2N71A

Nmr structure of cmpi-ii, a serin protease inhibitor isolated from mollusk cenchitis muricatus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
AEDCVGRKACTREWYPVCGSDGVTYSNPCNFSAQQEQCDPNITIAHMGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease inhibitor 2
publication title Solution structure and backbone dynamics of CmPI-II, a protease inhibitor isolated from mollusk Cenchitis muricatus.
rcsb
source organism Cenchritis muricatus
molecule tags Hydrolase inhibitor
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2n71A00
2NU0I 1OYVI 1DS2I 1SGQI 1UVGA 2JZMA 1CSOI 1YU6C 2NU4I 1TURA 1DS3I 3TJQA 1PCEA 1H0ZA 1MT1A 1OVOA 2QQCA 3OVOA 1M8BA 2NU2I 4HGUA 3SGQI 2GKRI 2KMPA 1N13A 2WCYA 1SGYI 2F3CI 2BUSA 1SGRI 4GI3C 2B0UC 2P6AC 1CGII 2KMRA 2KCXA 2SGDI 3B4VC 3QTLD 1BMOA 1CGJI 2N52A 2N71A 1LR7A 2ERWA 2NU1I 1IY6A 1NUBA 1OMUA 1KMAA 1SGEI 1TGSI 2KMOA 2KMQA 1UUCA 2GKTI 2OVOA 3HH2C 3SGBI 5DAEA 1Y1CA 4SGBI 1CE3A 2GKVA 2XRCA 2JXDA 1Z7KB 1LR8A 1CHOI 2V53A 1IY5A 2M5XA 5JHWC 1SGDI 1TBQR 2NU3I 1IW4A 2SGQI 1TIHA 1PPFI 1AN1I 1HPTA 1HDLA 1CT0I 1PJUA 1SGNI 1TBRR 1FYBA 1Y1BA 1M8CA 1CT2I 1BUSA 2N17A 1HJAI 1CT4I 1LR9A 2SGPI 1SGPI 1TUSA 2SGFI 3SEKC 2SGEI 1UVFA 4OVOA 2JYYA 2ARPF 2QQDA 2LEOA 1R0RI 1OMTA 1YTPA
chains in the Genus database with same CATH superfamily
2RC4A 2X3TA 2NU0I 3TOAA 1OYVI 1DS2I 2QQEA 2J9RA 5J8FA 2ELIA 4UXHA 1SGQI 4FKDA 1UVGA 2JZMA 1CSOI 2W0TA 2YUUA 1YU6C 2NU4I 3E2IA 1TURA 2GVIA 2V1CC 1RFHA 1DS3I 3TJQA 1PCEA 4JCVE 2V1CA 3TO7A 1H0ZA 2ORVA 1MT1A 1OVOA 2DIPA 2QQCA 4WP4A 1MJ9A 1MJBA 3OVOA 1FY7A 1M8BA 2NU2I 4HGUA 1ULMA 1W4RA 2Y0MA 1P9ZA 3SGQI 3UOEA 2DKVA 2GKRI 1N13A 2KMPA 2PQ8A 2WCYA 1FAQA 1SGYI 1V1HA 2F3CI 1TBNA 2BUSA 3CXLA 3MEKA 1SGRI 4UXIA 4DNCA 4GI3C 5J8CA 2B0UC 1NXUA 2B8TA 1ULNA 3UEYA 1FARA 2L7XA 2P6AC 3UFFA 1CGII 2CJSC 2CWGA 4E1RA 1U5KA 2KMRA 1KBEA 1W3SA 1XBTA 2KCXA 2ROWA 5FUWA 1KBFA 3BJIA 3FSYA 2SGDI 3QWPA 1P9GA 9WGAA 3OXGA 1PTRA 3B4VC 3QTLD 2WGCA 1BMOA 1CGJI 2N52A 2N71A 1UHAA 1LR7A 5E3PA 2ERWA 3TOBA 3GOXA 2NU1I 3D00A 2VRWB 1IY6A 4L9MA 1NUBA 1K7VA 