2N7DA

Solution structure of the ubl domain of human ddi2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHHHHHSSGHIEGRHMLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human DNA-Damage-Inducible 2 Protein Is Structurally and Functionally Distinct from Its Yeast Ortholog.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords Protein DDI1 homolog 2
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n7dA00
1WE7A 2LGDA 4EOYA 2A4ZA 4KZCA 2I1KA 3UINB 1AARA 2IY0B 3QHTA 2J0MA 4W9KA 4MM3A 1M94A 1P3QU 4EZKA 1V2YA 2PE6B 3H7PB 3ZDMC 1KM7A 2KC1A 4XC2A 4DHJD 3ZKJC 3ZIMA 2KX0A 4FA6A 3B1LX 3OAWA 3QWZB 3QK0A 3VTVA 3X23A 1IPGA 1OTRB 1WX9A 3NHEB 1YX5B 4WJNA 1WGRA 2GBNA 1WF9A 1WRDB 1E8WA 4HCPB 5J18A 2IBIB 2KX3A 5GMVA 2BYVE 3QARA 2D11A 3A4SC 2O2VB 2N9PC 1H8CA 4GDLB 3OJ4B 4W9CA 2BYFA 4CYEA 2LJ5A 2AL3A 2BF8B 3L13A 3EECA 1EUVB 3HK0A 3A9JB 4TQ0A 2MX2A 2LWPA 2L0FA 3PTFC 4BKTA 3WANA 1WXAA 4WJOA 1Y8RC 3A9KA 2B3AA 2FUHB 2LD9A 2IZVB 3CSTA 3U30A 1WGDA 4WWOA 2KJRA 2Z0DB 2HD5B 3VQIA 2MA9B 1SIFA 4ANVA 2J0KA 3VUYA 3UF8A 1Q5WB 2N7DA 4ANXA 2D2QA 4FADA 4IWPA 2WDTB 3VHTC 5IA7A 2KC2A 3ZTDA 3ONSA 2KTRB 2IO0B 2LGXA 4KSLC 4WJQA 4FJVB 4F7ZA 2KHWB 2KLGA 3OLMD 5C23A 3ML9A 1YJ1A 2O6VA 2CS4A 5KHQA 5CHVC 4G3XB 3NS8A 2BGFA 2KDIA 4W9LA 3WAMA 3JYUA 1U4AA 2MQJA 3KW5B 4EZLA 4HVBA 1UBIA 3L16A 1GC7A 3DOWA 4WAAA 4XZ4A 2KJ6A 3AU5A 1V6EA 2ZCCA 4FHKA 1WJ4A 4G11A 3A1QB 4PS3A 1RAXA 3PV1A 4DHZB 2RGFA 4MDKE 5TR5A 1I42A 2JXXA 2DYBA 2L76A 4F1SA 4ANUA 4W9HA 1GC6A 2KMAA 3LDZE 4GMVA 2JUOA 2DAJA 2N7EA 3ML8A 4GDKA 4KV2A 2ZNVB 4MGIE 2JY6A 4GGQA 3QA8A 2XK5B 3W1SC 2QHOA 5L83A 2CHZA 5BO4B 2KTFA 2JRIB 2NBWB 1X1MA 2IY1B 4A20A 1OEYJ 2M1MA 3QJZA 4K81A 4MSMB 4A3PA 2N4FA 1V81A 3M63B 1ZKHA 3IHPC 1L7YA 3QQ8B 4ICVA 2MW5A 5CHFA 2M0XA 2REXA 4GIVA 3KYDD 2LRUA 2LVPA 1Z5SB 1UBQA 3VH4B 4JLCA 2NR2A 1WM3A 3S2AA 2K8HA 4DBGA 2C7HA 4HK2A 4HWIB 4CHKA 4W9IA 4EKUA 2LI5A 1WMHB 3ZVVA 4NQKE 2KJHB 2GMIC 3EFUA 2V3SA 3A4RA 1VD2A 4JGHB 4ZRIA 2KD0A 3V60A 3VTWA 3ZW3A 4BKSD 4G0NB 5G55A 3GOEA 3EC8A 2MBOA 2ZZPB 3K9PB 4JL9A 1ISNA 5DPTA 4ZYNA 5J17A 2G3QB 4KVGB 3NZSA 2ZEQA 5CTRC 5D6JB 3NOBA 4GDKB 4KDIC 3SHQA 2L00B 3APDA 1LQBA 3N32A 2WX1A 3K9OB 3PHXB 4FN2A 4KIKB 4FJZA 3APCA 1YX6B 4DXAB 1K8RB 1R4MI 3UQAA 2JF5A 2ASQA 2D3GA 3VUWA 2BWES 4LCDE 3PZDA 3U7DA 3DQVA 5J2RA 2AWTA 2WYQA 1RFAA 2R2OA 2KKCA 2LUEA 3GZNI 2N9EB 4MGYE 4PS8A 3ZTCA 3RZWC 1Z2MA 5JZEB 4FBJB 1KLVA 1V9JA 2KDFB 1LXDA 2HE7A 2FIDA 3W1SA 2PJHA 2GBMA 2IO2B 2LVQA 2RR9A 3L08A 3Q3FA 1TBEA 3MJWA 1NDDA 2O6VB 4NY0A 3ZUNA 4DHZE 3ZNHB 3DBSA 2IO1B 2ZVNA 4OVUA 3M3JA 1WXSA 3X0WA 1EF1A 2KANA 2KTRA 3B08A 4MH0E 3RZFA 3ECIA 5KHOA 2MWSB 1EF5A 4E3CA 4AOFA 2UWQA 4LJPB 4TUUA 2KMCA 1WM2A 4PYZA 5D2MB 4AUQC 2CHWA 2KWCA 2M4NA 3V6EB 2MP2B 3JSVB 3JW0X 3KH0A 4DWFA 4F8CB 3A9KB 3LJ3A 3BINA 4RM9A 2KN5A 3PHWB 3PRZA 1J0GA 2L7RA 2YLMA 3DBRI 1WX7A 2EMSA 4IWQA 3TIXA 1F9JA 3A9JA 4JIOU 4KZ0A 5DPRA 5L95C 1RRBA 3ZLZA 1GJZA 2Z0EB 3RUIB 1XQQA 2KFJA 3VVWB 2JWZA 4MJSB 2YVCA 3PLVA 4JQWC 2KQSA 2M8SA 4MJSA 2FCQA 2LASA 2XEWA 2JVCA 4XX5A 2K6QA 1WZ0A 2WWZA 3VH3B 3HIZA 5C1ZA 2WX0A 1WXMA 3PPAA 4E74A 2UYZB 3RYTA 3MHSD 3H1UA 4WWNA 4AWJA 4IC7B 3JVZX 5AZHA 1J8CA 3PRPB 3SD5A 3DVNV 3AI5A 3DBHI 2MP2A 2KXJA 3JSVA 4FLHA 2RD0A 3H7PA 1E5WA 4GN1A 2DENB 2MRPA 3N3KB 3L54A 4M0WB 2DZMA 2C7MB 1WH3A 2PEAA 3L17A 4X57B 2FAZA 2OJRA 3DPDA 5JH5C 1KJTA 3TL5A 1C1YB 3KUDB 2KWUB 1WI0A 4NJ7A 3RD2A 3TJPA 4A3OA 2HJ8A 4FHJA 4FULA 2BPSA 2MLBA 4BKSA 3EHVA 4K1RB 3ZNGC 1WR6E 2K8CA 3R7QA 2DZJA 1V5OA 3H6NA 4IM0A 3DVNU 4TV3A 3PS6A 1WIAA 1NBFC 2DAFA 1TTNA 4N9F4 1OGWA 4BBNF 2NPTA 4J6IA 3T9LA 4PS7A 1WJNA 3T8MA 1SE9A 1MG8A 2BKRB 1PQSA 2G4SA 3ZNID 2HTHA 3AULA 3H9DA 4KIKA 4MGZE 4HLEA 2LVOA 1WJ6A 2DHZA 2ZJDA 3O65B 4B95A 1SGHA 2C60A 2KFKA 3B0AA 3DVGX 3OJ3A 1WYWB 2GBKA 1HE8A 1E8ZA 3MTNB 3N30A 3NZUA 4G50A 3ALBA 4BBNC 1FXTB 2DX5B 2GBRA 4RM8A 3PT2B 5CX3A 2BWFA 4HJKA 5HKHA 3QAQA 4RMAA 2VRRB 2BYEA 4GOCA 3UIOB 1WMHA 4I6PA 2LXCA 4W9JA 4DK5A 4AP4C 2NS5A 4I6NB 4II3B 2KDEB 3V6CB 3BY4B 3KUZA 5E6PA 4MEMA 4DDID 3VUXA 3ZRFA 2MBHA 3W1YA 4AJYB 4MSQB 1XT9B 4B6WA 3UQBA 3VFKA 3IFWB 4EZJA 3WALA 4BOZB 4M8NA 2BKFA 2CR5A 3QX1A 4ASWC 1CMXB 1WXVA 5LLIA 1UD7A 1YQBA 4KDLB 4MGKE 5D94A 2MSED 1XD3B 1S3SG 1ZW7A 4W9FA 3V62A 4ANWA 3WAOA 5LXHA 2LZ6A 4B9KA 2LXAA 2NBUA 2XK5A 2ZPYA 5AZGA 4WWPA 4HPMB 2LRWA 1V5TA 3CF6E 4NJ6A 3KVFB 1WGGA 1TGZB 2FNJB 5DCNA 1IYFA 2K25A 3ENEA 4NPNA 3TMPB 1S1QB 3R66C 1WE6A 2ZNVC 3IBEA 3PSEB 1ZGUB 2KLCA 3C0RB 5E6OA 2K1FA 2V1YA 1WZ3A 2FCMA 1H4RA 1T0YA 1P9DU 3A1QA 2V4LA 1E7UA 2EMTA 1L2NA 3M62B 1UELA 3ZNZB 3DDCB 2MBEA 3U8ZA 3R7RA 2KQ7A 3AXCA 4IUMB 3Q3JA 3L10B 4GB9A 4OVVA 5IAAC 3RULA 2JT4B 2K6DB 3PGEA 4FJYA 2JZ3B 4K7WA 1I35A 3DVGY 4ZRJA 1V80A 4P7IA 1GUAB 1OEYA 2L05A 4CO7A 1UGMA 4BVUC 2DYOA 4HCNB 3TBLD 4PYUA 5JHAA 2W9NA 2M17A 2KK8A 4K7UA 3TCAA 4BOSC 2KZRA 2KNBA 2RSUA 3L0WB 3VXWA 2K8BA 4KSKC 1YIWA 2ZCBA 1V86A 1E8XA 3APFA 1KOTA 4MELA 2LGYA 1UH6A 3UIPB 2AEHA 1Q1OA 2ZPNA 2MBBB 3QIJA 4ZRKA 3PLUA 4IG7B 4HDQA 3ZRCA 1GG3A 1RLFA 1WGYA 2I1JA 2JZZA 3DCGA 2FCNA 3AU4A 3HM6X 4GSWA 4HXDA 4GXBA 3V61A 1BT0A 2N1WA 4WQOB 1GNUA 2JPHA 4GDLA 4GU2A 4DDGD 2O2VA 1NI2A 2NVUI 5E6NA 5CHWA 2L8JA 4ICUA 4W9GA 4DHJB 2FCSA 3D32A 3M95A 3PREA 1QZEA 4TKNA 2L3ZA 5DPSA 3PRMB 2KOXA 1JRUA 4W9EA 2MCNB 4BFRA 3WIMA 1J19A 3RT3B 1WFYA 1P0RA 3I3TB 3PVLA 4NQLB 5AZFA 1WGHA 3SDLC 2MBQA 1P1AA 3A33B 2CU1A 5D7GA 2O6VD 3HHMA 2N9XA 3ZDTA 1IP9A 2R2QA 1R4NI 1WR1A 2Z59B 3SU8X 5LXIB 3VTUA 2K39A 2L0TA 2KDBA 2OOBB 3IG3A 3NY5A 2J0JA 3QCAA 3P2BA 5JHBA 2J7QB 2IYDB 2C7NB 4NNJB 4W9DA 5FR6A 3DBLI 1WX8A 4K7SA 3IVFA 3VAWA 4NAWB 3R3MA 2N1VA 5EDSA 1Q0WB 4IM3A 2CKHB 1C3TA 2AL6A 2NCNA 1E90A 4WJPA 2IO3B 4EEWA 2GBJA 3WA0A 4URKA 2G4DB 1G6JA 1LM8B 2AYOB 1D3ZA 1WY8A 2PE9A 2KFKB 2G45B 2A5UA 4I6LB 4HDOA 1TZ1A 2DYMA 4LJOB 4LDTB 2XBBC 4E71A 1P98A 2NBVB 3H7SA 1EO6A 2D07B 1WJUA 2KVRA 4ZDVA 2C5LC 2C9WB 4IM2A 4EFOA 1A5RA 4EUTA 4II2B 3KUCB 1UZXB 2EKEC 3WAPA 4AJWA 2FIFA 2CHXA 2DZIA 2NPTB 4YL8A 3RCZA 5DPWA 3KYCD 1E8YA 2KWVB 2D10A 1YD8U 2DZKA 4TQ1A 4IWOA 4M8MA 2Y5BB 4IW0A 3CMMB 2KO3A 4NAWA 5AEKB 4BKGA 3ZO5B 3VDZA 1V49A 2GOWA 4LDTD 5G2NA 2RPQA 1OQYA 2ZVOA 1LFDA 3UGBB 4HPLB 2PPHA 3HM3A 3CSFA 2JRHA 3QC8B 1VCBA 1E7VA
chains in the Genus database with same CATH superfamily
