2N8GA

Nmr structure of the homeodomain transcription factor gbx1[e23r,r58e] from homo sapiens
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
GAPGGKSRRRRTAFTSEQLLELRKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNERAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1[E23R,R58E] from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2n8gA00
2MGQA 1FTZA 2LVSA 1I50J 2X48A 4C3IJ 2K9QA 3TEDA 3S2DJ 3SJMA 5EF6A 2NS7A 3VPRA 2K40A 2EZIA 5F27A 1HLVA 1F43A 3GTLJ 2M9HA 5J1UA 3S1NJ 2HQ5A 3CDLA 2XPVA 1MBHA 3HGGA 4ABZA 3LNQA 1Y1VJ 3LSJA 2JJ7A 2XGEA 5E3NA 3BR0A 5K7ZA 4A3BJ 1UG2A 4A3JJ 2E2JJ 2DMPA 2LLKA 4BY1J 1UHSA 5EGOB 5C4JJ 1U78A 1GUUA 2JMWA 5J1RA 5K7FA 4A3EJ 2H1KA 1F36A 5F1JA 4S0HB 1GDTA 2LY9A 2Y9YA 1IG7A 1MBFA 3BT9A 1WGXA 1I3QJ 3E7LA 1VFCA 1RETA 2DTZA 2EH3A 2R7ZJ 2DMNA 1T56A 1IGNA 2CUEA 4X1EA 4UUSB 3M4OJ 2EZHA 1JKOC 2JA7J 4M3EA 2DA2A 2R5ZA 3IH2A 3LOCA 5F0CA 4G12A 3CMYA 3GTPJ 2XB0X 5J3LA 1YRNA 5E3LA 5EG0B 2EZLA 2QF7A 2XSDC 1H8AC 3PM1A 3GTOJ 3CCYA 5F0HA 4BXXJ 3NAUA 3W6VA 3IV5A 3SDGA 1P7IA 1B72A 2TCTA 5BNGA 5M3MJ 3S14J 2RAEA 3QPLA 1MH4A 1QVUA 1ITYA 5IP6A 2DMUA 4W1UA 4AYBN 2R93J 1IDYA 4XRSG 4MFEA 2IEKA 5IYCJ 3Q0UA 3LSGA 4CYCA 3DCFA 4A69C 3A02A 1JT0A 2M8GX 1OCPA 4QSHA 3FKIJ 2D5VA 4L5EA 2MG4A 3PO2J 3RKQA 3B6CA 5IP7J 2Y2ZA 3BG5A 4DYRA 4EEFG 4QIWN 4M6VA 1ZK8A 3TP0A 4A3LJ 1RPWA 4JX5A 2N8GA 5FKNA 5C44J 1AU7A 2KDZA 3FK6A 3HOUJ 1TWGJ 3S15J 2DJNA 1XS9A 3O8HA 2VI6A 1W0UA 4XK4A 1BW5A 3Q0WA 1ETVA 2LTPA 2JA8J 1HOMA 3I4MJ 1ORKA 1ZKGA 3FK7A 4JP0A 1PUFA 5C4XJ 5IPAA 2JA5J 2NS8A 2XPWA 2DA4A 2QCOA 5GPAA 2R5ZB 3LSRA 1S7EA 4A3FJ 1TWFJ 2R5YA 2L7ZA 4IEJA 1Y1WJ 1TC3C 4RBOA 3HKZN 1YRNB 5C3EJ 2JN6A 2WAQN 3BTCA 4XIDA 2HI3A 1QRYA 1K61A 3BR3A 3BG9A 3GBGA 1SFOJ 3OOUA 4A3GJ 3CQZJ 1I6HJ 4RDUA 1B72B 3JR9A 1B8IA 1QVTA 1W0TA 3HEFA 5E3MA 1E3OC 5F08A 1GVDA 5IYDJ 1NK3P 1FIAA 2VPRA 4V2FA 5EYRA 1IJWC 4IHVA 2AHQA 2E1OA 3GTGJ 4GFBA 4Y52J 5K7HA 1G2HA 2ME0A 4AC0A 2DMTA 4CYCB 2L7MP 3JRBA 1JTXA 1X2MA 3MN2A 2HOAA 3TW6A 4FTHA 1ZTRA 3JRAA 1X58A 2ID3A 2DA6A 2P81A 5FKKA 5DTDA 1BL0A 3BR6A 1JJ6C 2HOSA 3I4NJ 2ELKA 3IH4A 1ETOA 4D5CA 2DA1A 4IHXA 1WH5A 5JLWA 1Z77A 1MBEA 1LFUP 1ZGWA 4J19A 1JJ8C 1FTTA 2PMZN 1ETYA 2JK3A 2K9NA 3S1QJ 1ENHA 2Y30A 1AKHA 5JLXA 4B4CA 3H3VK 1RESA 1A6IA 3BR2A 2H8RA 1MBKA 2YU9J 2LFBA 4FE4A 3RZOJ 3Q3SA 1JUSA 4HNVA 4IHWA 4A3MJ 1PUFB 2JA6J 1JGGA 2FX0A 2FQ4A 3WHBA 2R5YB 4BY7J 3BTJA 2O8KA 2XGCA 1WI3A 2Y9ZA 3A01A 5F0FA 5M3FJ 3S1RJ 3JRCA 2ID6A 2X9DA 3RQIA 2CRGA 1TWHJ 2O7OA 5DS9A 4D5FA 1MH3A 2NVTJ 4M3FA 1HDPA 1Q1VA 3ZOBA 1ETWA 3C2BA 4JX6A 3OSFA 2R92J 2COBA 1WCMJ 4XICA 1POGA 1B8IB 3BTIA 3JRDA 2ECCA 1XC5A 3NARA 2E2HJ 1Z0XA 3M3YJ 1DU6A 2LP0A 1D5YA 1U9NA 4M3BA 3LSPA 2EBIA 4MO7A 1BA5A 2K9SA 3S2HJ 3G1MA 1NK2P 1BW6A 5GP9A 3G1OA 3TP3A 2B63J 3S16J 1MSEC 3DEWA 2OPTA 1QPIA 3ZQCA 1LFBA 1ZQ3P 2E2IJ 2M0CA 5EZGA 3JRFA 2IAIA 3A03A 1LE8A 2KT0A 1NTCA 3JRIA 4QTRA 2NOGA 1GT0C 5EDNA 3D1NI 3FISA 1AKHB 3F0CA 1RKTA 3BG3A 2L7FP 1OFCX 1TWAJ 2OF7A 1SANA 4LOCA 2FJ1A 2XB5A 3JRGA 1JUMA 1DU0A 5FLVA 4D7NA 1CQTA 2M2EA 5FKOA 2LR8A 3H0GJ 3ZQFA 2LD5A 5M5XJ 5IOYA 9ANTA 1XG1A 3QQAA 3L1PA 3A01B 1HF0A 4B3AA 3TW7A 1VI0A 2HYJA 1A5JA 2CU7A 3BQYA 2VUMJ 1JKQC 2YUSA 5M5YJ 2WV1A 1EF4A 2VKEA 4DYQA 3HOXJ 3GTKJ 5M5WJ 1H88C 1BJZA 2I10A 4B1RA 3HDDA 1T33A 1OJLA 1X2NA 5IP9J 4MIMA 2XPUA 3HOYJ 1IDZA 2YS9A 2HDDA 4W97A 3BR5A 5IOZA 3JRHA 2CQXA 1OCTC 5EZHA 4BBSJ 3BTLA 2Y31A 1APLC 2IBDA 4MLOA 2DA3A 3ZQLA 4IHYA 4A3DJ 2CJJA 1LE8B 1JTYA 4X6AJ 1VNDA 1GV5A 3HBLA 2LKXA 4DZPA 1P7JA 4D7MA 5IYBJ 4FCYA 3BR1A 1H89C 1ZR4A 1JUPA 3MKLA 1RR7A 1O4XA 3PO3J 4V2GA 1IC8A 4A3IJ 4FISA 2JWTA 2NVXJ 3HOWJ 3HOVJ 1ETQA 1JKPC 3HB9A 2DA5A 4C3JJ 3HM5A 1IV6A 2MSYA 2EZKA 2X6OA 2GBYA 3OSGA 1WPKA 1JKRC 4BBRJ 5FKMA 2EQRA 4A93J 2M34A 4NDLA 1FJLA 2WB1N 2VKVA 3OIOA 4AUXA 2HXOA 1TWCJ 1U8BA 1IUFA 2XRLA 3K2AA 3UKGA 1AHDP 3S1MJ 1WH7A 4A3CJ 2DN0A 1HCRA 2DA7A 2TRTA 2CQQA 2GLOA 1FIPA 2E19A 2LK2A 3GTJJ 2AO9A 3S17J 3BQZA 2DMQA 1ETXA 4DZJA 4A3KJ 3SFIA 2R0QC 1MSFC 5FKLA 2CUFA 2Y0SN 4XRSA 2XGDA 2G0EA 3IH3A 3ZQGA 4DW6A 5E3OA 2W48A 3WHCA 5FJ8J 5J1YA 1MNMC 4FE7A 5EGOA 2MW8A 3QPSA 1U9OA 3ZQIA 1GV2A 3ZQHA 1IRZA 5F04A 1JT6A 2ZB9A 2NVYJ 3MVPA 3JREA 4I6ZA 1MBJA 4Y7NJ 2L9RA 2O9LA 4BKXA 1VF9A 1HDDC 3RZDJ 4C2MJ 2NVQJ 3GTQJ 2ME6A 2ECBA 4UUSA 4DYCA 1R9TJ 1ETKA 3O8GA 1RKWA 1K83J 2FD5A 1FEXA 1UMQA 3HOZJ 4I76A 2HXIA 3G1LA 4UUTA 2L0KA 3B6AA 1MBGA 5GPCA 4JYKA 4XRMA 5EG0A 3K7AJ 4C3HJ 5EEAA 1ZR2A 2HOTA 3GTMJ 3FIWA 3HGYA 4MFDA 5HODA 2GM4A 3Q0VA 5FLMJ 4M3GA 4M3DA 4JX4A
chains in the Genus database with same CATH superfamily
