CCQA 1E0BA 3V2TA 1EY4A 4JI8L 5IYCG 1UE5A 3DWQA 1KABA 1LTRD 2AMCB 4IJLA 2G9HD 3NSWA 4LF5L 5EPLA 3PUWA 2RCNA 4LK1C 3A8KE 1YJNA 2X69A 2R92B 1HNWL 2L5TA 3E6ZX 4IN3A 1QE6A 4JI2L 4DV4L 3N6RA 5KNBA 3OYYA 3K5NA 4RGOS 1EY0A 1PZID 1STNA 5IODA 2MP1A 1PFBA 1P8LA 2P5ZX 2KHSA 1YJ9A 1Q1BA 2IJ0A 2I5MX 4RCNA 1M8AA 5FO9B 3RLFA 3HOXH 4GNXC 2WIIB 1EWCA 4MNOA 3U9SA 5M3MB 4S3SA 5CGKA 1YITA 5CR3A 2ZXPA 2R7ZB 4R4OA 2DGYA 3I73A 2K28A 1JJCB 1G51A 5J1ZA 3M7NA 1F2ZA 3TEHB 1X56A 3PCOB 1OTCA 2RQXA 3P1HA 3H3VC 4G7ZC 1EY6A 1BVSA 4RG1A 3HZXA 4DAPA 1PRTC 4B9WA 1MSGA 2D5DA 4A3IB 1WTWA 3VYUA 1SNOA 1STYA 1TWHH 1QWYA 2A1AA 2XVSA 4K5XA 2QF7A 3T53B 4YHHQ 2WACA 1SYCA 4KHPL 5IP7G 3NUCA 4A3GG 2CQAA 1YHBA 2Z0SA 3GTGB 3DEOA 1SNCA 2EYFA 2MUYA 1VQDA 5DNFA 1TR5A 4J1MA 2NTTA 2ICEC 1PTOD 1STAA 2FJ2A 4KN7C 1LT4D 4WORA 4KD4A 3T13A 3STBD 1VMCA 4DV7L 1XMQQ 5G3LF 4IPDA 5EAYA 2VXWA 3ER0A 4A3BH 3NP8A 4GNXA 3CD6A 5C3EB 5IP9H 3KYHC 3HOVH 1VQAA 2D2CC 2FMMA 2QDLA 3JAMi 1HZCA 1RF2D 5ELCA 2Y0SB 2CH4W 3ULPA 3H3VI 5IWAL 1RJTA 2KCCA 1CT1D 2ZJQA 1XMOL 3LNNA 1AN8A 4WJWA 4PV1C 4ILWA 3JAML 4C3JH 1NMGA 3CXCA 1KL9A 4Y7NB 2Z1CA 4NXML 1PTOF 5I9PA 4V0BA 2B2VC 4PMWA 5M5XH 2EYOA 3BDLA 1K0SA 2O5IC 2F0QA 2RDGA 4LNQA 1VQNA 2KCTA 4A3MH 3NPPA 4AQYQ 1Q3LA 2OCEA 2RHQB 1QCBD 4OWXB 1HR0L 3D3RA 4A3LG 4DV5L 1FJGL 4DNTB 3FPUB 5CBEE 4JVZA 5IT9c 4YHHL 1II3A 2RDHA 2AUKA 3CCVA 4FF2A 2E76C 2K5HA 3RZOH 3S2HH 4G4KA 4BA2I 2K03A 1K8MA 4XT3B 1WTXA 3H09A 4MIUA 2F0JA 2PYKA 3HG9A 3P20A 4OO1G 1L1OA 1X32A 2FXQA 1PYSB 4AYBE 1HHVA 4QUFA 1V1QA 1OXVA 2NYZD 3MVVA 1SYBA 4X62L 1HH2P 1KNEA 1DOMA 4Y52H 3DHQA 1J5EQ 4ULLA 3M4QA 4DAYB 3OW7A 4IFDJ 1PTOH 4BS9A 3J7A5 3GTOH 2VUMB 5LMUL 1PH7A 1O80A 3KF8A 3A8JE 3BDCA 2RDFA 4YWLA 2PNRC 1Y8PB 2BH8A 5M5WB 4GNXB 1TXYA 1KRTA 2WAQB 1EZ8A 3RZOB 2SEBD 1O78A 3QG1A 3GQBA 5C5MA 3OWFA 3K7AB 4X65Q 1X3FA 2F4IA 1SAPA 5DLQE 2XWBB 1B7YB 5HGQA 4BBSB 3NBIA 4POGA 3CQZB 2EVBA 1N36L 2UXCQ 1Z9FA 5DEHA 5GADC 2QGQA 1Q46A 2ID0A 2R93H 4ZQ3A 3GTJH 3CPFA 2JA6H 1E2WA 4KLKA 3PIPA 2KQ3A 4OWWB 1OXXK 1H9MA 4JI7L 2SDFA 4KJOA 1EIHA 3GO5A 1YNNC 2K50A 1RL2A 1T5XD 4HIKA 2X6LA 2VQFQ 3T51B 3U9OA 1XPUA 1CKOA 3UE0A 5E7NA 4QIWE 5DM73 1SYFA 1TWGB 4N9PA 4IOAA 1MD2D 1PTOC 1CZGA 4C3HG 3U58A 1WOCA 2ZXOA 4EQOA 1GHKA 1OO9B 2I5LX 3K0YA 3C3LA 3EJIA 3TSSA 3KJOA 2B2WC 1X3PA 2LKVA 4JC0A 1IBMQ 4OHJA 4YCWA 3PIP3 3GTGH 3GTLB 1DZ1A 1PRTF 3EQLC 1Y1VG 2GN5A 4HJ5A 2Q2TA 1AEXA 1WI5A 1LV9A 1U5KA 1N32L 5IE8A 4GKKL 1TWHB 4BA1I 4TQUS 1Y1VH 3RNUA 1MKHA 1KC8C 2XRSD 4QIWB 3GP7A 1PLFA 1DJRD 5E3FA 4H0LC 4DV7Q 4K2KA 3EBEA 1HFGA 1SEBD 1LTLA 5ELNA 5EKIA 4X6AH 3NTKA 5K36G 1AZQA 3FP9A 4B3MQ 1HZBA 5JEAG 2C35B 5EBDA 2Q8IB 1RTNA 3HKSA 3L3OC 5NUCA 4LF8L 2MHVA 1BBWA 4OX9L 5JVH3 1N34L 4LFBQ 2CW0D 1X3QA 1S5CD 3MEFA 5T1GA 2YV5A 3AMUA 5FLMH 2KEDA 1XX8A 3RZDB 3OMCA 1I6HB 2ATWA 3AFPA 4X3TA 1LTTD 2A73B 3W5OA 4HN7A 2GVBA 5CV8A 3J80E 3WDNA 3P7JA 3FMCA 1CSQA 3J7YW 1SJHD 2SNSA 1KQSA 4LF7Q 4R4CA 2I0QA 1CHQD 2Z8LA 2UUAL 1EY5A 1TS5A 3S16B 4ZKBB 4DR5Q 3JAMc 1BNZA 2F0IA 2EJMA 2EE1A 4LW1A 2F0FA 4JOIC 3DM1A 2A6EC 1D8LA 4XDXA 3HOUH 4DV5Q 1FJGQ 2AWNA 4FDBA 3J7ZC 2UUCL 3T1YL 5C44B 2CWPA 4X64L 4DR4L 2LS01 4TRDA 4NPSA 3HOYG 1Q8KA 2UXBL 3MWYW 4A3DG 1U4LA 5IYCH 4ZAIA 2R92G 1MGSA 1CA6A 3S1NH 1HUMA 1GUSA 2N3SA 2E5LL 2EY1A 1CZWA 4OELB 1ET6A 2EJGC 1MI2A 2XN9C 4K6LA 5I6WA 1B4OA 2JJQA 5C4HA 4EQPA 1KDAA 1KLGD 5TSSA 1Q8IA 3HOWB 4JI4L 2R7DA 1V8QA 4QB4A 4NKLA 4P72A 4QL5A 2MO1A 4GOPB 4K8JA 2KA7A 3PSIA 4DK0A 4A3DH 2EIFA 3MXGA 4KN4C 4NXMQ 1G6ZA 1XWEA 2VB3X 2XTIA 3NQTA 4LF6Q 2NVQB 1WJJA 2N55A 2L4NA 1EYCA 1H9JA 1VS0A 2B8FA 4ODGA 4CHTB 2KBNA 3VR4A 4A3IG 3MFYA 4LF6L 3M4PA 4JI1Q 1I4PA 1UUPA 3W1GA 2NVTB 4G7OC 4JI3L 3HOWH 5GROA 1NMFA 1K3RA 1BQQT 4A3JH 1EIYB 1IKMA 5J3BA 3GTMB 4UHVA 1SFOB 2Z4IA 4LMQD 3TREA 3L0OA 1V1PA 3L7ZC 4B08A 1EU4A 2K5WA 1X6OA 3HOZG 1ONLA 1ESFA 1JWSD 1RKNA 3VR3A 2JN4A 1GUTA 1TS2A 1DYQA 3D4WA 2H4OA 5LMNQ 1ILQA 3PO3B 4NXNQ 1H9KA 3H0GH 2ALYB 1SJED 2EYLA 4HIDA 2UU9Q 4RH6A 1JOKA 3KF6A 3M3YH 1YVCA 1JORA 4K8IA 2NVYB 2VW9A 5CC4A 4LF5Q 2JEAI 1I94Q 1ZXTA 3S16H 2NBFA 4DAYA 1KAWA 4GLAC 1EOVA 5DM63 2KECA 3KBXA 3AQQA 3E9HA 5ELEA 3BU2A 1XNRQ 2EXZA 2Y0SE 4DV2L 2N49A 3F2BA 2DNCA 4A3FG 1HJPA 3KLSX 2EYMA 1I94L 4YY3Q 4A3LH 3KF6B 3MXNB 4O1NA 4KKTA 2CKZB 2V4DA 3I91A 3D0FA 5C0XI 5M3FB 2EYJA 4A3FH 3PUZA 3SK6A 1EIFA 1Y1VB 4L63B 2YYZA 1RDPD 2E74C 3H91A 4LF8Q 4OIKA 4RGNA 2F0PA 1GOZA 3IFTA 2WP8J 4JI2Q 2RA4A 1DONA 1VQCA 4GLXA 1Q12A 1D6EC 2O5JC 4N8X1 1J8IA 1PYWD 5KNDA 2A5HA 3FPPA 4KY7A 3TQYA 5KIXA 3MXNA 1RTOA 2PI2E 4GN3B 4LWCA 3NBHA 3S1QB 2OTJA 5J39A 3S1MH 2C9OA 4A3IH 1WVLA 3ONAB 1UAPA 3R2TA 5I4DA 4DR3L 1V1PB 4DR5L 4A3EB 1XJVA 1HNZL 1KDCA 5FLXc 1O7LA 4LF4L 2ZM6Q 1YIJA 1NY4A 4JI0L 2G9DA 3K6OA 2HDLA 3RR5A 2IX1A 3HOXB 1EWIA 3SGIA 2JA7G 1EY7A 1IBML 5CYUA 1SE2A 4A3GB 2B2YC 4OIJA 2K52A 1CQFA 1F2YA 1SNMA 3M9BA 1SE4A 5C4XH 4OX9Q 1F9PA 3GDEA 1WCMH 2D0PA 5JPNC 2L9HA 4DV0Q 4XQNA 1UE6A 2JA9A 1MHWC 2VQFL 2PZTA 1SYDA 4PMCA 5C4XB 2IX3A 4RMFA 5C0XH 1AW7A 4L5QA 4NMZA 1FR3A 3T4AC 4HR7B 4JG2A 1LT3D 5M3FH 4L8JA 1JR0D 1XPRA 4XQJA 4HSPA 1SE3A 4XTCS 3TP6A 5KGUA 3BZDB 1RCVD 2VB2X 1SN8A 2XIWA 4RAUC 2NN6G 5KNCA 3CW2C 1F9RA 2X6GA 3CAMA 1WD0A 4BY7B 2EY5A 3MXPA 1VQ4A 1U9RA 4DR7L 4LFCL 1HCZA 1NTGA 4FF1A 2TMPA 2CH4A 3PMFA 4QF4A 4HIMA 4K0KL 3HOZH 1B44D 5ELBA 3KDFA 4LAAA 5GAHC 2WAQE 3CP0A 3CCLA 1CA5A 3I4LA 3K81C 3TMEA 2JEBI 1PHJA 3KUPA 1UEAB 4DV1Q 4C3IG 1QG7A 1VF7A 2WAQG 3PO2G 4OEMB 2PZUA 1U4PA 3LGJA 3GTQB 1WD1A 4DXFA 2A69D 2PMZE 5HY6A 4UPAA 1TQOA 3J7AF 4L5SA 2ZTEA 3PQIA 1T9HA 3MEHA 2E2JB 1WTPA 1S72A 4DR6L 2EJFC 1QVGA 3FKIH 3RLNA 1EY9A 4DXGA 1UE7A 5E4WC 3CKIB 1X3GA 2R3ZA 4C3IH 1TWCB 1DOKA 1NE3A 4JI0Q 3PO3G 1XNRL 4M1UB 5ELFA 2E2JH 2B2VA 2AUJD 1CSPA 4A3EG 4XYOA 4YCUA 2RVLA 4PG3A 4FXKC 3UDGA 1EWHA 4HTHA 3SK5A 1YNXA 2KHJA 4XT1B 1B9NA 5KEEA 3N52A 4FVMA 4FXDA 1H9RA 1D5XC 1A0IA 5LL6X 1GO3E 2PPBC 3GTQH 2XSCA 2RCFA 5C0XJ 2DY8A 4P75A 1G8ZD 5JOBA 1H95A 3U50C 3FKIG 3C46A 1KNAA 2DUDA 2K32A 2F0WA 2XRQD 3FHWA 4OO1I 3OOCA 4A3BB 3GV3A 4DA2A 1IBLQ 1ESRA 1AE2A 1PRTB 3E3XA 1A3VA 4EX5A 1R9TH 2UU9L 3IFDA 1PRTD 1Y8OB 4ABNA 3Q22A 1KTKA 4JI3Q 1Y1WH 5IP9G 3HOVG 2Z6BA 1F9SA 1S5FD 4CDFC 4ZLTF 1G2TA 1KRSA 1YZ6A 2K14A 5JJKA 1Q1EA 2GA4B 5IOCA 4C3HB 2OF1A 1TY2A 4TSSA 2Z4HA 2LSSA 1IL8A 1SYGA 1JJGA 2CVRA 2PO4A 4WRDA 1EQVA 2I07B 1S5DD 3STBC 1GJXA 4F87A 3BG3A 4ZUIA 3R3OA 4IPHA 1HXYD 1AP0A 4C56C 5FOBB 4FXGC 5IYDG 1WCMB 5A2QE 4X3KA 1WTOA 1EFID 2PCFB 3IRBA 1TY0A 4HMJA 2HD3A 2K5NA 3UE1A 1TIID 4AYBB 2NZ1D 1XMOQ 3MC0B 4DUZQ 4BXXG 1YJWA 2B29A 4A93B 3TP5A 3HRZC 3HP3A 5HURA 4V190 3R93A 4F7XA 4TKOB 5IY0A 4DUZL 1KLUD 2UXDL 2PZWA 4JBWA 3BVZA 1PTOB 2BA1A 1TWCH 3A56A 3D8GA 4KHPQ 4IPGA 4RCOA 1VQ9A 4BBRB 3I4NH 3G48A 2ASBA 4O0AA 3UI2A 2HT1A 4X3UA 1N33Q 1JOQA 1UWVA 5BN4A 3AB9A 3S1QH 4WJ4A 3SXHA 3A55A 4M8AA 3DUZA 5L37A 3CCEA 1A2UA 4C2MH 4R4IA 4PZ6A 3VR6A 2HHHL 1EU3A 3J80c 2KVMA 4GZYC 1VQBA 1JMCA 2NVXB 2VL6A 3NWSA 1IBLL 3LX0A 1A63A 2H1EA 1I6HH 4GLVB 2NTSA 3WOFA 4BY7G 2VNUD 5GAEC 2NN6H 3JAME 1WFQA 3B6YA 2JQOA 1G6PA 3OPOA 1ZYRD 3SK8A 2VY3A 3IL8A 2VQEL 4LFAL 3QOJA 3R8BA 2EXDA 5CORA 4DR6Q 4DN4M 3J81L 5FO7B 5CBAE 1HQMC 2MO0A 1UE1A 3A7LA 4XYQA 3TN2A 3M3YB 1D1KA 1RODA 3G4SA 3Q24A 2B2UA 4RGMA 2WB1B 2RHSB 1NUCA 3K5MA 5JPMC 2ZJPA 4FP5D 2YTXA 5ELOA 1VQ7A 1JE5A 4ZYSA 3Q0AA 2E2IH 1B53A 1C7YA 4A3MG 2M00A 5K36H 2R61A 3RN2A 1VQ8A 1O7YA 1D7QA 4IUUA 1JCKB 1BBXC 4LUVA 3TS2A 4KHVA 1Q90A 3AEVA 1HTPA 2E2HB 1ENCA 1Y1WG 1IZ6A 1PH6A 3T16A 1VQJA 2BH2A 2K04A 2JA7H 4K0KQ 2N8NA 4HMIA 4DV6L 3S24A 1YNND 1KAAA 3E9IA 4R9WA 1E7ZA 4PNYA 2BE5D 4YWKA 2RKSA 3EROA 4P2CB 3SR1A 1LYLA 4JBJA 1NCVA 4APVA 1B8AA 3KF8B 1TWAH 3X3MA 3NXWA 3CMAA 2JA8H 3BYTB 1EOTA 1DGSA 3O13A 4CDDC 4A93G 4J8QA 3I55A 4Y7NH 1TU2B 5M3FG 2Q2IA 4YIJA 2IT1A 5C44G 1E24A 4MZ9A 5A35A 3P75A 2AQ1B 4DNRB 2IL8A 4F88A 3EIVA 4LF9L 4TVAB 1SBBB 4PZ8A 5CV5A 1E2VA 3DMUA 2KENA 1SNDA 3I56A 1AZPA 3C1FA 4O42A 3ITPA 2UXBQ 1CKNB 2OEOA 4X65L 3SK4A 1EEID 4LFCQ 4GN5A 2F0OA 3CMEA 3D6WA 4IQZA 1ENFA 2ICIA 3HOWG 4A3CH 2B2TA 1FD7D 2K05A 4JI6Q 4JYAL 3S2HB 3ULLA 1A15A 4R8IA 3QWNA 1A6XA 5EPJA 4LUOA 3TS0A 1WTHA 5LL6S 2E2IB 3NTIA 3ERQA 2ZT9C 3GTLH 4JYAQ 1QNUA 2WINB 1QUQB 4RHSA 2VUMG 1VQHA 4G57A 