2N7ZA

Solution structure of rip2 card
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
GIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of death domain signaling in the p75 neurotrophin receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor-interacting serine/threonine-protein kinase 2
total genus 34
structure length 106
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2n7zA00
4D8OA 2BBZA 4ZBWA 1DDFA 2GF5A 2DBFA 1E3YA 2N83A 2OF5A 4IZ5E 1WMGA 3EZQA 1CWWA 4N1JA 1E41A 3MOPA 2MS8A 3EZQB 4UZ0A 4RHWE 4I16A 2NZ7A 2YQFA 1C15A 1N3KA 2OF5H 2MPCA 2DBGA 3MOPG 2BBRA 2B1WA 1D2ZA 2N00A 4F44A 4LWDA 3T6PA 2MS7A 4IZAB 2N97A 4M9ZA 4FH0A 4P4HI 4A2QA 2DBHA 4O9FA 1PN5A 2MB9A 3J6JA 4JUPA 2NSNA 2LS7A 4N1KA 1ICHA 4P4HA 2KN6A 2HM2Q 1UCPA 2YU0A 3MOPK 2A5YB 2NAQA 1FADA 2MN4A 2N7ZA 4RHWA 2DBDA 3QF2A 4M9XA 4N1LA 4JQWA 1WXPA 2IB1A 4M9SA 4QOBA 3J63A 2G7RA 4E9MA 4IZ7B 2KM6A 2LWEA 2YGSA 4EWIA 2L6AA 3KATA 2DO9A 1Z6TA 1WH4A 2A9IA 1CY5A 4DWNA 2O71A 4F42A 4A2WA 3LQQA 2LWDA 2VGQA 2N1FA 3CL3A 2P1HA 4NQKA 3LQRA 1DGNA 2YVIA 2L9MA 1D2ZB 1A1WA 2N80A 4O7QA 2M5VA 3CRDA 4O9LA 3YGSC 1YGOA 2D96A 4O6XA 2F1SA 1NGRA 3YGSP 1A1ZA
chains in the Genus database with same CATH superfamily
4D8OA 2BBZA 4ZBWA 1DDFA 2GF5A 2DBFA 1E3YA 2N83A 2OF5A 4IZ5E 1WMGA 3EZQA 1CWWA 4N1JA 1E41A 2MJMA 3MOPA 2MS8A 3EZQB 4UZ0A 4RHWE 4I16A 2NZ7A 2YQFA 1C15A 1N3KA 2OF5H 2MPCA 2DBGA 3MOPG 2BBRA 2B1WA 1D2ZA 2N00A 4F44A 4LWDA 3T6PA 2MS7A 4IZAB 2N97A 4M9ZA 4FH0A 4P4HI 4A2QA 2DBHA 4O9FA 1PN5A 2MB9A 3J6JA 4JUPA 2NSNA 2LS7A 4N1KA 1ICHA 4P4HA 2KN6A 2HM2Q 1UCPA 2YU0A 3MOPK 2A5YB 2NAQA 1FADA 2MN4A 2N7ZA 4RHWA 2DBDA 3QF2A 4M9XA 4N1LA 4JQWA 1WXPA 2IB1A 4M9SA 4QOBA 3J63A 2G7RA 4E9MA 4IZ7B 2KM6A 2LWEA 2YGSA 4EWIA 2L6AA 3KATA 2DO9A 1Z6TA 1WH4A 2A9IA 1CY5A 4DWNA 2O71A 4F42A 4A2WA 3LQQA 2LWDA 2VGQA 2N1FA 3CL3A 2P1HA 4NQKA 3LQRA 1DGNA 2YVIA 2L9MA 1D2ZB 1A1WA 2N80A 4O7QA 2XV9A 2M5VA 3CRDA 4O9LA 3YGSC 1YGOA 2D96A 4O6XA 2F1SA 1NGRA 3YGSP 1A1ZA
chains in the Genus database with same CATH topology