2R7QA 4LLLA 4KITB 3W6KB 1IF1A 4I98B 2X6YA 2BXYA 1ZG1A 5DM7F 1X1PA 3P7NA 3PUFA 2XPVA 3HGGA 1DPRA 1Y1VJ 4CCLA 1B4AA 1YJ9I 2XAQA 4G6QA 4X0GA 2JJ7A 2XGEA 4A3BJ 2DOAA 2DJIA 5DDGA 3HTUA 2LLKA 3A0HC 3GLXA 4HF0A 3GFMA 3ZXSA 1SFXA 2EV5A 3TL4X 4XLEA 5K5RA 1I6XA 1D1BA 2JMWA 3KP2A 5J1RA 3PNVA 4L9TA 2H1KA 1NG6A 1R1VA 3QPTA 3VB2A 1L0OC 3F8BA 5IT9Z 3M1CA 3BT9A 5ILVA 1WGXA 4CHUA 3E7LA 3I9V2 4UNOA 4NQWA 4XONA 3U1DA 4KIGA 3F8MA 4Y33A 3CUQB 1ODDA 1IN6A 2UV1A 3M9AA 4LMYA 3C2HA 3RQ4A 3RSNA 2QLZA 1X4OA 3M4OJ 2EZHA 1JKOC 1QA6A 2ZC2A 4P96A 4E6KG 4M3EA 4P55A 2JA7J 3HRUA 1IRGA 1LVKA 5HDGA 4UV9A 5CQGA 4XM3A 3H36A 2I8DA 1VQ7I 3BC8A 3BY6A 1PVEA 4ETSA 4CA0A 1YRNA 1N25A 5J6XA 1BI3A 2XSDC 1LDKB 4AIHA 3SFZA 2DU9A 3HRTA 2XRNA 5F0HA 3GTOJ 3G2BA 2ADUA 4BXXJ 1ZARA 3NAUA 4RGRA 3ZCOA 3WU2C 3V7RA 4BHPA 1DGRM 2HPMA 1HKSA 2LREA 5TRDA 3CCVI 3C3WA 4PJLA 3IC7A 1WRJA 5BNGA 5CVUA 1WJEA 2PN6A 4Y17A 2YSRA 3MWMA 4HG2A 3WGHA 5LD2C 4BDYA 3ULQB 3T8TA 1SAXA 1H0MA 2IEKA 5B3SH 5IYCJ 3GLLA 3Q0UA 4CCOA 1BI2A 3DCFA 3VEPA 1UFMA 4BEHB 1T8IA 1O3SA 3LAJA 3VODA 4L5EA 3W2AA 1RNLA 3OIPA 3PJRA 3LA3A 5J47A 2QSGX 2KDZA 4AIDA 2ESHA 5FO5A 3HOUJ 1FY7A 3S15J 4KISA 2EB7A 3D0SA 3O8HA 1Z67A 2BXZA 3RKWA 2VI6A 4CUGA 2FNPA 3K4NA 1X1CA 2X1EA 3I4MJ 2ELJA 4JP0A 4EV0A 1PUFA 4Q5SF 1XPXA 1SMYF 2HKXA 5E8IA 2O61A 5EJCA 3H0DA 2R5ZB 3BP8A 1IN5A 3EUAA 2E1CA 2PJPA 2UWMA 1TC3C 3CDIA 4U7DA 5C3EJ 4N9HA 4BQAA 2JN6A 3HKZA 5IY5H 1QRYA 1OMIA 3CDHA 4LK1F 1K61A 2XKOA 3LSHA 3BG9A 3HHHA 4II2A 2HEOA 2QGUA 1G3YA 3CQZJ 1YQAA 2A3SA 2CO5A 3BDDA 5E3MA 3I54A 3IKTA 1E3OC 1R5ID 4OINF 4HX4A 1SVMA 2ZFWA 1FIAA 4L0ZB 2VPRA 4HW0A 1IJWC 3GTGJ 2E1OA 4Y52J 5LHIA 5HDNA 4BNCA 5DD8A 5GTIC 3JRBA 1JTXA 3LFUA 3DEUA 3M8FA 1TQMA 5KHDA 2DOEA 1ZTRA 1UJ8A 1YW7A 2ID3A 2FOWA 4ZH4F 1OCZH 4B8XA 1E3PA 2LG4A 2BEOA 2V9KA 2VJJA 3FXLA 4Q47A 2Z9OA 2A5WA 1JJ6C 3QYFA 4BJTA 1YX3A 3SEQA 2CW7A 4D5CA 1ZLJA 4IHXA 5D4SA 3H5NA 2QEXI 1Z77A 1D0XA 2OJED 4BQNA 1LFUP 1ETYA 2JK3A 2ZXHA 4GCVA 4DQ2A 5JLXA 1WWXA 2Q2EA 2DPDA 2WAEA 1RESA 1U0JA 2CFOA 2O03A 4BDZA 3BWGA 3BR2A 1YW8A 1REPC 2YU9J 3FM5A 1W5TA 2FSWA 4G8XA 1VTNC 4OIOF 3RZOJ 3S2WA 3J7AY 3BJ6A 4HNVA 2UZKA 4IHWA 2BV6A 2JUGA 3AKZA 2PMHA 3DKXA 3DEEA 1LB2A 3N05A 4LGWA 2VBXA 2DODA 3WHBA 3HSRA 1Y8RB 3BTJA 3KP4A 5F0FA 5CVIA 2P5KA 4CGZA 2K3FA 2ID6A 2X9DA 4YELA 3H1CA 2EA4A 2ACJA 4AVZA 3FZVA 1WFXA 4UXNA 1I1GA 5KAFC 2DAOA 1VQKI 3DPLC 4M3FA 1Q1VA 2VBWA 2R7VA 2KQRA 4XICA 2DFIA 1EH6A 4PJ0C 1B8IB 2ECCA 1R1UA 3C18A 4PK4A 2E2HJ 1BOBA 4EJTA 2GOXB 3PFIA 3M3YJ 2LP0A 3KEQA 2PLYA 2B0LA 2F5FA 2JPCA 4M3BA 2A5YB 1F4KA 2HFHA 3LSPA 1V54H 1C0WA 2K9SA 3G1MA 2KL4A 3PSFA 1BW6A 4RGSA 3TP3A 3VOEA 2KZVA 1U8RA 4D1QA 3T1BA 3DEWA 3RTRA 3JCUC 1TT0A 2F4IA 1LFBA 5D5WB 4OIRF 4BH9A 3CCUI 5FRNA 1LE8A 3OYMA 1NTCA 3L2VA 1ON1A 3F22A 2NOGA 3LA7A 3QP6A 1Y39A 1GT0C 3M8EA 2CV2A 1W1WE 3OYDA 2QBYB 2OF7A 2QSHX 2RQQA 4LOCA 2EFQA 4HPQA 2OCCH 2XC7A 4EM2A 3JRGA 2OU2A 4UY8I 4A0YA 2LF8A 1WJ5A 4XRFA 3ASNH 4D7NA 2HZDA 1TZLA 3PL8A 3SHFA 4AIJA 3HL2A 3DBHB 4N0BA 3DPUA 3MZYA 1S5LC 9ANTA 3A01B 2RVCA 4XSXF 2OZUA 4B3AA 2JRMA 3BLYA 3B73A 1O3RA 2VE9A 5HS9A 2LH9A 4L9NA 1FMVA 2DT5A 1JKQC 2YUSA 1EF4A 2WV1A 3FHNA 2OCEA 3MKWB 4DYQA 1YE9A 1UG0A 4PDKA 1H88C 1V5GA 1BJZA 2V1XA 2JRTA 3QOPA 3E1SA 1W7PD 3ISPA 4DBQA 3GX4X 2BYVE 4B1RA 1GXPA 4BQQA 5IP9J 4MIMA 2XPUA 3R6SA 2F4OB 1EKEA 3RIRA 2YS9A 3KPHA 4PJJA 3NRVA 2LC2A 2PMUA 2ZCWA 2GIVA 3SZTA 2CQXA 2L54A 1OCTC 4BBSJ 3BTLA 1APLC 1U2WA 5DUIA 4NC8A 3DLAA 2E5NA 2F5VA 3K4JA 1OISA 2FQ3A 2KIFA 2KISA 4WX9A 2CJJA 3OYKA 4X6AJ 3H9GA 1YS7A 4BJ6C 3VYTB 3OYEA 4ZJZA 4FCYA 1H89C 2IRFG 3PNYA 4I0AA 1O4XA 2R3SA 1FYKA 3WTSC 4P5OA 4A3IJ 2K7LA 2JWTA 3CCQI 3QRFF 1G6NA 2O8XA 3K70C 3ABTA 1ETQA 3C7JA 1JKPC 5DCFA 2CS3A 4C3JJ 2JVGA 4Q4ZF 1IV6A 3UNGC 3V8KA 3DKYA 1HW5A 2NVUB 3TBIA 2GBYA 1JKRC 3K6GA 3R0JA 4E70A 2BOLA 2HGCA 2FUG2 3KP3A 2VIXA 2EV0A 3LSMA 4IKFA 3S1MJ 3K10A 4BXFA 2JT1A 2FU4A 2DA7A 2L9NA 2F5DA 3OL4A 4U0WA 3A0BC 5GAGJ 4OWRB 2GLOA 2W82A 3BJOA 2QUFA 2LK2A 1VQPI 4RAZA 4LLGF 1LPQA 4GXOA 3KP6A 4CCNA 1ETXA 3SFIA 3HSEA 4RLFA 2R0QC 2X1DA 1MSFC 2CUFA 2LY2A 5E1ZB 1D1AA 3DU6A 3IP4B 5K5QA 2XGDA 3OYHA 1I5ZA 1SC7A 2OD5A 4ZDLA 1IUYA 2CYYA 4HF2A 4FX0A 4E7ZA 1Y6IA 3GZ5A 4CO8A 2DFEA 4KIBA 2KLOA 3J7ZI 2WADA 2MW8A 2PQ8A 1GV2A 1JT6A 3G4SI 2W25A 4HDUA 2JVHA 2MABA 3KEYA 3LQQA 1G3SA 2E5ZA 1MBJA 4H4KC 4Y7NJ 1Q1HA 2BHZA 2DYSH 1STZA 4XKVA 3E6CC 4CZCA 4EATA 3E6BA 2V7FA 4EGYA 3JAMK 2VASA 2BGCA 2OQGA 3LL7A 3EUHA 4YIIA 2DQRA 4JOMA 2Q0OA 1RKWA 2ZMEA 1O3TA 1UMQA 3K1MA 3L9FA 1XDUA 1G3TA 5E20A 3FBNB 1RIOH 1WJAA 3V7SA 1D8JA 3HJEA 4EJUA 4L5JA 4LLNA 5DD4A 2HOTA 1PP8F 1HKQA 1ZN2A 1T95A 1YFHA 1O7FA 1MMNA 2CV0A 3CF5F 4S04A 2GM4A 5L3FA 3Q0VA 2MYSA 1SVOA 3AG3H 2BW3A 2MGQA 2LVSA 3LSKA 4Q48A 1T6SA 3DXJF 5LEKA 3TEDA 3J7AO 5IT9K 2QSFX 2RN7A 1S6LA 2NS7A 3ABUA 4F93B 1TLHB 2L01A 3VPRA 2BE5F 2RGVA 4ITVA 3HOSA 5D8KB 4XLNF 4LK0F 3GTLJ 5J1UA 2HQ5A 2E60A 2DK8A 2Q8KA 3H35A 4ABZA 3LNQA 1R4NB 4UVCA 3GYHX 1J2XA 3LSJA 2PJRB 1X1DA 3I56I 3BG6A 5E3NA 3BR0A 5K7ZA 4HLXA 5GAEJ 4BACA 2D2WA 1HW1A 1E2XA 3GMEA 2VOOA 4BY1J 1UHSA 1GUUA 3E97A 3FM3A 3ONQA 3HOTA 2OTJI 1HQCA 3EUHC 4BGDA 1FBQA 3CF2A 2Y9YA 3TGNA 4FQGA 5KNLA 1IG7A 1MBFA 2ZMEC 1B6AA 3TOAA 4HV5A 1VFCA 1BR2A 2R7ZJ 2KZGA 2WY7Q 3V7CA 4R79A 4DOZA 2M3AA 4UUSB 4WXDA 1TNTA 4EJVA 4EVIA 3K4CA 1OPCA 