5C3JB 1WE7A 4EOYA 1L4DB 4C7YA 4M01A 4W9KA 3RFZB 1M94A 3H7PB 2KC1A 4XC2A 3ZKJC 3Q3MC 4FA6A 3B1LX 1WX9A 3NHEB 1WGRA 1WRDB 2BYVE 2D11A 3OJ4B 1OQRA 1XXGA 4A8XC 3Q3NC 4ZHPA 3EECA 4LNKA 2MX2A 1WXAA 1UGJA 4WJOA 4YWGG 2VZKD 2WXLA 2CJOA 3ZQ4A 1HZ6A 2IZVB 1KLUD 1K51A 4RH6A 1SIFA 1Q5WB 2D2QA 4IWPA 2WDTB 5IA7A 2KC2A 3LB8C 3ZTDA 2KTRB 2R61A 4S0RA 3OLMD 1YJ1A 5KHQA 5CHVC 1CQVA 3NS8A 3WAMA 1TY0A 3L16A 4WAAA 4XZ4A 3AE6B 1V6EA 2ZCCA 4FHKA 4G11A 1RAXA 1WYGA 5IKCM 1ZOYB 2JXXA 2DYBA 4F1SA 4YSYB 1GC6A 1E0ZA 4GGQA 1KH0A 3W1SC 5L83A 2KTFA 2LEKA 2NBWB 2IY1B 4A20A 4MSMB 4K81A 4A3PA 2N4FA 1P7FA 3IHPC 1L7YA 1SSNA 2MW5A 4ZYSA 3BYYB 2REXA 5TSSA 2LVPA 4C7ZA 3VH4B 1WM3A 4XWWA 2C7HA 5BMIA 1FMAD 5BYSA 4ARIA 4CHKA 4EKUA 1FEHA 3NRZA 1WMHB 4NQKE 2KJHB 3EFUA 4JGHB 4XDCA 4G0NB 2M0AA 1QOFA 3GOEA 4MH8A 4MACA 2G3QB 1UF0A 3AE1B 3NZSA 1SB3C 1E6EB 4GDKB 4EE2A 2Y5CA 1LQBA 2N9LA 3K9OB 2RDBC 1TZOA 3GE3C 1T6BX 2BWES 3VUWA 4LCDE 3AE4B 3U7DA 3DQVA 3HVDA 4LNIA 2LUEA 3TSSA 4MGYE 2PIAA 4HKZE 2DNFA 5JZEB 2QJLA 1ACCA 1LXDA 2FIDA 3W1SA 1ENFA 2KDMA 2RR9A 3Q3FA 4OVZA 4DHZE 2INPE 2V3NA 4OVUA 2Y3AA 3M3JA 2KT7A 5D3IB 2KANA 4MH0E 2J52A 2N0SB 3RZFA 2MWSB 4WIPA 4AOFA 4LJPB 2KWDA 4PYZA 3LJ3A 3PHWB 4ZRPA 1RRBA 3ZLZA 2MEKA 2KFJA 2JWZA 2KQSA 3VRAB 3GB1A 5HG2A 2WWZA 5FK9C 3VH3B 4HJGE 2WX0A 3PPAA 3W2DA 2QMTA 4E74A 3RYTA 5AUIA 3H1UA 4WWNA 4IC7B 1J8CA 3DVNV 2OHFA 2WXIA 4FLHA 2KXJA 3E9SA 1UWMA 5HHDG 2C7MB 3AECB 1KJTA 3TL5A 3KUDB 2KWUB 4NJ7A 2QSDA 2HJ8A 3DBLB 1VZ7A 4A3OA 4FULA 1WGKA 1WR6E 2GRIA 3MFGA 4RGTA 3T9LA 3NJTA 1FO4A 4NAMA 4N6EB 1ZXIA 2DHZA 1WYWB 3MTNB 3U4EG 1J7BA 3ALBA 1FXTB 2GBRA 1I4GA 4HJKA 2KN4A 5HKHA 3C8YA 4GOCA 4Q2JA 3BK1A 2QEJC 3AEAB 4RF0A 3I5JC 2KDEB 3V6CB 4JPSA 5E6PA 3KUZA 4DDID 2GI9A 4HEA1 3W1YA 4OHJA 4EZJA 3IFWB 3WALA 2CR5A 3QX1A 1YQBA 4B0MA 1ZW7A 2MSED 4ANWA 2KMMA 3WAOA 5EE0A 4A9AA 2LXAA 4OZAA 3EA6A 4HPMB 2WXMA 1E10A 3TMPB 3R66C 2ZNVC 4O1NA 1TIFA 3PSEB 3DHGC 1WZ3A 2FCMA 3A1QA 3Q69A 2V4LA 2EMTA 3AM9A 3M62B 3ZNZB 4YXDB 2MJ3A 1FRDA 3AXCA 3L10B 3Q8EA 4K7WA 1I35A 1XEEA 3Q8CA 1T3QA 4RGOS 1UGMA 1D4BA 2DYOA 4HCNB 1DOYA 1L4ZB 3TCAA 2BYTA 2KZRA 2WGSA 2ZCBA 3AE3B 1NI3A 2LGYA 2ZPNA 4HDQA 2SAKA 1KLVA 4GSWA 2WXKA 3V61A 4WQOB 1GNUA 1IBXA 1QOBA 5E6NA 1ZDVA 2L8JA 2FCSA 2L3ZA 2MHJA 4C80A 5DPSA 3PRMB 1JRUA 3TEZA 1EWYC 1J19A 4RGMA 3RT3B 2J42A 1WGHA 2NMQA 2I38A 2JYTA 2O6VD 1PGAA 1I7HA 4K3BA 2PVOD 3SU8X 3AEGB 3N1YC 1C78A 3QCAA 2J7QB 1SF0A 3DBLI 1K50A 1WX8A 4K7SA 3VAWA 2JXTA 3ZJUA 1ZDXA 4IM3A 2CKHB 2AL6A 4WJPA 2AQ2B 4EEWA 2GBJA 1NYRA 3WA0A 2LHDA 1HXYD 2AYOB 3N9YC 1E7PB 1YN4A 4I6LB 3RI7C 1TZ1A 1T0SC 2DYMA 1MHHE 2XBBC 3N1ZC 2W82A 4XDDA 3BK2A 1UZXB 2EKEC 1C76A 2FIFA 4YL8A 5DPWA 1E8YA 1D5ZC 1XF5L 3Q6BA 3RN9C 3U2SC 4IWOA 4M8MA 2N7JA 3EGRA 2KO3A 4KGRA 5AEKB 3R2IA 2GOWA 4ZRQA 5G2NA 1OQYA 1XLOA 3TEYA 3UGBB 2FUG1 3BIID 3CSFA 3QC8B 2AX5A 5H92C 4BKSD 3MC8A 3RNBC 2I1KA 3QHTA 4LLGM 1P3QU 4EZKA 1V2YA 1KM7A 4DHJD 3ZIMA 3QK0A 3X23A 1IPGA 1OTRB 4WJNA 1WF9A 4HCPB 1E8WA 2IBIB 3NVVA 4WURA 1IBXB 1JWMD 3A4SC 2WU2B 4GDLB 4W9CA 1HTQA 3P4RB 4CYEA 2BF8B 2HTME 1EUVB 3FAHA 1STEA 3A9JB 4TQ0A 2LWPA 1TKEA 2L52A 3PTFC 3WANA 2B3AA 2FUHB 1RFKA 1ZE3D 4WWOA 2HD5B 3VQIA 1I4RA 2MA9B 4ANVA 3UF8A 2N7DA 4FADA 5LNK1 4OZCA 2QIEB 3AEFB 2KHWB 2KLGA 2O6VA 4JWUC 4G3XB 3BVGA 1PDXA 1U4AA 4EZLA 5BMHA 1F2RI 1PFDA 5T8IA 5MPOA 1WJ4A 3A1QB 3SEBA 4DHZB 4JX1C 4MDKE 3TUOA 4W9HA 1VLBA 3AMZA 4ARCA 1OQQA 4GMVA 4P16A 2JUOA 1D6EC 4MGIE 2JY6A 1F52A 3P42A 5IN7A 2QHOA 2CHZA 2HJ1A 1JRPA 1OEYJ 2M1MA 3QJZA 3IAS1 1ZKHA 3QQ8B 5CHFA 2M0XA 4GIVA 2LRUA 4ITKA 2NTSA 4D2KA 2BVCA 1KLGD 2W3SA 1ESFA 1YJJA 2LGIA 5GXGB 4YTMB 4W9IA 3ZJTA 2LI5A 2PLPA 3SFEB 2GMIC 3A4RA 3VTWA 3ZW3A 4ZRIA 2INDC 1XCTL 2MBOA 3K9PB 5DPTA 5J17A 1ISNA 4TMAB 1YJIA 3N32A 2WX1A 3APCA 1YX6B 4DXAB 1K8RB 1R4MI 3UQAA 5I4DA 3O13A 3PZDA 2IGGA 1V1OA 1QKZA 1RFAA 2R2OA 2N9EB 4PS8A 2KDFB 2HE7A 4CQNA 2LVQA 1L5PA 1UUPA 1NDDA 4C4VB 3WCQA 1WXSA 2DLBA 1KF6B 1EF1A 1J7AA 1K52A 3EFCA 2D3AA 2IDYA 1EF5A 1JWBD 4TUUA 5H8YE 3V6EB 2MP2B 3JSVB 3GS2A 3P4QB 4RM9A 2KN5A 4S17A 2YLMA 1N63A 3DBRI 4IWQA 3TIXA 4KZ0A 4HPPA 4N59A 3VVWB 2LMCA 1NENB 3AEBB 3PLVA 4JQWC 2YVCA 2M8SA 2XEWA 4XX5A 1XO3A 2K6QA 1WZ0A 5C1ZA 3I9V1 1N60A 1F0ZA 2UYZB 2WXPA 4DXFA 5AZHA 1QF6A 3PRPB 3H7PA 1E5WA 3I63C 2DENB 4LNOA 2PEAA 4X57B 2FAZA 3DPDA 5JH5C 4KKIA 2OJWA 3RD2A 4J3OD 4FHJA 2MLBA 1IGDA 1FPYA 2QDFA 1XLQA 4DQOC 3H6NA 4IM0A 4TV3A 3PS6A 1NBFC 4BBNF 2X38A 4PS7A 2BKRB 1MG8A 2LUMA 1PQSA 3BYTB 1I4QA 1TYGB 4UDUC 3DBHB 4MGZE 4HLEA 4KIKA 2ZJDA 3B0AA 3DVGX 3OJ3A 3NZUA 1E8ZA 1F2RC 3LXFA 3NVZA 4G50A 4BBNC 1I4XA 2CU3A 3AH7A 2DX5B 5CX3A 4HKQA 4RMAA 1N6ZA 3DHIC 2BYEA 4W9JA 1R7SA 4DK5A 2WXOA 2NS5A 4I6NB 2BBCA 2LJIA 4P1BC 3DHHC 3ZRFA 1E9MA 1FFVA 4B6WA 3UQBA 3U52E 4AS1A 1CMXB 1WXVA 2JYEA 1UD7A 5LLIA 3V62A 1S3SG 3ZYYX 3PO0A 5IOIA 1TS2A 4B9KA 1SEBD 2NBUA 1C4AA 3KVFB 2FNJB 1AWDA 1IYFA 3ENEA 4NPNA 3IBEA 3CWIA 1ZGUB 2KLCA 2WXNA 2K1FA 1H4RA 1T0YA 2WNMA 1E7UA 3DDCB 2V4IB 3NG0A 2JWUA 3RULA 3HVZA 4FJYA 4QAYA 2JZ3B 2ZW0A 1HEZE 4P7IA 1GUAB 1OEYA 4CO7A 4ZHOA 2BS3B 3L4PA 3MJ5A 1FD6A 3SFDB 1RYJA 2KK8A 4K7UA 4BOSC 4PK1A 4KGSA 2KNBA 3L0WB 1RWSA 1YIWA 3AEDB 1EU4A 2WDVB 3APFA 1UH6A 1DGJA 1TY2A 1XCQL 1Q1OA 2AEHA 4IG7B 1GG3A 2INNE 1RLFA 1F1HA 2I1JA 5JXVA 3AU4A 1N5XA 1NI2A 2NVUI 1V97A 5CHWA 1MPEA 4ICUA 4W9GA 3PREA 3Q8BA 1WFYA 3I3TB 4NQLB 2EKIA 5AZFA 3SDLC 2MBQA 1VJKA 3A33B 5D7GA 2N9XA 1JWSD 2LGSA 4WWMA 2R2QA 1WR1A 2K39A 3IG3A 3MP9A 2PVGC 3NY5A 1GPXA 5JHBA 2IYDB 2C7NB 3HUIA 2K5PA 4NAWB 3AE5B 5EDSA 4AQ7A 4L2YA 2BQQA 2NCNA 1XLNA 1YQ3B 4WH4A 3RNEC 3IT4B 1GB4A 2G4DB 1G6JA 1D3ZA 2PE9A 2KFKB 2E3TA 3AV8A 4B0EA 4N58A 3AB5A 1JROA 4LJOB 4E71A 1P98A 2B76B 4HRSA 1WJUA 2KVRA 4ZDVA 4IM2A 2BTEA 1Y56A 3MHZA 1ZXHA 4A90A 2CHXA 1CK1A 1JCKB 1VZ6A 2NPTB 3RCZA 4REZA 2KWVB 2D10A 1QOGA 2LFIA 4NAWA 3B2FA 5BMGA 2RPQA 3P4SB 2K3UA 4RNAA 3J9CA 1FM0D 1YNTE 2PPHA 2JX5A 2JRHA 1TJEA 5IP4D 2WU5B 2A4ZA 4KZCA 1ET9A 1AARA 2IY0B 1YN5A 2PE6B 3ZDMC 1C77A 2KX0A 3QWZB 2KVZA 1YX5B 2EELA 5GMVA 2ACZB 2N9PC 1H8CA 1HTOA 2SEBD 2LJ5A 2AL3A 3L13A 3ETRA 2YEPB 4BKTA 2D5GA 3A9KA 3VR9B 2IGDA 2LD9A 3U30A 1JQ4A 3DWGC 1TS3A 2J0KA 4ANXA 3FILB 3ONSA 2IO0B 4KSLC 4WJQA 4FJVB 4WAFA 5C23A 3ML9A 2CS4A 4C4VA 1MFWA 2BGFA 4W9LA 3JYUA 1AYFA 2MQJA 1GC7A 3DOWA 2K9XA 1PUTA 1MVKA 2KJ6A 2WXQA 2RGFA 1L6UA 1D5MC 2INCC 5EE3A 1I42A 3VRBB 2KMAA 3LDZE 3ZXVA 3AE8B 1UNSA 2PW9A 2H89B 2DAJA 3QA8A 3IAM1 1JWAD 2XK5B 1DYQA 3IT6B 3B9JA 4OW0A 2BS2B 3M63B 1V1PB 1L0XB 1SBBB 4PT5A 5EE1A 1FNWA 3KYDD 2OEDA 4LK0M 5FKAC 1WRIA 1UBQA 2L32A 4JLCA 2NR2A 3LYYA 2GLSA 3S2AA 1NYQA 2K8HA 3OG5A 3ABVB 4L23A 3ZVVA 1J7CA 1ZUD2 3ZGZA 3V60A 5G55A 3EC8A 4JL9A 2ZZPB 1WXQA 2ZEQA 3SHQA 3APDA 4US8A 1FFUA 3ZJVA 2NTTA 3PHXB 3KWLA 4FN2A 4RCOA 4KIKB 4FJZA 2ASQA 2D3GA 5J2RA 2WYQA 2WDRB 4XYCA 1Z2MA 2WXGA 4FBJB 2MH7A 1KTKA 3MC0B 2TSSA 2D3BA 2IO2B 2O6VB 3ZUNA 3DBSA 1IGCA 3HRDD 3B08A 1FCLA 3ECIA 5KHOA 4LTUA 2D3CA 4M0WA 1HZ5A 1PYWD 1WM2A 4AUQC 2M4NA 3JW0X 5BYRA 2RDGA 1YQ4B 3PRZA 2L7RA 5L95C 5DPRA 3A9JA 4JIOU 3N20C 1TKGA 1T0QC 3RUIB 1XQQA 4MJSB 2LHEA 2FCQA 2LASA 2JVCA 4USAA 1VZ8A 4LNFA 1ROEA 2L83A 3AI5A 3DBHI 2MP2A 3JSVA 1VDVA 4MM3B 3L54A 1N5WA 3L17A 3BZDB 1C1YB 1D5XC 3AE9B 4BKSA 3EHVA 3KQ4A 3C19A 3R7QA 1EM7A 4HROA 1ET6A 3DVNU 1WIAA 2ON8A 3RPFC 2FE8A 1TTNA 1WJNA 3T8MA 1L0YB 1T0RC 2G4SA 3RMKC 2WXFA 2WQYB 3GE8C 3H9DA 4P1CC 2UU7A 4YSZB 3O65B 1QLBB 4B95A 2H88B 3AE7B 1DOIA 1OFFA 2GBKA 2GB1A 2M19A 3PZ8A 4RM8A 2E6XA 3PT2B 1BUIC 2AQ3B 3UIOB 2FBWB 3PZ7A 2LXCA 4IDIA 4AP4C 2G9HD 4MEMA 1Q10A 3VUXA 3P63A 4MSQB 3VFKA 1YN3A 2BKFA 4KDLB 4MGKE 5D94A 3BVZA 3DBRB 5LXHA 2ZPYA 4A6QA 5AZGA 4WWPA 1V5TA 3CF6E 1ZP0B 4M02A 2WHIA 1CJEA 2K25A 1S1QB 1WE6A 4YT0B 3C0RB 1L2NA 3GP7A 2MBEA 3U8ZA 3Q3JA 4GB9A 2K6DB 3PGEA 4KX6B 4KKJA 4ZRJA 1V80A 2L05A 4BVUC 2W9NA 1MI0A 2RSUA 2W3RA 4GLSC 1V86A 1E8XA 3BWUD 1KOTA 2JSVX 3DWMA 2MBBB 3QIJA 4ZRKA 3PLUA 1NVID 3TEXA 3ZRCA 2V9HA 2FCNA 3HM6X 2X8XX 1C4PA 2N1WA 4DDGD 2JPHA 4GDLA 4GU2A 2O2VA 2CJNA 1A70A 3D32A 2WXHA 2KOXA 4W9EA 3RNGC 2MCNB 4BFRA 3WIMA 2K0PA 3HHMA 2I2YA 2Z59B 2L0TA 4TSSA 2J0JA 1SE3A 3P2BA 4W9DA 