1V9PA 1SXTA 4KI0A 2GVAA 2EZVA 1ZEQX 2L12A 2YU9B 1X65A 4C3IB 3QOLA 3DWAA 4B3SL 4UP9A 4LF4Q 2QKIC 2VS1A 4CGYB 1IW7C 1PH1A 2HQLA 2QEXA 5JAVA 4NP5A 2EOTA 4QJFA 1V1OA 2A74C 3A8IE 5ISRA 4RKBA 1I3QH 1D2BA 3CQZH 3CC4A 1XYIA 3E0JA 4KHZA 1VCIA 2CFMA 1A3TA 2JSOA 1R9TB 1EL0A 1LTAD 5FKAC 3I4MB 3OTOQ 4JBKA 1MJCA 1X54A 3OMGA 3PIO3 4B3SQ 5JJLA 1K0RA 1GHJA 4PZ7A 4OXPA 4DR1Q 2E2DC 4GOPC 3NTHA 1ASYA 4A3GH 4XXEA 2OQKA 1YI2A 1GUNA 3RZDH 3M4YA 4RGTA 3HKZG 2HUGA 5LMUQ 1VQ5A 3GTKB 5I9OA 5M5YH 3HOUG 3A0JA 2B2YA 2SNMA 4BBRG 1VQOA 3KLRA 1TWFB 1H9SA 4CKBA 3VR5A 2MFIA 1HZ9A 3A5UA 3PUVA 3J80L 5D3IB 4NB3A 2C5CA 2CHBD 3W2DA 4B9XA 2Q2HA 1B1ZA 2MGSA 1TKWB 1IYJB 5FJ8H 2BDOA 1EFWA 3VA7A 3HOYB 2JP1A 2Q8TA 2G5DA 3K7UC 2RBMA 2K1BA 5K5PA 2QW7A 2K4KA 2J0TD 1PZJD 1B50A 3OTOL 3PIOA 2IW3A 2Q2UA 1GUOA 1T5EA 2A68C 2R92H 2ZTDA 3J81j 3MAQA 5LMNL 3ERSX 4GN4B 1XNQL 1AE3A 1PYBA 3S15B 4JI5L 4MHEA 2F3VA 2BA0A 2KCMA 1I50B 1R4PB 2BDNA 5J22A 5EJWA 1CK1A 4ZUJA 1PH8A 2A8VA 1QVFA 1TWFH 1E1TA 1FNUA 1CKNA 3CC7A 3G7LA 1M90C 1HR0Q 1BCPD 4A3KG 4DV3Q 4IFDH 1SMXA 2KEEA 2QILA 1S5ED 2SOBA 3WWVA 3F2DA 4A75A 1LM0A 1VQEA 2D0OA 5JVG3 2JA8G 1VQLA 1SROA 4DK3C 1VQKA 3OIPA 4DKAC 4JPBW 1CM9A 5D65A 2F3WA 3M85A 2PW7A 4C2MB 5C4ZA 4CJ1B 1VQGA 3I4MH 3A74A 1U0LA 2F0UA 3I70A 4ZKCB 3M7GA 4HJ8A 3S15H 5M9OA 1B3AA 1HNZQ 4U673 1AFPA 2F0TA 4BY1G 5KYLA 3BVGA 3K7AH 2L0CA 1YEZA 3A7AB 4IUNA 3VR2A 5CV4A 4EQ5A 3VYRA 5CMDA 2RSOA 3JC66 3RUZA 3S1RB 3GTPB 3K80C 2YU9H 4KJNA 3TP8A 1FVIA 3HOXG 1IKLA 2WFWA 4CDCC 5IGGA 2F0SA 1S4ZA 1XTDA 3KBGA 4ME5A 2K5VA 4R8NA 3RMHA 1KD1C 5C4JB 1LTBD 4DV4Q 2F0DA 1X9NA 1WTRA 4Q0FA 1QZHA 5FLXL 4FNFA 2K75A 3W3AA 1PFMA 1F2MA 1Y14B 1AH9A 1HQRD 4A4IA 4A93H 2B39A 2YTYA 2F0MA 3GTKH 4DR4Q 3K8AA 5M5YB 1EUJA 1VQPA 1ILPA 1XNQQ 3HOYH 1X3EA 2JA5H 2EDGA 3GTMH 2L11A 3AU7A 4UAIA 2F3IA 3DEPA 5BN3A 4J15A 5C0XG 1SR3A 3EVQA 1R4QB 3HOUB 2JA6B 3ULJA 1G2SA 2L15A 4JV5L 1PA6A 3GTPH 2R93G 2Z6KC 3GV6A 4OWTB 4OGQC 2F1MA 1F2LA 1IL2A 3DWPA 1J9OA 2B63H 1PDQA 3J80i 4A3EH 3K57A 2UUCQ 1ZYRC 2WB1E 4U68A 1STBA 2MPMA 1I3QB 2L55A 1PVOA 1M1KC 4A3BG 2NVYH 4DR3Q 2R6GA 2R7ZG 5IWAQ 2M9VA 4R1JA 3PO2H 1K83B 1K8AC 1WCMG 3BDOA 4C3HH 2E5LQ 4O2DA 1W2BA 3KLSA 2K6AA 3MTSA 3ND8A 1TWAB 5LMNW 1W3SA 4CKCA 5IYBH 1BCPF 4NXNL 3M4OH 1B70B 1HTLD 2MJ8A 1BCPC 1U4RA 3UDFA 4CDEC 1XMQL 1L0XB 2PI2A 3Q8DA 4DR2L 3KLWA 4GKJQ 3MFGA 2RSNA 4R4TA 5I2XA 1ML0D 1K8OA 2QDBA 4LFAQ 2VQEQ 1PFNA 4KKSA 4P71A 4PMBA 2LXKA 2FMCA 1K9MC 5HGTA 1QILA 3RN5A 5FJ8G 1S5BD 1Q82C 4DU9A 1JWMD 2A6HC 1ET9A 1PH5A 5C6AA 3PGZA 2VZAA 1K83H 4IUQA 1KHIA 2IPKD 3TBIB 1E3PA 4POFA 5F2DA 1BBUA 5EBCA 4ALPA 2A6ED 3BYYB 3HKZB 3ND9A 4HAEA 3RLOA 3S9WA 3VYTA 3M4OB 1G291 3D31A 5E4XA 3K59A 4DV3L 4I7ZC 3VYSA 3HS0C 1QB5D 5GAGC 4OO1H 2NZHA 4RA8A 3NWTA 3FKIB 5M5XB 1I4GA 3WOEA 1SYEA 5BR8Q 2BCOA 4HJ9A 1ASZA 1OXUA 3QJYA 1VQ6A 1PH3A 3NQIA 1BXTA 1EIGA 1A3UA 1NSNS 4GS3A 2DJFC 2MQHA 2B63B 1TS4A 1VMPA 4B3RL 4DUYQ 5EPKA 4IOCA 1DOLA 4DK6C 5GQOA 4UDUC 1STHA 3V05A 2JK8A 2FHTA 2FINB 2NVTH 3TZDA 4B3TL 3HOVB 2PMZB 3KDFB 4CKEA 1IBKQ 1ZKOA 2F4VQ 2B3GA 5IGDA 1VQIA 1XXGA 1CTMA 3TP7A 4JK1C 1BKBA 3GD7A 2DJGC 1Y8NB 4C1NK 2PQAB 1N8RC 3CCSA 4A3KB 4IURA 5AJ3Q 4H44C 4RFBA 2AWOA 2ZXRA 4WJ3M 1WTVA 2JA5G 3MA2B 4QY7A 3AYHB 3H94A 3HKZE 3PUXA 2F0EA 3C2PA 1Z6HA 1DXMA 4KK7A 1I4RA 1WYDA 3VA5A 1CUKA 2B2WA 1IW7D 1JJ2A 5M3MH 4DV6Q 4KV6A 2HCIA 1BUVT 1LABA 3PO2B 4RWSC 2I46A 1F77A 4EVOA 3S1RH 1A62A 4AH6A 4DR7Q 4AYBG 3K5OA 2K33A 4C3JG 3T1HQ 2N88A 2WB1G 5G3LD 3SDZA 2UUBQ 1IHZA 3HFZB 2F0GA 1EY8A 4DR1L 1WTQA 3H3VH 3DLLA 3S2DB 1GD7A 4JW0A 3QB3A 2F03A 4I65A 3D6CA 2I5HA 1N9WA 1L0YB 1JB7A 1PH9A 1SNPA 3UDIA 3G6JB 5T1IA 3K5LA 2UUBL 3S17B 2QCPX 1L1OB 1W6JA 3CPWA 1TT2A 1HPCA 1OXSC 4DUYL 4JBMA 1JOOA 2WKDA 1LTGD 4DV0L 3BZCA 1J5EL 1ENAA 1I4HA 1MSHA 2E8GA 2ZM6L 1L2FA 4I7AA 5C3XA 4BY7H 1XTCD 3H0GG 1NNXA 3CC2A 2JA6G 3D4DA 3FDTA 1EQRA 2ES2A 4HSVA 1A8VA 4IUVA 5AFWA 1V43A 2IY5B 3TZUA 3W1BA 1EYDA 3S1MB 3FEWX 3I3CA 2HIVA 4X3SA 4BBRH 1I6VC 4LF9Q 3I4NB 5IP7H 1O7ZA 4R4QA 2UXCL 4MN3A 3QIAA 4KMUC 1LTID 1YNJC 4B3TQ 1SSOA 2N78A 4JI7Q 1N34Q 1YBYA 4L5RC 2HDMA 4MTKA 1STEA 4DF7A 5H1SE 3TRZA 2R7ZH 2NZOA 2Q8RE 5C3WA 3CRKC 5CV6A 1FNVA 3LWEA 4KY6A 1IYVA 5DAUA 3F8TA 1LLRD 4L5TA 3ZJYC 4DGZA 4A3MB 3QR8A 3CCMA 5IT9L 4J6HA 3CRLC 5M3MG 4ZRZA 3NBHB 4DV2Q 4BXXH 4F8MA 1K73C 4XQQA 1Q7YC 1Y1WB 3CCUA 2O4XA 2BOSA 1E2ZA 4K5WA 1NAPA 1EYGA 1P16A 3C1EA 4C1NI 2LY7A 2Y0SG 2F0NA 3I4OA 1SMYD 2CWAA 4OONA 1FGUA 1RIPA 2JXMB 4N9TA 2K7VA 5AJ3L 5D14A 1L1OC 2CQOA 2QEJC 3SEBA 4X62Q 4B3RQ 3V96A 4X66L 1SFOH 1I4QA 3CCRA 1W6KA 5IIFA 1LO5D 2F0KA 5KRUA 4ZCKA 1YHAA 1Q81C 1HZAA 4A3CG 5C3EH 1LT6D 1QNKA 4DK1A 1B2TA 1C9OA 1E22A 4FO2A 1JICA 5IGBA 3F2UA 1HNWQ 2CW0C 2PQAA 3G71A 3HOZB 1D5MC 3S1NB 2HCCA 2EPBA 1C4QA 1STGA 4CJ0B 2AQ3B 1LACA 1C8CA 2LMCB 4AQYL 1MJEA 2E75C 1QOHA 1KDBA 2AKWB 3RD4A 3KOJA 4GKJL 1D1IA 2K5DA 4OL7A 4LJZC 4DR2Q 1B9MA 3URYA 1EQQA 4A76A 4A3JG 1J6QA 1NJIC 3L9AX 3J81c 3SHLA 1VQFA 4NW2A 1MIUA 1JC7A 2WV6D 1PV4A 1PMRA 4IUPA 5D3DA 4HEDA 3PF5A 4JI1L 5CV7A 1RD9D 1PH4A 1N33L 1B3QA 5IYBG 4ME3A 3OW2A 3BJUA 4RKLA 4G7HC 1GM5A 4JV5Q 1VF5C 1QVCA 2K5QA 5CV9A 1D5ZC 4EQNA 3J81i 3AFQA 2HHHQ 3I4NG 5C44H 3E5SA 3BVMA 1UEBA 2A69C 3NELA 3D4RA 4HJ7A 5IGEA 1M4VA 3S17H 5JEAJ 1GVPA 2EY2A 2HIXA 3KFUA 5JEAH 3CCJA 1BOSA 5COYA 2PNHA 1LT5D 2F0HA 1HUNA 5IGFA 3MXUA 2V1CC 3PV0A 4H02A 1PH2A 3S2DH 3J81E 1RHPA 4X64Q 2VUMH 3GTOB 2IWHA 4CJ2C 2WKCA 4JI8Q 1K3BC 3OSOA 1YNJD 1EZ6A 1OXTA 1G91A 2Z9HA 5A2QL 1FNWA 3DM3A 2OQ0A 2KOLA 4P74A 2OXPA 3I2ZA 5EGTA 1X55A 1DCZA 2R7FA 2LXJA 2UUAQ 3F1ZA 2F52A 4KTAA 4YWMA 4DAMA 2JE6I 4YCVA 3TDQA 2D62A 2NVQH 1H9SB 3T56B 3OIQA 4JI4Q 5I2YA 2F0VA 3U4VA 1HR0W 4BY1B 3BZKA 3SE0A 2ENBA 1SRUA 1EYAA 3OWEB 3VDYA 1SLJA 1KIXA 2R93B 1HNXQ 1DM0B 3E0EA 4Q5VA 1MBYA 1S40A 2KHIA 2DNEA 4K14A 5C5LA 1EEFD 1TS3A 4RHRA 3I90A 2CCZA 3OHXC 4KD3A 4LF7L 2UXDQ 4BBSG 2IHEA 4K6DA 4A3FB 1SMYC 3R2IA 2M2LA 4EGVA 2OWOA 3HEJA 3NK9A 3Q6SA 5FLXE 2B63G 4XIGS 1GUWA 3NENA 3EFXD 3J7AV 1U4MA 1O7IA 4WFN3 4QMGA 1NR2A 4MTNA 2HQEA 1JT8A 2KUMA 3K0XA 2ZJRA 1Z47A 2ZTCA 5EKKA 1ICFB 1IXRA 4K2LA 5I6YA 1C0AA 4QQBX 2FFKB 3HGBA 3QO2A 2PW5A 5BN5A 3Q23A 4B3ML 3K58A 1F9QA 1N36Q 4A3JB 3UDXA 4IJHA 1LUZA 1IYUA 1ICWA 2L1BA 4IO9A 5LHY1 3F2CA 1VDZA 3MHBA 2K01A 4X66Q 4UP8A 2PQEA 4GKKQ 4QUCA 4LFBL 4FF3A 1N32Q 2A6HD 1A2TA 4JCVE 4HCEA 5IYDH 2B2UC 1CHPD 4DV1L 3L2PA 4HCSA 1LTSD 4BBSH 2A68D 1TWGH 1FGBD 2IHFA 5FO8B 4IFDG 4JI5Q 1CI3M 1HA5A 1JE4A 2NN6I 2NWGA 2RF4A 1Q86C 1NBWA 1PZKD 2YTVA 5EKLA 3I72A 2MNAA 5IT9E 3GTJB 5FLMG 2NVXH 1SDFA 1I50H 1YHQA 2LFNA 3DXJC 1BF4A 4ID6A 2Z6KA 2XWJB 4KKUA 4QCLA 5BR8L 2EYHA 1HA6A 1GKHA 5C3EG 3T1YQ 1GUGA 4A3DB 4K5VA 1SNQA 3X3NA 4FF4A 1CFMA 3CU7A 4DPGA 5FK9C 2NUCA 2B2TC 3S14B 5M5WH 3KK7A 4PQXA 2H5XA 5C4XG 2O2LD 3H6MA 4KY5A 1JB3A 2TSSA 1NR4A 2KJXA 4H13C 3CF5A 3H0GB 5KYIA 2EQSA 2J4XA 2XGTA 1SE8A 3PUYA 1BDOA 4YY3L 2JYOA 1CQVA 1BO0A 3ZYYX 3FRPB 3LWUA 3U4ZA 2F0LA 2A19A 1K8GA 3A54A 2IX0A 2E2HH 4JI6L 1E1OA 1L0WA 3EN2A 4AIMA 3ICEA 1I5FA 2AQ2B 3EA6A 4QGUA 2EYPA 2OT2A 5JJZA 3G6EA 3PO3H 3S14H 3I8ZA 5ELDA 2QA4A 4UY8C 1JQYD 4P73A 1HFNA 1KXLA 2F4VL 1IBKL 4C3JB 4HJAA 1S3OA 2NB0A 4HIOA 2AHOB 2B8GA 2DY7A 1QUQA 5C4JH 3H15A 3T1HL 3MZ5A 3I7FA 2OTLA 3I4MG 3NEMA 1FYCA 2XNAC 4IZ8A 4FYDA 2JA8B 1BCPB 1JWUD 1TVXA 4N8FA 1HNXL 2KCNA 4CBVA 4NDXA 4IUTA 2JA5B 4ZK9B 3BS1A 4UP7A 4L6TB 4IFDI 5JJIA 5E1FA 1PXUA 4BWGB 1Z7TA 3FVQA 1PFSA 4E6IA 1GXDC 1CKMA 2D9UA 3CHBD 4DFAA 4DAVA 4BY1H 5IGCA 4LUZA 2EY6A 2J7ZA 1C48A 3NHHA 1Y69U 4IPCA 3SVMA 1EQTA 5EQ0A 1BR9A 4IALA 3IKJA 1VQMA 2JA7B 4Z9CB 3NE5B 4H7BA 4JOIA 3IAYA 1QZGA 4DNIA 1K28A 1XPOA 4A3KH 1QJOA 1I4XA 2BE5C 1FL0A 2DN8A 4GOPA 1DD2A
chains in the Genus database with same CATH topology