1N78A 4XMYA 2DA2A 5CVJA 3JSPA 1ZELA 5H2FC 3WTTC 3LOCA 5F0CA 5LRRA 5JFRA 1K78A 3BG7A 4R8HA 5AONA 4XORA 2DCEA 1FMWA 5JVTA 3DV8A 3BPXA 1H8AC 3PM1A 4V19K 1KYWA 3HZJA 3CCYA 5E18F 3J7YJ 3SDGA 1PJRA 1WJCA 2W84A 4O6JA 1EV7A 4D0PA 2V4JC 2WA0A 2ZXWH 3S14J 4PUSA 2RAEA 2QZ8A 2RV8A 2K5CA 1MH4A 1RZ4A 2IA2A 4W1UA 3OYIA 1VQOI 2DK5A 2OC6A 3FBIB 2PJRA 1IDYA 4MFEA 1OCRH 5FFXA 2O6GE 2DLLA 3HRMA 3LFKA 2ICWG 2RC4A 4Z2YA 4AD9A 4Z6YA 2ISZA 3DFGA 2GAUA 1BN5A 3D5RC 2KPMA 3OS2A 2JPBA 3RYPA 3FKIJ 1EA3A 3R60A 2F48A 2LY1A 1R5HA 4EM1A 3PO2J 2ZJRF 3RKQA 4QIWN 1FT9A 4BHCA 3HRSA 2LKSA 1KZHA 3TP0A 1RPWA 2L02A 3BCAA 5J8CA 5C44J 5BS6A 4XOTA 4IVNA 4LFUA 3IAM2 4B09A 1FC3A 2VXZA 4I2OA 2DJNA 1R6RA 4NQWB 3RPUD 2VC0A 3FMSA 4XK4A 1BW5A 1KQ8A 1U5TA 2LTPA 1HSJA 2FA5A 3J80K 1H9TA 1ZKGA 5D5VB 4IRIA 2R7TA 2JA5J 2XPWA 2DA4A 5GPAA 4A3FJ 3LSRA 1S7EA 2P6TA 2R5YA 1Y1WJ 1HW2A 4RBOA 2XKPA 1BC8C 1P4XA 3GW2A 5A2QK 3HKZN 4QLCU 1VQ5I 2KRHA 1YRNB 2WAQA 3HXLA 1K79A 1FP2A 1QHHD 2VT3A 3BR3A 4M6YA 2VBYA 4ZC3A 3X2QH 1IXRC 2VPLA 3FXMA 3JAMZ 2P5VA 2R7OA 3OOUA 2G9WA 1I6HJ 3KEOA 3S8PA 4A0XA 2R7XA 1QVTA 1JXSA 1JE8A 5F08A 5KAIC 3VFZA 5J4YA 5IYDJ 2IGKA 4G6TB 2A6TA 3CP8A 2P7VB 2HZTA 1HKTA 3QWLA 1QNTA 3CTAA 4C30A 1K4SA 5K7HA 1FOWA 2Z99A 5IT3A 2ME0A 3N97A 4OIQF 1LDJA 1TW3A 3MN2A 3ERED 2H27A 2FEZA 1XN7A 4FTHA 1XCBA 4I02A 5H20A 2Z2SB 3GZ6A 1T2KA 2P81A 2W85A 2XF7A 5DTDA 3OYGA 3NEUA 5J40A 4XLFA 2K9MA 2HOSA 1SFEA 2ELKA 1MMAA 3IH4A 3F3XA 3OS1A 4ENNA 1IN4A 1U5TC 4LD5A 4J19A 3K0LA 1W4MA 2DT6A 2L4MA 2PMZN 5E8GA 2K9NA 3S1QJ 1AKHA 1YS6A 4KNYA 3I53A 3T5XA 4B4CA 1YW9A 2I5UA 4CCMA 3DPTA 2CFXA 1D0YA 2K85A 2H8RA 1MBKA 3GXOA 5K1YA 4GYGA 5BPDA 3E3VA 1ZRDA 4B47A 4A12A 5ICEA 3L2CA 6PAXA 4A3MJ 1PUFB 1D0ZA 2HS5A 2JA6J 1S8NA 2FQ4A 3QU6A 3F8FA 2B9SA 4KIFA 1K6OA 4XN3A 5M3FJ 3S3NA 1TWHJ 2O7OA 3K4LA 5DS9A 2VXDA 1Z7UA 4RGXA 4HAMA 3ZOBA 1ETWA 3C2BA 4JX6A 3ZN1A 2ETHA 2MLGA 3L2WA 4UVAA 3OSFA 2XUBA 4C2TA 3TDUC 1MKMA 3D5SC 2JTVA 3OV8A 3NARA 1R71A 4PFPA 3TDZC 1TL8A 1R23A 4L9JA 3E6DA 4AIKA 1SFUA 2BY1A 1W36C 1D5YA 4E7LA 2L4AA 1A6QA 4MO7A 1BI0A 3HSFA 2M7BA 3ZQ7A 3VDXA 2GXBA 2PFBA 3AFHA 3G1OA 3I59A 3CLQA 2IGNA 2UXNA 2E1MC 3ZMVA 5LHHA 1LEBA 1MSEC 5F64A 3S3MA 3ZQCA 4MHGA 2E2IJ 3GFJA 1ULYA 2IAIA 3G6EI 5K5OA 3QYBA 2KT0A 4OIPF 2EPFA 4QTRA 1V55H 2HWVA 1UAAA 1BR1A 3D1NI 3TO7A 3FISA 3KE2A 5KK1A 2IT0A 2LMDA 3EPZA 2Q2EB 3I4PA 2L7FP 4FT8A 1OFCX 5HDKA 1A36A 1Z6TA 4NNJA 1P4WA 3IHUA 1VQNI 4EQQA 1AA7A 2FJ1A 2K27A 3K1NA 1JUMA 5LEJA 1EH8A 2HDWA 4KMUX 1S7AA 4O5VA 3ABKH 4E7IA 3QOEA 3V42A 2XAGA 1QZYA 2AXLA 4Y15A 2LR8A 3G3ZA 2P5LC 1D8KA 3KIOA 3ECOA 3ZQFA 2LD5A 1OCOH 1XG1A 4XOPA 2R4GA 5EEGA 3TW7A 1VI0A 2PEXA 2CH0A 3I71A 4CCJA 5H6RA 2M4KA 1QZZA 2CU7A 3BQYA 2O3FA 1MDMA 3F23A 2XROA 3WTXC 3GTKJ 4HEA2 3LWFA 1SAUA 5JR3A 3J80Z 3T8RA 1SD7A 3HDDA 1X3UA 1T33A 1X2NA 3HPGA 3SXYA 2EINH 5GAHJ 1DP3A 1ERDA 5A2QZ 3K9TA 3CO6C 1FWZA 2FBIA 2K9LA 3D5LA 1RUNA 3HYIA 2GXAA 4B43A 2MA3A 3BR5A 3JRHA 3CCMI 2E71A 2QQBA 4OMYA 2CG4A 3CLOA 5GTHC 5ICGA 2IBDA 3KYDB 3I58A 3ZGKA 3KCCA 1UHWA 2PMZA 3KZYA 2DA3A 4CICA 3ZQLA 1IAWA 2BVMA 1F9NA 1TTYA 1LE8B 3KZIC 4EM0B 1VNDA 1LNWA 1A35A 2XGXA 3HBLA 2X85A 1P7JA 4EJOA 4YIRX 1R00A 4L5IA 3I64A 4G6DA 3BR1A 2R7FA 4WK8F 1S9HA 3VWBA 1IC8A 4U87A 2ESNA 4Y3OA 4DBRA 2NVXJ 4HRIA 4ESJA 3OYNA 2LBFA 2DA5A 5LGUA 2JA2A 1P4AA 2XSJC 2EZKA 4F52A 1WPKA 2CUZA 5FKMA 4NDLA 5KCMA 2WB1A 4P9UA 1SD6A 1TWCJ 4RS8A 3MQ0A 4LG3A 2W7NA 1UZCA 4HDVA 3FXRA 2DN0A 2HPIA 4WF2A 1MGTA 2IA1A 2BY2A 1F1ZA 2IJLA 2CQQA 1IN8A 4XBFA 4OMZA 4S05A 2R7RA 1RR8C 4PSXA 2IS6A 1KYZA 3GTJJ 4A5MA 2AO9A 3B02A 4U7BA 3WU1B 2WV0A 4F3QA 2VL8A 2VJ5A 2MC4A 5L3CA 2XAFA 4NBQA 4KICA 1G59A 3ZN0A 2P8TA 3WGIA 1P6RA 1XGOA 1LJ9A 1QO0D 4GRIA 2A6HF 3ELKA 2G0EA 4DW6A 3WHCA 2HKOA 2NS0A 4HSRA 4HV6A 5J1YA 2UUZA 1MNMC 4FE7A 4PGHA 5EGOA 2MFZA 4HZFA 4KJZA 4HBLA 4A6EA 4RAYA 5F04A 2X51A 1R7JA 2NVYJ 3MVPA 3JREA 5L3GA 4I7HA 4YEJA 4BJ5C 4BQOA 3ML6A 1VF9A 1QHGA 2Z16A 5LRSA 3RZDJ 1HDDC 3WU0A 4N4OB 3GTQJ 2OBPA 2IA0A 3M07A 2ECBA 2KRFA 1HA8A 2ZKZA 2CWEA 4DYCA 4IOAF 3GUDA 4JK1X 1W5SA 4FETA 2VQGA 3O8GA 4ZYGA 2V6CA 2VQLA 2VODA 3DQVC 4XKCA 2MLKA 4MNUA 2BZTA 3OWTA 2HDCA 4RAGA 2W1OA 5CPRB 4UUTA 2L0KA 3B6AA 1MBGA 5EG0A 3K7AJ 1BOAA 4RA2A 2HTSA 4CXFA 5EEAA 3GTMJ 1S3JA 2G7HA 5B1BH 4B3XA 1NHAA 1WVRA 3PQKA 4MFDA 3LA2A 3WODF 2F6CA 1B1BA 2F2EA 1Y56A 5FLMJ 4JX4A 1YIJI 1FTZA 1U6GA 2X48A 4C3IJ 1SEUA 2CW8A 1OYWA 3MCZA 4RB1A 5HLHA 3F8NA 1MMSA 2VQHA 1D5VA 2K40A 2EZIA 5F27A 2HQNA 1HLVA 4G94A 3ERMA 1F43A 3H5RA 1XSDA 2P7CB 5L3DA 3S1NJ 1H9GA 1G3WA 2EFPA 4U0YA 2VLAA 4KN4X 2BHYA 3KP5A 3KLOA 3H3UA 4MTEA 1YI2I 1UG2A 1USSA 4RM2A 1V5EA 3DTEA 4A3JJ 2CV1A 4JBAA 4XN0A 3QU3A 2ZNYA 4CDGA 4KMFA 5CKTA 2GA1A 5K7FA 4A3EJ 1ZRFA 2OA4A 2MC3A 2V1DA 3BZ6A 5F1JA 2M87A 3UR3C 2M0MA 4OAZA 4HF1A 3K4BA 1I3QJ 3GO5A 2IVMA 3GCMA 5BPIA 1R49A 1BIAA 1RETA 4DIQA 3FXJA 2VJ4A 1T56A 3QPHA 2CUEA 1IGNA 2E34A 1Z3XA 5LGNA 2DXIA 2O0YA 4HNTA 1MJAA 4PZJA 2ZMEB 3BROA 3RKXA 