1OMUA 1TOTA 3PDNA 5EX0A 5FUXA 2WVJA 2N1AB 1KMAA 2QPOA 1SGEI 1TBOA 1TGSI 2KMOA 2KMQA 2ENZA 1HEVA 3OXFA 2ODDA 1UUCA 1WGTA 2GKTI 2OVOA 3HH2C 1ULKA 3QAHA 3SGBI 4MPIA 2JW6A 1PTQA 1Y1CA 1XA6A 5DAEA 3UGDA 3FC3A 2DB6A 4SGBI 5EX3A 1Y8FA 2GIVA 2GKVA 2ORWA 2XRCA 1CE3A 2JXDA 4B6DA 1Z7KB 1LR8A 5HQ8A 1Z2IA 2YQPA 1CHOI 4AMLA 2ENNA 2LB7A 2FNFX 5FUYA 2V53A 1IY5A 2M5XA 5JHWC 1Q9BA 4UXJA 1K7UA 1X74A 1SGDI 2K9HA 3RU0A 2E73A 1TBQR 2NU3I 7WGAA 3VE5A 1IW4A 3KY9A 3FSXA 3UGIA 2SGQI 1TIHA 2UVOA 1PPFI 1AN1I 5HI7A 4E1PA 2CWFA 3OL0A 1HPTA 1HDLA 1CT0I 5FUVA 2L8EA 1PJUA 1XX6A 3TO6A 2LUYA 1VDDA 1SGNI 3VDPA 2CWHA 1TBRR 3OXLA 5E3RA 2OZUA 2J87A 1FYBA 1Y1BA 3R5BA 3TO9A 1M8CA 3UGLA 1V1IA 1CT2I 1BUSA 2N17A 5CCLA 3R5AA 1HJAI 2OD1A 1CT4I 2A20A 1WGCA 1LR9A 5CCMA 2E5RA 1SGPI 1TUSA 2OU2A 2RIJA 2SGFI 2SGPI 3VDUA 3UEJA 2JA1A 2UZ3A 3R5DA 3SEKC 1K7TA 2QQ0A 1WTJA 2SGEI 1X4SA 1R79A 1UVFA 4OVOA 1WKXA 1S20A 2JYYA 2ARPF 4A24A 2X52A 3E59A 2QQDA 5E3QA 2LEOA 3R5CA 1R0RI 1OMTA 1MJAA 1YTPA
chains in the Genus database with same CATH topology
2NU0I 1OYVI 1DS2I 2QQEA 2J9RA 2ELIA 4UXHA 1SGQI 4FKDA 1UVGA 2JZMA 1CSOI 2W0TA 2YUUA 1YU6C 2NU4I 3E2IA 1TURA 2GVIA 2V1CC 1RFHA 1DS3I 3TJQA 1PCEA 4JCVE 2V1CA 1H0ZA 2ORVA 1MT1A 1OVOA 2DIPA 2QQCA 3OVOA 1M8BA 2NU2I 4HGUA 1W4RA 3SGQI 2GKRI 2KMPA 1N13A 1FAQA 2WCYA 1SGYI 1V1HA 2F3CI 1TBNA 2BUSA 3CXLA 3MEKA 1SGRI 4UXIA 4GI3C 2B0UC 2B8TA 3UEYA 1FARA 2L7XA 2P6AC 3UFFA 1CGII 2CJSC 4E1RA 1U5KA 2KMRA 1KBEA 1W3SA 1XBTA 2KCXA 2ROWA 5FUWA 1KBFA 3BJIA 2SGDI 3QWPA 3OXGA 1PTRA 3B4VC 3QTLD 1BMOA 1CGJI 2N52A 2N71A 1LR7A 2ERWA 3GOXA 2NU1I 3D00A 2VRWB 1IY6A 4L9MA 1NUBA 1OMUA 1TOTA 3PDNA 5EX0A 5FUXA 2WVJA 2N1AB 1KMAA 2QPOA 1SGEI 1TBOA 1TGSI 2KMOA 2KMQA 2ENZA 3OXFA 2ODDA 1UUCA 2GKTI 2OVOA 3HH2C 3SGBI 2JW6A 1PTQA 1Y1CA 1XA6A 5DAEA 3UGDA 3FC3A 2DB6A 4SGBI 5EX3A 1Y8FA 2GKVA 2ORWA 2XRCA 1CE3A 2JXDA 4B6DA 1Z7KB 1LR8A 5HQ8A 2YQPA 1CHOI 2ENNA 2FNFX 5FUYA 2V53A 1IY5A 2M5XA 5JHWC 4UXJA 1X74A 1SGDI 2K9HA 3RU0A 2E73A 1TBQR 2NU3I 3VE5A 1IW4A 3KY9A 3UGIA 2SGQI 1TIHA 1PPFI 1AN1I 5HI7A 4E1PA 3OL0A 1HPTA 1HDLA 