1HRJA 1UNSA 1E0BA 3V2TA 1EY4A 3DWQA 1KABA 1LTRD 2G9HD 3NSWA 5EPLA 3PUWA 4LK1C 3A8KE 2X69A 2R92B 2L5TA 3E6ZX 4IN3A 1QE6A 3N6RA 5KNBA 3K5NA 4RGOS 1EY0A 1PZID 1STNA 5IODA 2MP1A 1PFBA 2KHSA 1Q1BA 2IJ0A 4RCNA 1M8AA 5FO9B 3RLFA 2WIIB 1EWCA 3U9SA 5M3MB 4S3SA 5CGKA 5CR3A 2ZXPA 2R7ZB 3I73A 2K28A 5J1ZA 3M7NA 1F2ZA 2RQXA 3P1HA 3H3VC 4G7ZC 1EY6A 3HZXA 4DAPA 1PRTC 4B9WA 1MSGA 2D5DA 4A3IB 1WTWA 3VYUA 1SNOA 1STYA 1QWYA 2XVSA 4K5XA 2QF7A 3T53B 2WACA 1SYCA 3NUCA 2CQAA 3GTGB 3DEOA 1SNCA 2EYFA 2MUYA 5DNFA 1TR5A 4J1MA 2NTTA 2ICEC 1PTOD 1STAA 2FJ2A 4KN7C 1LT4D 4WORA 4KD4A 3T13A 1VMCA 5G3LF 2VXWA 3NP8A 5C3EB 2D2CC 2FMMA 1RF2D 5ELCA 2Y0SB 1RJTA 2KCCA 1CT1D 3LNNA 1AN8A 4WJWA 4PV1C 4ILWA 3JAML 4Y7NB 2Z1CA 1PTOF 5I9PA 4V0BA 2B2VC 4PMWA 2EYOA 3BDLA 2O5IC 2F0QA 2RDGA 3NPPA 1Q3LA 1QCBD 3D3RA 4DNTB 3FPUB 5CBEE 1II3A 2RDHA 2AUKA 4FF2A 2E76C 4G4KA 4BA2I 2K03A 1K8MA 4XT3B 1WTXA 3H09A 4MIUA 2F0JA 2PYKA 3HG9A 3P20A 4OO1G 1X32A 1HHVA 4QUFA 1OXVA 2NYZD 3MVVA 1SYBA 1KNEA 1DOMA 3DHQA 4ULLA 3OW7A 4IFDJ 1PTOH 4BS9A 2VUMB 1O80A 3KF8A 3A8JE 3BDCA 2RDFA 2PNRC 1Y8PB 5M5WB 2WAQB 1EZ8A 3RZOB 2SEBD 1O78A 3QG1A 3GQBA 5C5MA 3OWFA 3K7AB 2F4IA 1SAPA 2XWBB 4BBSB 3NBIA 3CQZB 2EVBA 5DEHA 2ID0A 4ZQ3A 1E2WA 2KQ3A 1OXXK 1H9MA 2SDFA 4KJOA 1EIHA 3GO5A 1YNNC 1T5XD 2X6LA 3T51B 3U9OA 5DM73 1SYFA 1TWGB 4N9PA 1MD2D 1PTOC 1CZGA 4C3HG 2ZXOA 4EQOA 1GHKA 1OO9B 3K0YA 3C3LA 3EJIA 3TSSA 2B2WC 1X3PA 2LKVA 4OHJA 3GTLB 3PIP3 1DZ1A 1PRTF 3EQLC 1AEXA 1LV9A 1TWHB 4BA1I 4TQUS 2XRSD 4QIWB 3GP7A 1PLFA 1DJRD 5E3FA 4H0LC 4K2KA 1HFGA 1SEBD 5EKIA 3NTKA 5K36G 1AZQA 5JEAG 5EBDA 2Q8IB 1RTNA 5NUCA 3L3OC 2MHVA 5JVH3 2CW0D 1X3QA 1S5CD 5T1GA 3AMUA 2KEDA 1XX8A 3RZDB 3OMCA 1I6HB 4X3TA 1LTTD 2A73B 4HN7A 5CV8A 3J80E 3WDNA 3P7JA 3FMCA 3J7YW 1SJHD 2SNSA 1CHQD 2Z8LA 1EY5A 1TS5A 3S16B 4ZKBB 1BNZA 2F0IA 2EJMA 2EE1A 2F0FA 3DM1A 2A6EC 4XDXA 2AWNA 5C44B 2LS01 4TRDA 3MWYW 1U4LA 4ZAIA 1MGSA 1CA6A 1HUMA 1GUSA 2EY1A 1CZWA 1ET6A 2EJGC 1MI2A 2XN9C 4K6LA 5I6WA 1B4OA 5C4HA 4EQPA 1KDAA 1KLGD 5TSSA 1Q8IA 3HOWB 1V8QA 4QB4A 4NKLA 4K8JA 2KA7A 4DK0A 3MXGA 4KN4C 1G6ZA 1XWEA 2VB3X 3NQTA 2NVQB 2N55A 2L4NA 1EYCA 1H9JA 2B8FA 4ODGA 4CHTB 3VR4A 3MFYA 1I4PA 1UUPA 2NVTB 4G7OC 1IKMA 1BQQT 3GTMB 1SFOB 2Z4IA 4LMQD 1V1PA 3L7ZC 4B08A 1EU4A 2K5WA 1ONLA 1RKNA 1ESFA 3VR3A 1JWSD 1GUTA 1TS2A 1DYQA 3D4WA 2H4OA 1ILQA 3PO3B 1H9KA 1SJED 2EYLA 4RH6A 1JOKA 1JORA 4K8IA 2NVYB 5CC4A 2JEAI 1ZXTA 2NBFA 4DAYA 5DM63 2KECA 3KBXA 5ELEA 2EXZA 2DNCA 3KLSX 2EYMA 4O1NA 4KKTA 2V4DA 3I91A 5C0XI 5M3FB 2EYJA 3PUZA 3SK6A 1Y1VB 4L63B 2YYZA 1RDPD 2E74C 3H91A 4OIKA 4RGNA 2F0PA 1GOZA 3IFTA 2WP8J 2RA4A 1DONA 1Q12A 1D6EC 2O5JC 1J8IA 1PYWD 5KNDA 2A5HA 3FPPA 4KY7A 5KIXA 3MXNA 1RTOA 3S1QB 3NBHA 5J39A 2C9OA 1WVLA 3ONAB 1UAPA 3R2TA 5I4DA 1V1PB 4A3EB 1KDCA 1O7LA 2G9DA 3K6OA 2HDLA 2IX1A 3HOXB 1EY7A 5CYUA 1SE2A 4A3GB 2B2YC 4OIJA 1CQFA 1F2YA 1SNMA 1SE4A 1F9PA 5JPNC 2L9HA 4XQNA 2PZTA 1SYDA 4PMCA 5C4XB 2IX3A 5C0XH 1AW7A 4NMZA 1FR3A 3T4AC 4HR7B 1LT3D 4L8JA 1JR0D 4XQJA 4HSPA 1SE3A 4XTCS 3TP6A 5KGUA 3BZDB 1RCVD 2VB2X 2XIWA 4RAUC 2NN6G 5KNCA 1F9RA 2X6GA 1WD0A 4BY7B 2EY5A 3MXPA 1U9RA 1HCZA 4FF1A 2TMPA 3PMFA 4QF4A 1B44D 5ELBA 4LAAA 1CA5A 3I4LA 3TMEA 2JEBI 3KUPA 1UEAB 4C3IG 1QG7A 1VF7A 2PZUA 1U4PA 3GTQB 1WD1A 4DXFA 2A69D 1TQOA 3J7AF 3MEHA 2E2JB 1WTPA 2EJFC 1EY9A 4DXGA 5E4WC 3CKIB 2R3ZA 1TWCB 1DOKA 4M1UB 5ELFA 2B2VA 2AUJD 4XYOA 2RVLA 4FXKC 1EWHA 4HTHA 3SK5A 4XT1B 5KEEA 1B9NA 3N52A 4FVMA 4FXDA 1H9RA 1D5XC 5LL6X 2PPBC 2XSCA 5C0XJ 2DY8A 1G8ZD 5JOBA 3C46A 1KNAA 2K32A 2F0WA 2XRQD 4OO1I 3OOCA 4A3BB 3GV3A 4DA2A 1ESRA 1PRTB 1A3VA 3IFDA 1PRTD 1Y8OB 4ABNA 3Q22A 1KTKA 1F9SA 1S5FD 4ZLTF 1G2TA 1Q1EA 2GA4B 5IOCA 4C3HB 2OF1A 1TY2A 4TSSA 2Z4HA 1IL8A 1SYGA 2CVRA 2PO4A 4WRDA 1EQVA 2I07B 1S5DD 1GJXA 4F87A 3BG3A 4ZUIA 3R3OA 1HXYD 1AP0A 4C56C 5FOBB 4FXGC 5A2QE 1WCMB 4X3KA 1WTOA 1EFID 2PCFB 1TY0A 4HMJA 1TIID 4AYBB 2NZ1D 3MC0B 4A93B 3TP5A 3HRZC 3HP3A 5HURA 4V190 3R93A 4F7XA 4TKOB 1KLUD 2PZWA 4JBWA 3BVZA 1PTOB 2BA1A 3A56A 3D8GA 4RCOA 4BBRB 3UI2A 4X3UA 1JOQA 5BN4A 3AB9A 3SXHA 3A55A 4M8AA 3DUZA 1A2UA 3VR6A 1EU3A 2KVMA 4GZYC 2NVXB 3NWSA 3LX0A 2H1EA 2NTSA 3WOFA 2VNUD 2NN6H 3JAME 3OPOA 1ZYRD 3SK8A 3IL8A 3QOJA 3R8BA 5CORA 4DN4M 3J81L 5FO7B 5CBAE 1HQMC 3A7LA 4XYQA 3M3YB 3TN2A 1D1KA 1RODA 3Q24A 2B2UA 4RGMA 2WB1B 1NUCA 3K5MA 5JPMC 4FP5D 3Q0AA 4ZYSA 1B53A 2M00A 5K36H 2R61A 1O7YA 4IUUA 1JCKB 1BBXC 4KHVA 1Q90A 1HTPA 2E2HB 1ENCA 3T16A 2K04A 4HMIA 1YNND 1KAAA 4R9WA 4PNYA 2BE5D 2RKSA 3EROA 4P2CB 3SR1A 1NCVA 3X3MA 3NXWA 3BYTB 1EOTA 3O13A 4J8QA 1TU2B 4YIJA 2IT1A 5A35A 3P75A 2AQ1B 4DNRB 2IL8A 4F88A 1SBBB 5CV5A 1E2VA 3DMUA 1SNDA 1AZPA 3C1FA 4O42A 3ITPA 2OEOA 3SK4A 1EEID 2F0OA 3D6WA 4IQZA 1ENFA 2ICIA 2B2TA 1FD7D 2K05A 3S2HB 1A15A 4R8IA 3QWNA 1A6XA 5EPJA 5LL6S 2E2IB 3NTIA 3ERQA 2ZT9C 1QNUA 2WINB 4RHSA 4G57A 1SXTA 4KI0A 2EZVA 1ZEQX 2L12A 2YU9B 4C3IB 3QOLA 3DWAA 2QKIC 4CGYB 1IW7C 5JAVA 4NP5A 2EOTA 1V1OA 2A74C 3A8IE 5ISRA 4RKBA 1D2BA 1XYIA 3E0JA 4KHZA 1VCIA 2JSOA 1A3TA 1R9TB 1EL0A 1LTAD 5FKAC 3I4MB 3OMGA 3PIO3 1GHJA 2E2DC 3NTHA 4XXEA 1GUNA 3M4YA 4RGTA 2HUGA 3GTKB 5I9OA 2B2YA 2SNMA 3KLRA 1TWFB 1H9SA 4CKBA 3VR5A 3PUVA 3J80L 5D3IB 2C5CA 2CHBD 3W2DA 4B9XA 1B1ZA 2MGSA 1TKWB 2BDOA 3VA7A 3HOYB 2JP1A 2Q8TA 2RBMA 2K1BA 5K5PA 2J0TD 1PZJD 1B50A 2IW3A 1GUOA 1T5EA 2A68C 3MAQA 3S15B 4MHEA 2F3VA 2BA0A 1I50B 1R4PB 2BDNA 5J22A 5EJWA 1CK1A 4ZUJA 1FNUA 3G7LA 1BCPD 4IFDH 2KEEA 2QILA 1S5ED 2SOBA 5JVG3 3OIPA 1CM9A 5D65A 2F3WA 3M85A 2PW7A 4C2MB 5C4ZA 4CJ1B 2F0UA 3I70A 4ZKCB 3M7GA 5M9OA 1B3AA 4U673 1AFPA 2F0TA 5KYLA 3BVGA 2L0CA 3A7AB 4IUNA 3VR2A 5CMDA 5CV4A 3VYRA 2RSOA 3RUZA 3S1RB 3GTPB 4KJNA 3TP8A 1IKLA 5IGGA 2F0SA 1S4ZA 3KBGA 4ME5A 4R8NA 3RMHA 5C4JB 1LTBD 2F0DA 1WTRA 4Q0FA 5FLXL 4FNFA 3W3AA 1PFMA 1F2MA 1HQRD 2B39A 2F0MA 5M5YB 1ILPA 2EDGA 2L11A 3AU7A 4UAIA 3DEPA 5BN3A 5C0XG 3EVQA 1R4QB 3HOUB 2JA6B 1G2SA 3GV6A 4OGQC 2F1MA 1F2LA 3DWPA 1J9OA 1PDQA 3K57A 1ZYRC 4U68A 1STBA 2MPMA 1I3QB 2L55A 2R6GA 2M9VA 1K83B 3BDOA 3KLSA 2K6AA 3MTSA 3ND8A 1TWAB 4CKCA 1BCPF 1HTLD 2MJ8A 1BCPC 1U4RA 1L0XB 3MFGA 2RSNA 5I2XA 1ML0D 1K8OA 2QDBA 1PFNA 4KKSA 4PMBA 2FMCA 5HGTA 1QILA 1S5BD 4DU9A 1JWMD 2A6HC 1ET9A 5C6AA 4IUQA 2IPKD 3TBIB 5F2DA 5EBCA 2A6ED 3BYYB 3HKZB 3ND9A 4HAEA 3S9WA 3VYTA 3M4OB 1G291 3D31A 5E4XA 3K59A 4I7ZC 3VYSA 3HS0C 1QB5D 4OO1H 4RA8A 3NWTA 3FKIB 5M5XB 1I4GA 3WOEA 1SYEA 2BCOA 1OXUA 3QJYA 3NQIA 1BXTA 1EIGA 1A3UA 1NSNS 2B63B 1TS4A 1VMPA 5EPKA 1DOLA 4UDUC 1STHA 3V05A 2FHTA 2FINB 3TZDA 3HOVB 2PMZB 4CKEA 1ZKOA 5IGDA 1XXGA 1CTMA 3TP7A 4JK1C 3GD7A 4C1NK 1Y8NB 4A3KB 4IURA 4H44C 4RFBA 2AWOA 2ZXRA 1WTVA 3MA2B 3H94A 3PUXA 2F0EA 3C2PA 1Z6HA 1DXMA 4KK7A 1I4RA 3VA5A 2B2WA 1IW7D 4KV6A 2HCIA 1BUVT 1LABA 3PO2B 4RWSC 2I46A 1F77A 4EVOA 3K5OA 2K33A 4C3JG 2N88A 5G3LD 3SDZA 1IHZA 2F0GA 1EY8A 1WTQA 3S2DB 3QB3A 2F03A 4I65A 3D6CA 1L0YB 1SNPA 3G6JB 5T1IA 3K5LA 3S17B 2QCPX 1W6JA 1TT2A 1HPCA 1OXSC 1JOOA 2WKDA 1LTGD 1ENAA 1I4HA 1MSHA 5C3XA 1XTCD 3D4DA 3FDTA 4HSVA 4IUVA 5AFWA 1V43A 3TZUA 1EYDA 3S1MB 3FEWX 3I3CA 4X3SA 3I4NB 1I6VC 1O7ZA 4MN3A 3QIAA 4KMUC 1LTID 1YNJC 1SSOA 2HDMA 4DF7A 1STEA 2Q8RE 5C3WA 3CRKC 5CV6A 1FNVA 3LWEA 4KY6A 1IYVA 5DAUA 1LLRD 4DGZA 4A3MB 5IT9L 4J6HA 3CRLC 4ZRZA 4F8MA 4XQQA 1Y1WB 2O4XA 2BOSA 1E2ZA 4K5WA 1NAPA 3C1EA 4C1NI 2LY7A 2F0NA 1SMYD 2JXMB 4N9TA 2K7VA 5D14A 2QEJC 3SEBA 3V96A 1I4QA 1W6KA 5IIFA 1LO5D 2F0KA 5KRUA 1LT6D 1QNKA 4DK1A 1B2TA 4FO2A 1JICA 5IGBA 3F2UA 2CW0C 3HOZB 1D5MC 3S1NB 2HCCA 2EPBA 1C4QA 1STGA 4CJ0B 2AQ3B 1LACA 1C8CA 2LMCB 2E75C 1QOHA 1KDBA 3RD4A 1D1IA 2K5DA 4OL7A 4LJZC 1B9MA 3URYA 3L9AX 3SHLA 4NW2A 1JC7A 2WV6D 1PMRA 4IUPA 5D3DA 4HEDA 5CV7A 1RD9D 4RKLA 4G7HC 1VF5C 2K5QA 5CV9A 4EQNA 1D5ZC 3E5SA 3BVMA 2A69C 3D4RA 5IGEA 1M4VA 5JEAJ 2EY2A 5JEAH 1BOSA 5COYA 1LT5D 2F0HA 1HUNA 5IGFA 3MXUA 3PV0A 3J81E 1RHPA 3GTOB 2IWHA 4CJ2C 2WKCA 3OSOA 1YNJD 1EZ6A 1OXTA 1G91A 5A2QL 1FNWA 2KOLA 2OXPA 5EGTA 1DCZA 4KTAA 2JE6I 3TDQA 2D62A 1H9SB 3T56B 3OIQA 5I2YA 2F0VA 4BY1B 3SE0A 2ENBA 1EYAA 3OWEB 2R93B 1DM0B 4Q5VA 1MBYA 2DNEA 4K14A 5C5LA 1EEFD 1TS3A 4RHRA 3I90A 3OHXC 4KD3A 4K6DA 4A3FB 1SMYC 3R2IA 2M2LA 4EGVA 3HEJA 3NK9A 3Q6SA 5FLXE 4XIGS 1GUWA 3EFXD 3J7AV 1U4MA 4WFN3 4QMGA 1NR2A 2HQEA 2KUMA 1Z47A 5EKKA 4K2LA 5I6YA 2FFKB 3HGBA 3QO2A 2PW5A 5BN5A 3Q23A 3K58A 1F9QA 4A3JB 1IYUA 1ICWA 2L1BA 5LHY1 1VDZA 3MHBA 2K01A 2PQEA 4QUCA 4FF3A 2A6HD 1A2TA 4HCEA 2B2UC 1CHPD 4HCSA 1LTSD 2A68D 1FGBD 5FO8B 4IFDG 1CI3M 1HA5A 1JE4A 2NN6I 2NWGA 1PZKD 5EKLA 3I72A 5IT9E 3GTJB 1SDFA 2LFNA 3DXJC 1BF4A 4ID6A 2XWJB 4KKUA 4QCLA 2EYHA 1HA6A 1GUGA 4A3DB 4K5VA 1SNQA 3X3NA 4FF4A 1CFMA 3CU7A 5FK9C 2NUCA 2B2TC 3S14B 3KK7A 4PQXA 2O2LD 3H6MA 4KY5A 1JB3A 2TSSA 1NR4A 2KJXA 4H13C 