3IH2A 3CMEI 4LG0A 1YX5A 3W2WA 3GTPJ 1IO2A 3OOPA 3IRQA 2XB0X 5J3LA 1IN7A 5BMZA 3R4KA 5E3LA 3Q9VA 2XIGA 3L2QA 2C6YA 3PQJA 2KP6A 2PI0A 1VQ8I 3ASOH 2A05A 4I09A 1R22A 3W6VA 2J5PA 3P9KA 3HUGA 1WSUA 3CUOA 1A04A 1B72A 2BW3B 5M3MJ 1K4TA 2KIQA 3QPLA 2OUMA 2QENA 2DMUA 1TBXA 1DQUA 4XRSG 4J01A 1TNSA 3ECHA 2RQPA 1PYVA 4U0VA 5JHFA 2FMYA 4CH7A 5CJ9A 4CYCA 2TDXA 4GO1A 1T0FA 2G7UA 3A02A 3GZNB 2LRDA 1DGWY 1JT0A 1OCPA 4QSHA 3U21A 2D5VA 1W7PA 5E79C 2YX7A 1ACIA 1R58A 2KFDA 4MEYF 1S72I 3B6CA 5IP7J 2Y2ZA 5HVQC 4YFXF 3ZPLA 3G71I 4M6VA 1ZK8A 1ZRCA 4A3LJ 3P5JA 3P9CA 3F6OA 2N8GA 5FKNA 3H92A 5HNHA 2BVLA 2IP2A 2LDUA 4CCKA 4GYIA 2NNYA 1XS9A 4B48A 1OQYA 1W0UA 3Q0WA 2HTJA 3ZMZA 5E17F 3CCRI 1IRXA 2IPQX 4FHTA 1ORKA 3QP5A 3FK7A 3PIPF 1A31A 3OYJA 4GDFA 2L2OA 5GADJ 2MH2A 1KONA 1CGPA 4C9YA 2M1BA 4IEJA 3KETA 1DP7P 3WE3A 1BM9A 1K78B 4XQFA 3EYIA 1HC8A 1B9MA 2GQQA 5HOOA 2LKPA 4DGWB 2WAQN 2HI3A 1FX7A 2HVRA 2YX4A 3CMAI 1Z1DA 4LB6B 1J9IA 5CQEA 2V1UA 4RDUA 4E7KA 3JR9A 1W0TA 3MKYB 3PSIA 1GVDA 5B66C 1T0FC 1NK3P 3AAFA 3WTYC 4IHVA 1KU2A 1V5FA 3M8JA 2AHQA 3M1EA 3RCOA 2VT2A 4GFBA 4H0EA 4E7SA 5HLIA 2AS5F 4C2UA 2BBYA 2QQAA 2VKHA 3OR1C 4UB6C 2DMTA 4AC0A 2L7MP 3IL2A 3LSTA 2YU3A 4OOIA 4NHJA 3JRAA 1X58A 4IPAA 3TMOA 3KX2A 4G9YA 1LFPA 4G7OF 1P92A 4UHTA 1ETOA 2IS1A 2KKOA 3I5UA 1LVAA 1LDDA 1JJ8C 1FTTA 5DM6F 1J0RA 1J59A 4ZZDA 3EYYA 2LFBA 1FOYA 1ZAOA 1U5TB 3Q3SA 1JUSA 3CJNA 5FD5A 1VQMI 3CC4I 1JGGA 1YG2A 1FLIA 5FLXK 4ZYHA 2KRCA 4XLPF 1YO5C 4M72A 2R5YB 2MD0A 5E1XA 1WI3A 2Y9ZA 1WJDA 1Z3YA 3S1RJ 2GXGA 2CRGA 1TT5B 1ZYRF 3I3LA 3S3OA 2FOKA 2NVTJ 4OU0A 4M9ZA 2EFOA 1HDPA 1XGSA 2RNJA 3Q5FA 2MH9A 2R92J 2JZYA 1WCMJ 4BUPA 3FHZA 3NWSA 3JRDA 2M30A 1CF7A 3ZMDA 1XC5A 1XD7A 1JHFA 1DU6A 2J5OA 5DEQA 3MKZA 1FSEA 2QWWA 4CZZA 4PCQA 1U9NA 3OR2C 2EBIA 2K4JA 3IWZA 3AL0C 5JHUA 2H8WA 2KIUA 3LAPA 2LNBA 3MAJA 1KGSA 2B63J 4RAFA 1I1SA 3CCJI 3BZCA 3QODA 5FROA 1ON2A 4CSWA 2OPTA 1VQLI 4AU7A 2MD5A 1LKXA 5EZGA 2GWRA 2KHMA 3A03A 3ABMH 3JRIA 3SQNA 2E1MB 2VOPA 1AKHB 3TKYA 2D45A 1RKTA 3CCSI 1MW7A 4E4HA 1TWAJ 1OYYA 1RUOA 1SANA 1J5YA 1PDNC 2M4GA 2DOFA 2XB5A 3S32A 2O5RA 4HOBA 1D3YA 3DTKA 4ZZLA 1DU0A 4BE2A 5FLVA 5LFAA 3A1YA 1CQTA 5FKOA 1V3FA 1OLTA 2L5QA 2F4MB 3VYUB 5M5XJ 2EV6A 3GFLA 4M9XA 5IOYA 3EDPA 3L1PA 2K4BA 2Y0MA 1S7OA 1HF0A 2YPRA 3P9IA 4IX7A 1XTAA 1MNEA 1SFKA 2HYJA 1A5JA 2HQRA 4ZDOA 2D1VA 2XAUA 3IAS2 2L9SA 3T0YA 4ZYEA 1L3LA 2E35A 2XF5A 3OYFA 1N75A 2IS4A 2DFFA 4XNFA 3HOXJ 2PG4A 1RI7A 3VSKA 2HR3A 3OIQA 2QQ9A 3F9KA 4UUVA 2FE3A 3WGGA 1XCVA 2ISYA 1PP7U 4ENJA 1ZG5A 1ZH5A 1SVLA 2JUCA 2LOOA 2EIMH 2OV7A 1IDZA 3ZQQA 2RREA 2HDDA 4W97A 3WTVC 4IXAA 5EZHA 2F5CA 3I59B 5LGTA 2QQ8A 4KUMA 4IHYA 4A3DJ 1SD4A 5CLSA 2A69F 2X1CA 1LEAA 1KU3A 1JTYA 2LSOA 3FWEA 4NUBA 2A07F 1GV5A 4UVBA 1GVJA 3ESWB 3Q9SA 2NNNA 4RM3A 1UB9A 1K7AA 2K02A 3PNTA 3WTWC 1KA8A 1RR7A 3CP2A 4V2GA 2EFWA 1KQ0A 4EGZA 2FBHA 3GF2A 3LMMA 2B7EA 3F72A 2Y75A 3HM5A 4FASD 1OCCH 4HYEA 2MSYA 2QKLB 4LIVA 4PJMA 3OSGA 5HS7A 5AIQA 5HLGA 2WBMA 5DUKA 3RPUA 2M34A 3CJQB 4A93J 2WB1N 1WQ2A 2VKVA 2HXOA 5BOXA 2WAFA 4HLYA 3K2AA 2WC2A 4DNCA 4A2UA 1WH7A 2X0LA 4IJAA 2PX9A 4A3CJ 2MBFA 3MFKA 1MDMB 4XLAA 3WTUC 3SYTA 1FIPA 1YHQI 1FP1D 3S17J 3IWFA 1MJBA 1Z91A 5FLXZ 4K2EA 4DZJA 4ENKA 3OYAA 1XGNA 3DBLB 4HX8A 1G8XA 1MNDA 4A3KJ 1ZREA 2BY0A 3JW4A 5FKLA 1XB4A 1KQ9A 3FX3A 4IHSA 3KLNA 1DUXC 2VONA 2Y0SA 2Q1ZB 3V8LA 4ZTJA 3IH3A 3ZQGA 5E3OA 5FJ8J 2W48A 2NYXA 4XLCA 2HVQA 3S93A 2E1NA 2W4SA 5E1WA 3ZQHA 2OTLI 1IRZA 1WZ2A 2HNHA 2ZB9A 4E7JA 2E7XA 2COMA 2P4WA 4QPQA 4AVPA 4G7HF 2DDAA 2D1HA 3GWZA 2V26A 3IRRA 1VQ9I 3WE2A 3DLLF 1OR7A 4RB2C 2NVQJ 3CUQA 1R9TJ 5H6QA 1ETKA 3F6VA 5HNFA 1K83J 1JHHA 2A68F 4IRHA 1FEXA 1X3WB 3NWTA 4BS9A 2FMLA 2LBFB 3HOZJ 3CO7C 3N4MA 4YFKF 5L3BA 5GPCA 5FD6A 1E3HA 2IW5A 2DYRH 4C3HJ 5HS8A 2CUJA 3FIWA 1XMAA 3TQNA 3SDBA 4WXHA 1IZ1A 4KN7X 2JSCA 1KU9A 5ERIA 1GXQA 4M3GA 1O57A 5L3EA 1FZPB 1I50J 2V79A 4I99C 2K9QA 2ZXJA 4MTDA 1YJWI 2UXXA 3S2DJ 3SJMA 5EF6A 2W57A 2VJIA 2OQRA 2V9VA 3DTIA 1RC9A 2OAZA 2E36A 5J8FA 1R1TA 3HTSB 2M9HA 2AXTC 3BPVA 2M45A 1ZG3A 2K3PA 2ZJ2A 3CDLA 3GVAA 1QPMA 1MBHA 3ROUA 3CC2I 3LQRA 1YITI 4Y13A 3GFIA 2STTA 1D1CA 4EJWA 2GA2A 1GLNA 4BEHA 1Z05A 3U1KA 2ZNZA 1DPUA 1WI9A 3HG9A 2E2JJ 2DMPA 1Y0NA 2RDPA 5EGOB 5C4JJ 1U78A 3CC7I 3MD2A 2DFHA 1OYIA 2NXNB 1OR7C 1XMXA 1QBJA 3CUQC 1XSXA 2KJBA 2ELHA 3WTZA 2CW0F 1F36A 4MGRA 4YRVA 3E6MA 4S0HB 1GDTA 2LY9A 2ZJPF 3K1PA 4RGUA 3JTHA 1TP4A 2DTZA 1P9QC 2EH3A 2KDOA 2DMNA 2IGMA 3K70D 4X1EA 2WTEA 2IGOA 2FXAA 3BJAA 4BL0B 1ONVA 3RI4A 3FXKA 2R5ZA 1O7LA 5TISC 4G12A 3CMYA 2V1NA 1FOXA 4MQVA 5EG0B 1WKMA 2F5EA 3RDIA 2EZLA 2QF7A 3AG2H 5J4VA 3OS0A 1UHMA 2QKMB 1BR4A 3TOBA 2HU9A 3HIFA 5D6FA 1X19A 2ZSIB 3IV5A 3ZP5A 4XL9A 1P7IA 3H3ZA 2EIKH 2TCTA 4D9JA 3FMRA 2CQKA 4N4NB 4KDPA 2XV4S 1QVUA 1ITYA 4G7ZF 1JGSA 5IP6A 4AYBN 4U88A 2KMUA 1QQIA 2R93J 2CSOA 3LSIA 3V4GA 2LF7A 3CZ6A 4L9VA 3FKJA 3FDYA 3EQLF 1FYLA 4KT6A 1XSVA 1MIJA 2Z1DA 2X4HA 3LSGA 2VB6A 3E5UA 5F6FA 3ZMUA 