1CT0I 5FUVA 2L8EA 1PJUA 1XX6A 2LUYA 1VDDA 1SGNI 3VDPA 3OXLA 1TBRR 2J87A 1FYBA 1Y1BA 3UGLA 1M8CA 1V1IA 1CT2I 1BUSA 2N17A 5CCLA 1HJAI 2OD1A 1CT4I 2A20A 1LR9A 5CCMA 2E5RA 1SGPI 1TUSA 2SGPI 2SGFI 3VDUA 3UEJA 2JA1A 2UZ3A 3SEKC 2QQ0A 2SGEI 1X4SA 1R79A 1UVFA 4OVOA 2JYYA 4A24A 2ARPF 3E59A 2QQDA 2LEOA 1R0RI 1OMTA 1YTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NU0 I;  1OYV I;  1DS2 I;  1SGQ I;  1UVG A;  2JZM A;  1CSO I;  1YU6 C;  2NU4 I;  1TUR A;  1DS3 I;  3TJQ A;  1PCE A;  1H0Z A;  1MT1 A;  1OVO A;  2QQC A;  3OVO A;  1M8B A;  2NU2 I;  4HGU A;  3SGQ I;  2GKR I;  2KMP A;  1N13 A;  2WCY A;  1SGY I;  2F3C I;  2BUS A;  1SGR I;  4GI3 C;  2B0U C;  2P6A C;  1CGI I;  2KMR A;  2KCX A;  2SGD I;  3B4V C;  3QTL D;  1BMO A;  1CGJ I;  2N52 A;  2N71 A;  1LR7 A;  2ERW A;  2NU1 I;  1IY6 A;  1NUB A;  1OMU A;  1KMA A;  1SGE I;  1TGS I;  2KMO A;  2KMQ A;  1UUC A;  2GKT I;  2OVO A;  3HH2 C;  3SGB I;  5DAE A;  1Y1C A;  4SGB I;  1CE3 A;  2GKV A;  2XRC A;  2JXD A;  1Z7K B;  1LR8 A;  1CHO I;  2V53 A;  1IY5 A;  2M5X A;  5JHW C;  1SGD I;  1TBQ R;  2NU3 I;  1IW4 A;  2SGQ I;  1TIH A;  1PPF I;  1AN1 I;  1HPT A;  1HDL A;  1CT0 I;  1PJU A;  1SGN I;  1TBR R;  1FYB A;  1Y1B A;  1M8C A;  1CT2 I;  1BUS A;  2N17 A;  1HJA I;  1CT4 I;  1LR9 A;  2SGP I;  1SGP I;  1TUS A;  2SGF I;  3SEK C;  2SGE I;  1UVF A;  4OVO A;  2JYY A;  2ARP F;  2QQD A;  2LEO A;  1R0R I;  1OMT A;  1YTP A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  2X3T A;  2NU0 I;  3TOA A;  1OYV I;  1DS2 I;  2QQE A;  2J9R A;  5J8F A;  2ELI A;  4UXH A;  1SGQ I;  4FKD A;  1UVG A;  2JZM A;  1CSO I;  2W0T A;  2YUU A;  1YU6 C;  2NU4 I;  3E2I A;  1TUR A;  2GVI A;  2V1C C;  1RFH A;  1DS3 I;  3TJQ A;  1PCE A;  4JCV E;  2V1C A;  3TO7 A;  1H0Z A;  2ORV A;  1MT1 A;  1OVO A;  2DIP A;  2QQC A;  4WP4 A;  1MJ9 A;  1MJB A;  3OVO A;  1FY7 A;  1M8B A;  2NU2 I;  4HGU A;  1ULM A;  1W4R A;  2Y0M A;  1P9Z A;  3SGQ I;  3UOE A;  2DKV A;  2GKR I;  1N13 A;  2KMP A;  2PQ8 A;  2WCY A;  1FAQ A;  1SGY I;  1V1H A;  2F3C I;  1TBN A;  2BUS A;  3CXL A;  3MEK