4D8OA 2BBZA 4ZBWA 1DDFA 2GF5A 2DBFA 1E3YA 2N83A 2OF5A 4IZ5E 1WMGA 3EZQA 1CWWA 4N1JA 1E41A 2MJMA 3MOPA 2MS8A 3EZQB 4UZ0A 4RHWE 4I16A 2NZ7A 2YQFA 1C15A 1N3KA 2OF5H 2MPCA 2DBGA 3MOPG 2BBRA 2B1WA 1D2ZA 2N00A 4F44A 4LWDA 3T6PA 2MS7A 4IZAB 2N97A 4M9ZA 4FH0A 4P4HI 4A2QA 2DBHA 4O9FA 1PN5A 2MB9A 3J6JA 4JUPA 2NSNA 2LS7A 4N1KA 1ICHA 4P4HA 2KN6A 2HM2Q 1UCPA 2YU0A 3MOPK 2A5YB 2NAQA 1FADA 2MN4A 2N7ZA 4RHWA 2DBDA 3QF2A 4M9XA 4N1LA 4JQWA 1WXPA 2IB1A 4M9SA 4QOBA 3J63A 2G7RA 4E9MA 4IZ7B 2KM6A 2LWEA 2YGSA 4EWIA 2L6AA 3KATA 2DO9A 1Z6TA 1WH4A 2A9IA 1CY5A 4DWNA 2O71A 4F42A 4A2WA 3LQQA 2LWDA 2VGQA 2N1FA 3CL3A 2P1HA 4NQKA 3LQRA 1DGNA 2YVIA 2L9MA 1D2ZB 1A1WA 2N80A 4O7QA 2XV9A 2M5VA 3CRDA 4O9LA 3YGSC 1YGOA 2D96A 4O6XA 2F1SA 1NGRA 3YGSP 1A1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8O A;  2BBZ A;  4ZBW A;  1DDF A;  2GF5 A;  2DBF A;  1E3Y A;  2N83 A;  2OF5 A;  4IZ5 E;  1WMG A;  3EZQ A;  1CWW A;  4N1J A;  1E41 A;  3MOP A;  2MS8 A;  3EZQ B;  4UZ0 A;  4RHW E;  4I16 A;  2NZ7 A;  2YQF A;  1C15 A;  1N3K A;  2OF5 H;  2MPC A;  2DBG A;  3MOP G;  2BBR A;  2B1W A;  1D2Z A;  2N00 A;  4F44 A;  4LWD A;  3T6P A;  2MS7 A;  4IZA B;  2N97 A;  4M9Z A;  4FH0 A;  4P4H I;  4A2Q A;  2DBH A;  4O9F A;  1PN5 A;  2MB9 A;  3J6J A;  4JUP A;  2NSN A;  2LS7 A;  4N1K A;  1ICH A;  4P4H A;  2KN6 A;  2HM2 Q;  1UCP A;  2YU0 A;  3MOP K;  2A5Y B;  2NAQ A;  1FAD A;  2MN4 A;  2N7Z A;  4RHW A;  2DBD A;  3QF2 A;  4M9X A;  4N1L A;  4JQW A;  1WXP A;  2IB1 A;  4M9S A;  4QOB A;  3J63 A;  2G7R A;  4E9M A;  4IZ7 B;  2KM6 A;  2LWE A;  2YGS A;  4EWI A;  2L6A A;  3KAT A;  2DO9 A;  1Z6T A;  1WH4 A;  2A9I A;  1CY5 A;  4DWN A;  2O71 A;  4F42 A;  4A2W A;  3LQQ A;  2LWD A;  2VGQ A;  2N1F A;  3CL3 A;  2P1H A;  4NQK A;  3LQR A;  1DGN A;  2YVI A;  2L9M A;  1D2Z B;  1A1W A;  2N80 A;  4O7Q A;  2M5V A;  3CRD A;  4O9L A;  3YGS C;  1YGO A;  2D96 A;  4O6X A;  2F1S A;  1NGR A;  3YGS P;  1A1Z A; 
#chains in the Genus database with same CATH topology