4A69C 3ABLH 1T98A 4KFCA 4KA4A 1TW2A 5D6EA 1HXDA 5FGMA 4HA8A 2M8GX 5CVRA 1KU7A 1R5GA 4BXUA 1TQPA 2V9PA 2MG4A 1BI1A 3EUKL 2ZXIA 2DI3A 3BG5A 3OMYA 4DYRA 2DO7A 4EEFG 3JSOA 1Y8QB 1XMKA 2K86A 3VYRB 3DF8A 1YOVB 4JX5A 3KP7A 1Z7LA 3K4MA 1X4PA 2W24A 2WY8Q 3J81K 1AU7A 5FRMA 2H94A 3FK6A 1TWGJ 1MD0A 2DQLA 2VC1A 4NB5A 5DCMB 1E17A 1I39A 5EEHA 4IL6C 3HC7A 3CJRB 3M7GA 2YR2A 1ETVA 4UB8C 3EETA 2JA8J 1HOMA 2HQAA 3C2GA 4N9IA 4WXCA 3OYCA 4PJNA 2EA2A 2NAZA 4F92B 5C4XJ 5IPAA 2NS8A 2Y48A 3C1DA 2H1LA 2QCOA 3E5XA 1EJ9A 1TWFJ 3COAC 4LG0B 1TQIA 2L7ZA 2XHKA 3CCLI 2EWNA 2IXSA 2DPUA 1B9NA 3BTCA 4XIDA 3U2RA 4HQEA 4XSZF 3CESA 3VSLA 1IV8A 2CQ7A 5CYVA 2M7AA 3GBGA 2Z33A 1SFOJ 3HUGB 2IS2A 3W2VA 2QVOA 3WG7H 4A3GJ 1B72B 3HHGA 1X1AA 1B8IA 3HEFA 5TGTA 1X1BA 1OKRA 5TJJA 4F91B 4ENMA 4IOCF 3FMQA 3TO9A 4V2FA 5EYRA 4PSWA 3MZ8A 4A0ZA 4WWCA 4I0BA 3R61A 1G2HA 5FB2A 4YFNF 4Y4RA 3SZPA 1I27A 4CYCB 2L9VA 3BZKA 1ZHFA 1X2MA 1G4DA 1FNNA 1M1EB 1W5CC 2HOAA 2P6SA 3DP7A 3TW6A 5JVGF 4ZTFA 2CQNA 2DA6A 1W7PB 5FKKA 1BL0A 2QYOA 3BR6A 3I4NJ 5FFZA 1J09A 1MMGA 5DCMA 2XF6A 2DA1A 1WH5A 5JLWA 4MEXF 1MBEA 3O2PE 1ZGWA 4IHTA 2FBKA 2NOJB 1R4MB 1ENHA 2Y30A 3SZGA 3H3VK 2VE8A 1A6IA 2VKDA 2QBYA 4II3A 4FE4A 1NG7A 4P1WA 1U3EM 3JTGA 1XGMA 4I01A 3RYRA 1GHCA 2XAHA 2BY3A 1PUEE 2FX0A 4XKBA 1YIOA 4J00A 3RKYA 1YLFA 3CMMA 4XKWA 1FYMA 4BY7J 3AG1H 2O8KA 2XGCA 4AM3A 4XR6A 3A01A 3FF5A 4PFOA 3JRCA 3RQIA 4NC7A 3H9JA 5ED4A 4M9SA 2L3DA 3L2RA 3V8JA 5DYMA 4D5FA 1MH3A 4P9FA 2ZJQF 2M8EA 5DV5A 2PBIA 2XDVA 1ZGAA 5HLTA 1IRFA 3ZR8X 2COBA 5JI6A 4AYBA 1POGA 2V6EA 5CVVA 4BHBA 3BTIA 3FXOA 4HSTA 3ZMSA 1Z9CA 1Z0XA 2ZO4A 3RPQA 3SEZA 4M71A 3MEXA 1FBSA 4QPOA 4B44A 1FOKA 2EK5A 4HX7A 2X6WA 1ZLKA 3OY9A 2VN2A 1BA5A 3K2ZA 1MZBA 3S2HJ 4MQ9F 1NK2P 3IUOA 5GP9A 2Z3YA 2OZ6A 2GIZA 4R1HA 4KYWA 3S16J 4M6XA 1QGPA 4OAYA 3O6BB 4M74A 1RRJA 2EILH 2X6XA 1QPIA 4BE0A 1ZQ3P 3H5AA 2M0CA 3PFYA 2R7WA 4BYYA 4NC6A 3AL0B 5D4RA 1T08B 3JRFA 2AQFA 1FSHA 2XVCA 5KVRA 2FNAA 2FRHA 3U9GA 4PGGA 5EDNA 3KZZA 3F0CA 4EMSA 3BG3A 3I0TA 5D5XB 2JSPA 4ON0A 1BBYA 3HPHA 4UV8A 1IXCA 3QAHA 4XLHA 4RB0A 1IXSB 3TO6A 1Z6RA 4WCGA 1I3AA 2P0WA 2QM3A 4LIUA 2M2EA 2R7UA 2RNGA 3H0GJ 3L09A 2EIJH 3QQAA 1ZGJA 4IF4A 1AOYA 4RMNA 2ZSHB 4YIFA 1YYVA 5B1AH 3J81Z 3RJPA 1EH7A 4ZYAA 1X3ZB 4ANJA 1BC7C 4IQJA 5M5YJ 3ZRGA 2VUMJ 4LITA 4M73A 2VKEA 3CCEI 3KFWX 4ASNA 4ESFA 3CD6I 5M5WJ 5LHGA 2EFNA 3F21A 3OYBA 1T39A 1O3QA 2I10A 1R36A 4TV7A 1CF7B 1E0EA 2A6EF 3DKWA 3G73A 1OJLA 3BOQA 2KIMA 3HOYJ 3E0JB 1S29A 1LUJB 4O3MA 1T38A 5IOZA 4ESBA 1UCRA 2WWYA 2CMPA 3K69A 2GOMA 2Y31A 5AIPA 3W6JB 1DDNA 5BQTA 2XASA 3FXQA 3OL3A 4MLOA 3H9QA 2CGPA 1NH3A 4BU2A 2A61A 1N77A 4HNUA 1MMDA 3K4KA 5ICCA 5LBQA 2LKXA 4DZPA 4A5NA 4A6DA 1SD5A 2H09A 5IYBJ 4JQFA 2VQCA 4D7MA 4F55A 1FPQA 1ZR4A 1JUPA 3MKLA 3NQOA 2ZBKA 3PO3J 1USTA 4KT5C 4FISA 3QYEA 1Z21A 2ZFUA 2JQ7A 5B5EC 3I55I 4HQMA 3HOWJ 4IO9F 3HOVJ 2DBBA 3HB9A 2DDBA 3DWLE 1B59A 1Y0UA 1XDSA 2X6OA 2DT7B 4RB3C 3KYLA 3VYSB 4LJZF 4BBRJ 2EJRA 2EQRA 4DJAA 1FJLA 2HOEA 3OIOA 4AUXA 1J75A 4LB5A 5LLQA 1VZ0A 3WG9A 1U8BA 1F5TA 1IUFA 2XRLA 3A4CA 3PIOF 3UKGA 1QZEA 1YJNI 1AHDP 4IQ4A 1HCRA 1VQ6I 2TRTA 1P2FA 1LQ1A 3IKVA 2HVSA 4YG2F 1HSTA 2E19A 2M5WA 5ILSA 2RKHA 3AG4H 1W36D 2VBZA 3BQZA 2DMQA 3L00A 2GZWA 1WHUA 4GGGA 2W00A 3REOA 1BJAA 2STWA 2Y0SN 2LYCA 4XRSA 1AWCA 3DBRB 3ZMTA 1QU3A 4F7ZA 3L2UA 2R7DA 4CYDA 2AQEA 2HYFA 1J7KA 2H6CA 3PUBA 3W3CA 4AWXB 5ICFA 4RLQA 4BE1A 2Y69H 3QPSA 4E7HA 1U9OA 3ZQIA 4ZYDA 1SMTA 2R7SA 4IZZA 3L7WA 2HYGD 2XAJA 5D5UB 2NRAC 4L18B 4I6ZA 1XX5A 3R0AA 3F8CA 3MMYB 1MJ9A 2H6BA 2L9RA 2KJCA 4IRGA 4BKXA 2O9LA 3BCBA 1BIBA 3GEZA 4C2MJ 4FX4A 4QWQA 1HBXG 2ME6A 3CJTB 1K6YA 2DTRA 1V4RA 4UUSA 3OYLA 3MZHA 1VQ4I 1WJFA 1IW7F 3E5QA 1YTYA 2FD5A 5ILUA 2E7WA 2L7KA 2QA4I 4I76A 2HXIA 2Z5UA 3O3KA 4ZDPA 3G1LA 3DU5A 4XRMA 1UELB 4JYKA 4BAYA 1ZR2A 3FXUA 1WJBA 1FBUA 5D8LB 3HGYA 3KYCB 5HODA 2DW4A 5F1RA 1JI8A 4L0YB 3A2KA 2FF4A 4M3DA
chains in the Genus database with same CATH topology
2MGQA 1FTZA 2LVSA 1I50J 2X48A 4C3IJ 2K9QA 3TEDA 3S2DJ 3SJMA 5EF6A 2NS7A 3VPRA 2K40A 2EZIA 5F27A 1HLVA 1F43A 3GTLJ 2M9HA 5J1UA 3S1NJ 2HQ5A 3CDLA 2XPVA 1MBHA 3HGGA 4ABZA 3LNQA 1Y1VJ 3LSJA 2JJ7A 2XGEA 5E3NA 3BR0A 5K7ZA 4A3BJ 1UG2A 4A3JJ 2E2JJ 2DMPA 2LLKA 4BY1J 1UHSA 5EGOB 5C4JJ 1U78A 1GUUA 2JMWA 5J1RA 5K7FA 4A3EJ 2H1KA 1F36A 5F1JA 4S0HB 1GDTA 2LY9A 2Y9YA 1IG7A 1MBFA 3BT9A 1WGXA 1I3QJ 3E7LA 1VFCA 1RETA 2DTZA 2EH3A 2R7ZJ 2DMNA 1T56A 1IGNA 2CUEA 4X1EA 4UUSB 3M4OJ 2EZHA 1JKOC 2JA7J 4M3EA 2DA2A 2R5ZA 3IH2A 3LOCA 5F0CA 4G12A 3CMYA 3GTPJ 2XB0X 5J3LA 1YRNA 5E3LA 5EG0B 2EZLA 2QF7A 2XSDC 1H8AC 3PM1A 3GTOJ 3CCYA 5F0HA 4BXXJ 3NAUA 3W6VA 3IV5A 3SDGA 1P7IA 1B72A 2TCTA 5BNGA 5M3MJ 3S14J 2RAEA 3QPLA 1MH4A 1QVUA 1ITYA 5IP6A 2DMUA 4W1UA 4AYBN 2R93J 1IDYA 4XRSG 4MFEA 2IEKA 5IYCJ 3Q0UA 3LSGA 4CYCA 3DCFA 4A69C 3A02A 1JT0A 2M8GX 1OCPA 4QSHA 3FKIJ 2D5VA 4L5EA 2MG4A 3PO2J 3RKQA 3B6CA 5IP7J 2Y2ZA 3BG5A 4DYRA 4EEFG 4QIWN 4M6VA 1ZK8A 3TP0A 4A3LJ 1RPWA 