A;  1SGR I;  4UXI A;  4DNC A;  4GI3 C;  5J8C A;  2B0U C;  1NXU A;  2B8T A;  1ULN A;  3UEY A;  1FAR A;  2L7X A;  2P6A C;  3UFF A;  1CGI I;  2CJS C;  2CWG A;  4E1R A;  1U5K A;  2KMR A;  1KBE A;  1W3S A;  1XBT A;  2KCX A;  2ROW A;  5FUW A;  1KBF A;  3BJI A;  3FSY A;  2SGD I;  3QWP A;  1P9G A;  9WGA A;  3OXG A;  1PTR A;  3B4V C;  3QTL D;  2WGC A;  1BMO A;  1CGJ I;  2N52 A;  2N71 A;  1UHA A;  1LR7 A;  5E3P A;  2ERW A;  3TOB A;  3GOX A;  2NU1 I;  3D00 A;  2VRW B;  1IY6 A;  4L9M A;  1NUB A;  1K7V A;  1OMU A;  1TOT A;  3PDN A;  5EX0 A;  5FUX A;  2WVJ A;  2N1A B;  1KMA A;  2QPO A;  1SGE I;  1TBO A;  1TGS I;  2KMO A;  2KMQ A;  2ENZ A;  1HEV A;  3OXF A;  2ODD A;  1UUC A;  1WGT A;  2GKT I;  2OVO A;  3HH2 C;  1ULK A;  3QAH A;  3SGB I;  4MPI A;  2JW6 A;  1PTQ A;  1Y1C A;  1XA6 A;  5DAE A;  3UGD A;  3FC3 A;  2DB6 A;  4SGB I;  5EX3 A;  1Y8F A;  2GIV A;  2GKV A;  2ORW A;  2XRC A;  1CE3 A;  2JXD A;  4B6D A;  1Z7K B;  1LR8 A;  5HQ8 A;  1Z2I A;  2YQP A;  1CHO I;  4AML A;  2ENN A;  2LB7 A;  2FNF X;  5FUY A;  2V53 A;  1IY5 A;  2M5X A;  5JHW C;  1Q9B A;  4UXJ A;  1K7U A;  1X74 A;  1SGD I;  2K9H A;  3RU0 A;  2E73 A;  1TBQ R;  2NU3 I;  7WGA A;  3VE5 A;  1IW4 A;  3KY9 A;  3FSX A;  3UGI A;  2SGQ I;  1TIH A;  2UVO A;  1PPF I;  1AN1 I;  5HI7 A;  4E1P A;  2CWF A;  3OL0 A;  1HPT A;  1HDL A;  1CT0 I;  5FUV A;  2L8E A;  1PJU A;  1XX6 A;  3TO6 A;  2LUY A;  1VDD A;  1SGN I;  3VDP A;  2CWH A;  1TBR R;  3OXL A;  5E3R A;  2OZU A;  2J87 A;  1FYB A;  1Y1B A;  3R5B A;  3TO9 A;  1M8C A;  3UGL A;  1V1I A;  1CT2 I;  1BUS A;  2N17 A;  5CCL A;  3R5A A;  1HJA I;  2OD1 A;  1CT4 I;  2A20 A;  1WGC A;  1LR9 A;  5CCM A;  2E5R A;  1SGP I;  1TUS A;  2OU2 A;  2RIJ A;  2SGF I;  2SGP I;  3VDU A;  3UEJ A;  2JA1 A;  2UZ3 A;  3R5D A;  3SEK C;  1K7T A;  2QQ0 A;  1WTJ A;  2SGE I;  1X4S A;  1R79 A;  1UVF A;  4OVO A;  1WKX A;  1S20 A;  2JYY A;  2ARP F;  4A24 A;  2X52 A;  3E59 A;  2QQD A;  5E3Q A;  2LEO A;  3R5C A;  1R0R I;  1OMT A;  1MJA A;  1YTP A; 
#chains in the Genus database with same CATH homology