4NNJB 4NJCA 3R8BA 2N1VA 1QT9A 2J53A 1BXTA 3IXSA 1C3TA 2PMVA 3FC4A 2WDQB 2IO3B 2WXRA 2G1EA 2WS3B 1YOVB 2BW2A 2RDHA 1WY8A 2A5UA 4HDOA 2NBVB 2HDEA 1VR9A 2D07B 2C5LC 2C9WB 1N61A 3P1MA 1A5RA 3ZXRA 3W5UB 3GZNB 3KUCB 1DOXA 1MG4A 1YD8U 2Y5BB 4IW0A 2W55A 4BKGA 3ZO5B 1V49A 2ZVOA 3R2TA 1LFDA 2YEPF 2VH2A 4HPLB 3HM3A 1E7VA 2LGDA 2JZPA 3UINB 2QCZA 3RNFC 2J0MA 1TS5A 4MM3A 3OAWA 2XNAC 3VTVA 1FXIA 2GBNA 1SJED 5J18A 4C00A 2KX3A 4LNNA 3QARA 2BS4B 2O2VB 2IJ0A 1P7EA 3Q8AA 2BYFA 3KWVA 3HK0A 3Q2AC 2L0FA 1Y8RC 3CSTA 1WGDA 4H2AA 2KJRA 2Z0DB 4OZBA 5C2TB 4XE0A 3VUYA 2JQRB 3VHTC 3AE2B 2LGXA 1N62A 1C79A 1QILA 4F7ZA 5FR3A 2PTLA 4ACFA 2KDIA 1TT5B 2BB5A 1WWTA 2Y5PA 1C4CA 3KW5B 4HVBA 2MJEA 1UBIA 3AU5A 4L1BA 4PS3A 3PV1A 3AN1A 5TR5A 2L76A 1JWUD 4ANUA 1GB1A 1SE2A 2KQ4X 2N7EA 3ML8A 4GDKA 4KV2A 2ZNVB 2W54A 1MJDA 2VH1A 5BO4B 2JRIB 1X1MA 1RM6C 1V81A 4ICVA 5G5GA 2RMMA 1Z5SB 3V05A 3U7ZA 4RGNA 4DBGA 3I57A 1C9FA 4HK2A 4HWIB 3Q8FA 2V3SA 1VD2A 2KD0A 4YTNB 2ICIA 4ZYNA 1JMLA 3KLSX 4KVGB 5CTRC 5D6JB 3NOBA 4KDIC 2L00B 2N9KA 3UI3A 1I4PA 2JF5A 4R3DA 1FNUA 2AWTA 1IUEA 1UWXA 2KKCA 3GZNI 1YMHE 3E56A 3ZTCA 3RZWC 1V9JA 3B2GA 3V3XA 2PJHA 2GBMA 3L08A 1TBEA 3MJWA 4NY0A 3ZNHB 2IO1B 2Q5WD 2ZVNA 4BAXA 3X0WA 2KTRA 3FILA 1V8CA 3N1XC 4E3CA 1CZPA 1JW9D 2UWQA 3URYA 2KMCA 4RFBA 5D2MB 4P6VF 2CHWA 2KWCA 4DWFA 3KH0A 1QQRA 4F8CB 3A9KB 2BT6A 2KAJA 1T5XD 3TEWA 3BINA 3BVMA 1ZPSA 1HA5A 1J0GA 1GOZA 1WX7A 2EMSA 3NS1A 1F9JA 1L0VB 1WSPA 2Z0EB 1GJZA 1TS4A 3CIRB 4MJSA 1L6VA 4ZOHC 5EE9A 1PGBA 1FXAA 3HIZA 3NUHB 2ZW1A 1WXMA 3MC9A 4KGTA 3MHSD 4AWJA 3JVZX 4YTPB 3SD5A 2BB6A 2IGHA 2RD0A 4GN1A 2MRPA 3N3KB 4M0WB 4WQMA 1MHXA 1SXTA 2DZMA 1WH3A 2OJRA 3FKYA 1EWCA 3RNCC 5HFYA 1VRAB 1WI0A 2VZKB 3TJPA 1FCCC 2BPSA 4K1RB 3ZNGC 4FXCA 2K8CA 2Z8LA 2DZJA 1V5OA 2L1AA 3AEEB 2DAFA 2XN9C 1OGWA 4N9F4 2NPTA 4J6IA 1PGXA 1SE9A 3T3OA 1KRHA 3ZNID 2HTHA 2IPKD 4RF1A 3AULA 2J4XA 1AN8A 2LVOA 1WJ6A 4NZLB 1EU3A 1SGHA 2C60A 2KFKA 2M56B 1HE8A 3N30A 5D3DA 3EUB2 2BWFA 1BMLC 2DBYA 3QAQA 2VRRB 1SE4A 1WMHA 1FRRA 2AQ1B 4I6PA 3H8HA 1I4HA 4II3B 1B1ZA 3BY4B 2QC8A 4XWTA 1HQRD 2K22A 2MBHA 4AJYB 4DXGA 1XT9B 3SR6A 4BOZB 4M8NA 4ASWC 3Q14C 1V1PA 1JALA 1XD3B 5BYQA 4W9FA 2LZ6A 1LGRA 1R4MB 2XK5A 4XGAB 2LRWA 5AUKA 4NJ6A 1WGGA 1TGZB 4JWSC 5DCNA 5IO9A 5E6OA 3VR8B 2V1YA 1P9DU 4IKGA 1UELA 3T3NA 3R7RA 2WXJA 2KQ7A 4IUMB 5IAAC 4OVVA 2JT4B 1NEKB 4IOIE 3W5VB 1XLPA 3NVYA 3DVGY 2KYWA 3TBLD 4PYUA 3P4PB 5JHAA 3NZ3A 2ONQA 2M17A 3OWEB 3VXWA 2K8BA 4KSKC 3Q3OC 3W9CB 4MELA 3UIPB 4C56C 1WGYA 2JZZA 3DCGA 4HXDA 1KFYB 4GXBA 1BT0A 4JE3B 1FIQA 2V3PA 1R4NB 3RNAC 4DHJB 3M95A 1QZEA 4TKNA 5E6JA 1P0RA 3PVLA 4M00A 1P1AA 2V0GA 1K53A 2CU1A 1SIJA 5G5HA 3ZDTA 1IP9A 2KACA 1R4NI 4K3CA 1F77A 1TKYA 5LXIB 2RPVA 4BZAA 3VTUA 3NVWA 2KDBA 2OOBB 4MT5A 1B9RA 5FR6A 3IVFA 3R3MA 4YSXB 2WP9B 1Q0WB 2WLBA 1FNVA 1M4VA 1E90A 4URKA 2JU6X 2QILA 1LM8B 2G45B 1SJHD 2PKOA 4LDTB 1LO5D 3H7SA 1EO6A 4A55A 4EFOA 1GAQB 4EUTA 4II2B 3WAPA 5HI1A 4AJWA 2DZIA 3KYCD 1QOAA 2DZKA 4TQ1A 3CMMB 2MJDA 3VDZA 2DWQA 4LDTD 1AW7A 4US9A 1VCBA
chains in the Genus database with same CATH topology
1WE7A 2LGDA 4EOYA 2A4ZA 4KZCA 2I1KA 3UINB 1AARA 2IY0B 3QHTA 2J0MA 4W9KA 4MM3A 1M94A 1P3QU 4EZKA 1V2YA 2PE6B 3H7PB 3ZDMC 1KM7A 2KC1A 4XC2A 4DHJD 3ZKJC 3ZIMA 2KX0A 4FA6A 3B1LX 3OAWA 3QWZB 3QK0A 3VTVA 3X23A 1IPGA 1OTRB 1WX9A 3NHEB 1YX5B 4WJNA 1WGRA 2GBNA 1WF9A 1WRDB 1E8WA 4HCPB 5J18A 2IBIB 2KX3A 5GMVA 2BYVE 3QARA 2D11A 3A4SC 2O2VB 2N9PC 1H8CA 4GDLB 3OJ4B 4W9CA 2BYFA 4CYEA 2LJ5A 2AL3A 2BF8B 3L13A 3EECA 1EUVB 3HK0A 3A9JB 4TQ0A 2MX2A 2LWPA 2L0FA 3PTFC 4BKTA 3WANA 1WXAA 4WJOA 1Y8RC 3A9KA 2B3AA 2FUHB 2LD9A 2IZVB 3CSTA 3U30A 1WGDA 4WWOA 2KJRA 2Z0DB 2HD5B 3VQIA 2MA9B 1SIFA 4ANVA 2J0KA 3VUYA 3UF8A 1Q5WB 2N7DA 4ANXA 2D2QA 4FADA 4IWPA 2WDTB 3VHTC 5IA7A 2KC2A 3ZTDA 3ONSA 2KTRB 2IO0B 2LGXA 4KSLC 4WJQA 4FJVB 4F7ZA 2KHWB 2KLGA 3OLMD 5C23A 3ML9A 1YJ1A 2O6VA 2CS4A 5KHQA 5CHVC 4G3XB 3NS8A 2BGFA 2KDIA 4W9LA 3WAMA 3JYUA 1U4AA 2MQJA 3KW5B 4EZLA 4HVBA 1UBIA 3L16A 1GC7A 3DOWA 4WAAA 4XZ4A 2KJ6A 3AU5A 1V6EA 2ZCCA 4FHKA 1WJ4A 4G11A 3A1QB 4PS3A 1RAXA 3PV1A 4DHZB 2RGFA 4MDKE 5TR5A 1I42A 2JXXA 2DYBA 2L76A 4F1SA 4ANUA 4W9HA 1GC6A 2KMAA 3LDZE 4GMVA 2JUOA 2DAJA 2N7EA 3ML8A 4GDKA 4KV2A 2ZNVB 4MGIE 2JY6A 4GGQA 3QA8A 2XK5B 3W1SC 2QHOA 5L83A 2CHZA 5BO4B 2KTFA 2JRIB 2NBWB 1X1MA 2IY1B 4A20A 1OEYJ 2M1MA 3QJZA 4K81A 4MSMB 4A3PA 2N4FA 1V81A 3M63B 1ZKHA 3IHPC 1L7YA 3QQ8B 4ICVA 2MW5A 5CHFA 2M0XA 2REXA 4GIVA 3KYDD 2LRUA 2LVPA 1Z5SB 1UBQA 3VH4B 4JLCA 2NR2A 1WM3A 3S2AA 2K8HA 4DBGA 2C7HA 4HK2A 4HWIB 4CHKA 4W9IA 4EKUA 2LI5A 1WMHB 3ZVVA 4NQKE 2KJHB 2GMIC 3EFUA 2V3SA 3A4RA 1VD2A 4JGHB 4ZRIA 2KD0A 3V60A 3VTWA 3ZW3A 4BKSD 4G0NB 5G55A 3GOEA 3EC8A 2MBOA 2ZZPB 3K9PB 4JL9A 1ISNA 5DPTA 4ZYNA 5J17A 2G3QB 4KVGB 3NZSA 2ZEQA 5CTRC 5D6JB 3NOBA 4GDKB 4KDIC 3SHQA 2L00B 3APDA 1LQBA 3N32A 2WX1A 3K9OB 3PHXB 4FN2A 4KIKB 4FJZA 3APCA 1YX6B 4DXAB 1K8RB 1R4MI 3UQAA 2JF5A 2ASQA 2D3GA 3VUWA 2BWES 4LCDE 3PZDA 3U7DA 3DQVA 5J2RA 2AWTA 2WYQA 1RFAA 2R2OA 2KKCA 2LUEA 3GZNI 2N9EB 4MGYE 4PS8A 3ZTCA 3RZWC 1Z2MA 5JZEB 4FBJB 1KLVA 1V9JA 2KDFB 1LXDA 2HE7A 2FIDA 3W1SA 2PJHA 2GBMA 2IO2B 2LVQA 2RR9A 3L08A 3Q3FA 1TBEA 3MJWA 1NDDA 2O6VB 4NY0A 3ZUNA 4DHZE 3ZNHB 3DBSA 2IO1B 2ZVNA 4OVUA 3M3JA 1WXSA 3X0WA 1EF1A 2KANA 2KTRA 3B08A 4MH0E 3RZFA 3ECIA 5KHOA 2MWSB 1EF5A 4E3CA 4AOFA 2UWQA 4LJPB 4TUUA 2KMCA 1WM2A 4PYZA 5D2MB 4AUQC 2CHWA 2KWCA 2M4NA 3V6EB 2MP2B 3JSVB 3JW0X 3KH0A 4DWFA 4F8CB 3A9KB 3LJ3A 3BINA 4RM9A 2KN5A 3PHWB 3PRZA 1J0GA 2L7RA 2YLMA 3DBRI 1WX7A 2EMSA 4IWQA 3TIXA 1F9JA 3A9JA 4JIOU 4KZ0A 5DPRA 5L95C 1RRBA 3ZLZA 1GJZA 2Z0EB 3RUIB 1XQQA 2KFJA 3VVWB 2JWZA 4MJSB 2YVCA 3PLVA 4JQWC 2KQSA 2M8SA 4MJSA 2FCQA 2LASA 2XEWA 2JVCA 4XX5A 2K6QA 1WZ0A 2WWZA 3VH3B 3HIZA 5C1ZA 2WX0A 1WXMA 3PPAA 4E74A 2UYZB 3RYTA 3MHSD 3H1UA 4WWNA 4AWJA 4IC7B 3JVZX 5AZHA 1J8CA 3PRPB 3SD5A 3DVNV 3AI5A 3DBHI 2MP2A 2KXJA 3JSVA 4FLHA 2RD0A 3H7PA 1E5WA 4GN1A 2DENB 2MRPA 3N3KB 3L54A 4M0WB 2DZMA 2C7MB 1WH3A 2PEAA 3L17A 4X57B 2FAZA 2OJRA 3DPDA 5JH5C 1KJTA 3TL5A 1C1YB 3KUDB 2KWUB 1WI0A 4NJ7A 3RD2A 3TJPA 4A3OA 2HJ8A 4FHJA 4FULA 2BPSA 2MLBA 4BKSA 3EHVA 4K1RB 3ZNGC 1WR6E 2K8CA 3R7QA 2DZJA 1V5OA 3H6NA 4IM0A 3DVNU 4TV3A 3PS6A 1WIAA 1NBFC 2DAFA 1TTNA 4N9F4 1OGWA 4BBNF 2NPTA 4J6IA 3T9LA 4PS7A 1WJNA 3T8MA 1SE9A 1MG8A 2BKRB 1PQSA 2G4SA 3ZNID 2HTHA 3AULA 3H9DA 4KIKA 4MGZE 4HLEA 2LVOA 1WJ6A 2DHZA 2ZJDA 3O65B 4B95A 1SGHA 2C60A 2KFKA 3B0AA 3DVGX 3OJ3A 1WYWB 2GBKA 1HE8A 1E8ZA 3MTNB 3N30A 3NZUA 4G50A 3ALBA 4BBNC 1FXTB 2DX5B 2GBRA 4RM8A 3PT2B 5CX3A 2BWFA 4HJKA 5HKHA 3QAQA 4RMAA 2VRRB 2BYEA 4GOCA 3UIOB 1WMHA 4I6PA 2LXCA 4W9JA 4DK5A 4AP4C 2NS5A 4I6NB 4II3B 2KDEB 3V6CB 3BY4B 3KUZA 5E6PA 4MEMA 4DDID 3VUXA 3ZRFA 2MBHA 3W1YA 4AJYB 4MSQB 1XT9B 4B6WA 3UQBA 3VFKA 3IFWB 4EZJA 3WALA 4BOZB 4M8NA 2BKFA 2CR5A 3QX1A 4ASWC 1CMXB 1WXVA 5LLIA 1UD7A 1YQBA 4KDLB 4MGKE 5D94A 2MSED 1XD3B 1S3SG 1ZW7A 4W9FA 3V62A 4ANWA 3WAOA 5LXHA 2LZ6A 4B9KA 2LXAA 2NBUA 2XK5A 2ZPYA 5AZGA 4WWPA 4HPMB 2LRWA 1V5TA 3CF6E 4NJ6A 3KVFB 1WGGA 1TGZB 2FNJB 5DCNA 1IYFA 2K25A 3ENEA 4NPNA 3TMPB 1S1QB 3R66C 1WE6A 2ZNVC 3IBEA 3PSEB 1ZGUB 2KLCA 3C0RB 5E6OA 2K1FA 2V1YA 1WZ3A 2FCMA 1H4RA 1T0YA 1P9DU 