4JX5A 2N8GA 5FKNA 5C44J 1AU7A 2KDZA 3FK6A 3HOUJ 1TWGJ 3S15J 2DJNA 1XS9A 3O8HA 2VI6A 1W0UA 4XK4A 1BW5A 3Q0WA 1ETVA 2LTPA 2JA8J 1HOMA 3I4MJ 1ORKA 1ZKGA 3FK7A 4JP0A 1PUFA 5C4XJ 5IPAA 2JA5J 2NS8A 2XPWA 2DA4A 2QCOA 5GPAA 2R5ZB 3LSRA 1S7EA 4A3FJ 1TWFJ 2R5YA 2L7ZA 4IEJA 1Y1WJ 1TC3C 4RBOA 3HKZN 1YRNB 5C3EJ 2JN6A 2WAQN 3BTCA 4XIDA 2HI3A 1QRYA 1K61A 3BR3A 3BG9A 3GBGA 1SFOJ 3OOUA 4A3GJ 3CQZJ 1I6HJ 4RDUA 1B72B 3JR9A 1B8IA 1QVTA 1W0TA 3HEFA 5E3MA 1E3OC 5F08A 1GVDA 5IYDJ 1NK3P 1FIAA 2VPRA 4V2FA 5EYRA 1IJWC 4IHVA 2AHQA 2E1OA 3GTGJ 4GFBA 4Y52J 5K7HA 1G2HA 2ME0A 4AC0A 2DMTA 4CYCB 2L7MP 3JRBA 1JTXA 1X2MA 3MN2A 2HOAA 3TW6A 4FTHA 1ZTRA 3JRAA 1X58A 2ID3A 2DA6A 2P81A 5FKKA 5DTDA 1BL0A 3BR6A 1JJ6C 2HOSA 3I4NJ 2ELKA 3IH4A 1ETOA 4D5CA 2DA1A 4IHXA 1WH5A 5JLWA 1Z77A 1MBEA 1LFUP 1ZGWA 4J19A 1JJ8C 1FTTA 2PMZN 1ETYA 2JK3A 2K9NA 3S1QJ 1ENHA 2Y30A 1AKHA 5JLXA 4B4CA 3H3VK 1RESA 1A6IA 3BR2A 2H8RA 1MBKA 2YU9J 2LFBA 4FE4A 3RZOJ 3Q3SA 1JUSA 4HNVA 4IHWA 4A3MJ 1PUFB 2JA6J 1JGGA 2FX0A 2FQ4A 3WHBA 2R5YB 4BY7J 3BTJA 2O8KA 2XGCA 1WI3A 2Y9ZA 3A01A 5F0FA 5M3FJ 3S1RJ 3JRCA 2ID6A 2X9DA 3RQIA 2CRGA 1TWHJ 2O7OA 5DS9A 4D5FA 1MH3A 2NVTJ 4M3FA 1HDPA 1Q1VA 3ZOBA 1ETWA 3C2BA 4JX6A 3OSFA 2R92J 2COBA 1WCMJ 4XICA 1POGA 1B8IB 3BTIA 3JRDA 2ECCA 1XC5A 3NARA 2E2HJ 1Z0XA 3M3YJ 1DU6A 2LP0A 1D5YA 1U9NA 4M3BA 3LSPA 2EBIA 4MO7A 1BA5A 2K9SA 3S2HJ 3G1MA 1NK2P 1BW6A 5GP9A 3G1OA 3TP3A 2B63J 3S16J 1MSEC 3DEWA 2OPTA 1QPIA 3ZQCA 1LFBA 1ZQ3P 2E2IJ 2M0CA 5EZGA 3JRFA 2IAIA 3A03A 1LE8A 2KT0A 1NTCA 3JRIA 4QTRA 2NOGA 1GT0C 5EDNA 3D1NI 3FISA 1AKHB 3F0CA 1RKTA 3BG3A 2L7FP 1OFCX 1TWAJ 2OF7A 1SANA 4LOCA 2FJ1A 2XB5A 3JRGA 1JUMA 1DU0A 5FLVA 4D7NA 1CQTA 2M2EA 5FKOA 2LR8A 3H0GJ 3ZQFA 2LD5A 5M5XJ 5IOYA 9ANTA 1XG1A 3QQAA 3L1PA 3A01B 1HF0A 4B3AA 3TW7A 1VI0A 2HYJA 1A5JA 2CU7A 3BQYA 2VUMJ 1JKQC 2YUSA 5M5YJ 2WV1A 1EF4A 2VKEA 4DYQA 3HOXJ 3GTKJ 5M5WJ 1H88C 1BJZA 2I10A 4B1RA 3HDDA 1T33A 1OJLA 1X2NA 5IP9J 4MIMA 2XPUA 3HOYJ 1IDZA 2YS9A 2HDDA 4W97A 3BR5A 5IOZA 3JRHA 2CQXA 1OCTC 5EZHA 4BBSJ 3BTLA 2Y31A 1APLC 2IBDA 4MLOA 2DA3A 3ZQLA 4IHYA 4A3DJ 2CJJA 1LE8B 1JTYA 4X6AJ 1VNDA 1GV5A 3HBLA 2LKXA 4DZPA 1P7JA 4D7MA 5IYBJ 4FCYA 3BR1A 1H89C 1ZR4A 1JUPA 3MKLA 1RR7A 1O4XA 3PO3J 4V2GA 1IC8A 4A3IJ 4FISA 2JWTA 2NVXJ 3HOWJ 3HOVJ 1ETQA 1JKPC 3HB9A 2DA5A 4C3JJ 3HM5A 1IV6A 2MSYA 2EZKA 2X6OA 2GBYA 3OSGA 1WPKA 1JKRC 4BBRJ 5FKMA 2EQRA 4A93J 2M34A 4NDLA 1FJLA 2WB1N 2VKVA 3OIOA 4AUXA 2HXOA 1TWCJ 1U8BA 1IUFA 2XRLA 3K2AA 3UKGA 1AHDP 3S1MJ 1WH7A 4A3CJ 2DN0A 1HCRA 2DA7A 2TRTA 2CQQA 2GLOA 1FIPA 2E19A 2LK2A 3GTJJ 2AO9A 3S17J 3BQZA 2DMQA 1ETXA 4DZJA 4A3KJ 3SFIA 2R0QC 1MSFC 5FKLA 2CUFA 2Y0SN 4XRSA 2XGDA 2G0EA 3IH3A 3ZQGA 4DW6A 5E3OA 2W48A 3WHCA 5FJ8J 5J1YA 1MNMC 4FE7A 5EGOA 2MW8A 3QPSA 1U9OA 3ZQIA 1GV2A 3ZQHA 1IRZA 5F04A 1JT6A 2ZB9A 2NVYJ 3MVPA 3JREA 4I6ZA 1MBJA 4Y7NJ 2L9RA 2O9LA 4BKXA 1VF9A 1HDDC 3RZDJ 4C2MJ 2NVQJ 3GTQJ 2ME6A 2ECBA 4UUSA 4DYCA 1R9TJ 1ETKA 3O8GA 1RKWA 1K83J 2FD5A 1FEXA 1UMQA 3HOZJ 4I76A 2HXIA 3G1LA 4UUTA 2L0KA 3B6AA 1MBGA 5GPCA 4JYKA 4XRMA 5EG0A 3K7AJ 4C3HJ 5EEAA 1ZR2A 2HOTA 3GTMJ 3FIWA 3HGYA 4MFDA 5HODA 2GM4A 3Q0VA 5FLMJ 4M3GA 4M3DA 4JX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MGQ A;  1FTZ A;  2LVS A;  1I50 J;  2X48 A;  4C3I J;  2K9Q A;  3TED A;  3S2D J;  3SJM A;  5EF6 A;  2NS7 A;  3VPR A;  2K40 A;  2EZI A;  5F27 A;  1HLV A;  1F43 A;  3GTL J;  2M9H A;  5J1U A;  3S1N J;  2HQ5 A;  3CDL A;  2XPV A;  1MBH A;  3HGG A;  4ABZ A;  3LNQ A;  1Y1V J;  3LSJ A;  2JJ7 A;  2XGE A;  5E3N A;  3BR0 A;  5K7Z A;  4A3B J;  1UG2 A;  4A3J J;  2E2J J;  2DMP A;  2LLK A;  4BY1 J;  1UHS A;  5EGO B;  5C4J J;  1U78 A;  1GUU A;  2JMW A;  5J1R A;  5K7F A;  4A3E J;  2H1K A;  1F36 A;  5F1J A;  4S0H B;  1GDT A;  2LY9 A;  2Y9Y A;  1IG7 A;  1MBF A;  3BT9 A;  1WGX A;  1I3Q J;  3E7L A;  1VFC A;  1RET A;  2DTZ A;  2EH3 A;  2R7Z J;  2DMN A;  1T56 A;  1IGN A;  2CUE A;  4X1E A;  4UUS B;  3M4O J;  2EZH A;  1JKO C;  2JA7 J;  4M3E A;  2DA2 A;  2R5Z A;  3IH2 A;  3LOC A;  5F0C A;  4G12 A;  3CMY A;  3GTP J;  2XB0 X;  5J3L A;  1YRN A;  5E3L A;  5EG0 B;  2EZL A;  2QF7 A;  2XSD C;  1H8A C;  3PM1 A;  3GTO J;  3CCY A;  5F0H A;  4BXX J;  3NAU A;  3W6V A;  3IV5 A;  3SDG A;  1P7I A;  1B72 A;  2TCT A;  5BNG A;  5M3M J;  3S14 J;  2RAE A;  3QPL A;  1MH4 A;  1QVU A;  1ITY A;  5IP6 A;  2DMU A;  4W1U A;  4AYB N;  2R93 J;  1IDY A;  4XRS G;  4MFE A;  2IEK A;  5IYC J;  3Q0U A;  3LSG A;  4CYC A;  3DCF A;  4A69 C;  3A02 A;  1JT0 A;  2M8G X;  1OCP A;  4QSH A;  3FKI J;  2D5V A;  4L5E A;  2MG4 A;  3PO2 J;  3RKQ A;  3B6C A;  5IP7 J;  2Y2Z A;  3BG5 A;  4DYR A;  4EEF G;  4QIW N;  4M6V A;  1ZK8 A;  3TP0 A;  4A3L J;  1RPW A;  4JX5 A;  2N8G A;  5FKN A;  5C44 J;  1AU7 A;  2KDZ A;  3FK6 A;  3HOU J;  1TWG J;  3S15 J;  2DJN A;  1XS9 A;  3O8H A;  2VI6 A;  1W0U A;  4XK4 A;  1BW5 A;  3Q0W A;  1ETV A;  2LTP A;  2JA8 J;  1HOM A;  3I4M J;  1ORK A;  1ZKG A;  3FK7 A;  4JP0 