3H0GB 5KYIA 2J4XA 3PUYA 1BDOA 2JYOA 1CQVA 1BO0A 3ZYYX 3FRPB 3LWUA 2F0LA 3A54A 2IX0A 3EA6A 2AQ2B 2EYPA 2OT2A 5JJZA 3I8ZA 5ELDA 1JQYD 1HFNA 4C3JB 2NB0A 2B8GA 2DY7A 3MZ5A 1FYCA 2XNAC 4IZ8A 4FYDA 2JA8B 1BCPB 1JWUD 1TVXA 2KCNA 4CBVA 4NDXA 4IUTA 2JA5B 4ZK9B 3BS1A 4L6TB 4IFDI 5E1FA 1PXUA 4BWGB 1Z7TA 3FVQA 4E6IA 1GXDC 2D9UA 3CHBD 4DFAA 4DAVA 5IGCA 2EY6A 2J7ZA 1C48A 3NHHA 1Y69U 3SVMA 1EQTA 5EQ0A 1BR9A 4IALA 3IKJA 2JA7B 4Z9CB 3NE5B 4H7BA 3IAYA 1QJOA 1I4XA 2BE5C 2DN8A 1DD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9H A;  1RJT A;  2DY8 A;  4X3U A;  1HRJ A;  3DM1 A;  4XDX A;  1E0B A;  1IKM A;  2SDF A;  1ZXT A;  2HCC A;  2EPB A;  1ILP A;  1EIH A;  4CJ0 B;  2X6L A;  2L11 A;  3I90 A;  2KEC A;  1KNA A;  1NR4 A;  3KBX A;  4UAI A;  1C8C A;  2IL8 A;  3DEP A;  2MGS A;  1EIG A;  3FDT A;  5EPL A;  3GV3 A;  4HSV A;  1AZP A;  2X69 A;  4IUV A;  5AFW A;  3MWY W;  2M2L A;  1G2S A;  1U4L A;  2Q8T A;  2JP1 A;  1ESR A;  1VMP A;  2JYO A;  2KVM A;  3Q6S A;  2B2V C;  3GV6 A;  1MGS A;  5EPK A;  4ZAI A;  1DOL A;  1BO0 A;  2K1B A;  1CA6 A;  1HUM A;  1GUW A;  1QE6 A;  4O42 A;  1U4M A;  1F2L A;  1B50 A;  3IFD A;  3I3C A;  3I91 A;  4X3S A;  2FHT A;  2H1E A;  4NW2 A;  1J9O A;  1NR2 A;  1MI2 A;  1O7Z A;  2B2W C;  2FIN B;  1B4O A;  1PDQ A;  1PFB A;  1Q3L A;  1X3P A;  2KUM A;  2MP1 A;  2XIW A;  3D6W A;  4RAU C;  4IUP A;  3TZD A;  4MN3 A;  1F9R A;  2B2T A;  2X6G A;  4U68 A;  1DZ1 A;  2MPM A;  1M8A A;  2K05 A;  4HED A;  4MHE A;  1WD0 A;  3H91 A;  1F9S A;  1SSO A;  4ZLT F;  1A15 A;  4OIK A;  2BDN A;  3FPU B;  1G2T A;  2HDM A;  5CBE E;  4R8I A;  5JJZ A;  3IL8 A;  5EJW A;  1LV9 A;  2FFK B;  3QO2 A;  5EPJ A;  2RA4 A;  3I8Z A;  2Q8R E;  5COR A;  1DON A;  4DN4 M;  1HFN A;  1F9Q A;  5CBA E;  2K28 A;  4IUR A;  3TN2 A;  2K03 A;  1ROD A;  3MTS A;  3G7L A;  4XT3 B;  1WTX A;  1J8I A;  1WTV A;  1CA5 A;  1ICW A;  2B2U A;  2L1B A;  3LWE A;  1G6Z A;  1IL8 A;  1PLF A;  1X32 A;  2KEE A;  2DY7 A;  2MJ8 A;  3KUP A;  1RTO A;  2CVR A;  1U4R A;  1HFG A;  1HHV A;  1B53 A;  2N55 A;  1QG7 A;  2L4N A;  1MSG A;  2K01 A;  2L12 A;  5EKI A;  4QUF A;  2NYZ D;  4QUC A;  1WTW A;  1AZQ A;  2B2W A;  1WVL A;  1KNE A;  1DOM A;  1TVX A;  2EE1 A;  5COY A;  1AP0 A;  1HUN A;  2HCI A;  2B2U C;  2RSN A;  1O7Y A;  3ONA B;  1ML0 D;  4X3K A;  4IUU A;  4HCS A;  1U4P A;  4RWS C;  1WTO A;  1RTN A;  1CM9 A;  5D65 A;  1BBX C;  1WD1 A;  1PFN A;  2EOT A;  4CJ1 B;  1RHP A;  4IUT A;  1X3Q A;  2N88 A;  3DEO A;  4ZK9 B;  4CJ2 C;  1JE4 A;  5DNF A;  1NAP A;  5T1G A;  1B3A A;  4ZKC B;  2NZ1 D;  2NWG A;  1XYI A;  1O80 A;  1WTP A;  2KED A;  4LMQ D;  1XX8 A;  2K04 A;  1G91 A;  1EL0 A;  5CMD A;  2RSO A;  2D9U A;  1WTQ A;  4X3T A;  2KOL A;  2HDL A;  4IUQ A;  2FJ2 A;  4R9W A;  3HP3 A;  5E4W C;  5D14 A;  1SDF A;  1IKL A;  2J7Z A;  1VMC A;  2R3Z A;  3SVM A;  3R93 A;  1DOK A;  1EQT A;  1S4Z A;  3P7J A;  5EQ0 A;  5T1I A;  1BF4 A;  1ILQ A;  2VXW A;  2B2V A;  4HAE A;  1NCV A;  2B2Y C;  2RVL A;  4OIJ A;  5E4X A;  1SAP A;  2HUG A;  2FMM A;  1HA6 A;  1QNK A;  4XT1 B;  1WTR A;  1B2T A;  3N52 A;  2B2Y A;  4ZKB B;  1JIC A;  1F9P A;  3F2U A;  1PFM A;  4RA8 A;  1EOT A;  1BNZ A;  1MSH A;  3UI2 A;  2B2T C; 
#chains in the Genus database with same CATH topology
 3A5Z B;  3KJP A;  1HRJ A;  3PF4 A;  1UNS A;  3CCQ A;  1E0B A;  3V2T A;  1EY4 A;  4JI8 L;  5IYC G;  1UE5 A;  3DWQ A;  1KAB A;  1LTR D;  2AMC B;  4IJL A;  2G9H D;  3NSW A;  4LF5 L;  5EPL A;  3PUW A;  2RCN A;  4LK1 C;  3A8K E;  1YJN A;  2X69 A;  2R92 B;  1HNW L;  2L5T A;  3E6Z X;  4IN3 A;  1QE6 A;  4JI2 L;  4DV4 L;  3N6R A;  5KNB A;  3OYY A;  3K5N A;  4RGO S;  1EY0 A;  1PZI D;  1STN A;  5IOD A;  2MP1 A;  1PFB A;  1P8L A;  2P5Z X;  2KHS A;  1YJ9 A;  1Q1B A;  2IJ0 A;  2I5M X;  4RCN A;  1M8A A;  5FO9 B;  3RLF A;  3HOX H;  4GNX C;  2WII B;  1EWC A;  4MNO A;  3U9S A;  5M3M B;  4S3S A;  5CGK A;  1YIT A;  5CR3 A;  2ZXP A;  2R7Z B;  4R4O A;  2DGY A;  3I73 A;  2K28 A;  1JJC B;  1G51 A;  5J1Z A;  3M7N A;  1F2Z A;  3TEH B;  1X56 A;  3PCO B;  1OTC A;  2RQX A;  3P1H A;  3H3V C;  4G7Z C;  1EY6 A;  1BVS A;  4RG1 A;  3HZX A;  4DAP A;  1PRT C;  4B9W A;  1MSG A;  2D5D A;  4A3I B;  1WTW A;  3VYU A;  1SNO A;  1STY A;  1TWH H;  1QWY A;  2A1A A;  2XVS A;  4K5X A;  2QF7 A;  3T53 B;  4YHH Q;  2WAC A;  1SYC A;  4KHP L;  5IP7 G;  3NUC A;  4A3G G;  2CQA A;  1YHB A;  2Z0S A;  3GTG B;  3DEO A;  1SNC A;  2EYF A;  2MUY A;  1VQD A;  5DNF A;  1TR5 A;  4J1M A;  2NTT A;  2ICE C;  1PTO D;  1STA A;  2FJ2 A;  4KN7 C;  1LT4 D;  4WOR A;  4KD4 A;  3T13 A;  3STB D;  1VMC A;  4DV7 L;  1XMQ Q;  5G3L F;  4IPD A;  5EAY A;  2VXW A;  3ER0 A;  4A3B H;  3NP8 A;  4GNX A;  3CD6 A;  5C3E B;  5IP9 H;  3KYH C;  3HOV H;  1VQA A;  2D2C C;  2FMM A;  2QDL A;  3JAM i;  1HZC A;  1RF2 D;  5ELC A;  2Y0S B;  2CH4 W;  3ULP A;  3H3V I;  5IWA L;  1RJT A;  2KCC A;  1CT1 D;  2ZJQ A;  1XMO L;  3LNN A;  1AN8 A;  4WJW A;  4PV1 C;  4ILW A;  3JAM L;  4C3J H;  1NMG A;  3CXC A;  1KL9 A;  4Y7N B;  2Z1C A;  4NXM L;  1PTO F;  5I9P A;  4V0B A;  2B2V C;  4PMW A;  5M5X H;  2EYO A;  3BDL A;  1K0S A;  2O5I C;  2F0Q A;  2RDG A;  4LNQ A;  1VQN A;  2KCT A;  4A3M H;  3NPP A;  4AQY Q;  1Q3L A;  2OCE A;  2RHQ B;  1QCB D;  4OWX B;  1HR0 L;  3D3R A;  4A3L G;  4DV5 L;  1FJG L;  4DNT B;  3FPU B;  5CBE E;  4JVZ A;  5IT9 c;  4YHH L;  1II3 A;  2RDH A;  2AUK A;  3CCV A;  4FF2 A;  2E76 C;  2K5H A;  3RZO H;  3S2H H;  4G4K A;  4BA2 I;  2K03 A;  1K8M A;  4XT3 B;  1WTX A;  3H09 A;  4MIU A;  2F0J A;  2PYK A;  3HG9 A;  3P20 A;  4OO1 G;  1L1O A;  1X32 A;  2FXQ A;  1PYS B;  4AYB E;  1HHV A;  4QUF A;  1V1Q A;  1OXV A;  2NYZ D;  3MVV A;  1SYB A;  4X62 L;  1HH2 P;  1KNE A;  1DOM A;  4Y52 H;  3DHQ A;  1J5E Q;  4ULL A;  3M4Q A;  4DAY B;  3OW7 A;  4IFD J;  1PTO H;  4BS9 A;  3J7A 5;  3GTO H;  2VUM B;  5LMU L;  1PH7 A;  1O80 A;  3KF8 A;  3A8J E;  3BDC A;  2RDF A;  4YWL A;  2PNR C;  1Y8P B;  2BH8 A;  5M5W B;  4GNX B;  1TXY A;  1KRT A;  2WAQ B;  1EZ8 A;  3RZO B;  2SEB D;  1O78 A;  3QG1 A;  3GQB A;  5C5M A;  3OWF A;  3K7A B;  4X65 Q;  1X3F A;  2F4I A;  1SAP A;  5DLQ E;  2XWB B;  1B7Y B;  5HGQ A;  4BBS B;  3NBI A;  4POG A;  3CQZ B;  2EVB A;  1N36 L;  2UXC Q;  1Z9F A;  5DEH A;  5GAD C;  2QGQ A;  1Q46 A;  2ID0 A;  2R93 H;  4ZQ3 A;  3GTJ H;  3CPF A;  2JA6 H;  1E2W A;  4KLK A;  3PIP A;  2KQ3 A;  4OWW B;  1OXX K;  1H9M A;  4JI7 L;  2SDF A;  4KJO A;  1EIH A;  3GO5 A;  1YNN C;  2K50 A;  1RL2 A;  1T5X D;  4HIK A;  2X6L A;  2VQF Q;  3T51 B;  3U9O A;  1XPU A;  1CKO A;  3UE0 A;  5E7N A;  4QIW E;  5DM7 3;  1SYF A;  1TWG B;  4N9P A;  4IOA A;  1MD2 D;  1PTO C;  1CZG A;  4C3H G;  3U58 A;  1WOC A;  2ZXO A;  4EQO A;  1GHK A;  1OO9 B;  2I5L X;  3K0Y A;  3C3L A;  3EJI A;  3TSS A;  3KJO A;  2B2W C;  1X3P A;  2LKV A;  4JC0 A;  1IBM Q;  4OHJ A;  4YCW A;  3PIP 3;  3GTG H;  3GTL B;  1DZ1 A;  1PRT F;  3EQL C;  1Y1V G;  2GN5 A;  4HJ5 A;  2Q2T A;  1AEX A;  1WI5 A;  1LV9 A;  1U5K A;  1N32 L;  5IE8 A;  4GKK L;  1TWH B;  4BA1 I;  4TQU S;  1Y1V H;  3RNU A;  1MKH A;  1KC8 C;  2XRS D;  4QIW B;  3GP7 A;  1PLF A;  1DJR D;  5E3F A;  4H0L C;  4DV7 Q;  4K2K A;  3EBE A;  1HFG A;  1SEB D;  1LTL A;  5ELN A;  5EKI A;  4X6A H;  3NTK A;  5K36 G;  1AZQ A;  3FP9 A;  4B3M Q;  1HZB A;  5JEA G;  2C35 B;  5EBD A;  2Q8I B;  1RTN A;  3HKS A;  3L3O C;  5NUC A;  4LF8 L;  2MHV A;  1BBW A;  4OX9 L;  5JVH 3;  1N34 L;  4LFB Q;  2CW0 D;  1X3Q A;  1S5C D;  3MEF A;  5T1G A;  2YV5 A;  3AMU A;  5FLM H;  2KED A;  1XX8 A;  3RZD B;  3OMC A;  1I6H B;  2ATW A;  3AFP A;  4X3T A;  1LTT D;  2A73 B;  3W5O A;  4HN7 A;  2GVB A;  5CV8 A;  3J80 E;  3WDN A;  3P7J A;  3FMC A;  1CSQ A;  3J7Y W;  1SJH D;  2SNS A;  1KQS A;  4LF7 Q;  4R4C A;  2I0Q A;  1CHQ D;  2Z8L A;  2UUA L;  1EY5 A;  1TS5 A;  3S16 B;  4ZKB B;  4DR5 Q;  3JAM c;  1BNZ A;  2F0I A;  2EJM A;  2EE1 A;  4LW1 A;  2F0F A;  4JOI C;  3DM1 A;  2A6E C;  1D8L A;  4XDX A;  3HOU H;  4DV5 Q;  1FJG Q;  2AWN A;  4FDB A;  3J7Z C;  2UUC L;  3T1Y L;  5C44 B;  2CWP A;  4X64 L;  4DR4 L;  2LS0 1;  4TRD A;  4NPS A;  3HOY G;  1Q8K A;  2UXB L;  3MWY W;  4A3D G;  1U4L A;  5IYC H;  4ZAI A;  2R92 G;  1MGS A;  1CA6 A;  