 2NU0 I;  1OYV I;  1DS2 I;  2QQE A;  2J9R A;  2ELI A;  4UXH A;  1SGQ I;  4FKD A;  1UVG A;  2JZM A;  1CSO I;  2W0T A;  2YUU A;  1YU6 C;  2NU4 I;  3E2I A;  1TUR A;  2GVI A;  2V1C C;  1RFH A;  1DS3 I;  3TJQ A;  1PCE A;  4JCV E;  2V1C A;  1H0Z A;  2ORV A;  1MT1 A;  1OVO A;  2DIP A;  2QQC A;  3OVO A;  1M8B A;  2NU2 I;  4HGU A;  1W4R A;  3SGQ I;  2GKR I;  2KMP A;  1N13 A;  1FAQ A;  2WCY A;  1SGY I;  1V1H A;  2F3C I;  1TBN A;  2BUS A;  3CXL A;  3MEK A;  1SGR I;  4UXI A;  4GI3 C;  2B0U C;  2B8T A;  3UEY A;  1FAR A;  2L7X A;  2P6A C;  3UFF A;  1CGI I;  2CJS C;  4E1R A;  1U5K A;  2KMR A;  1KBE A;  1W3S A;  1XBT A;  2KCX A;  2ROW A;  5FUW A;  1KBF A;  3BJI A;  2SGD I;  3QWP A;  3OXG A;  1PTR A;  3B4V C;  3QTL D;  1BMO A;  1CGJ I;  2N52 A;  2N71 A;  1LR7 A;  2ERW A;  3GOX A;  2NU1 I;  3D00 A;  2VRW B;  1IY6 A;  4L9M A;  1NUB A;  1OMU A;  1TOT A;  3PDN A;  5EX0 A;  5FUX A;  2WVJ A;  2N1A B;  1KMA A;  2QPO A;  1SGE I;  1TBO A;  1TGS I;  2KMO A;  2KMQ A;  2ENZ A;  3OXF A;  2ODD A;  1UUC A;  2GKT I;  2OVO A;  3HH2 C;  3SGB I;  2JW6 A;  1PTQ A;  1Y1C A;  1XA6 A;  5DAE A;  3UGD A;  3FC3 A;  2DB6 A;  4SGB I;  5EX3 A;  1Y8F A;  2GKV A;  2ORW A;  2XRC A;  1CE3 A;  2JXD A;  4B6D A;  1Z7K B;  1LR8 A;  5HQ8 A;  2YQP A;  1CHO I;  2ENN A;  2FNF X;  5FUY A;  2V53 A;  1IY5 A;  2M5X A;  5JHW C;  4UXJ A;  1X74 A;  1SGD I;  2K9H A;  3RU0 A;  2E73 A;  1TBQ R;  2NU3 I;  3VE5 A;  1IW4 A;  3KY9 A;  3UGI A;  2SGQ I;  1TIH A;  1PPF I;  1AN1 I;  5HI7 A;  4E1P A;  3OL0 A;  1HPT A;  1HDL A;  1CT0 I;  5FUV A;  2L8E A;  1PJU A;  1XX6 A;  2LUY A;  1VDD A;  1SGN I;  3VDP A;  3OXL A;  1TBR R;  2J87 A;  1FYB A;  1Y1B A;  3UGL A;  1M8C A;  1V1I A;  1CT2 I;  1BUS A;  2N17 A;  5CCL A;  1HJA I;  2OD1 A;  1CT4 I;  2A20 A;  1LR9 A;  5CCM A;  2E5R A;  1SGP I;  1TUS A;  2SGP I;  2SGF I;  3VDU A;  3UEJ A;  2JA1 A;  2UZ3 A;  3SEK C;  2QQ0 A;  2SGE I;  1X4S A;  1R79 A;  1UVF A;  4OVO A;  2JYY A;  4A24 A;  2ARP F;  3E59 A;  2QQD A;  2LEO A;  1R0R I;  1OMT A;  1YTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...