3A1QA 2V4LA 1E7UA 2EMTA 1L2NA 3M62B 1UELA 3ZNZB 3DDCB 2MBEA 3U8ZA 3R7RA 2KQ7A 3AXCA 4IUMB 3Q3JA 3L10B 4GB9A 4OVVA 5IAAC 3RULA 2JT4B 2K6DB 3PGEA 4FJYA 2JZ3B 4K7WA 1I35A 3DVGY 4ZRJA 1V80A 4P7IA 1GUAB 1OEYA 2L05A 4CO7A 1UGMA 4BVUC 2DYOA 4HCNB 3TBLD 4PYUA 5JHAA 2W9NA 2M17A 2KK8A 4K7UA 3TCAA 4BOSC 2KZRA 2KNBA 2RSUA 3L0WB 3VXWA 2K8BA 4KSKC 1YIWA 2ZCBA 1V86A 1E8XA 3APFA 1KOTA 4MELA 2LGYA 1UH6A 3UIPB 2AEHA 1Q1OA 2ZPNA 2MBBB 3QIJA 4ZRKA 3PLUA 4IG7B 4HDQA 3ZRCA 1GG3A 1RLFA 1WGYA 2I1JA 2JZZA 3DCGA 2FCNA 3AU4A 3HM6X 4GSWA 4HXDA 4GXBA 3V61A 1BT0A 2N1WA 4WQOB 1GNUA 2JPHA 4GDLA 4GU2A 4DDGD 2O2VA 1NI2A 2NVUI 5E6NA 5CHWA 2L8JA 4ICUA 4W9GA 4DHJB 2FCSA 3D32A 3M95A 3PREA 1QZEA 4TKNA 2L3ZA 5DPSA 3PRMB 2KOXA 1JRUA 4W9EA 2MCNB 4BFRA 3WIMA 1J19A 3RT3B 1WFYA 1P0RA 3I3TB 3PVLA 4NQLB 5AZFA 1WGHA 3SDLC 2MBQA 1P1AA 3A33B 2CU1A 5D7GA 2O6VD 3HHMA 2N9XA 3ZDTA 1IP9A 2R2QA 1R4NI 1WR1A 2Z59B 3SU8X 5LXIB 3VTUA 2K39A 2L0TA 2KDBA 2OOBB 3IG3A 3NY5A 2J0JA 3QCAA 3P2BA 5JHBA 2J7QB 2IYDB 2C7NB 4NNJB 4W9DA 5FR6A 3DBLI 1WX8A 4K7SA 3IVFA 3VAWA 4NAWB 3R3MA 2N1VA 5EDSA 1Q0WB 4IM3A 2CKHB 1C3TA 2AL6A 2NCNA 1E90A 4WJPA 2IO3B 4EEWA 2GBJA 3WA0A 4URKA 2G4DB 1G6JA 1LM8B 2AYOB 1D3ZA 1WY8A 2PE9A 2KFKB 2G45B 2A5UA 4I6LB 4HDOA 1TZ1A 2DYMA 4LJOB 4LDTB 2XBBC 4E71A 1P98A 2NBVB 3H7SA 1EO6A 2D07B 1WJUA 2KVRA 4ZDVA 2C5LC 2C9WB 4IM2A 4EFOA 1A5RA 4EUTA 4II2B 3KUCB 1UZXB 2EKEC 3WAPA 4AJWA 2FIFA 2CHXA 2DZIA 2NPTB 4YL8A 3RCZA 5DPWA 3KYCD 1E8YA 2KWVB 2D10A 1YD8U 2DZKA 4TQ1A 4IWOA 4M8MA 2Y5BB 4IW0A 3CMMB 2KO3A 4NAWA 5AEKB 4BKGA 3ZO5B 3VDZA 1V49A 2GOWA 4LDTD 5G2NA 2RPQA 1OQYA 2ZVOA 1LFDA 3UGBB 4HPLB 2PPHA 3HM3A 3CSFA 2JRHA 3QC8B 1VCBA 1E7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE7 A;  2LGD A;  4EOY A;  2A4Z A;  4KZC A;  2I1K A;  3UIN B;  1AAR A;  2IY0 B;  3QHT A;  2J0M A;  4W9K A;  4MM3 A;  1M94 A;  1P3Q U;  4EZK A;  1V2Y A;  2PE6 B;  3H7P B;  3ZDM C;  1KM7 A;  2KC1 A;  4XC2 A;  4DHJ D;  3ZKJ C;  3ZIM A;  2KX0 A;  4FA6 A;  3B1L X;  3OAW A;  3QWZ B;  3QK0 A;  3VTV A;  3X23 A;  1IPG A;  1OTR B;  1WX9 A;  3NHE B;  1YX5 B;  4WJN A;  1WGR A;  2GBN A;  1WF9 A;  1WRD B;  1E8W A;  4HCP B;  5J18 A;  2IBI B;  2KX3 A;  5GMV A;  2BYV E;  3QAR A;  2D11 A;  3A4S C;  2O2V B;  2N9P C;  1H8C A;  4GDL B;  3OJ4 B;  4W9C A;  2BYF A;  4CYE A;  2LJ5 A;  2AL3 A;  2BF8 B;  3L13 A;  3EEC A;  1EUV B;  3HK0 A;  3A9J B;  4TQ0 A;  2MX2 A;  2LWP A;  2L0F A;  3PTF C;  4BKT A;  3WAN A;  1WXA A;  4WJO A;  1Y8R C;  3A9K A;  2B3A A;  2FUH B;  2LD9 A;  2IZV B;  3CST A;  3U30 A;  1WGD A;  4WWO A;  2KJR A;  2Z0D B;  2HD5 B;  3VQI A;  2MA9 B;  1SIF A;  4ANV A;  2J0K A;  3VUY A;  3UF8 A;  1Q5W B;  2N7D A;  4ANX A;  2D2Q A;  4FAD A;  4IWP A;  2WDT B;  3VHT C;  5IA7 A;  2KC2 A;  3ZTD A;  3ONS A;  2KTR B;  2IO0 B;  2LGX A;  4KSL C;  4WJQ A;  4FJV B;  4F7Z A;  2KHW B;  2KLG A;  3OLM D;  5C23 A;  3ML9 A;  1YJ1 A;  2O6V A;  2CS4 A;  5KHQ A;  5CHV C;  4G3X B;  3NS8 A;  2BGF A;  2KDI A;  4W9L A;  3WAM A;  3JYU A;  1U4A A;  2MQJ A;  3KW5 B;  4EZL A;  4HVB A;  1UBI A;  3L16 A;  1GC7 A;  3DOW A;  4WAA A;  4XZ4 A;  2KJ6 A;  3AU5 A;  1V6E A;  2ZCC A;  4FHK A;  1WJ4 A;  4G11 A;  3A1Q B;  4PS3 A;  1RAX A;  3PV1 A;  4DHZ B;  2RGF A;  4MDK E;  5TR5 A;  1I42 A;  2JXX A;  2DYB A;  2L76 A;  4F1S A;  4ANU A;  4W9H A;  1GC6 A;  2KMA A;  3LDZ E;  4GMV A;  2JUO A;  2DAJ A;  2N7E A;  3ML8 A;  4GDK A;  4KV2 A;  2ZNV B;  4MGI E;  2JY6 A;  4GGQ A;  3QA8 A;  2XK5 B;  3W1S C;  2QHO A;  5L83 A;  2CHZ A;  5BO4 B;  2KTF A;  2JRI B;  2NBW B;  1X1M A;  2IY1 B;  4A20 A;  1OEY J;  2M1M A;  3QJZ A;  4K81 A;  4MSM B;  4A3P A;  2N4F A;  1V81 A;  3M63 B;  1ZKH A;  3IHP C;  1L7Y A;  3QQ8 B;  4ICV A;  2MW5 A;  5CHF A;  2M0X A;  2REX A;  4GIV A;  3KYD D;  2LRU A;  2LVP A;  1Z5S B;  1UBQ A;  3VH4 B;  4JLC A;  2NR2 A;  1WM3 A;  3S2A A;  2K8H A;  4DBG A;  2C7H A;  4HK2 A;  4HWI B;  4CHK A;  4W9I A;  4EKU A;  2LI5 A;  1WMH B;  3ZVV A;  4NQK E;  2KJH B;  2GMI C;  3EFU A;  2V3S A;  3A4R A;  1VD2 A;  4JGH B;  4ZRI A;  2KD0 A;  3V60 A;  3VTW A;  3ZW3 A;  4BKS D;  4G0N B;  5G55 A;  3GOE A;  3EC8 A;  2MBO A;  2ZZP B;  3K9P B;  4JL9 A;  1ISN A;  5DPT A;  4ZYN A;  5J17 A;  2G3Q B;  4KVG B;  3NZS A;  2ZEQ A;  5CTR C;  5D6J B;  3NOB A;  4GDK B;  4KDI C;  3SHQ A;  2L00 B;  3APD A;  1LQB A;  3N32 A;  2WX1 A;  3K9O B;  3PHX B;  4FN2 A;  4KIK B;  4FJZ A;  3APC A;  1YX6 B;  4DXA B;  1K8R B;  1R4M I;  3UQA A;  2JF5 A;  2ASQ A;  2D3G A;  3VUW A;  2BWE S;  4LCD E;  3PZD A;  3U7D A;  3DQV A;  5J2R A;  2AWT A;  2WYQ A;  1RFA A;  2R2O A;  2KKC A;  2LUE A;  3GZN I;  2N9E B;  4MGY E;  4PS8 A;  3ZTC A;  3RZW C;  1Z2M A;  5JZE B;  4FBJ B;  1KLV A;  1V9J A;  2KDF B;  1LXD A;  2HE7 A;  2FID A;  3W1S A;  2PJH A;  2GBM A;  2IO2 B;  2LVQ A;  2RR9 A;  3L08 A;  3Q3F A;  1TBE A;  3MJW A;  1NDD A;  2O6V B;  4NY0 A;  3ZUN A;  4DHZ E;  3ZNH B;  3DBS A;  2IO1 B;  2ZVN A;  4OVU A;  3M3J A;  1WXS A;  3X0W A;  1EF1 A;  2KAN A;  2KTR A;  3B08 A;  4MH0 E;  3RZF A;  3ECI A;  5KHO A;  2MWS B;  1EF5 A;  4E3C A;  4AOF A;  2UWQ A;  4LJP B;  4TUU A;  2KMC A;  1WM2 A;  4PYZ A;  5D2M B;  4AUQ C;  2CHW A;  2KWC A;  2M4N A;  3V6E B;  2MP2 B;  3JSV B;  3JW0 X;  3KH0 A;  4DWF A;  4F8C B;  3A9K B;  3LJ3 A;  3BIN A;  4RM9 A;  2KN5 A;  3PHW B;  3PRZ A;  1J0G A;  2L7R A;  2YLM A;  3DBR I;  1WX7 A;  2EMS A;  4IWQ A;  3TIX A;  1F9J A;  3A9J A;  4JIO U;  4KZ0 A;  5DPR A;  5L95 C;  1RRB A;  3ZLZ A;  1GJZ A;  2Z0E B;  3RUI B;  1XQQ A;  2KFJ A;  3VVW B;  2JWZ A;  4MJS B;  2YVC A;  3PLV A;  4JQW C;  2KQS A;  2M8S A;  4MJS A;  2FCQ A;  2LAS A;  2XEW A;  2JVC A;  4XX5 A;  2K6Q A;  1WZ0 A;  2WWZ A;  3VH3 B;  3HIZ A;  5C1Z A;  2WX0 A;  1WXM A;  3PPA A;  4E74 A;  2UYZ B;  3RYT A;  3MHS D;  3H1U A;  4WWN A;  4AWJ A;  4IC7 B;  3JVZ X;  5AZH A;  1J8C A;  3PRP B;  3SD5 A;  3DVN V;  3AI5 A;  3DBH I;  2MP2 A;  2KXJ A;  3JSV A;  4FLH A;  2RD0 A;  3H7P A;  1E5W A;  4GN1 A;  2DEN B;  2MRP A;  3N3K B;  3L54 A;  4M0W B;  2DZM A;  2C7M B;  1WH3 A;  2PEA A;  3L17 A;  4X57 B;  2FAZ A;  2OJR A;  3DPD A;  5JH5 C;  1KJT A;  3TL5 A;  1C1Y B;  3KUD B;  2KWU B;  1WI0 A;  4NJ7 A;  3RD2 A;  3TJP A;  4A3O A;  2HJ8 A;  4FHJ A;  4FUL A;  2BPS A;  2MLB A;  4BKS A;  3EHV A;  4K1R B;  3ZNG C;  1WR6 E;  2K8C A;  3R7Q A;  2DZJ A;  1V5O A;  3H6N A;  4IM0 A;  3DVN U;  4TV3 A;  3PS6 A;  1WIA A;  1NBF C;  2DAF A;  1TTN A;  4N9F 4;  1OGW A;  4BBN F;  2NPT A;  4J6I A;  3T9L A;  4PS7 A;  1WJN A;  3T8M A;  1SE9 A;  1MG8 A;  2BKR B;  1PQS A;  2G4S A;  3ZNI D;  2HTH A;  3AUL A;  3H9D A;  4KIK A;  4MGZ E;  4HLE A;  2LVO A;  1WJ6 A;  2DHZ A;  2ZJD A;  3O65 B;  4B95 A;  1SGH A;  2C60 A;  2KFK A;  3B0A A;  3DVG X;  3OJ3 A;  1WYW B;  2GBK A;  1HE8 A;  1E8Z A;  3MTN B;  3N30 A;  3NZU A;  4G50 A;  3ALB A;  4BBN C;  1FXT B;  2DX5 B;  2GBR A;  4RM8 A;  3PT2 B;  5CX3 A;  2BWF A;  4HJK A;  5HKH A;  3QAQ A;  4RMA A;  2VRR B;  2BYE A;  4GOC A;  3UIO B;  1WMH A;  4I6P A;  2LXC A;  4W9J A;  4DK5 A;  4AP4 C;  2NS5 A;  4I6N B;  4II3 B;  2KDE B;  3V6C B;  3BY4 B;  3KUZ A;  5E6P A;  4MEM A;  4DDI D;  3VUX A;  3ZRF A;  2MBH A;  3W1Y A;  4AJY