3S1N H;  1HUM A;  1GUS A;  2N3S A;  2E5L L;  2EY1 A;  1CZW A;  4OEL B;  1ET6 A;  2EJG C;  1MI2 A;  2XN9 C;  4K6L A;  5I6W A;  1B4O A;  2JJQ A;  5C4H A;  4EQP A;  1KDA A;  1KLG D;  5TSS A;  1Q8I A;  3HOW B;  4JI4 L;  2R7D A;  1V8Q A;  4QB4 A;  4NKL A;  4P72 A;  4QL5 A;  2MO1 A;  4GOP B;  4K8J A;  2KA7 A;  3PSI A;  4DK0 A;  4A3D H;  2EIF A;  3MXG A;  4KN4 C;  4NXM Q;  1G6Z A;  1XWE A;  2VB3 X;  2XTI A;  3NQT A;  4LF6 Q;  2NVQ B;  1WJJ A;  2N55 A;  2L4N A;  1EYC A;  1H9J A;  1VS0 A;  2B8F A;  4ODG A;  4CHT B;  2KBN A;  3VR4 A;  4A3I G;  3MFY A;  4LF6 L;  3M4P A;  4JI1 Q;  1I4P A;  1UUP A;  3W1G A;  2NVT B;  4G7O C;  4JI3 L;  3HOW H;  5GRO A;  1NMF A;  1K3R A;  1BQQ T;  4A3J H;  1EIY B;  1IKM A;  5J3B A;  3GTM B;  4UHV A;  1SFO B;  2Z4I A;  4LMQ D;  3TRE A;  3L0O A;  1V1P A;  3L7Z C;  4B08 A;  1EU4 A;  2K5W A;  1X6O A;  3HOZ G;  1ONL A;  1ESF A;  1JWS D;  1RKN A;  3VR3 A;  2JN4 A;  1GUT A;  1TS2 A;  1DYQ A;  3D4W A;  2H4O A;  5LMN Q;  1ILQ A;  3PO3 B;  4NXN Q;  1H9K A;  3H0G H;  2ALY B;  1SJE D;  2EYL A;  4HID A;  2UU9 Q;  4RH6 A;  1JOK A;  3KF6 A;  3M3Y H;  1YVC A;  1JOR A;  4K8I A;  2NVY B;  2VW9 A;  5CC4 A;  4LF5 Q;  2JEA I;  1I94 Q;  1ZXT A;  3S16 H;  2NBF A;  4DAY A;  1KAW A;  4GLA C;  1EOV A;  5DM6 3;  2KEC A;  3KBX A;  3AQQ A;  3E9H A;  5ELE A;  3BU2 A;  1XNR Q;  2EXZ A;  2Y0S E;  4DV2 L;  2N49 A;  3F2B A;  2DNC A;  4A3F G;  1HJP A;  3KLS X;  2EYM A;  1I94 L;  4YY3 Q;  4A3L H;  3KF6 B;  3MXN B;  4O1N A;  4KKT A;  2CKZ B;  2V4D A;  3I91 A;  3D0F A;  5C0X I;  5M3F B;  2EYJ A;  4A3F H;  3PUZ A;  3SK6 A;  1EIF A;  1Y1V B;  4L63 B;  2YYZ A;  1RDP D;  2E74 C;  3H91 A;  4LF8 Q;  4OIK A;  4RGN A;  2F0P A;  1GOZ A;  3IFT A;  2WP8 J;  4JI2 Q;  2RA4 A;  1DON A;  1VQC A;  4GLX A;  1Q12 A;  1D6E C;  2O5J C;  4N8X 1;  1J8I A;  1PYW D;  5KND A;  2A5H A;  3FPP A;  4KY7 A;  3TQY A;  5KIX A;  3MXN A;  1RTO A;  2PI2 E;  4GN3 B;  4LWC A;  3NBH A;  3S1Q B;  2OTJ A;  5J39 A;  3S1M H;  2C9O A;  4A3I H;  1WVL A;  3ONA B;  1UAP A;  3R2T A;  5I4D A;  4DR3 L;  1V1P B;  4DR5 L;  4A3E B;  1XJV A;  1HNZ L;  1KDC A;  5FLX c;  1O7L A;  4LF4 L;  2ZM6 Q;  1YIJ A;  1NY4 A;  4JI0 L;  2G9D A;  3K6O A;  2HDL A;  3RR5 A;  2IX1 A;  3HOX B;  1EWI A;  3SGI A;  2JA7 G;  1EY7 A;  1IBM L;  5CYU A;  1SE2 A;  4A3G B;  2B2Y C;  4OIJ A;  2K52 A;  1CQF A;  1F2Y A;  1SNM A;  3M9B A;  1SE4 A;  5C4X H;  4OX9 Q;  1F9P A;  3GDE A;  1WCM H;  2D0P A;  5JPN C;  2L9H A;  4DV0 Q;  4XQN A;  1UE6 A;  2JA9 A;  1MHW C;  2VQF L;  2PZT A;  1SYD A;  4PMC A;  5C4X B;  2IX3 A;  4RMF A;  5C0X H;  1AW7 A;  4L5Q A;  4NMZ A;  1FR3 A;  3T4A C;  4HR7 B;  4JG2 A;  1LT3 D;  5M3F H;  4L8J A;  1JR0 D;  1XPR A;  4XQJ A;  4HSP A;  1SE3 A;  4XTC S;  3TP6 A;  5KGU A;  3BZD B;  1RCV D;  2VB2 X;  1SN8 A;  2XIW A;  4RAU C;  2NN6 G;  5KNC A;  3CW2 C;  1F9R A;  2X6G A;  3CAM A;  1WD0 A;  4BY7 B;  2EY5 A;  3MXP A;  1VQ4 A;  1U9R A;  4DR7 L;  4LFC L;  1HCZ A;  1NTG A;  4FF1 A;  2TMP A;  2CH4 A;  3PMF A;  4QF4 A;  4HIM A;  4K0K L;  3HOZ H;  1B44 D;  5ELB A;  3KDF A;  4LAA A;  5GAH C;  2WAQ E;  3CP0 A;  3CCL A;  1CA5 A;  3I4L A;  3K81 C;  3TME A;  2JEB I;  1PHJ A;  3KUP A;  1UEA B;  4DV1 Q;  4C3I G;  1QG7 A;  1VF7 A;  2WAQ G;  3PO2 G;  4OEM B;  2PZU A;  1U4P A;  3LGJ A;  3GTQ B;  1WD1 A;  4DXF A;  2A69 D;  2PMZ E;  5HY6 A;  4UPA A;  1TQO A;  3J7A F;  4L5S A;  2ZTE A;  3PQI A;  1T9H A;  3MEH A;  2E2J B;  1WTP A;  1S72 A;  4DR6 L;  2EJF C;  1QVG A;  3FKI H;  3RLN A;  1EY9 A;  4DXG A;  1UE7 A;  5E4W C;  3CKI B;  1X3G A;  2R3Z A;  4C3I H;  1TWC B;  1DOK A;  1NE3 A;  4JI0 Q;  3PO3 G;  1XNR L;  4M1U B;  5ELF A;  2E2J H;  2B2V A;  2AUJ D;  1CSP A;  4A3E G;  4XYO A;  4YCU A;  2RVL A;  4PG3 A;  4FXK C;  3UDG A;  1EWH A;  4HTH A;  3SK5 A;  1YNX A;  2KHJ A;  4XT1 B;  1B9N A;  5KEE A;  3N52 A;  4FVM A;  4FXD A;  1H9R A;  1D5X C;  1A0I A;  5LL6 X;  1GO3 E;  2PPB C;  3GTQ H;  2XSC A;  2RCF A;  5C0X J;  2DY8 A;  4P75 A;  1G8Z D;  5JOB A;  1H95 A;  3U50 C;  3FKI G;  3C46 A;  1KNA A;  2DUD A;  2K32 A;  2F0W A;  2XRQ D;  3FHW A;  4OO1 I;  3OOC A;  4A3B B;  3GV3 A;  4DA2 A;  1IBL Q;  1ESR A;  1AE2 A;  1PRT B;  3E3X A;  1A3V A;  4EX5 A;  1R9T H;  2UU9 L;  3IFD A;  1PRT D;  1Y8O B;  4ABN A;  3Q22 A;  1KTK A;  4JI3 Q;  1Y1W H;  5IP9 G;  3HOV G;  2Z6B A;  1F9S A;  1S5F D;  4CDF C;  4ZLT F;  1G2T A;  1KRS A;  1YZ6 A;  2K14 A;  5JJK A;  1Q1E A;  2GA4 B;  5IOC A;  4C3H B;  2OF1 A;  1TY2 A;  4TSS A;  2Z4H A;  2LSS A;  1IL8 A;  1SYG A;  1JJG A;  2CVR A;  2PO4 A;  4WRD A;  1EQV A;  2I07 B;  1S5D D;  3STB C;  1GJX A;  4F87 A;  3BG3 A;  4ZUI A;  3R3O A;  4IPH A;  1HXY D;  1AP0 A;  4C56 C;  5FOB B;  4FXG C;  5IYD G;  1WCM B;  5A2Q E;  4X3K A;  1WTO A;  1EFI D;  2PCF B;  3IRB A;  1TY0 A;  4HMJ A;  2HD3 A;  2K5N A;  3UE1 A;  1TII D;  4AYB B;  2NZ1 D;  1XMO Q;  3MC0 B;  4DUZ Q;  4BXX G;  1YJW A;  2B29 A;  4A93 B;  3TP5 A;  3HRZ C;  3HP3 A;  5HUR A;  4V19 0;  3R93 A;  4F7X A;  4TKO B;  5IY0 A;  4DUZ L;  1KLU D;  2UXD L;  2PZW A;  4JBW A;  3BVZ A;  1PTO B;  2BA1 A;  1TWC H;  3A56 A;  3D8G A;  4KHP Q;  4IPG A;  4RCO A;  1VQ9 A;  4BBR B;  3I4N H;  3G48 A;  2ASB A;  4O0A A;  3UI2 A;  2HT1 A;  4X3U A;  1N33 Q;  1JOQ A;  1UWV A;  5BN4 A;  3AB9 A;  3S1Q H;  4WJ4 A;  3SXH A;  3A55 A;  4M8A A;  3DUZ A;  5L37 A;  3CCE A;  1A2U A;  4C2M H;  4R4I A;  4PZ6 A;  3VR6 A;  2HHH L;  1EU3 A;  3J80 c;  2KVM A;  4GZY C;  1VQB A;  1JMC A;  2NVX B;  2VL6 A;  3NWS A;  1IBL L;  3LX0 A;  1A63 A;  2H1E A;  1I6H H;  4GLV B;  2NTS A;  3WOF A;  4BY7 G;  2VNU D;  5GAE C;  2NN6 H;  3JAM E;  1WFQ A;  3B6Y A;  2JQO A;  1G6P A;  3OPO A;  1ZYR D;  3SK8 A;  2VY3 A;  3IL8 A;  2VQE L;  4LFA L;  3QOJ A;  3R8B A;  2EXD A;  5COR A;  4DR6 Q;  4DN4 M;  3J81 L;  5FO7 B;  5CBA E;  1HQM C;  2MO0 A;  1UE1 A;  3A7L A;  4XYQ A;  3TN2 A;  3M3Y B;  1D1K A;  1ROD A;  3G4S A;  3Q24 A;  2B2U A;  4RGM A;  2WB1 B;  2RHS B;  1NUC A;  3K5M A;  5JPM C;  2ZJP A;  4FP5 D;  2YTX A;  5ELO A;  1VQ7 A;  1JE5 A;  4ZYS A;  3Q0A A;  2E2I H;  1B53 A;  1C7Y A;  4A3M G;  2M00 A;  5K36 H;  2R61 A;  3RN2 A;  1VQ8 A;  1O7Y A;  1D7Q A;  4IUU A;  1JCK B;  1BBX C;  4LUV A;  3TS2 A;  4KHV A;  1Q90 A;  3AEV A;  1HTP A;  2E2H B;  1ENC A;  1Y1W G;  1IZ6 A;  1PH6 A;  3T16 A;  1VQJ A;  2BH2 A;  2K04 A;  2JA7 H;  4K0K Q;  2N8N A;  4HMI A;  4DV6 L;  3S24 A;  1YNN D;  1KAA A;  3E9I A;  4R9W A;  1E7Z A;  4PNY A;  2BE5 D;  4YWK A;  2RKS A;  3ERO A;  4P2C B;  3SR1 A;  1LYL A;  4JBJ A;  1NCV A;  4APV A;  1B8A A;  3KF8 B;  1TWA H;  3X3M A;  3NXW A;  3CMA A;  2JA8 H;  3BYT B;  1EOT A;  1DGS A;  3O13 A;  4CDD C;  4A93 G;  4J8Q A;  3I55 A;  4Y7N H;  1TU2 B;  5M3F G;  2Q2I A;  4YIJ A;  2IT1 A;  5C44 G;  1E24 A;  4MZ9 A;  5A35 A;  3P75 A;  2AQ1 B;  4DNR B;  2IL8 A;  4F88 A;  3EIV A;  4LF9 L;  4TVA B;  1SBB B;  4PZ8 A;  5CV5 A;  1E2V A;  3DMU A;  2KEN A;  1SND A;  3I56 A;  1AZP A;  3C1F A;  4O42 A;  3ITP A;  2UXB Q;  1CKN B;  2OEO A;  4X65 L;  3SK4 A;  1EEI D;  4LFC Q;  4GN5 A;  2F0O A;  3CME A;  3D6W A;  4IQZ A;  1ENF A;  2ICI A;  3HOW G;  4A3C H;  2B2T A;  1FD7 D;  2K05 A;  4JI6 Q;  4JYA L;  3S2H B;  3ULL A;  1A15 A;  4R8I A;  3QWN A;  1A6X A;  5EPJ A;  4LUO A;  3TS0 A;  1WTH A;  5LL6 S;  2E2I B;  3NTI A;  3ERQ A;  2ZT9 C;  3GTL H;  4JYA Q;  1QNU A;  2WIN B;  1QUQ B;  4RHS A;  2VUM G;  1VQH A;  4G57 A;  1V9P A;  1SXT A;  4KI0 A;  2GVA A;  2EZV A;  1ZEQ X;  2L12 A;  2YU9 B;  1X65 A;  4C3I B;  3QOL A;  3DWA A;  4B3S L;  4UP9 A;  4LF4 Q;  2QKI C;  2VS1 A;  4CGY B;  1IW7 C;  1PH1 A;  2HQL A;  2QEX A;  5JAV A;  4NP5 A;  2EOT A;  4QJF A;  1V1O A;  2A74 C;  3A8I E;  5ISR A;  4RKB A;  1I3Q H;  1D2B A;  3CQZ H;  3CC4 A;  1XYI A;  3E0J A;  4KHZ A;  1VCI A;  2CFM A;  1A3T A;  2JSO A;  1R9T B;  1EL0 A;  1LTA D;  5FKA C;  3I4M B;  3OTO Q;  4JBK A;  1MJC A;  1X54 A;  3OMG A;  3PIO 3;  4B3S Q;  5JJL A;  1K0R A;  1GHJ A;  4PZ7 A;  4OXP A;  4DR1 Q;  2E2D C;  4GOP C;  3NTH A;  1ASY A;  4A3G H;  4XXE A;  2OQK A;  1YI2 A;  1GUN A;  3RZD H;  3M4Y A;  4RGT A;  3HKZ G;  2HUG A;  5LMU Q;  1VQ5 A;  3GTK B;  5I9O A;  5M5Y H;  3HOU G;  3A0J A;  