A;  1PUF A;  5C4X J;  5IPA A;  2JA5 J;  2NS8 A;  2XPW A;  2DA4 A;  2QCO A;  5GPA A;  2R5Z B;  3LSR A;  1S7E A;  4A3F J;  1TWF J;  2R5Y A;  2L7Z A;  4IEJ A;  1Y1W J;  1TC3 C;  4RBO A;  3HKZ N;  1YRN B;  5C3E J;  2JN6 A;  2WAQ N;  3BTC A;  4XID A;  2HI3 A;  1QRY A;  1K61 A;  3BR3 A;  3BG9 A;  3GBG A;  1SFO J;  3OOU A;  4A3G J;  3CQZ J;  1I6H J;  4RDU A;  1B72 B;  3JR9 A;  1B8I A;  1QVT A;  1W0T A;  3HEF A;  5E3M A;  1E3O C;  5F08 A;  1GVD A;  5IYD J;  1NK3 P;  1FIA A;  2VPR A;  4V2F A;  5EYR A;  1IJW C;  4IHV A;  2AHQ A;  2E1O A;  3GTG J;  4GFB A;  4Y52 J;  5K7H A;  1G2H A;  2ME0 A;  4AC0 A;  2DMT A;  4CYC B;  2L7M P;  3JRB A;  1JTX A;  1X2M A;  3MN2 A;  2HOA A;  3TW6 A;  4FTH A;  1ZTR A;  3JRA A;  1X58 A;  2ID3 A;  2DA6 A;  2P81 A;  5FKK A;  5DTD A;  1BL0 A;  3BR6 A;  1JJ6 C;  2HOS A;  3I4N J;  2ELK A;  3IH4 A;  1ETO A;  4D5C A;  2DA1 A;  4IHX A;  1WH5 A;  5JLW A;  1Z77 A;  1MBE A;  1LFU P;  1ZGW A;  4J19 A;  1JJ8 C;  1FTT A;  2PMZ N;  1ETY A;  2JK3 A;  2K9N A;  3S1Q J;  1ENH A;  2Y30 A;  1AKH A;  5JLX A;  4B4C A;  3H3V K;  1RES A;  1A6I A;  3BR2 A;  2H8R A;  1MBK A;  2YU9 J;  2LFB A;  4FE4 A;  3RZO J;  3Q3S A;  1JUS A;  4HNV A;  4IHW A;  4A3M J;  1PUF B;  2JA6 J;  1JGG A;  2FX0 A;  2FQ4 A;  3WHB A;  2R5Y B;  4BY7 J;  3BTJ A;  2O8K A;  2XGC A;  1WI3 A;  2Y9Z A;  3A01 A;  5F0F A;  5M3F J;  3S1R J;  3JRC A;  2ID6 A;  2X9D A;  3RQI A;  2CRG A;  1TWH J;  2O7O A;  5DS9 A;  4D5F A;  1MH3 A;  2NVT J;  4M3F A;  1HDP A;  1Q1V A;  3ZOB A;  1ETW A;  3C2B A;  4JX6 A;  3OSF A;  2R92 J;  2COB A;  1WCM J;  4XIC A;  1POG A;  1B8I B;  3BTI A;  3JRD A;  2ECC A;  1XC5 A;  3NAR A;  2E2H J;  1Z0X A;  3M3Y J;  1DU6 A;  2LP0 A;  1D5Y A;  1U9N A;  4M3B A;  3LSP A;  2EBI A;  4MO7 A;  1BA5 A;  2K9S A;  3S2H J;  3G1M A;  1NK2 P;  1BW6 A;  5GP9 A;  3G1O A;  3TP3 A;  2B63 J;  3S16 J;  1MSE C;  3DEW A;  2OPT A;  1QPI A;  3ZQC A;  1LFB A;  1ZQ3 P;  2E2I J;  2M0C A;  5EZG A;  3JRF A;  2IAI A;  3A03 A;  1LE8 A;  2KT0 A;  1NTC A;  3JRI A;  4QTR A;  2NOG A;  1GT0 C;  5EDN A;  3D1N I;  3FIS A;  1AKH B;  3F0C A;  1RKT A;  3BG3 A;  2L7F P;  1OFC X;  1TWA J;  2OF7 A;  1SAN A;  4LOC A;  2FJ1 A;  2XB5 A;  3JRG A;  1JUM A;  1DU0 A;  5FLV A;  4D7N A;  1CQT A;  2M2E A;  5FKO A;  2LR8 A;  3H0G J;  3ZQF A;  2LD5 A;  5M5X J;  5IOY A;  9ANT A;  1XG1 A;  3QQA A;  3L1P A;  3A01 B;  1HF0 A;  4B3A A;  3TW7 A;  1VI0 A;  2HYJ A;  1A5J A;  2CU7 A;  3BQY A;  2VUM J;  1JKQ C;  2YUS A;  5M5Y J;  2WV1 A;  1EF4 A;  2VKE A;  4DYQ A;  3HOX J;  3GTK J;  5M5W J;  1H88 C;  1BJZ A;  2I10 A;  4B1R A;  3HDD A;  1T33 A;  1OJL A;  1X2N A;  5IP9 J;  4MIM A;  2XPU A;  3HOY J;  1IDZ A;  2YS9 A;  2HDD A;  4W97 A;  3BR5 A;  5IOZ A;  3JRH A;  2CQX A;  1OCT C;  5EZH A;  4BBS J;  3BTL A;  2Y31 A;  1APL C;  2IBD A;  4MLO A;  2DA3 A;  3ZQL A;  4IHY A;  4A3D J;  2CJJ A;  1LE8 B;  1JTY A;  4X6A J;  1VND A;  1GV5 A;  3HBL A;  2LKX A;  4DZP A;  1P7J A;  4D7M A;  5IYB J;  4FCY A;  3BR1 A;  1H89 C;  1ZR4 A;  1JUP A;  3MKL A;  1RR7 A;  1O4X A;  3PO3 J;  4V2G A;  1IC8 A;  4A3I J;  4FIS A;  2JWT A;  2NVX J;  3HOW J;  3HOV J;  1ETQ A;  1JKP C;  3HB9 A;  2DA5 A;  4C3J J;  3HM5 A;  1IV6 A;  2MSY A;  2EZK A;  2X6O A;  2GBY A;  3OSG A;  1WPK A;  1JKR C;  4BBR J;  5FKM A;  2EQR A;  4A93 J;  2M34 A;  4NDL A;  1FJL A;  2WB1 N;  2VKV A;  3OIO A;  4AUX A;  2HXO A;  1TWC J;  1U8B A;  1IUF A;  2XRL A;  3K2A A;  3UKG A;  1AHD P;  3S1M J;  1WH7 A;  4A3C J;  2DN0 A;  1HCR A;  2DA7 A;  2TRT A;  2CQQ A;  2GLO A;  1FIP A;  2E19 A;  2LK2 A;  3GTJ J;  2AO9 A;  3S17 J;  3BQZ A;  2DMQ A;  1ETX A;  4DZJ A;  4A3K J;  3SFI A;  2R0Q C;  1MSF C;  5FKL A;  2CUF A;  2Y0S N;  4XRS A;  2XGD A;  2G0E A;  3IH3 A;  3ZQG A;  4DW6 A;  5E3O A;  2W48 A;  3WHC A;  5FJ8 J;  5J1Y A;  1MNM C;  4FE7 A;  5EGO A;  2MW8 A;  3QPS A;  1U9O A;  3ZQI A;  1GV2 A;  3ZQH A;  1IRZ A;  5F04 A;  1JT6 A;  2ZB9 A;  2NVY J;  3MVP A;  3JRE A;  4I6Z A;  1MBJ A;  4Y7N J;  2L9R A;  2O9L A;  4BKX A;  1VF9 A;  1HDD C;  3RZD J;  4C2M J;  2NVQ J;  3GTQ J;  2ME6 A;  2ECB A;  4UUS A;  4DYC A;  1R9T J;  1ETK A;  3O8G A;  1RKW A;  1K83 J;  2FD5 A;  1FEX A;  1UMQ A;  3HOZ J;  4I76 A;  2HXI A;  3G1L A;  4UUT A;  2L0K A;  3B6A A;  1MBG A;  5GPC A;  4JYK A;  4XRM A;  5EG0 A;  3K7A J;  4C3H J;  5EEA A;  1ZR2 A;  2HOT A;  3GTM J;  3FIW A;  3HGY A;  4MFD A;  5HOD A;  2GM4 A;  3Q0V A;  5FLM J;  4M3G A;  4M3D A;  4JX4 A; 
#chains in the Genus database with same CATH topology