B;  4MSQ B;  1XT9 B;  4B6W A;  3UQB A;  3VFK A;  3IFW B;  4EZJ A;  3WAL A;  4BOZ B;  4M8N A;  2BKF A;  2CR5 A;  3QX1 A;  4ASW C;  1CMX B;  1WXV A;  5LLI A;  1UD7 A;  1YQB A;  4KDL B;  4MGK E;  5D94 A;  2MSE D;  1XD3 B;  1S3S G;  1ZW7 A;  4W9F A;  3V62 A;  4ANW A;  3WAO A;  5LXH A;  2LZ6 A;  4B9K A;  2LXA A;  2NBU A;  2XK5 A;  2ZPY A;  5AZG A;  4WWP A;  4HPM B;  2LRW A;  1V5T A;  3CF6 E;  4NJ6 A;  3KVF B;  1WGG A;  1TGZ B;  2FNJ B;  5DCN A;  1IYF A;  2K25 A;  3ENE A;  4NPN A;  3TMP B;  1S1Q B;  3R66 C;  1WE6 A;  2ZNV C;  3IBE A;  3PSE B;  1ZGU B;  2KLC A;  3C0R B;  5E6O A;  2K1F A;  2V1Y A;  1WZ3 A;  2FCM A;  1H4R A;  1T0Y A;  1P9D U;  3A1Q A;  2V4L A;  1E7U A;  2EMT A;  1L2N A;  3M62 B;  1UEL A;  3ZNZ B;  3DDC B;  2MBE A;  3U8Z A;  3R7R A;  2KQ7 A;  3AXC A;  4IUM B;  3Q3J A;  3L10 B;  4GB9 A;  4OVV A;  5IAA C;  3RUL A;  2JT4 B;  2K6D B;  3PGE A;  4FJY A;  2JZ3 B;  4K7W A;  1I35 A;  3DVG Y;  4ZRJ A;  1V80 A;  4P7I A;  1GUA B;  1OEY A;  2L05 A;  4CO7 A;  1UGM A;  4BVU C;  2DYO A;  4HCN B;  3TBL D;  4PYU A;  5JHA A;  2W9N A;  2M17 A;  2KK8 A;  4K7U A;  3TCA A;  4BOS C;  2KZR A;  2KNB A;  2RSU A;  3L0W B;  3VXW A;  2K8B A;  4KSK C;  1YIW A;  2ZCB A;  1V86 A;  1E8X A;  3APF A;  1KOT A;  4MEL A;  2LGY A;  1UH6 A;  3UIP B;  2AEH A;  1Q1O A;  2ZPN A;  2MBB B;  3QIJ A;  4ZRK A;  3PLU A;  4IG7 B;  4HDQ A;  3ZRC A;  1GG3 A;  1RLF A;  1WGY A;  2I1J A;  2JZZ A;  3DCG A;  2FCN A;  3AU4 A;  3HM6 X;  4GSW A;  4HXD A;  4GXB A;  3V61 A;  1BT0 A;  2N1W A;  4WQO B;  1GNU A;  2JPH A;  4GDL A;  4GU2 A;  4DDG D;  2O2V A;  1NI2 A;  2NVU I;  5E6N A;  5CHW A;  2L8J A;  4ICU A;  4W9G A;  4DHJ B;  2FCS A;  3D32 A;  3M95 A;  3PRE A;  1QZE A;  4TKN A;  2L3Z A;  5DPS A;  3PRM B;  2KOX A;  1JRU A;  4W9E A;  2MCN B;  4BFR A;  3WIM A;  1J19 A;  3RT3 B;  1WFY A;  1P0R A;  3I3T B;  3PVL A;  4NQL B;  5AZF A;  1WGH A;  3SDL C;  2MBQ A;  1P1A A;  3A33 B;  2CU1 A;  5D7G A;  2O6V D;  3HHM A;  2N9X A;  3ZDT A;  1IP9 A;  2R2Q A;  1R4N I;  1WR1 A;  2Z59 B;  3SU8 X;  5LXI B;  3VTU A;  2K39 A;  2L0T A;  2KDB A;  2OOB B;  3IG3 A;  3NY5 A;  2J0J A;  3QCA A;  3P2B A;  5JHB A;  2J7Q B;  2IYD B;  2C7N B;  4NNJ B;  4W9D A;  5FR6 A;  3DBL I;  1WX8 A;  4K7S A;  3IVF A;  3VAW A;  4NAW B;  3R3M A;  2N1V A;  5EDS A;  1Q0W B;  4IM3 A;  2CKH B;  1C3T A;  2AL6 A;  2NCN A;  1E90 A;  4WJP A;  2IO3 B;  4EEW A;  2GBJ A;  3WA0 A;  4URK A;  2G4D B;  1G6J A;  1LM8 B;  2AYO B;  1D3Z A;  1WY8 A;  2PE9 A;  2KFK B;  2G45 B;  2A5U A;  4I6L B;  4HDO A;  1TZ1 A;  2DYM A;  4LJO B;  4LDT B;  2XBB C;  4E71 A;  1P98 A;  2NBV B;  3H7S A;  1EO6 A;  2D07 B;  1WJU A;  2KVR A;  4ZDV A;  2C5L C;  2C9W B;  4IM2 A;  4EFO A;  1A5R A;  4EUT A;  4II2 B;  3KUC B;  1UZX B;  2EKE C;  3WAP A;  4AJW A;  2FIF A;  2CHX A;  2DZI A;  2NPT B;  4YL8 A;  3RCZ A;  5DPW A;  3KYC D;  1E8Y A;  2KWV B;  2D10 A;  1YD8 U;  2DZK A;  4TQ1 A;  4IWO A;  4M8M A;  2Y5B B;  4IW0 A;  3CMM B;  2KO3 A;  4NAW A;  5AEK B;  4BKG A;  3ZO5 B;  3VDZ A;  1V49 A;  2GOW A;  4LDT D;  5G2N A;  2RPQ A;  1OQY A;  2ZVO A;  1LFD A;  3UGB B;  4HPL B;  2PPH A;  3HM3 A;  3CSF A;  2JRH A;  3QC8 B;  1VCB A;  1E7V A; 
#chains in the Genus database with same CATH topology
 5C3J B;  1WE7 A;  4EOY A;  1L4D B;  4C7Y A;  4M01 A;  4W9K A;  3RFZ B;  1M94 A;  3H7P B;  2KC1 A;  4XC2 A;  3ZKJ C;  3Q3M C;  4FA6 A;  3B1L X;  1WX9 A;  3NHE B;  1WGR A;  1WRD B;  2BYV E;  2D11 A;  3OJ4 B;  1OQR A;  1XXG A;  4A8X C;  3Q3N C;  4ZHP A;  3EEC A;  4LNK A;  2MX2 A;  1WXA A;  1UGJ A;  4WJO A;  4YWG G;  2VZK D;  2WXL A;  2CJO A;  3ZQ4 A;  1HZ6 A;  2IZV B;  1KLU D;  1K51 A;  4RH6 A;  1SIF A;  1Q5W B;  2D2Q A;  4IWP A;  2WDT B;  5IA7 A;  2KC2 A;  3LB8 C;  3ZTD A;  2KTR B;  2R61 A;  4S0R A;  3OLM D;  1YJ1 A;  5KHQ A;  5CHV C;  1CQV A;  3NS8 A;  3WAM A;  1TY0 A;  3L16 A;  4WAA A;  4XZ4 A;  3AE6 B;  1V6E A;  2ZCC A;  4FHK A;  4G11 A;  1RAX A;  1WYG A;  5IKC M;  1ZOY B;  2JXX A;  2DYB A;  4F1S A;  4YSY B;  1GC6 A;  1E0Z A;  4GGQ A;  1KH0 A;  3W1S C;  5L83 A;  2KTF A;  2LEK A;  2NBW B;  2IY1 B;  4A20 A;  4MSM B;  4K81 A;  4A3P A;  2N4F A;  1P7F A;  3IHP C;  1L7Y A;  1SSN A;  2MW5 A;  4ZYS A;  3BYY B;  2REX A;  5TSS A;  2LVP A;  4C7Z A;  3VH4 B;  1WM3 A;  4XWW A;  2C7H A;  5BMI A;  1FMA D;  5BYS A;  4ARI A;  4CHK A;  4EKU A;  1FEH A;  3NRZ A;  1WMH B;  4NQK E;  2KJH B;  3EFU A;  4JGH B;  4XDC A;  4G0N B;  2M0A A;  1QOF A;  3GOE A;  4MH8 A;  4MAC A;  2G3Q B;  1UF0 A;  3AE1 B;  3NZS A;  1SB3 C;  1E6E B;  4GDK B;  4EE2 A;  2Y5C A;  1LQB A;  2N9L A;  3K9O B;  2RDB C;  1TZO A;  3GE3 C;  1T6B X;  2BWE S;  3VUW A;  4LCD E;  3AE4 B;  3U7D A;  3DQV A;  3HVD A;  4LNI A;  2LUE A;  3TSS A;  4MGY E;  2PIA A;  4HKZ E;  2DNF A;  5JZE B;  2QJL A;  1ACC A;  1LXD A;  2FID A;  3W1S A;  1ENF A;  2KDM A;  2RR9 A;  3Q3F A;  4OVZ A;  4DHZ E;  2INP E;  2V3N A;  4OVU A;  2Y3A A;  3M3J A;  2KT7 A;  5D3I B;  2KAN A;  4MH0 E;  2J52 A;  2N0S B;  3RZF A;  2MWS B;  4WIP A;  4AOF A;  4LJP B;  2KWD A;  4PYZ A;  3LJ3 A;  3PHW B;  4ZRP A;  1RRB A;  3ZLZ A;  2MEK A;  2KFJ A;  2JWZ A;  2KQS A;  3VRA B;  3GB1 A;  5HG2 A;  2WWZ A;  5FK9 C;  3VH3 B;  4HJG E;  2WX0 A;  3PPA A;  3W2D A;  2QMT A;  4E74 A;  3RYT A;  5AUI A;  3H1U A;  4WWN A;  4IC7 B;  1J8C A;  3DVN V;  2OHF A;  2WXI A;  4FLH A;  2KXJ A;  3E9S A;  1UWM A;  5HHD G;  2C7M B;  3AEC B;  1KJT A;  3TL5 A;  3KUD B;  2KWU B;  4NJ7 A;  2QSD A;  2HJ8 A;  3DBL B;  1VZ7 A;  4A3O A;  4FUL A;  1WGK A;  1WR6 E;  2GRI A;  3MFG A;  4RGT A;  3T9L A;  3NJT A;  1FO4 A;  4NAM A;  4N6E B;  1ZXI A;  2DHZ A;  1WYW B;  3MTN B;  3U4E G;  1J7B A;  3ALB A;  1FXT B;  2GBR A;  1I4G A;  4HJK A;  2KN4 A;  5HKH A;  3C8Y A;  4GOC A;  4Q2J A;  3BK1 A;  2QEJ C;  3AEA B;  4RF0 A;  3I5J C;  2KDE B;  3V6C B;  4JPS A;  5E6P A;  3KUZ A;  4DDI D;  2GI9 A;  4HEA 1;  3W1Y A;  4OHJ A;  4EZJ A;  3IFW B;  3WAL A;  2CR5 A;  3QX1 A;  1YQB A;  4B0M A;  1ZW7 A;  2MSE D;  4ANW A;  2KMM A;  3WAO A;  5EE0 A;  4A9A A;  2LXA A;  4OZA A;  3EA6 A;  4HPM B;  2WXM A;  1E10 A;  3TMP B;  3R66 C;  2ZNV C;  4O1N A;  1TIF A;  3PSE B;  3DHG C;  1WZ3 A;  2FCM A;  3A1Q A;  3Q69 A;  2V4L A;  2EMT A;  3AM9 A;  3M62 B;  3ZNZ B;  4YXD B;  2MJ3 A;  1FRD A;  3AXC A;  3L10 B;  3Q8E A;  4K7W A;  1I35 A;  1XEE A;  3Q8C A;  1T3Q A;  4RGO S;  1UGM A;  1D4B A;  2DYO A;  4HCN B;  1DOY A;  1L4Z B;  3TCA A;  2BYT A;  2KZR A;  2WGS A;  2ZCB A;  3AE3 B;  1NI3 A;  2LGY A;  2ZPN A;  4HDQ A;  2SAK A;  1KLV A;  4GSW A;  2WXK A;  3V61 A;  4WQO B;  1GNU A;  1IBX A;  1QOB A;  5E6N A;  1ZDV A;  2L8J A;  2FCS A;  2L3Z A;  2MHJ A;  4C80 A;  5DPS A;  3PRM B;  1JRU A;  3TEZ A;  1EWY C;  1J19 A;  4RGM A;  3RT3 B;  2J42 A;  1WGH A;  2NMQ A;  2I38 A;  2JYT A;  2O6V D;  1PGA A;  1I7H A;  4K3B A;  2PVO D;  3SU8 X;  3AEG B;  3N1Y C;  1C78 A;  3QCA A;  2J7Q B;  1SF0 A;  3DBL I;  1K50 A;  1WX8 A;  4K7S A;  3VAW A;  2JXT A;  3ZJU A;  1ZDX A;  4IM3 A;  2CKH B;  2AL6 A;  4WJP A;  2AQ2 B;  4EEW A;  2GBJ A;  1NYR A;  3WA0 A;  2LHD A;  1HXY D;  2AYO B;  3N9Y C;  1E7P B;  1YN4 A;  4I6L B;  3RI7 C;  1TZ1 A;  1T0S C;  