2B2Y A;  2SNM A;  4BBR G;  1VQO A;  3KLR A;  1TWF B;  1H9S A;  4CKB A;  3VR5 A;  2MFI A;  1HZ9 A;  3A5U A;  3PUV A;  3J80 L;  5D3I B;  4NB3 A;  2C5C A;  2CHB D;  3W2D A;  4B9X A;  2Q2H A;  1B1Z A;  2MGS A;  1TKW B;  1IYJ B;  5FJ8 H;  2BDO A;  1EFW A;  3VA7 A;  3HOY B;  2JP1 A;  2Q8T A;  2G5D A;  3K7U C;  2RBM A;  2K1B A;  5K5P A;  2QW7 A;  2K4K A;  2J0T D;  1PZJ D;  1B50 A;  3OTO L;  3PIO A;  2IW3 A;  2Q2U A;  1GUO A;  1T5E A;  2A68 C;  2R92 H;  2ZTD A;  3J81 j;  3MAQ A;  5LMN L;  3ERS X;  4GN4 B;  1XNQ L;  1AE3 A;  1PYB A;  3S15 B;  4JI5 L;  4MHE A;  2F3V A;  2BA0 A;  2KCM A;  1I50 B;  1R4P B;  2BDN A;  5J22 A;  5EJW A;  1CK1 A;  4ZUJ A;  1PH8 A;  2A8V A;  1QVF A;  1TWF H;  1E1T A;  1FNU A;  1CKN A;  3CC7 A;  3G7L A;  1M90 C;  1HR0 Q;  1BCP D;  4A3K G;  4DV3 Q;  4IFD H;  1SMX A;  2KEE A;  2QIL A;  1S5E D;  2SOB A;  3WWV A;  3F2D A;  4A75 A;  1LM0 A;  1VQE A;  2D0O A;  5JVG 3;  2JA8 G;  1VQL A;  1SRO A;  4DK3 C;  1VQK A;  3OIP A;  4DKA C;  4JPB W;  1CM9 A;  5D65 A;  2F3W A;  3M85 A;  2PW7 A;  4C2M B;  5C4Z A;  4CJ1 B;  1VQG A;  3I4M H;  3A74 A;  1U0L A;  2F0U A;  3I70 A;  4ZKC B;  3M7G A;  4HJ8 A;  3S15 H;  5M9O A;  1B3A A;  1HNZ Q;  4U67 3;  1AFP A;  2F0T A;  4BY1 G;  5KYL A;  3BVG A;  3K7A H;  2L0C A;  1YEZ A;  3A7A B;  4IUN A;  3VR2 A;  5CV4 A;  4EQ5 A;  3VYR A;  5CMD A;  2RSO A;  3JC6 6;  3RUZ A;  3S1R B;  3GTP B;  3K80 C;  2YU9 H;  4KJN A;  3TP8 A;  1FVI A;  3HOX G;  1IKL A;  2WFW A;  4CDC C;  5IGG A;  2F0S A;  1S4Z A;  1XTD A;  3KBG A;  4ME5 A;  2K5V A;  4R8N A;  3RMH A;  1KD1 C;  5C4J B;  1LTB D;  4DV4 Q;  2F0D A;  1X9N A;  1WTR A;  4Q0F A;  1QZH A;  5FLX L;  4FNF A;  2K75 A;  3W3A A;  1PFM A;  1F2M A;  1Y14 B;  1AH9 A;  1HQR D;  4A4I A;  4A93 H;  2B39 A;  2YTY A;  2F0M A;  3GTK H;  4DR4 Q;  3K8A A;  5M5Y B;  1EUJ A;  1VQP A;  1ILP A;  1XNQ Q;  3HOY H;  1X3E A;  2JA5 H;  2EDG A;  3GTM H;  2L11 A;  3AU7 A;  4UAI A;  2F3I A;  3DEP A;  5BN3 A;  4J15 A;  5C0X G;  1SR3 A;  3EVQ A;  1R4Q B;  3HOU B;  2JA6 B;  3ULJ A;  1G2S A;  2L15 A;  4JV5 L;  1PA6 A;  3GTP H;  2R93 G;  2Z6K C;  3GV6 A;  4OWT B;  4OGQ C;  2F1M A;  1F2L A;  1IL2 A;  3DWP A;  1J9O A;  2B63 H;  1PDQ A;  3J80 i;  4A3E H;  3K57 A;  2UUC Q;  1ZYR C;  2WB1 E;  4U68 A;  1STB A;  2MPM A;  1I3Q B;  2L55 A;  1PVO A;  1M1K C;  4A3B G;  2NVY H;  4DR3 Q;  2R6G A;  2R7Z G;  5IWA Q;  2M9V A;  4R1J A;  3PO2 H;  1K83 B;  1K8A C;  1WCM G;  3BDO A;  4C3H H;  2E5L Q;  4O2D A;  1W2B A;  3KLS A;  2K6A A;  3MTS A;  3ND8 A;  1TWA B;  5LMN W;  1W3S A;  4CKC A;  5IYB H;  1BCP F;  4NXN L;  3M4O H;  1B70 B;  1HTL D;  2MJ8 A;  1BCP C;  1U4R A;  3UDF A;  4CDE C;  1XMQ L;  1L0X B;  2PI2 A;  3Q8D A;  4DR2 L;  3KLW A;  4GKJ Q;  3MFG A;  2RSN A;  4R4T A;  5I2X A;  1ML0 D;  1K8O A;  2QDB A;  4LFA Q;  2VQE Q;  1PFN A;  4KKS A;  4P71 A;  4PMB A;  2LXK A;  2FMC A;  1K9M C;  5HGT A;  1QIL A;  3RN5 A;  5FJ8 G;  1S5B D;  1Q82 C;  4DU9 A;  1JWM D;  2A6H C;  1ET9 A;  1PH5 A;  5C6A A;  3PGZ A;  2VZA A;  1K83 H;  4IUQ A;  1KHI A;  2IPK D;  3TBI B;  1E3P A;  4POF A;  5F2D A;  1BBU A;  5EBC A;  4ALP A;  2A6E D;  3BYY B;  3HKZ B;  3ND9 A;  4HAE A;  3RLO A;  3S9W A;  3VYT A;  3M4O B;  1G29 1;  3D31 A;  5E4X A;  3K59 A;  4DV3 L;  4I7Z C;  3VYS A;  3HS0 C;  1QB5 D;  5GAG C;  4OO1 H;  2NZH A;  4RA8 A;  3NWT A;  3FKI B;  5M5X B;  1I4G A;  3WOE A;  1SYE A;  5BR8 Q;  2BCO A;  4HJ9 A;  1ASZ A;  1OXU A;  3QJY A;  1VQ6 A;  1PH3 A;  3NQI A;  1BXT A;  1EIG A;  1A3U A;  1NSN S;  4GS3 A;  2DJF C;  2MQH A;  2B63 B;  1TS4 A;  1VMP A;  4B3R L;  4DUY Q;  5EPK A;  4IOC A;  1DOL A;  4DK6 C;  5GQO A;  4UDU C;  1STH A;  3V05 A;  2JK8 A;  2FHT A;  2FIN B;  2NVT H;  3TZD A;  4B3T L;  3HOV B;  2PMZ B;  3KDF B;  4CKE A;  1IBK Q;  1ZKO A;  2F4V Q;  2B3G A;  5IGD A;  1VQI A;  1XXG A;  1CTM A;  3TP7 A;  4JK1 C;  1BKB A;  3GD7 A;  2DJG C;  1Y8N B;  4C1N K;  2PQA B;  1N8R C;  3CCS A;  4A3K B;  4IUR A;  5AJ3 Q;  4H44 C;  4RFB A;  2AWO A;  2ZXR A;  4WJ3 M;  1WTV A;  2JA5 G;  3MA2 B;  4QY7 A;  3AYH B;  3H94 A;  3HKZ E;  3PUX A;  2F0E A;  3C2P A;  1Z6H A;  1DXM A;  4KK7 A;  1I4R A;  1WYD A;  3VA5 A;  1CUK A;  2B2W A;  1IW7 D;  1JJ2 A;  5M3M H;  4DV6 Q;  4KV6 A;  2HCI A;  1BUV T;  1LAB A;  3PO2 B;  4RWS C;  2I46 A;  1F77 A;  4EVO A;  3S1R H;  1A62 A;  4AH6 A;  4DR7 Q;  4AYB G;  3K5O A;  2K33 A;  4C3J G;  3T1H Q;  2N88 A;  2WB1 G;  5G3L D;  3SDZ A;  2UUB Q;  1IHZ A;  3HFZ B;  2F0G A;  1EY8 A;  4DR1 L;  1WTQ A;  3H3V H;  3DLL A;  3S2D B;  1GD7 A;  4JW0 A;  3QB3 A;  2F03 A;  4I65 A;  3D6C A;  2I5H A;  1N9W A;  1L0Y B;  1JB7 A;  1PH9 A;  1SNP A;  3UDI A;  3G6J B;  5T1I A;  3K5L A;  2UUB L;  3S17 B;  2QCP X;  1L1O B;  1W6J A;  3CPW A;  1TT2 A;  1HPC A;  1OXS C;  4DUY L;  4JBM A;  1JOO A;  2WKD A;  1LTG D;  4DV0 L;  3BZC A;  1J5E L;  1ENA A;  1I4H A;  1MSH A;  2E8G A;  2ZM6 L;  1L2F A;  4I7A A;  5C3X A;  4BY7 H;  1XTC D;  3H0G G;  1NNX A;  3CC2 A;  2JA6 G;  3D4D A;  3FDT A;  1EQR A;  2ES2 A;  4HSV A;  1A8V A;  4IUV A;  5AFW A;  1V43 A;  2IY5 B;  3TZU A;  3W1B A;  1EYD A;  3S1M B;  3FEW X;  3I3C A;  2HIV A;  4X3S A;  4BBR H;  1I6V C;  4LF9 Q;  3I4N B;  5IP7 H;  1O7Z A;  4R4Q A;  2UXC L;  4MN3 A;  3QIA A;  4KMU C;  1LTI D;  1YNJ C;  4B3T Q;  1SSO A;  2N78 A;  4JI7 Q;  1N34 Q;  1YBY A;  4L5R C;  2HDM A;  4MTK A;  1STE A;  4DF7 A;  5H1S E;  3TRZ A;  2R7Z H;  2NZO A;  2Q8R E;  5C3W A;  3CRK C;  5CV6 A;  1FNV A;  3LWE A;  4KY6 A;  1IYV A;  5DAU A;  3F8T A;  1LLR D;  4L5T A;  3ZJY C;  4DGZ A;  4A3M B;  3QR8 A;  3CCM A;  5IT9 L;  4J6H A;  3CRL C;  5M3M G;  4ZRZ A;  3NBH B;  4DV2 Q;  4BXX H;  4F8M A;  1K73 C;  4XQQ A;  1Q7Y C;  1Y1W B;  3CCU A;  2O4X A;  2BOS A;  1E2Z A;  4K5W A;  1NAP A;  1EYG A;  1P16 A;  3C1E A;  4C1N I;  2LY7 A;  2Y0S G;  2F0N A;  3I4O A;  1SMY D;  2CWA A;  4OON A;  1FGU A;  1RIP A;  2JXM B;  4N9T A;  2K7V A;  5AJ3 L;  5D14 A;  1L1O C;  2CQO A;  2QEJ C;  3SEB A;  4X62 Q;  4B3R Q;  3V96 A;  4X66 L;  1SFO H;  1I4Q A;  3CCR A;  1W6K A;  5IIF A;  1LO5 D;  2F0K A;  5KRU A;  4ZCK A;  1YHA A;  1Q81 C;  1HZA A;  4A3C G;  5C3E H;  1LT6 D;  1QNK A;  4DK1 A;  1B2T A;  1C9O A;  1E22 A;  4FO2 A;  1JIC A;  5IGB A;  3F2U A;  1HNW Q;  2CW0 C;  2PQA A;  3G71 A;  3HOZ B;  1D5M C;  3S1N B;  2HCC A;  2EPB A;  1C4Q A;  1STG A;  4CJ0 B;  2AQ3 B;  1LAC A;  1C8C A;  2LMC B;  4AQY L;  1MJE A;  2E75 C;  1QOH A;  1KDB A;  2AKW B;  3RD4 A;  3KOJ A;  4GKJ L;  1D1I A;  2K5D A;  4OL7 A;  4LJZ C;  4DR2 Q;  1B9M A;  3URY A;  1EQQ A;  4A76 A;  4A3J G;  1J6Q A;  1NJI C;  3L9A X;  3J81 c;  3SHL A;  1VQF A;  4NW2 A;  1MIU A;  1JC7 A;  2WV6 D;  1PV4 A;  1PMR A;  4IUP A;  5D3D A;  4HED A;  3PF5 A;  4JI1 L;  5CV7 A;  1RD9 D;  1PH4 A;  1N33 L;  1B3Q A;  5IYB G;  4ME3 A;  3OW2 A;  3BJU A;  4RKL A;  4G7H C;  1GM5 A;  4JV5 Q;  1VF5 C;  1QVC A;  2K5Q A;  5CV9 A;  1D5Z C;  4EQN A;  3J81 i;  3AFQ A;  2HHH Q;  3I4N G;  5C44 H;  3E5S A;  3BVM A;  1UEB A;  2A69 C;  3NEL A;  3D4R A;  4HJ7 A;  5IGE A;  1M4V A;  3S17 H;  5JEA J;  1GVP A;  2EY2 A;  2HIX A;  3KFU A;  5JEA H;  3CCJ A;  1BOS A;  5COY A;  2PNH A;  1LT5 D;  2F0H A;  1HUN A;  5IGF A;  3MXU A;  2V1C C;  3PV0 A;  4H02 A;  1PH2 A;  3S2D H;  3J81 E;  1RHP A;  4X64 Q;  2VUM H;  3GTO B;  2IWH A;  4CJ2 C;  2WKC A;  4JI8 Q;  1K3B C;  3OSO A;  1YNJ D;  1EZ6 A;  1OXT A;  1G91 A;  2Z9H A;  5A2Q L;  1FNW A;  3DM3 A;  2OQ0 A;  2KOL A;  4P74 A;  2OXP A;  3I2Z A;  5EGT A;  1X55 A;  1DCZ A;  2R7F A;  2LXJ A;  2UUA Q;  3F1Z A;  2F52 A;  4KTA A;  4YWM A;  4DAM A;  2JE6 I;  4YCV A;  3TDQ A;  2D62 A;  2NVQ H;  1H9S B;  3T56 B;  3OIQ A;  4JI4 Q;  5I2Y A;  2F0V A;  3U4V A;  1HR0 W;  4BY1 B;  3BZK A;  3SE0 A;  2ENB A;  1SRU A;  1EYA A;  3OWE B;  3VDY A;  1SLJ A;  1KIX A;  2R93 B;  1HNX Q;  1DM0 B;  3E0E A;  4Q5V A;  1MBY A;  1S40 A;  2KHI A;  2DNE A;  4K14 A;  5C5L A;  1EEF D;  1TS3 A;  4RHR A;  3I90 A;  2CCZ A;  3OHX C;  4KD3 A;  4LF7 L;  2UXD Q;  4BBS G;  2IHE A;  4K6D A;  4A3F B;  1SMY C;  3R2I A;  2M2L A;  4EGV A;  2OWO A;  3HEJ A;  3NK9 A;  3Q6S A;  5FLX E;  2B63 G;  4XIG S;  1GUW A;  3NEN A;  3EFX D;  3J7A V;  1U4M