 4D8O A;  2BBZ A;  4ZBW A;  1DDF A;  2GF5 A;  2DBF A;  1E3Y A;  2N83 A;  2OF5 A;  4IZ5 E;  1WMG A;  3EZQ A;  1CWW A;  4N1J A;  1E41 A;  2MJM A;  3MOP A;  2MS8 A;  3EZQ B;  4UZ0 A;  4RHW E;  4I16 A;  2NZ7 A;  2YQF A;  1C15 A;  1N3K A;  2OF5 H;  2MPC A;  2DBG A;  3MOP G;  2BBR A;  2B1W A;  1D2Z A;  2N00 A;  4F44 A;  4LWD A;  3T6P A;  2MS7 A;  4IZA B;  2N97 A;  4M9Z A;  4FH0 A;  4P4H I;  4A2Q A;  2DBH A;  4O9F A;  1PN5 A;  2MB9 A;  3J6J A;  4JUP A;  2NSN A;  2LS7 A;  4N1K A;  1ICH A;  4P4H A;  2KN6 A;  2HM2 Q;  1UCP A;  2YU0 A;  3MOP K;  2A5Y B;  2NAQ A;  1FAD A;  2MN4 A;  2N7Z A;  4RHW A;  2DBD A;  3QF2 A;  4M9X A;  4N1L A;  4JQW A;  1WXP A;  2IB1 A;  4M9S A;  4QOB A;  3J63 A;  2G7R A;  4E9M A;  4IZ7 B;  2KM6 A;  2LWE A;  2YGS A;  4EWI A;  2L6A A;  3KAT A;  2DO9 A;  1Z6T A;  1WH4 A;  2A9I A;  1CY5 A;  4DWN A;  2O71 A;  4F42 A;  4A2W A;  3LQQ A;  2LWD A;  2VGQ A;  2N1F A;  3CL3 A;  2P1H A;  4NQK A;  3LQR A;  1DGN A;  2YVI A;  2L9M A;  1D2Z B;  1A1W A;  2N80 A;  4O7Q A;  2XV9 A;  2M5V A;  3CRD A;  4O9L A;  3YGS C;  1YGO A;  2D96 A;  4O6X A;  2F1S A;  1NGR A;  3YGS P;  1A1Z A; 
#chains in the Genus database with same CATH homology
 4D8O A;  2BBZ A;  4ZBW A;  1DDF A;  2GF5 A;  2DBF A;  1E3Y A;  2N83 A;  2OF5 A;  4IZ5 E;  1WMG A;  3EZQ A;  1CWW A;  4N1J A;  1E41 A;  2MJM A;  3MOP A;  2MS8 A;  3EZQ B;  4UZ0 A;  4RHW E;  4I16 A;  2NZ7 A;  2YQF A;  1C15 A;  1N3K A;  2OF5 H;  2MPC A;  2DBG A;  3MOP G;  2BBR A;  2B1W A;  1D2Z A;  2N00 A;  4F44 A;  4LWD A;  3T6P A;  2MS7 A;  4IZA B;  2N97 A;  4M9Z A;  4FH0 A;  4P4H I;  4A2Q A;  2DBH A;  4O9F A;  1PN5 A;  2MB9 A;  3J6J A;  4JUP A;  2NSN A;  2LS7 A;  4N1K A;  1ICH A;  4P4H A;  2KN6 A;  2HM2 Q;  1UCP A;  2YU0 A;  3MOP K;  2A5Y B;  2NAQ A;  1FAD A;  2MN4 A;  2N7Z A;  4RHW A;  2DBD A;  3QF2 A;  4M9X A;  4N1L A;  4JQW A;  1WXP A;  2IB1 A;  4M9S A;  4QOB A;  3J63 A;  2G7R A;  4E9M A;  4IZ7 B;  2KM6 A;  2LWE A;  2YGS A;  4EWI A;  2L6A A;  3KAT A;  2DO9 A;  1Z6T A;  1WH4 A;  2A9I A;  1CY5 A;  4DWN A;  2O71 A;  4F42 A;  4A2W A;  3LQQ A;  2LWD A;  2VGQ A;  2N1F A;  3CL3 A;  2P1H A;  4NQK A;  3LQR A;  1DGN A;  2YVI A;  2L9M A;  1D2Z B;  1A1W A;  2N80 A;  4O7Q A;  2XV9 A;  2M5V A;  3CRD A;  4O9L A;  3YGS C;  1YGO A;  2D96 A;  4O6X A;  2F1S A;  1NGR A;  3YGS P;  1A1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...