2DYM A;  1MHH E;  2XBB C;  3N1Z C;  2W82 A;  4XDD A;  3BK2 A;  1UZX B;  2EKE C;  1C76 A;  2FIF A;  4YL8 A;  5DPW A;  1E8Y A;  1D5Z C;  1XF5 L;  3Q6B A;  3RN9 C;  3U2S C;  4IWO A;  4M8M A;  2N7J A;  3EGR A;  2KO3 A;  4KGR A;  5AEK B;  3R2I A;  2GOW A;  4ZRQ A;  5G2N A;  1OQY A;  1XLO A;  3TEY A;  3UGB B;  2FUG 1;  3BII D;  3CSF A;  3QC8 B;  2AX5 A;  5H92 C;  4BKS D;  3MC8 A;  3RNB C;  2I1K A;  3QHT A;  4LLG M;  1P3Q U;  4EZK A;  1V2Y A;  1KM7 A;  4DHJ D;  3ZIM A;  3QK0 A;  3X23 A;  1IPG A;  1OTR B;  4WJN A;  1WF9 A;  4HCP B;  1E8W A;  2IBI B;  3NVV A;  4WUR A;  1IBX B;  1JWM D;  3A4S C;  2WU2 B;  4GDL B;  4W9C A;  1HTQ A;  3P4R B;  4CYE A;  2BF8 B;  2HTM E;  1EUV B;  3FAH A;  1STE A;  3A9J B;  4TQ0 A;  2LWP A;  1TKE A;  2L52 A;  3PTF C;  3WAN A;  2B3A A;  2FUH B;  1RFK A;  1ZE3 D;  4WWO A;  2HD5 B;  3VQI A;  1I4R A;  2MA9 B;  4ANV A;  3UF8 A;  2N7D A;  4FAD A;  5LNK 1;  4OZC A;  2QIE B;  3AEF B;  2KHW B;  2KLG A;  2O6V A;  4JWU C;  4G3X B;  3BVG A;  1PDX A;  1U4A A;  4EZL A;  5BMH A;  1F2R I;  1PFD A;  5T8I A;  5MPO A;  1WJ4 A;  3A1Q B;  3SEB A;  4DHZ B;  4JX1 C;  4MDK E;  3TUO A;  4W9H A;  1VLB A;  3AMZ A;  4ARC A;  1OQQ A;  4GMV A;  4P16 A;  2JUO A;  1D6E C;  4MGI E;  2JY6 A;  1F52 A;  3P42 A;  5IN7 A;  2QHO A;  2CHZ A;  2HJ1 A;  1JRP A;  1OEY J;  2M1M A;  3QJZ A;  3IAS 1;  1ZKH A;  3QQ8 B;  5CHF A;  2M0X A;  4GIV A;  2LRU A;  4ITK A;  2NTS A;  4D2K A;  2BVC A;  1KLG D;  2W3S A;  1ESF A;  1YJJ A;  2LGI A;  5GXG B;  4YTM B;  4W9I A;  3ZJT A;  2LI5 A;  2PLP A;  3SFE B;  2GMI C;  3A4R A;  3VTW A;  3ZW3 A;  4ZRI A;  2IND C;  1XCT L;  2MBO A;  3K9P B;  5DPT A;  5J17 A;  1ISN A;  4TMA B;  1YJI A;  3N32 A;  2WX1 A;  3APC A;  1YX6 B;  4DXA B;  1K8R B;  1R4M I;  3UQA A;  5I4D A;  3O13 A;  3PZD A;  2IGG A;  1V1O A;  1QKZ A;  1RFA A;  2R2O A;  2N9E B;  4PS8 A;  2KDF B;  2HE7 A;  4CQN A;  2LVQ A;  1L5P A;  1UUP A;  1NDD A;  4C4V B;  3WCQ A;  1WXS A;  2DLB A;  1KF6 B;  1EF1 A;  1J7A A;  1K52 A;  3EFC A;  2D3A A;  2IDY A;  1EF5 A;  1JWB D;  4TUU A;  5H8Y E;  3V6E B;  2MP2 B;  3JSV B;  3GS2 A;  3P4Q B;  4RM9 A;  2KN5 A;  4S17 A;  2YLM A;  1N63 A;  3DBR I;  4IWQ A;  3TIX A;  4KZ0 A;  4HPP A;  4N59 A;  3VVW B;  2LMC A;  1NEN B;  3AEB B;  3PLV A;  4JQW C;  2YVC A;  2M8S A;  2XEW A;  4XX5 A;  1XO3 A;  2K6Q A;  1WZ0 A;  5C1Z A;  3I9V 1;  1N60 A;  1F0Z A;  2UYZ B;  2WXP A;  4DXF A;  5AZH A;  1QF6 A;  3PRP B;  3H7P A;  1E5W A;  3I63 C;  2DEN B;  4LNO A;  2PEA A;  4X57 B;  2FAZ A;  3DPD A;  5JH5 C;  4KKI A;  2OJW A;  3RD2 A;  4J3O D;  4FHJ A;  2MLB A;  1IGD A;  1FPY A;  2QDF A;  1XLQ A;  4DQO C;  3H6N A;  4IM0 A;  4TV3 A;  3PS6 A;  1NBF C;  4BBN F;  2X38 A;  4PS7 A;  2BKR B;  1MG8 A;  2LUM A;  1PQS A;  3BYT B;  1I4Q A;  1TYG B;  4UDU C;  3DBH B;  4MGZ E;  4HLE A;  4KIK A;  2ZJD A;  3B0A A;  3DVG X;  3OJ3 A;  3NZU A;  1E8Z A;  1F2R C;  3LXF A;  3NVZ A;  4G50 A;  4BBN C;  1I4X A;  2CU3 A;  3AH7 A;  2DX5 B;  5CX3 A;  4HKQ A;  4RMA A;  1N6Z A;  3DHI C;  2BYE A;  4W9J A;  1R7S A;  4DK5 A;  2WXO A;  2NS5 A;  4I6N B;  2BBC A;  2LJI A;  4P1B C;  3DHH C;  3ZRF A;  1E9M A;  1FFV A;  4B6W A;  3UQB A;  3U52 E;  4AS1 A;  1CMX B;  1WXV A;  2JYE A;  1UD7 A;  5LLI A;  3V62 A;  1S3S G;  3ZYY X;  3PO0 A;  5IOI A;  1TS2 A;  4B9K A;  1SEB D;  2NBU A;  1C4A A;  3KVF B;  2FNJ B;  1AWD A;  1IYF A;  3ENE A;  4NPN A;  3IBE A;  3CWI A;  1ZGU B;  2KLC A;  2WXN A;  2K1F A;  1H4R A;  1T0Y A;  2WNM A;  1E7U A;  3DDC B;  2V4I B;  3NG0 A;  2JWU A;  3RUL A;  3HVZ A;  4FJY A;  4QAY A;  2JZ3 B;  2ZW0 A;  1HEZ E;  4P7I A;  1GUA B;  1OEY A;  4CO7 A;  4ZHO A;  2BS3 B;  3L4P A;  3MJ5 A;  1FD6 A;  3SFD B;  1RYJ A;  2KK8 A;  4K7U A;  4BOS C;  4PK1 A;  4KGS A;  2KNB A;  3L0W B;  1RWS A;  1YIW A;  3AED B;  1EU4 A;  2WDV B;  3APF A;  1UH6 A;  1DGJ A;  1TY2 A;  1XCQ L;  1Q1O A;  2AEH A;  4IG7 B;  1GG3 A;  2INN E;  1RLF A;  1F1H A;  2I1J A;  5JXV A;  3AU4 A;  1N5X A;  1NI2 A;  2NVU I;  1V97 A;  5CHW A;  1MPE A;  4ICU A;  4W9G A;  3PRE A;  3Q8B A;  1WFY A;  3I3T B;  4NQL B;  2EKI A;  5AZF A;  3SDL C;  2MBQ A;  1VJK A;  3A33 B;  5D7G A;  2N9X A;  1JWS D;  2LGS A;  4WWM A;  2R2Q A;  1WR1 A;  2K39 A;  3IG3 A;  3MP9 A;  2PVG C;  3NY5 A;  1GPX A;  5JHB A;  2IYD B;  2C7N B;  3HUI A;  2K5P A;  4NAW B;  3AE5 B;  5EDS A;  4AQ7 A;  4L2Y A;  2BQQ A;  2NCN A;  1XLN A;  1YQ3 B;  4WH4 A;  3RNE C;  3IT4 B;  1GB4 A;  2G4D B;  1G6J A;  1D3Z A;  2PE9 A;  2KFK B;  2E3T A;  3AV8 A;  4B0E A;  4N58 A;  3AB5 A;  1JRO A;  4LJO B;  4E71 A;  1P98 A;  2B76 B;  4HRS A;  1WJU A;  2KVR A;  4ZDV A;  4IM2 A;  2BTE A;  1Y56 A;  3MHZ A;  1ZXH A;  4A90 A;  2CHX A;  1CK1 A;  1JCK B;  1VZ6 A;  2NPT B;  3RCZ A;  4REZ A;  2KWV B;  2D10 A;  1QOG A;  2LFI A;  4NAW A;  3B2F A;  5BMG A;  2RPQ A;  3P4S B;  2K3U A;  4RNA A;  3J9C A;  1FM0 D;  1YNT E;  2PPH A;  2JX5 A;  2JRH A;  1TJE A;  5IP4 D;  2WU5 B;  2A4Z A;  4KZC A;  1ET9 A;  1AAR A;  2IY0 B;  1YN5 A;  2PE6 B;  3ZDM C;  1C77 A;  2KX0 A;  3QWZ B;  2KVZ A;  1YX5 B;  2EEL A;  5GMV A;  2ACZ B;  2N9P C;  1H8C A;  1HTO A;  2SEB D;  2LJ5 A;  2AL3 A;  3L13 A;  3ETR A;  2YEP B;  4BKT A;  2D5G A;  3A9K A;  3VR9 B;  2IGD A;  2LD9 A;  3U30 A;  1JQ4 A;  3DWG C;  1TS3 A;  2J0K A;  4ANX A;  3FIL B;  3ONS A;  2IO0 B;  4KSL C;  4WJQ A;  4FJV B;  4WAF A;  5C23 A;  3ML9 A;  2CS4 A;  4C4V A;  1MFW A;  2BGF A;  4W9L A;  3JYU A;  1AYF A;  2MQJ A;  1GC7 A;  3DOW A;  2K9X A;  1PUT A;  1MVK A;  2KJ6 A;  2WXQ A;  2RGF A;  1L6U A;  1D5M C;  2INC C;  5EE3 A;  1I42 A;  3VRB B;  2KMA A;  3LDZ E;  3ZXV A;  3AE8 B;  1UNS A;  2PW9 A;  2H89 B;  2DAJ A;  3QA8 A;  3IAM 1;  1JWA D;  2XK5 B;  1DYQ A;  3IT6 B;  3B9J A;  4OW0 A;  2BS2 B;  3M63 B;  1V1P B;  1L0X B;  1SBB B;  4PT5 A;  5EE1 A;  1FNW A;  3KYD D;  2OED A;  4LK0 M;  5FKA C;  1WRI A;  1UBQ A;  2L32 A;  4JLC A;  2NR2 A;  3LYY A;  2GLS A;  3S2A A;  1NYQ A;  2K8H A;  3OG5 A;  3ABV B;  4L23 A;  3ZVV A;  1J7C A;  1ZUD 2;  3ZGZ A;  3V60 A;  5G55 A;  3EC8 A;  4JL9 A;  2ZZP B;  1WXQ A;  2ZEQ A;  3SHQ A;  3APD A;  4US8 A;  1FFU A;  3ZJV A;  2NTT A;  3PHX B;  3KWL A;  4FN2 A;  4RCO A;  4KIK B;  4FJZ A;  2ASQ A;  2D3G A;  5J2R A;  2WYQ A;  2WDR B;  4XYC A;  1Z2M A;  2WXG A;  4FBJ B;  2MH7 A;  1KTK A;  3MC0 B;  2TSS A;  2D3B A;  2IO2 B;  2O6V B;  3ZUN A;  3DBS A;  1IGC A;  3HRD D;  3B08 A;  1FCL A;  3ECI A;  5KHO A;  4LTU A;  2D3C A;  4M0W A;  1HZ5 A;  1PYW D;  1WM2 A;  4AUQ C;  2M4N A;  3JW0 X;  5BYR A;  2RDG A;  1YQ4 B;  3PRZ A;  2L7R A;  5L95 C;  5DPR A;  3A9J A;  4JIO U;  3N20 C;  1TKG A;  1T0Q C;  3RUI B;  1XQQ A;  4MJS B;  2LHE A;  2FCQ A;  2LAS A;  2JVC A;  4USA A;  1VZ8 A;  4LNF A;  1ROE A;  2L83 A;  3AI5 A;  3DBH I;  2MP2 A;  3JSV A;  1VDV A;  4MM3 B;  3L54 A;  1N5W A;  3L17 A;  3BZD B;  1C1Y B;  1D5X C;  3AE9 B;  4BKS A;  3EHV A;  3KQ4 A;  3C19 A;  3R7Q A;  1EM7 A;  4HRO A;  1ET6 A;  3DVN U;  1WIA A;  2ON8 A;  3RPF C;  2FE8 A;  1TTN A;  1WJN A;  3T8M A;  1L0Y B;  1T0R C;  2G4S A;  3RMK C;  2WXF A;  2WQY B;  3GE8 C;  3H9D A;  4P1C C;  2UU7 A;  4YSZ B;  3O65 B;  1QLB B;  4B95 A;  2H88 B;  3AE7 B;  1DOI A;  