A;  1O7I A;  4WFN 3;  4QMG A;  1NR2 A;  4MTN A;  2HQE A;  1JT8 A;  2KUM A;  3K0X A;  2ZJR A;  1Z47 A;  2ZTC A;  5EKK A;  1ICF B;  1IXR A;  4K2L A;  5I6Y A;  1C0A A;  4QQB X;  2FFK B;  3HGB A;  3QO2 A;  2PW5 A;  5BN5 A;  3Q23 A;  4B3M L;  3K58 A;  1F9Q A;  1N36 Q;  4A3J B;  3UDX A;  4IJH A;  1LUZ A;  1IYU A;  1ICW A;  2L1B A;  4IO9 A;  5LHY 1;  3F2C A;  1VDZ A;  3MHB A;  2K01 A;  4X66 Q;  4UP8 A;  2PQE A;  4GKK Q;  4QUC A;  4LFB L;  4FF3 A;  1N32 Q;  2A6H D;  1A2T A;  4JCV E;  4HCE A;  5IYD H;  2B2U C;  1CHP D;  4DV1 L;  3L2P A;  4HCS A;  1LTS D;  4BBS H;  2A68 D;  1TWG H;  1FGB D;  2IHF A;  5FO8 B;  4IFD G;  4JI5 Q;  1CI3 M;  1HA5 A;  1JE4 A;  2NN6 I;  2NWG A;  2RF4 A;  1Q86 C;  1NBW A;  1PZK D;  2YTV A;  5EKL A;  3I72 A;  2MNA A;  5IT9 E;  3GTJ B;  5FLM G;  2NVX H;  1SDF A;  1I50 H;  1YHQ A;  2LFN A;  3DXJ C;  1BF4 A;  4ID6 A;  2Z6K A;  2XWJ B;  4KKU A;  4QCL A;  5BR8 L;  2EYH A;  1HA6 A;  1GKH A;  5C3E G;  3T1Y Q;  1GUG A;  4A3D B;  4K5V A;  1SNQ A;  3X3N A;  4FF4 A;  1CFM A;  3CU7 A;  4DPG A;  5FK9 C;  2NUC A;  2B2T C;  3S14 B;  5M5W H;  3KK7 A;  4PQX A;  2H5X A;  5C4X G;  2O2L D;  3H6M A;  4KY5 A;  1JB3 A;  2TSS A;  1NR4 A;  2KJX A;  4H13 C;  3CF5 A;  3H0G B;  5KYI A;  2EQS A;  2J4X A;  2XGT A;  1SE8 A;  3PUY A;  1BDO A;  4YY3 L;  2JYO A;  1CQV A;  1BO0 A;  3ZYY X;  3FRP B;  3LWU A;  3U4Z A;  2F0L A;  2A19 A;  1K8G A;  3A54 A;  2IX0 A;  2E2H H;  4JI6 L;  1E1O A;  1L0W A;  3EN2 A;  4AIM A;  3ICE A;  1I5F A;  2AQ2 B;  3EA6 A;  4QGU A;  2EYP A;  2OT2 A;  5JJZ A;  3G6E A;  3PO3 H;  3S14 H;  3I8Z A;  5ELD A;  2QA4 A;  4UY8 C;  1JQY D;  4P73 A;  1HFN A;  1KXL A;  2F4V L;  1IBK L;  4C3J B;  4HJA A;  1S3O A;  2NB0 A;  4HIO A;  2AHO B;  2B8G A;  2DY7 A;  1QUQ A;  5C4J H;  3H15 A;  3T1H L;  3MZ5 A;  3I7F A;  2OTL A;  3I4M G;  3NEM A;  1FYC A;  2XNA C;  4IZ8 A;  4FYD A;  2JA8 B;  1BCP B;  1JWU D;  1TVX A;  4N8F A;  1HNX L;  2KCN A;  4CBV A;  4NDX A;  4IUT A;  2JA5 B;  4ZK9 B;  3BS1 A;  4UP7 A;  4L6T B;  4IFD I;  5JJI A;  5E1F A;  1PXU A;  4BWG B;  1Z7T A;  3FVQ A;  1PFS A;  4E6I A;  1GXD C;  1CKM A;  2D9U A;  3CHB D;  4DFA A;  4DAV A;  4BY1 H;  5IGC A;  4LUZ A;  2EY6 A;  2J7Z A;  1C48 A;  3NHH A;  1Y69 U;  4IPC A;  3SVM A;  1EQT A;  5EQ0 A;  1BR9 A;  4IAL A;  3IKJ A;  1VQM A;  2JA7 B;  4Z9C B;  3NE5 B;  4H7B A;  4JOI A;  3IAY A;  1QZG A;  4DNI A;  1K28 A;  1XPO A;  4A3K H;  1QJO A;  1I4X A;  2BE5 C;  1FL0 A;  2DN8 A;  4GOP A;  1DD2 A; 
#chains in the Genus database with same CATH homology
 1HRJ A;  1UNS A;  1E0B A;  3V2T A;  1EY4 A;  3DWQ A;  1KAB A;  1LTR D;  2G9H D;  3NSW A;  5EPL A;  3PUW A;  4LK1 C;  3A8K E;  2X69 A;  2R92 B;  2L5T A;  3E6Z X;  4IN3 A;  1QE6 A;  3N6R A;  5KNB A;  3K5N A;  4RGO S;  1EY0 A;  1PZI D;  1STN A;  5IOD A;  2MP1 A;  1PFB A;  2KHS A;  1Q1B A;  2IJ0 A;  4RCN A;  1M8A A;  5FO9 B;  3RLF A;  2WII B;  1EWC A;  3U9S A;  5M3M B;  4S3S A;  5CGK A;  5CR3 A;  2ZXP A;  2R7Z B;  3I73 A;  2K28 A;  5J1Z A;  3M7N A;  1F2Z A;  2RQX A;  3P1H A;  3H3V C;  4G7Z C;  1EY6 A;  3HZX A;  4DAP A;  1PRT C;  4B9W A;  1MSG A;  2D5D A;  4A3I B;  1WTW A;  3VYU A;  1SNO A;  1STY A;  1QWY A;  2XVS A;  4K5X A;  2QF7 A;  3T53 B;  2WAC A;  1SYC A;  3NUC A;  2CQA A;  3GTG B;  3DEO A;  1SNC A;  2EYF A;  2MUY A;  5DNF A;  1TR5 A;  4J1M A;  2NTT A;  2ICE C;  1PTO D;  1STA A;  2FJ2 A;  4KN7 C;  1LT4 D;  4WOR A;  4KD4 A;  3T13 A;  1VMC A;  5G3L F;  2VXW A;  3NP8 A;  5C3E B;  2D2C C;  2FMM A;  1RF2 D;  5ELC A;  2Y0S B;  1RJT A;  2KCC A;  1CT1 D;  3LNN A;  1AN8 A;  4WJW A;  4PV1 C;  4ILW A;  3JAM L;  4Y7N B;  2Z1C A;  1PTO F;  5I9P A;  4V0B A;  2B2V C;  4PMW A;  2EYO A;  3BDL A;  2O5I C;  2F0Q A;  2RDG A;  3NPP A;  1Q3L A;  1QCB D;  3D3R A;  4DNT B;  3FPU B;  5CBE E;  1II3 A;  2RDH A;  2AUK A;  4FF2 A;  2E76 C;  4G4K A;  4BA2 I;  2K03 A;  1K8M A;  4XT3 B;  1WTX A;  3H09 A;  4MIU A;  2F0J A;  2PYK A;  3HG9 A;  3P20 A;  4OO1 G;  1X32 A;  1HHV A;  4QUF A;  1OXV A;  2NYZ D;  3MVV A;  1SYB A;  1KNE A;  1DOM A;  3DHQ A;  4ULL A;  3OW7 A;  4IFD J;  1PTO H;  4BS9 A;  2VUM B;  1O80 A;  3KF8 A;  3A8J E;  3BDC A;  2RDF A;  2PNR C;  1Y8P B;  5M5W B;  2WAQ B;  1EZ8 A;  3RZO B;  2SEB D;  1O78 A;  3QG1 A;  3GQB A;  5C5M A;  3OWF A;  3K7A B;  2F4I A;  1SAP A;  2XWB B;  4BBS B;  3NBI A;  3CQZ B;  2EVB A;  5DEH A;  2ID0 A;  4ZQ3 A;  1E2W A;  2KQ3 A;  1OXX K;  1H9M A;  2SDF A;  4KJO A;  1EIH A;  3GO5 A;  1YNN C;  1T5X D;  2X6L A;  3T51 B;  3U9O A;  5DM7 3;  1SYF A;  1TWG B;  4N9P A;  1MD2 D;  1PTO C;  1CZG A;  4C3H G;  2ZXO A;  4EQO A;  1GHK A;  1OO9 B;  3K0Y A;  3C3L A;  3EJI A;  3TSS A;  2B2W C;  1X3P A;  2LKV A;  4OHJ A;  3GTL B;  3PIP 3;  1DZ1 A;  1PRT F;  3EQL C;  1AEX A;  1LV9 A;  1TWH B;  4BA1 I;  4TQU S;  2XRS D;  4QIW B;  3GP7 A;  1PLF A;  1DJR D;  5E3F A;  4H0L C;  4K2K A;  1HFG A;  1SEB D;  5EKI A;  3NTK A;  5K36 G;  1AZQ A;  5JEA G;  5EBD A;  2Q8I B;  1RTN A;  5NUC A;  3L3O C;  2MHV A;  5JVH 3;  2CW0 D;  1X3Q A;  1S5C D;  5T1G A;  3AMU A;  2KED A;  1XX8 A;  3RZD B;  3OMC A;  1I6H B;  4X3T A;  1LTT D;  2A73 B;  4HN7 A;  5CV8 A;  3J80 E;  3WDN A;  3P7J A;  3FMC A;  3J7Y W;  1SJH D;  2SNS A;  1CHQ D;  2Z8L A;  1EY5 A;  1TS5 A;  3S16 B;  4ZKB B;  1BNZ A;  2F0I A;  2EJM A;  2EE1 A;  2F0F A;  3DM1 A;  2A6E C;  4XDX A;  2AWN A;  5C44 B;  2LS0 1;  4TRD A;  3MWY W;  1U4L A;  4ZAI A;  1MGS A;  1CA6 A;  1HUM A;  1GUS A;  2EY1 A;  1CZW A;  1ET6 A;  2EJG C;  1MI2 A;  2XN9 C;  4K6L A;  5I6W A;  1B4O A;  5C4H A;  4EQP A;  1KDA A;  1KLG D;  5TSS A;  1Q8I A;  3HOW B;  1V8Q A;  4QB4 A;  4NKL A;  4K8J A;  2KA7 A;  4DK0 A;  3MXG A;  4KN4 C;  1G6Z A;  1XWE A;  2VB3 X;  3NQT A;  2NVQ B;  2N55 A;  2L4N A;  1EYC A;  1H9J A;  2B8F A;  4ODG A;  4CHT B;  3VR4 A;  3MFY A;  1I4P A;  1UUP A;  2NVT B;  4G7O C;  1IKM A;  1BQQ T;  3GTM B;  1SFO B;  2Z4I A;  4LMQ D;  1V1P A;  3L7Z C;  4B08 A;  1EU4 A;  2K5W A;  1ONL A;  1RKN A;  1ESF A;  3VR3 A;  1JWS D;  1GUT A;  1TS2 A;  1DYQ A;  3D4W A;  2H4O A;  1ILQ A;  3PO3 B;  1H9K A;  1SJE D;  2EYL A;  4RH6 A;  1JOK A;  1JOR A;  4K8I A;  2NVY B;  5CC4 A;  2JEA I;  1ZXT A;  2NBF A;  4DAY A;  5DM6 3;  2KEC A;  3KBX A;  5ELE A;  2EXZ A;  2DNC A;  3KLS X;  2EYM A;  4O1N A;  4KKT A;  2V4D A;  3I91 A;  5C0X I;  5M3F B;  2EYJ A;  3PUZ A;  3SK6 A;  1Y1V B;  4L63 B;  2YYZ A;  1RDP D;  2E74 C;  3H91 A;  4OIK A;  4RGN A;  2F0P A;  1GOZ A;  3IFT A;  2WP8 J;  2RA4 A;  1DON A;  1Q12 A;  1D6E C;  2O5J C;  1J8I A;  1PYW D;  5KND A;  2A5H A;  3FPP A;  4KY7 A;  5KIX A;  3MXN A;  1RTO A;  3S1Q B;  3NBH A;  5J39 A;  2C9O A;  1WVL A;  3ONA B;  1UAP A;  3R2T A;  5I4D A;  1V1P B;  4A3E B;  1KDC A;  1O7L A;  2G9D A;  3K6O A;  2HDL A;  2IX1 A;  3HOX B;  1EY7 A;  5CYU A;  1SE2 A;  4A3G B;  2B2Y C;  4OIJ A;  1CQF A;  1F2Y A;  1SNM A;  1SE4 A;  1F9P A;  5JPN C;  2L9H A;  4XQN A;  2PZT A;  1SYD A;  4PMC A;  5C4X B;  2IX3 A;  5C0X H;  1AW7 A;  4NMZ A;  1FR3 A;  3T4A C;  4HR7 B;  1LT3 D;  4L8J A;  1JR0 D;  4XQJ A;  4HSP A;  1SE3 A;  4XTC S;  3TP6 A;  5KGU A;  3BZD B;  1RCV D;  2VB2 X;  2XIW A;  4RAU C;  2NN6 G;  5KNC A;  1F9R A;  2X6G A;  1WD0 A;  4BY7 B;  2EY5 A;  3MXP A;  1U9R A;  1HCZ A;  4FF1 A;  2TMP A;  3PMF A;  4QF4 A;  1B44 D;  5ELB A;  4LAA A;  1CA5 A;  3I4L A;  3TME A;  2JEB I;  3KUP A;  1UEA B;  4C3I G;  1QG7 A;  1VF7 A;  2PZU A;  1U4P A;  3GTQ B;  1WD1 A;  4DXF A;  2A69 D;  1TQO A;  3J7A F;  3MEH A;  2E2J B;  1WTP A;  2EJF C;  1EY9 A;  4DXG A;  5E4W C;  3CKI B;  2R3Z A;  1TWC B;  1DOK A;  4M1U B;  5ELF A;  2B2V A;  2AUJ D;  4XYO A;  2RVL A;  4FXK C;  1EWH A;  4HTH A;  3SK5 A;  4XT1 B;  5KEE A;  1B9N A;  3N52 A;  4FVM A;  4FXD A;  1H9R A;  1D5X C;  5LL6 X;  2PPB C;  2XSC A;  5C0X J;  2DY8 A;  1G8Z D;  5JOB A;  3C46 A;  1KNA A;  2K32 A;  2F0W A;  2XRQ D;  4OO1 I;  3OOC A;  4A3B B;  3GV3 A;  4DA2 A;  1ESR A;  1PRT B;  1A3V A;  3IFD A;  1PRT D;  1Y8O B;  4ABN A;  3Q22 A;  1KTK A;  1F9S A;  1S5F D;  4ZLT F;  1G2T A;  1Q1E A;  2GA4 B;  5IOC A;  4C3H B;  2OF1 A;  1TY2 A;  4TSS A;  2Z4H A;  1IL8 A;  1SYG A;  2CVR A;  2PO4 A;  4WRD A;  1EQV A;  