1OFF A;  2GBK A;  2GB1 A;  2M19 A;  3PZ8 A;  4RM8 A;  2E6X A;  3PT2 B;  1BUI C;  2AQ3 B;  3UIO B;  2FBW B;  3PZ7 A;  2LXC A;  4IDI A;  4AP4 C;  2G9H D;  4MEM A;  1Q10 A;  3VUX A;  3P63 A;  4MSQ B;  3VFK A;  1YN3 A;  2BKF A;  4KDL B;  4MGK E;  5D94 A;  3BVZ A;  3DBR B;  5LXH A;  2ZPY A;  4A6Q A;  5AZG A;  4WWP A;  1V5T A;  3CF6 E;  1ZP0 B;  4M02 A;  2WHI A;  1CJE A;  2K25 A;  1S1Q B;  1WE6 A;  4YT0 B;  3C0R B;  1L2N A;  3GP7 A;  2MBE A;  3U8Z A;  3Q3J A;  4GB9 A;  2K6D B;  3PGE A;  4KX6 B;  4KKJ A;  4ZRJ A;  1V80 A;  2L05 A;  4BVU C;  2W9N A;  1MI0 A;  2RSU A;  2W3R A;  4GLS C;  1V86 A;  1E8X A;  3BWU D;  1KOT A;  2JSV X;  3DWM A;  2MBB B;  3QIJ A;  4ZRK A;  3PLU A;  1NVI D;  3TEX A;  3ZRC A;  2V9H A;  2FCN A;  3HM6 X;  2X8X X;  1C4P A;  2N1W A;  4DDG D;  2JPH A;  4GDL A;  4GU2 A;  2O2V A;  2CJN A;  1A70 A;  3D32 A;  2WXH A;  2KOX A;  4W9E A;  3RNG C;  2MCN B;  4BFR A;  3WIM A;  2K0P A;  3HHM A;  2I2Y A;  2Z59 B;  2L0T A;  4TSS A;  2J0J A;  1SE3 A;  3P2B A;  4W9D A;  4NNJ B;  4NJC A;  3R8B A;  2N1V A;  1QT9 A;  2J53 A;  1BXT A;  3IXS A;  1C3T A;  2PMV A;  3FC4 A;  2WDQ B;  2IO3 B;  2WXR A;  2G1E A;  2WS3 B;  1YOV B;  2BW2 A;  2RDH A;  1WY8 A;  2A5U A;  4HDO A;  2NBV B;  2HDE A;  1VR9 A;  2D07 B;  2C5L C;  2C9W B;  1N61 A;  3P1M A;  1A5R A;  3ZXR A;  3W5U B;  3GZN B;  3KUC B;  1DOX A;  1MG4 A;  1YD8 U;  2Y5B B;  4IW0 A;  2W55 A;  4BKG A;  3ZO5 B;  1V49 A;  2ZVO A;  3R2T A;  1LFD A;  2YEP F;  2VH2 A;  4HPL B;  3HM3 A;  1E7V A;  2LGD A;  2JZP A;  3UIN B;  2QCZ A;  3RNF C;  2J0M A;  1TS5 A;  4MM3 A;  3OAW A;  2XNA C;  3VTV A;  1FXI A;  2GBN A;  1SJE D;  5J18 A;  4C00 A;  2KX3 A;  4LNN A;  3QAR A;  2BS4 B;  2O2V B;  2IJ0 A;  1P7E A;  3Q8A A;  2BYF A;  3KWV A;  3HK0 A;  3Q2A C;  2L0F A;  1Y8R C;  3CST A;  1WGD A;  4H2A A;  2KJR A;  2Z0D B;  4OZB A;  5C2T B;  4XE0 A;  3VUY A;  2JQR B;  3VHT C;  3AE2 B;  2LGX A;  1N62 A;  1C79 A;  1QIL A;  4F7Z A;  5FR3 A;  2PTL A;  4ACF A;  2KDI A;  1TT5 B;  2BB5 A;  1WWT A;  2Y5P A;  1C4C A;  3KW5 B;  4HVB A;  2MJE A;  1UBI A;  3AU5 A;  4L1B A;  4PS3 A;  3PV1 A;  3AN1 A;  5TR5 A;  2L76 A;  1JWU D;  4ANU A;  1GB1 A;  1SE2 A;  2KQ4 X;  2N7E A;  3ML8 A;  4GDK A;  4KV2 A;  2ZNV B;  2W54 A;  1MJD A;  2VH1 A;  5BO4 B;  2JRI B;  1X1M A;  1RM6 C;  1V81 A;  4ICV A;  5G5G A;  2RMM A;  1Z5S B;  3V05 A;  3U7Z A;  4RGN A;  4DBG A;  3I57 A;  1C9F A;  4HK2 A;  4HWI B;  3Q8F A;  2V3S A;  1VD2 A;  2KD0 A;  4YTN B;  2ICI A;  4ZYN A;  1JML A;  3KLS X;  4KVG B;  5CTR C;  5D6J B;  3NOB A;  4KDI C;  2L00 B;  2N9K A;  3UI3 A;  1I4P A;  2JF5 A;  4R3D A;  1FNU A;  2AWT A;  1IUE A;  1UWX A;  2KKC A;  3GZN I;  1YMH E;  3E56 A;  3ZTC A;  3RZW C;  1V9J A;  3B2G A;  3V3X A;  2PJH A;  2GBM A;  3L08 A;  1TBE A;  3MJW A;  4NY0 A;  3ZNH B;  2IO1 B;  2Q5W D;  2ZVN A;  4BAX A;  3X0W A;  2KTR A;  3FIL A;  1V8C A;  3N1X C;  4E3C A;  1CZP A;  1JW9 D;  2UWQ A;  3URY A;  2KMC A;  4RFB A;  5D2M B;  4P6V F;  2CHW A;  2KWC A;  4DWF A;  3KH0 A;  1QQR A;  4F8C B;  3A9K B;  2BT6 A;  2KAJ A;  1T5X D;  3TEW A;  3BIN A;  3BVM A;  1ZPS A;  1HA5 A;  1J0G A;  1GOZ A;  1WX7 A;  2EMS A;  3NS1 A;  1F9J A;  1L0V B;  1WSP A;  2Z0E B;  1GJZ A;  1TS4 A;  3CIR B;  4MJS A;  1L6V A;  4ZOH C;  5EE9 A;  1PGB A;  1FXA A;  3HIZ A;  3NUH B;  2ZW1 A;  1WXM A;  3MC9 A;  4KGT A;  3MHS D;  4AWJ A;  3JVZ X;  4YTP B;  3SD5 A;  2BB6 A;  2IGH A;  2RD0 A;  4GN1 A;  2MRP A;  3N3K B;  4M0W B;  4WQM A;  1MHX A;  1SXT A;  2DZM A;  1WH3 A;  2OJR A;  3FKY A;  1EWC A;  3RNC C;  5HFY A;  1VRA B;  1WI0 A;  2VZK B;  3TJP A;  1FCC C;  2BPS A;  4K1R B;  3ZNG C;  4FXC A;  2K8C A;  2Z8L A;  2DZJ A;  1V5O A;  2L1A A;  3AEE B;  2DAF A;  2XN9 C;  1OGW A;  4N9F 4;  2NPT A;  4J6I A;  1PGX A;  1SE9 A;  3T3O A;  1KRH A;  3ZNI D;  2HTH A;  2IPK D;  4RF1 A;  3AUL A;  2J4X A;  1AN8 A;  2LVO A;  1WJ6 A;  4NZL B;  1EU3 A;  1SGH A;  2C60 A;  2KFK A;  2M56 B;  1HE8 A;  3N30 A;  5D3D A;  3EUB 2;  2BWF A;  1BML C;  2DBY A;  3QAQ A;  2VRR B;  1SE4 A;  1WMH A;  1FRR A;  2AQ1 B;  4I6P A;  3H8H A;  1I4H A;  4II3 B;  1B1Z A;  3BY4 B;  2QC8 A;  4XWT A;  1HQR D;  2K22 A;  2MBH A;  4AJY B;  4DXG A;  1XT9 B;  3SR6 A;  4BOZ B;  4M8N A;  4ASW C;  3Q14 C;  1V1P A;  1JAL A;  1XD3 B;  5BYQ A;  4W9F A;  2LZ6 A;  1LGR A;  1R4M B;  2XK5 A;  4XGA B;  2LRW A;  5AUK A;  4NJ6 A;  1WGG A;  1TGZ B;  4JWS C;  5DCN A;  5IO9 A;  5E6O A;  3VR8 B;  2V1Y A;  1P9D U;  4IKG A;  1UEL A;  3T3N A;  3R7R A;  2WXJ A;  2KQ7 A;  4IUM B;  5IAA C;  4OVV A;  2JT4 B;  1NEK B;  4IOI E;  3W5V B;  1XLP A;  3NVY A;  3DVG Y;  2KYW A;  3TBL D;  4PYU A;  3P4P B;  5JHA A;  3NZ3 A;  2ONQ A;  2M17 A;  3OWE B;  3VXW A;  2K8B A;  4KSK C;  3Q3O C;  3W9C B;  4MEL A;  3UIP B;  4C56 C;  1WGY A;  2JZZ A;  3DCG A;  4HXD A;  1KFY B;  4GXB A;  1BT0 A;  4JE3 B;  1FIQ A;  2V3P A;  1R4N B;  3RNA C;  4DHJ B;  3M95 A;  1QZE A;  4TKN A;  5E6J A;  1P0R A;  3PVL A;  4M00 A;  1P1A A;  2V0G A;  1K53 A;  2CU1 A;  1SIJ A;  5G5H A;  3ZDT A;  1IP9 A;  2KAC A;  1R4N I;  4K3C A;  1F77 A;  1TKY A;  5LXI B;  2RPV A;  4BZA A;  3VTU A;  3NVW A;  2KDB A;  2OOB B;  4MT5 A;  1B9R A;  5FR6 A;  3IVF A;  3R3M A;  4YSX B;  2WP9 B;  1Q0W B;  2WLB A;  1FNV A;  1M4V A;  1E90 A;  4URK A;  2JU6 X;  2QIL A;  1LM8 B;  2G45 B;  1SJH D;  2PKO A;  4LDT B;  1LO5 D;  3H7S A;  1EO6 A;  4A55 A;  4EFO A;  1GAQ B;  4EUT A;  4II2 B;  3WAP A;  5HI1 A;  4AJW A;  2DZI A;  3KYC D;  1QOA A;  2DZK A;  4TQ1 A;  3CMM B;  2MJD A;  3VDZ A;  2DWQ A;  4LDT D;  1AW7 A;  4US9 A;  1VCB A; 
#chains in the Genus database with same CATH homology
 1WE7 A;  2LGD A;  4EOY A;  2A4Z A;  4KZC A;  2I1K A;  3UIN B;  1AAR A;  2IY0 B;  3QHT A;  2J0M A;  4W9K A;  4MM3 A;  1M94 A;  1P3Q U;  4EZK A;  1V2Y A;  2PE6 B;  3H7P B;  3ZDM C;  1KM7 A;  2KC1 A;  4XC2 A;  4DHJ D;  3ZKJ C;  3ZIM A;  2KX0 A;  4FA6 A;  3B1L X;  3OAW A;  3QWZ B;  3QK0 A;  3VTV A;  3X23 A;  1IPG A;  1OTR B;  1WX9 A;  3NHE B;  1YX5 B;  4WJN A;  1WGR A;  2GBN A;  1WF9 A;  1WRD B;  1E8W A;  4HCP B;  5J18 A;  2IBI B;  2KX3 A;  5GMV A;  2BYV E;  3QAR A;  2D11 A;  3A4S C;  2O2V B;  2N9P C;  1H8C A;  4GDL B;  3OJ4 B;  4W9C A;  2BYF A;  4CYE A;  2LJ5 A;  2AL3 A;  2BF8 B;  3L13 A;  3EEC A;  1EUV B;  3HK0 A;  3A9J B;  4TQ0 A;  2MX2 A;  2LWP A;  2L0F A;  3PTF C;  4BKT A;  3WAN A;  1WXA A;  4WJO A;  1Y8R C;  3A9K A;  2B3A A;  2FUH B;  2LD9 A;  2IZV B;  3CST A;  3U30 A;  1WGD A;  4WWO A;  2KJR A;  2Z0D B;  2HD5 B;  3VQI A;  2MA9 B;  1SIF A;  4ANV A;  2J0K A;  3VUY A;  3UF8 A;  1Q5W B;  2N7D A;  4ANX A;  2D2Q A;  4FAD A;  4IWP A;  2WDT B;  3VHT C;  5IA7 A;  2KC2 A;  3ZTD A;  3ONS A;  2KTR B;  2IO0 B;  2LGX A;  4KSL C;  4WJQ A;  4FJV B;  4F7Z A;  2KHW B;  2KLG A;  3OLM D;  5C23 A;  3ML9 A;  1YJ1 A;  2O6V A;  2CS4 A;  5KHQ A;  5CHV C;  4G3X B;  3NS8 A;  2BGF A;  2KDI A;  4W9L A;  3WAM A;  3JYU A;  1U4A A;  2MQJ A;  3KW5 B;  4EZL A;  4HVB A;  1UBI A;  3L16 A;  1GC7 A;  3DOW A;  4WAA A;  4XZ4 A;  2KJ6 A;  3AU5 A;  1V6E A;  2ZCC A;  4FHK A;  1WJ4 A;  4G11 A;  3A1Q B;  4PS3 A;  1RAX A;  3PV1 A;  4DHZ B;  2RGF A;  4MDK E;  5TR5 