2I07 B;  1S5D D;  1GJX A;  4F87 A;  3BG3 A;  4ZUI A;  3R3O A;  1HXY D;  1AP0 A;  4C56 C;  5FOB B;  4FXG C;  5A2Q E;  1WCM B;  4X3K A;  1WTO A;  1EFI D;  2PCF B;  1TY0 A;  4HMJ A;  1TII D;  4AYB B;  2NZ1 D;  3MC0 B;  4A93 B;  3TP5 A;  3HRZ C;  3HP3 A;  5HUR A;  4V19 0;  3R93 A;  4F7X A;  4TKO B;  1KLU D;  2PZW A;  4JBW A;  3BVZ A;  1PTO B;  2BA1 A;  3A56 A;  3D8G A;  4RCO A;  4BBR B;  3UI2 A;  4X3U A;  1JOQ A;  5BN4 A;  3AB9 A;  3SXH A;  3A55 A;  4M8A A;  3DUZ A;  1A2U A;  3VR6 A;  1EU3 A;  2KVM A;  4GZY C;  2NVX B;  3NWS A;  3LX0 A;  2H1E A;  2NTS A;  3WOF A;  2VNU D;  2NN6 H;  3JAM E;  3OPO A;  1ZYR D;  3SK8 A;  3IL8 A;  3QOJ A;  3R8B A;  5COR A;  4DN4 M;  3J81 L;  5FO7 B;  5CBA E;  1HQM C;  3A7L A;  4XYQ A;  3M3Y B;  3TN2 A;  1D1K A;  1ROD A;  3Q24 A;  2B2U A;  4RGM A;  2WB1 B;  1NUC A;  3K5M A;  5JPM C;  4FP5 D;  3Q0A A;  4ZYS A;  1B53 A;  2M00 A;  5K36 H;  2R61 A;  1O7Y A;  4IUU A;  1JCK B;  1BBX C;  4KHV A;  1Q90 A;  1HTP A;  2E2H B;  1ENC A;  3T16 A;  2K04 A;  4HMI A;  1YNN D;  1KAA A;  4R9W A;  4PNY A;  2BE5 D;  2RKS A;  3ERO A;  4P2C B;  3SR1 A;  1NCV A;  3X3M A;  3NXW A;  3BYT B;  1EOT A;  3O13 A;  4J8Q A;  1TU2 B;  4YIJ A;  2IT1 A;  5A35 A;  3P75 A;  2AQ1 B;  4DNR B;  2IL8 A;  4F88 A;  1SBB B;  5CV5 A;  1E2V A;  3DMU A;  1SND A;  1AZP A;  3C1F A;  4O42 A;  3ITP A;  2OEO A;  3SK4 A;  1EEI D;  2F0O A;  3D6W A;  4IQZ A;  1ENF A;  2ICI A;  2B2T A;  1FD7 D;  2K05 A;  3S2H B;  1A15 A;  4R8I A;  3QWN A;  1A6X A;  5EPJ A;  5LL6 S;  2E2I B;  3NTI A;  3ERQ A;  2ZT9 C;  1QNU A;  2WIN B;  4RHS A;  4G57 A;  1SXT A;  4KI0 A;  2EZV A;  1ZEQ X;  2L12 A;  2YU9 B;  4C3I B;  3QOL A;  3DWA A;  2QKI C;  4CGY B;  1IW7 C;  5JAV A;  4NP5 A;  2EOT A;  1V1O A;  2A74 C;  3A8I E;  5ISR A;  4RKB A;  1D2B A;  1XYI A;  3E0J A;  4KHZ A;  1VCI A;  2JSO A;  1A3T A;  1R9T B;  1EL0 A;  1LTA D;  5FKA C;  3I4M B;  3OMG A;  3PIO 3;  1GHJ A;  2E2D C;  3NTH A;  4XXE A;  1GUN A;  3M4Y A;  4RGT A;  2HUG A;  3GTK B;  5I9O A;  2B2Y A;  2SNM A;  3KLR A;  1TWF B;  1H9S A;  4CKB A;  3VR5 A;  3PUV A;  3J80 L;  5D3I B;  2C5C A;  2CHB D;  3W2D A;  4B9X A;  1B1Z A;  2MGS A;  1TKW B;  2BDO A;  3VA7 A;  3HOY B;  2JP1 A;  2Q8T A;  2RBM A;  2K1B A;  5K5P A;  2J0T D;  1PZJ D;  1B50 A;  2IW3 A;  1GUO A;  1T5E A;  2A68 C;  3MAQ A;  3S15 B;  4MHE A;  2F3V A;  2BA0 A;  1I50 B;  1R4P B;  2BDN A;  5J22 A;  5EJW A;  1CK1 A;  4ZUJ A;  1FNU A;  3G7L A;  1BCP D;  4IFD H;  2KEE A;  2QIL A;  1S5E D;  2SOB A;  5JVG 3;  3OIP A;  1CM9 A;  5D65 A;  2F3W A;  3M85 A;  2PW7 A;  4C2M B;  5C4Z A;  4CJ1 B;  2F0U A;  3I70 A;  4ZKC B;  3M7G A;  5M9O A;  1B3A A;  4U67 3;  1AFP A;  2F0T A;  5KYL A;  3BVG A;  2L0C A;  3A7A B;  4IUN A;  3VR2 A;  5CMD A;  5CV4 A;  3VYR A;  2RSO A;  3RUZ A;  3S1R B;  3GTP B;  4KJN A;  3TP8 A;  1IKL A;  5IGG A;  2F0S A;  1S4Z A;  3KBG A;  4ME5 A;  4R8N A;  3RMH A;  5C4J B;  1LTB D;  2F0D A;  1WTR A;  4Q0F A;  5FLX L;  4FNF A;  3W3A A;  1PFM A;  1F2M A;  1HQR D;  2B39 A;  2F0M A;  5M5Y B;  1ILP A;  2EDG A;  2L11 A;  3AU7 A;  4UAI A;  3DEP A;  5BN3 A;  5C0X G;  3EVQ A;  1R4Q B;  3HOU B;  2JA6 B;  1G2S A;  3GV6 A;  4OGQ C;  2F1M A;  1F2L A;  3DWP A;  1J9O A;  1PDQ A;  3K57 A;  1ZYR C;  4U68 A;  1STB A;  2MPM A;  1I3Q B;  2L55 A;  2R6G A;  2M9V A;  1K83 B;  3BDO A;  3KLS A;  2K6A A;  3MTS A;  3ND8 A;  1TWA B;  4CKC A;  1BCP F;  1HTL D;  2MJ8 A;  1BCP C;  1U4R A;  1L0X B;  3MFG A;  2RSN A;  5I2X A;  1ML0 D;  1K8O A;  2QDB A;  1PFN A;  4KKS A;  4PMB A;  2FMC A;  5HGT A;  1QIL A;  1S5B D;  4DU9 A;  1JWM D;  2A6H C;  1ET9 A;  5C6A A;  4IUQ A;  2IPK D;  3TBI B;  5F2D A;  5EBC A;  2A6E D;  3BYY B;  3HKZ B;  3ND9 A;  4HAE A;  3S9W A;  3VYT A;  3M4O B;  1G29 1;  3D31 A;  5E4X A;  3K59 A;  4I7Z C;  3VYS A;  3HS0 C;  1QB5 D;  4OO1 H;  4RA8 A;  3NWT A;  3FKI B;  5M5X B;  1I4G A;  3WOE A;  1SYE A;  2BCO A;  1OXU A;  3QJY A;  3NQI A;  1BXT A;  1EIG A;  1A3U A;  1NSN S;  2B63 B;  1TS4 A;  1VMP A;  5EPK A;  1DOL A;  4UDU C;  1STH A;  3V05 A;  2FHT A;  2FIN B;  3TZD A;  3HOV B;  2PMZ B;  4CKE A;  1ZKO A;  5IGD A;  1XXG A;  1CTM A;  3TP7 A;  4JK1 C;  3GD7 A;  4C1N K;  1Y8N B;  4A3K B;  4IUR A;  4H44 C;  4RFB A;  2AWO A;  2ZXR A;  1WTV A;  3MA2 B;  3H94 A;  3PUX A;  2F0E A;  3C2P A;  1Z6H A;  1DXM A;  4KK7 A;  1I4R A;  3VA5 A;  2B2W A;  1IW7 D;  4KV6 A;  2HCI A;  1BUV T;  1LAB A;  3PO2 B;  4RWS C;  2I46 A;  1F77 A;  4EVO A;  3K5O A;  2K33 A;  4C3J G;  2N88 A;  5G3L D;  3SDZ A;  1IHZ A;  2F0G A;  1EY8 A;  1WTQ A;  3S2D B;  3QB3 A;  2F03 A;  4I65 A;  3D6C A;  1L0Y B;  1SNP A;  3G6J B;  5T1I A;  3K5L A;  3S17 B;  2QCP X;  1W6J A;  1TT2 A;  1HPC A;  1OXS C;  1JOO A;  2WKD A;  1LTG D;  1ENA A;  1I4H A;  1MSH A;  5C3X A;  1XTC D;  3D4D A;  3FDT A;  4HSV A;  4IUV A;  5AFW A;  1V43 A;  3TZU A;  1EYD A;  3S1M B;  3FEW X;  3I3C A;  4X3S A;  3I4N B;  1I6V C;  1O7Z A;  4MN3 A;  3QIA A;  4KMU C;  1LTI D;  1YNJ C;  1SSO A;  2HDM A;  4DF7 A;  1STE A;  2Q8R E;  5C3W A;  3CRK C;  5CV6 A;  1FNV A;  3LWE A;  4KY6 A;  1IYV A;  5DAU A;  1LLR D;  4DGZ A;  4A3M B;  5IT9 L;  4J6H A;  3CRL C;  4ZRZ A;  4F8M A;  4XQQ A;  1Y1W B;  2O4X A;  2BOS A;  1E2Z A;  4K5W A;  1NAP A;  3C1E A;  4C1N I;  2LY7 A;  2F0N A;  1SMY D;  2JXM B;  4N9T A;  2K7V A;  5D14 A;  2QEJ C;  3SEB A;  3V96 A;  1I4Q A;  1W6K A;  5IIF A;  1LO5 D;  2F0K A;  5KRU A;  1LT6 D;  1QNK A;  4DK1 A;  1B2T A;  4FO2 A;  1JIC A;  5IGB A;  3F2U A;  2CW0 C;  3HOZ B;  1D5M C;  3S1N B;  2HCC A;  2EPB A;  1C4Q A;  1STG A;  4CJ0 B;  2AQ3 B;  1LAC A;  1C8C A;  2LMC B;  2E75 C;  1QOH A;  1KDB A;  3RD4 A;  1D1I A;  2K5D A;  4OL7 A;  4LJZ C;  1B9M A;  3URY A;  3L9A X;  3SHL A;  4NW2 A;  1JC7 A;  2WV6 D;  1PMR A;  4IUP A;  5D3D A;  4HED A;  5CV7 A;  1RD9 D;  4RKL A;  4G7H C;  1VF5 C;  2K5Q A;  5CV9 A;  4EQN A;  1D5Z C;  3E5S A;  3BVM A;  2A69 C;  3D4R A;  5IGE A;  1M4V A;  5JEA J;  2EY2 A;  5JEA H;  1BOS A;  5COY A;  1LT5 D;  2F0H A;  1HUN A;  5IGF A;  3MXU A;  3PV0 A;  3J81 E;  1RHP A;  3GTO B;  2IWH A;  4CJ2 C;  2WKC A;  3OSO A;  1YNJ D;  1EZ6 A;  1OXT A;  1G91 A;  5A2Q L;  1FNW A;  2KOL A;  2OXP A;  5EGT A;  1DCZ A;  4KTA A;  2JE6 I;  3TDQ A;  2D62 A;  1H9S B;  3T56 B;  3OIQ A;  5I2Y A;  2F0V A;  4BY1 B;  3SE0 A;  2ENB A;  1EYA A;  3OWE B;  2R93 B;  1DM0 B;  4Q5V A;  1MBY A;  2DNE A;  4K14 A;  5C5L A;  1EEF D;  1TS3 A;  4RHR A;  3I90 A;  3OHX C;  4KD3 A;  4K6D A;  4A3F B;  1SMY C;  3R2I A;  2M2L A;  4EGV A;  3HEJ A;  3NK9 A;  3Q6S A;  5FLX E;  4XIG S;  1GUW A;  3EFX D;  3J7A V;  1U4M A;  4WFN 3;  4QMG A;  1NR2 A;  2HQE A;  2KUM A;  1Z47 A;  5EKK A;  4K2L A;  5I6Y A;  2FFK B;  3HGB A;  3QO2 A;  2PW5 A;  5BN5 A;  3Q23 A;  3K58 A;  1F9Q A;  4A3J B;  1IYU A;  1ICW A;  2L1B A;  5LHY 1;  1VDZ A;  3MHB A;  2K01 A;  2PQE A;  4QUC A;  4FF3 A;  2A6H D;  1A2T A;  4HCE A;  2B2U C;  1CHP D;  4HCS A;  1LTS D;  2A68 D;  1FGB D;  5FO8 B;  4IFD G;  1CI3 M;  1HA5 A;  1JE4 A;  2NN6 I;  2NWG A;  1PZK D;  5EKL A;  3I72 A;  5IT9 E;  3GTJ B;  1SDF A;  2LFN A;  3DXJ C;  1BF4 A;  4ID6 A;  2XWJ B;  4KKU A;  4QCL A;  2EYH A;  1HA6 A;  1GUG A;  4A3D B;  4K5V A;  1SNQ A;  3X3N A;  4FF4 A;  1CFM A;  3CU7 A;  5FK9 C;  2NUC A;  2B2T C;  3S14 B;  3KK7 A;  4PQX A;  2O2L D;  3H6M A;  4KY5 A;  1JB3 A;  2TSS A;  1NR4 A;  2KJX A;  4H13 C;  3H0G B;  5KYI A;  2J4X A;  3PUY A;  1BDO A;  2JYO A;  1CQV A;  1BO0 A;  3ZYY X;  3FRP B;  3LWU A;  2F0L A;  3A54 A;  2IX0 A;  3EA6 A;  2AQ2 B;  2EYP A;  2OT2 A;  5JJZ A;  3I8Z A;  5ELD A;  1JQY D;  1HFN A;  4C3J B;  2NB0 A;  2B8G A;  2DY7 A;  3MZ5 A;  1FYC A;  2XNA C;  4IZ8 A;  4FYD A;  2JA8 B;  1BCP B;  1JWU D;  1TVX A;  2KCN A;  4CBV A;  4NDX A;  4IUT A;  2JA5 B;  4ZK9 B;  3BS1 A;  4L6T B;  4IFD I;  5E1F A;  1PXU A;  4BWG B;  1Z7T A;  3FVQ A;  4E6I A;  1GXD C;  2D9U A;  3CHB D;  4DFA A;  4DAV A;  5IGC A;  2EY6 A;  2J7Z A;  1C48 A;  3NHH A;  1Y69 U;  3SVM A;  1EQT A;  5EQ0 A;  1BR9 A;  4IAL A;  3IKJ A;  2JA7 B;  4Z9C B;  3NE5 B;  4H7B A;  3IAY A;  1QJO A;  1I4X A;  2BE5 C;  2DN8 A;  1DD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...