A;  1I42 A;  2JXX A;  2DYB A;  2L76 A;  4F1S A;  4ANU A;  4W9H A;  1GC6 A;  2KMA A;  3LDZ E;  4GMV A;  2JUO A;  2DAJ A;  2N7E A;  3ML8 A;  4GDK A;  4KV2 A;  2ZNV B;  4MGI E;  2JY6 A;  4GGQ A;  3QA8 A;  2XK5 B;  3W1S C;  2QHO A;  5L83 A;  2CHZ A;  5BO4 B;  2KTF A;  2JRI B;  2NBW B;  1X1M A;  2IY1 B;  4A20 A;  1OEY J;  2M1M A;  3QJZ A;  4K81 A;  4MSM B;  4A3P A;  2N4F A;  1V81 A;  3M63 B;  1ZKH A;  3IHP C;  1L7Y A;  3QQ8 B;  4ICV A;  2MW5 A;  5CHF A;  2M0X A;  2REX A;  4GIV A;  3KYD D;  2LRU A;  2LVP A;  1Z5S B;  1UBQ A;  3VH4 B;  4JLC A;  2NR2 A;  1WM3 A;  3S2A A;  2K8H A;  4DBG A;  2C7H A;  4HK2 A;  4HWI B;  4CHK A;  4W9I A;  4EKU A;  2LI5 A;  1WMH B;  3ZVV A;  4NQK E;  2KJH B;  2GMI C;  3EFU A;  2V3S A;  3A4R A;  1VD2 A;  4JGH B;  4ZRI A;  2KD0 A;  3V60 A;  3VTW A;  3ZW3 A;  4BKS D;  4G0N B;  5G55 A;  3GOE A;  3EC8 A;  2MBO A;  2ZZP B;  3K9P B;  4JL9 A;  1ISN A;  5DPT A;  4ZYN A;  5J17 A;  2G3Q B;  4KVG B;  3NZS A;  2ZEQ A;  5CTR C;  5D6J B;  3NOB A;  4GDK B;  4KDI C;  3SHQ A;  2L00 B;  3APD A;  1LQB A;  3N32 A;  2WX1 A;  3K9O B;  3PHX B;  4FN2 A;  4KIK B;  4FJZ A;  3APC A;  1YX6 B;  4DXA B;  1K8R B;  1R4M I;  3UQA A;  2JF5 A;  2ASQ A;  2D3G A;  3VUW A;  2BWE S;  4LCD E;  3PZD A;  3U7D A;  3DQV A;  5J2R A;  2AWT A;  2WYQ A;  1RFA A;  2R2O A;  2KKC A;  2LUE A;  3GZN I;  2N9E B;  4MGY E;  4PS8 A;  3ZTC A;  3RZW C;  1Z2M A;  5JZE B;  4FBJ B;  1KLV A;  1V9J A;  2KDF B;  1LXD A;  2HE7 A;  2FID A;  3W1S A;  2PJH A;  2GBM A;  2IO2 B;  2LVQ A;  2RR9 A;  3L08 A;  3Q3F A;  1TBE A;  3MJW A;  1NDD A;  2O6V B;  4NY0 A;  3ZUN A;  4DHZ E;  3ZNH B;  3DBS A;  2IO1 B;  2ZVN A;  4OVU A;  3M3J A;  1WXS A;  3X0W A;  1EF1 A;  2KAN A;  2KTR A;  3B08 A;  4MH0 E;  3RZF A;  3ECI A;  5KHO A;  2MWS B;  1EF5 A;  4E3C A;  4AOF A;  2UWQ A;  4LJP B;  4TUU A;  2KMC A;  1WM2 A;  4PYZ A;  5D2M B;  4AUQ C;  2CHW A;  2KWC A;  2M4N A;  3V6E B;  2MP2 B;  3JSV B;  3JW0 X;  3KH0 A;  4DWF A;  4F8C B;  3A9K B;  3LJ3 A;  3BIN A;  4RM9 A;  2KN5 A;  3PHW B;  3PRZ A;  1J0G A;  2L7R A;  2YLM A;  3DBR I;  1WX7 A;  2EMS A;  4IWQ A;  3TIX A;  1F9J A;  3A9J A;  4JIO U;  4KZ0 A;  5DPR A;  5L95 C;  1RRB A;  3ZLZ A;  1GJZ A;  2Z0E B;  3RUI B;  1XQQ A;  2KFJ A;  3VVW B;  2JWZ A;  4MJS B;  2YVC A;  3PLV A;  4JQW C;  2KQS A;  2M8S A;  4MJS A;  2FCQ A;  2LAS A;  2XEW A;  2JVC A;  4XX5 A;  2K6Q A;  1WZ0 A;  2WWZ A;  3VH3 B;  3HIZ A;  5C1Z A;  2WX0 A;  1WXM A;  3PPA A;  4E74 A;  2UYZ B;  3RYT A;  3MHS D;  3H1U A;  4WWN A;  4AWJ A;  4IC7 B;  3JVZ X;  5AZH A;  1J8C A;  3PRP B;  3SD5 A;  3DVN V;  3AI5 A;  3DBH I;  2MP2 A;  2KXJ A;  3JSV A;  4FLH A;  2RD0 A;  3H7P A;  1E5W A;  4GN1 A;  2DEN B;  2MRP A;  3N3K B;  3L54 A;  4M0W B;  2DZM A;  2C7M B;  1WH3 A;  2PEA A;  3L17 A;  4X57 B;  2FAZ A;  2OJR A;  3DPD A;  5JH5 C;  1KJT A;  3TL5 A;  1C1Y B;  3KUD B;  2KWU B;  1WI0 A;  4NJ7 A;  3RD2 A;  3TJP A;  4A3O A;  2HJ8 A;  4FHJ A;  4FUL A;  2BPS A;  2MLB A;  4BKS A;  3EHV A;  4K1R B;  3ZNG C;  1WR6 E;  2K8C A;  3R7Q A;  2DZJ A;  1V5O A;  3H6N A;  4IM0 A;  3DVN U;  4TV3 A;  3PS6 A;  1WIA A;  1NBF C;  2DAF A;  1TTN A;  4N9F 4;  1OGW A;  4BBN F;  2NPT A;  4J6I A;  3T9L A;  4PS7 A;  1WJN A;  3T8M A;  1SE9 A;  1MG8 A;  2BKR B;  1PQS A;  2G4S A;  3ZNI D;  2HTH A;  3AUL A;  3H9D A;  4KIK A;  4MGZ E;  4HLE A;  2LVO A;  1WJ6 A;  2DHZ A;  2ZJD A;  3O65 B;  4B95 A;  1SGH A;  2C60 A;  2KFK A;  3B0A A;  3DVG X;  3OJ3 A;  1WYW B;  2GBK A;  1HE8 A;  1E8Z A;  3MTN B;  3N30 A;  3NZU A;  4G50 A;  3ALB A;  4BBN C;  1FXT B;  2DX5 B;  2GBR A;  4RM8 A;  3PT2 B;  5CX3 A;  2BWF A;  4HJK A;  5HKH A;  3QAQ A;  4RMA A;  2VRR B;  2BYE A;  4GOC A;  3UIO B;  1WMH A;  4I6P A;  2LXC A;  4W9J A;  4DK5 A;  4AP4 C;  2NS5 A;  4I6N B;  4II3 B;  2KDE B;  3V6C B;  3BY4 B;  3KUZ A;  5E6P A;  4MEM A;  4DDI D;  3VUX A;  3ZRF A;  2MBH A;  3W1Y A;  4AJY B;  4MSQ B;  1XT9 B;  4B6W A;  3UQB A;  3VFK A;  3IFW B;  4EZJ A;  3WAL A;  4BOZ B;  4M8N A;  2BKF A;  2CR5 A;  3QX1 A;  4ASW C;  1CMX B;  1WXV A;  5LLI A;  1UD7 A;  1YQB A;  4KDL B;  4MGK E;  5D94 A;  2MSE D;  1XD3 B;  1S3S G;  1ZW7 A;  4W9F A;  3V62 A;  4ANW A;  3WAO A;  5LXH A;  2LZ6 A;  4B9K A;  2LXA A;  2NBU A;  2XK5 A;  2ZPY A;  5AZG A;  4WWP A;  4HPM B;  2LRW A;  1V5T A;  3CF6 E;  4NJ6 A;  3KVF B;  1WGG A;  1TGZ B;  2FNJ B;  5DCN A;  1IYF A;  2K25 A;  3ENE A;  4NPN A;  3TMP B;  1S1Q B;  3R66 C;  1WE6 A;  2ZNV C;  3IBE A;  3PSE B;  1ZGU B;  2KLC A;  3C0R B;  5E6O A;  2K1F A;  2V1Y A;  1WZ3 A;  2FCM A;  1H4R A;  1T0Y A;  1P9D U;  3A1Q A;  2V4L A;  1E7U A;  2EMT A;  1L2N A;  3M62 B;  1UEL A;  3ZNZ B;  3DDC B;  2MBE A;  3U8Z A;  3R7R A;  2KQ7 A;  3AXC A;  4IUM B;  3Q3J A;  3L10 B;  4GB9 A;  4OVV A;  5IAA C;  3RUL A;  2JT4 B;  2K6D B;  3PGE A;  4FJY A;  2JZ3 B;  4K7W A;  1I35 A;  3DVG Y;  4ZRJ A;  1V80 A;  4P7I A;  1GUA B;  1OEY A;  2L05 A;  4CO7 A;  1UGM A;  4BVU C;  2DYO A;  4HCN B;  3TBL D;  4PYU A;  5JHA A;  2W9N A;  2M17 A;  2KK8 A;  4K7U A;  3TCA A;  4BOS C;  2KZR A;  2KNB A;  2RSU A;  3L0W B;  3VXW A;  2K8B A;  4KSK C;  1YIW A;  2ZCB A;  1V86 A;  1E8X A;  3APF A;  1KOT A;  4MEL A;  2LGY A;  1UH6 A;  3UIP B;  2AEH A;  1Q1O A;  2ZPN A;  2MBB B;  3QIJ A;  4ZRK A;  3PLU A;  4IG7 B;  4HDQ A;  3ZRC A;  1GG3 A;  1RLF A;  1WGY A;  2I1J A;  2JZZ A;  3DCG A;  2FCN A;  3AU4 A;  3HM6 X;  4GSW A;  4HXD A;  4GXB A;  3V61 A;  1BT0 A;  2N1W A;  4WQO B;  1GNU A;  2JPH A;  4GDL A;  4GU2 A;  4DDG D;  2O2V A;  1NI2 A;  2NVU I;  5E6N A;  5CHW A;  2L8J A;  4ICU A;  4W9G A;  4DHJ B;  2FCS A;  3D32 A;  3M95 A;  3PRE A;  1QZE A;  4TKN A;  2L3Z A;  5DPS A;  3PRM B;  2KOX A;  1JRU A;  4W9E A;  2MCN B;  4BFR A;  3WIM A;  1J19 A;  3RT3 B;  1WFY A;  1P0R A;  3I3T B;  3PVL A;  4NQL B;  5AZF A;  1WGH A;  3SDL C;  2MBQ A;  1P1A A;  3A33 B;  2CU1 A;  5D7G A;  2O6V D;  3HHM A;  2N9X A;  3ZDT A;  1IP9 A;  2R2Q A;  1R4N I;  1WR1 A;  2Z59 B;  3SU8 X;  5LXI B;  3VTU A;  2K39 A;  2L0T A;  2KDB A;  2OOB B;  3IG3 A;  3NY5 A;  2J0J A;  3QCA A;  3P2B A;  5JHB A;  2J7Q B;  2IYD B;  2C7N B;  4NNJ B;  4W9D A;  5FR6 A;  3DBL I;  1WX8 A;  4K7S A;  3IVF A;  3VAW A;  4NAW B;  3R3M A;  2N1V A;  5EDS A;  1Q0W B;  4IM3 A;  2CKH B;  1C3T A;  2AL6 A;  2NCN A;  1E90 A;  4WJP A;  2IO3 B;  4EEW A;  2GBJ A;  3WA0 A;  4URK A;  2G4D B;  1G6J A;  1LM8 B;  2AYO B;  1D3Z A;  1WY8 A;  2PE9 A;  2KFK B;  2G45 B;  2A5U A;  4I6L B;  4HDO A;  1TZ1 A;  2DYM A;  4LJO B;  4LDT B;  2XBB C;  4E71 A;  1P98 A;  2NBV B;  3H7S A;  1EO6 A;  2D07 B;  1WJU A;  2KVR A;  4ZDV A;  2C5L C;  2C9W B;  4IM2 A;  4EFO A;  1A5R A;  4EUT A;  4II2 B;  3KUC B;  1UZX B;  2EKE C;  3WAP A;  4AJW A;  2FIF A;  2CHX A;  2DZI A;  2NPT B;  4YL8 A;  3RCZ A;  5DPW A;  3KYC D;  1E8Y A;  2KWV B;  2D10 A;  1YD8 U;  2DZK A;  4TQ1 A;  4IWO A;  4M8M A;  2Y5B B;  4IW0 A;  3CMM B;  2KO3 A;  4NAW A;  5AEK B;  4BKG A;  3ZO5 B;  3VDZ A;  1V49 A;  2GOW A;  4LDT D;  5G2N A;  2RPQ A;  1OQY A;  2ZVO A;  1LFD A;  3UGB B;  4HPL B;  2PPH A;  3HM3 A;  3CSF A;  2JRH A;  3QC8 B;  1VCB A;  1E7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...