 2R7Q A;  4LLL A;  4KIT B;  3W6K B;  1IF1 A;  4I98 B;  2X6Y A;  2BXY A;  1ZG1 A;  5DM7 F;  1X1P A;  3P7N A;  3PUF A;  2XPV A;  3HGG A;  1DPR A;  1Y1V J;  4CCL A;  1B4A A;  1YJ9 I;  2XAQ A;  4G6Q A;  4X0G A;  2JJ7 A;  2XGE A;  4A3B J;  2DOA A;  2DJI A;  5DDG A;  3HTU A;  2LLK A;  3A0H C;  3GLX A;  4HF0 A;  3GFM A;  3ZXS A;  1SFX A;  2EV5 A;  3TL4 X;  4XLE A;  5K5R A;  1I6X A;  1D1B A;  2JMW A;  3KP2 A;  5J1R A;  3PNV A;  4L9T A;  2H1K A;  1NG6 A;  1R1V A;  3QPT A;  3VB2 A;  1L0O C;  3F8B A;  5IT9 Z;  3M1C A;  3BT9 A;  5ILV A;  1WGX A;  4CHU A;  3E7L A;  3I9V 2;  4UNO A;  4NQW A;  4XON A;  3U1D A;  4KIG A;  3F8M A;  4Y33 A;  3CUQ B;  1ODD A;  1IN6 A;  2UV1 A;  3M9A A;  4LMY A;  3C2H A;  3RQ4 A;  3RSN A;  2QLZ A;  1X4O A;  3M4O J;  2EZH A;  1JKO C;  1QA6 A;  2ZC2 A;  4P96 A;  4E6K G;  4M3E A;  4P55 A;  2JA7 J;  3HRU A;  1IRG A;  1LVK A;  5HDG A;  4UV9 A;  5CQG A;  4XM3 A;  3H36 A;  2I8D A;  1VQ7 I;  3BC8 A;  3BY6 A;  1PVE A;  4ETS A;  4CA0 A;  1YRN A;  1N25 A;  5J6X A;  1BI3 A;  2XSD C;  1LDK B;  4AIH A;  3SFZ A;  2DU9 A;  3HRT A;  2XRN A;  5F0H A;  3GTO J;  3G2B A;  2ADU A;  4BXX J;  1ZAR A;  3NAU A;  4RGR A;  3ZCO A;  3WU2 C;  3V7R A;  4BHP A;  1DGR M;  2HPM A;  1HKS A;  2LRE A;  5TRD A;  3CCV I;  3C3W A;  4PJL A;  3IC7 A;  1WRJ A;  5BNG A;  5CVU A;  1WJE A;  2PN6 A;  4Y17 A;  2YSR A;  3MWM A;  4HG2 A;  3WGH A;  5LD2 C;  4BDY A;  3ULQ B;  3T8T A;  1SAX A;  1H0M A;  2IEK A;  5B3S H;  5IYC J;  3GLL A;  3Q0U A;  4CCO A;  1BI2 A;  3DCF A;  3VEP A;  1UFM A;  4BEH B;  1T8I A;  1O3S A;  3LAJ A;  3VOD A;  4L5E A;  3W2A A;  1RNL A;  3OIP A;  3PJR A;  3LA3 A;  5J47 A;  2QSG X;  2KDZ A;  4AID A;  2ESH A;  5FO5 A;  3HOU J;  1FY7 A;  3S15 J;  4KIS A;  2EB7 A;  3D0S A;  3O8H A;  1Z67 A;  2BXZ A;  3RKW A;  2VI6 A;  4CUG A;  2FNP A;  3K4N A;  1X1C A;  2X1E A;  3I4M J;  2ELJ A;  4JP0 A;  4EV0 A;  1PUF A;  4Q5S F;  1XPX A;  1SMY F;  2HKX A;  5E8I A;  2O61 A;  5EJC A;  3H0D A;  2R5Z B;  3BP8 A;  1IN5 A;  3EUA A;  2E1C A;  2PJP A;  2UWM A;  1TC3 C;  3CDI A;  4U7D A;  5C3E J;  4N9H A;  4BQA A;  2JN6 A;  3HKZ A;  5IY5 H;  1QRY A;  1OMI A;  3CDH A;  4LK1 F;  1K61 A;  2XKO A;  3LSH A;  3BG9 A;  3HHH A;  4II2 A;  2HEO A;  2QGU A;  1G3Y A;  3CQZ J;  1YQA A;  2A3S A;  2CO5 A;  3BDD A;  5E3M A;  3I54 A;  3IKT A;  1E3O C;  1R5I D;  4OIN F;  4HX4 A;  1SVM A;  2ZFW A;  1FIA A;  4L0Z B;  2VPR A;  4HW0 A;  1IJW C;  3GTG J;  2E1O A;  4Y52 J;  5LHI A;  5HDN A;  4BNC A;  5DD8 A;  5GTI C;  3JRB A;  1JTX A;  3LFU A;  3DEU A;  3M8F A;  1TQM A;  5KHD A;  2DOE A;  1ZTR A;  1UJ8 A;  1YW7 A;  2ID3 A;  2FOW A;  4ZH4 F;  1OCZ H;  4B8X A;  1E3P A;  2LG4 A;  2BEO A;  2V9K A;  2VJJ A;  3FXL A;  4Q47 A;  2Z9O A;  2A5W A;  1JJ6 C;  3QYF A;  4BJT A;  1YX3 A;  3SEQ A;  2CW7 A;  4D5C A;  1ZLJ A;  4IHX A;  5D4S A;  3H5N A;  2QEX I;  1Z77 A;  1D0X A;  2OJE D;  4BQN A;  1LFU P;  1ETY A;  2JK3 A;  2ZXH A;  4GCV A;  4DQ2 A;  5JLX A;  1WWX A;  2Q2E A;  2DPD A;  2WAE A;  1RES A;  1U0J A;  2CFO A;  2O03 A;  4BDZ A;  3BWG A;  3BR2 A;  1YW8 A;  1REP C;  2YU9 J;  3FM5 A;  1W5T A;  2FSW A;  4G8X A;  1VTN C;  4OIO F;  3RZO J;  3S2W A;  3J7A Y;  3BJ6 A;  4HNV A;  2UZK A;  4IHW A;  2BV6 A;  2JUG A;  3AKZ A;  2PMH A;  3DKX A;  3DEE A;  1LB2 A;  3N05 A;  4LGW A;  2VBX A;  2DOD A;  3WHB A;  3HSR A;  1Y8R B;  3BTJ A;  3KP4 A;  5F0F A;  5CVI A;  2P5K A;  4CGZ A;  2K3F A;  2ID6 A;  2X9D A;  4YEL A;  3H1C A;  2EA4 A;  2ACJ A;  4AVZ A;  3FZV A;  1WFX A;  4UXN A;  1I1G A;  5KAF C;  2DAO A;  1VQK I;  3DPL C;  4M3F A;  1Q1V A;  2VBW A;  2R7V A;  2KQR A;  4XIC A;  2DFI A;  1EH6 A;  4PJ0 C;  1B8I B;  2ECC A;  1R1U A;  3C18 A;  4PK4 A;  2E2H J;  1BOB A;  4EJT A;  2GOX B;  3PFI A;  3M3Y J;  2LP0 A;  3KEQ A;  2PLY A;  2B0L A;  2F5F A;  2JPC A;  4M3B A;  2A5Y B;  1F4K A;  2HFH A;  3LSP A;  1V54 H;  1C0W A;  2K9S A;  3G1M A;  2KL4 A;  3PSF A;  1BW6 A;  4RGS A;  3TP3 A;  3VOE A;  2KZV A;  1U8R A;  4D1Q A;  3T1B A;  3DEW A;  3RTR A;  3JCU C;  1TT0 A;  2F4I A;  1LFB A;  5D5W B;  4OIR F;  4BH9 A;  3CCU I;  5FRN A;  1LE8 A;  3OYM A;  1NTC A;  3L2V A;  1ON1 A;  3F22 A;  2NOG A;  3LA7 A;  3QP6 A;  1Y39 A;  1GT0 C;  3M8E A;  2CV2 A;  1W1W E;  3OYD A;  2QBY B;  2OF7 A;  2QSH X;  2RQQ A;  4LOC A;  2EFQ A;  4HPQ A;  2OCC H;  2XC7 A;  4EM2 A;  3JRG A;  2OU2 A;  4UY8 I;  4A0Y A;  2LF8 A;  1WJ5 A;  4XRF A;  3ASN H;  4D7N A;  2HZD A;  1TZL A;  3PL8 A;  3SHF A;  4AIJ A;  3HL2 A;  3DBH B;  4N0B A;  3DPU A;  3MZY A;  1S5L C;  9ANT A;  3A01 B;  2RVC A;  4XSX F;  2OZU A;  4B3A A;  2JRM A;  3BLY A;  3B73 A;  1O3R A;  2VE9 A;  5HS9 A;  2LH9 A;  4L9N A;  1FMV A;  2DT5 A;  1JKQ C;  2YUS A;  1EF4 A;  2WV1 A;  3FHN A;  2OCE A;  3MKW B;  4DYQ A;  1YE9 A;  1UG0 A;  4PDK A;  1H88 C;  1V5G A;  1BJZ A;  2V1X A;  2JRT A;  3QOP A;  3E1S A;  1W7P D;  3ISP A;  4DBQ A;  3GX4 X;  2BYV E;  4B1R A;  1GXP A;  4BQQ A;  5IP9 J;  4MIM A;  2XPU A;  3R6S A;  2F4O B;  1EKE A;  3RIR A;  2YS9 A;  3KPH A;  4PJJ A;  3NRV A;  2LC2 A;  2PMU A;  2ZCW A;  2GIV A;  3SZT A;  2CQX A;  2L54 A;  1OCT C;  4BBS J;  3BTL A;  1APL C;  1U2W A;  5DUI A;  4NC8 A;  3DLA A;  2E5N A;  2F5V A;  3K4J A;  1OIS A;  2FQ3 A;  2KIF A;  2KIS A;  4WX9 A;  2CJJ A;  3OYK A;  4X6A J;  3H9G A;  1YS7 A;  4BJ6 C;  3VYT B;  3OYE A;  4ZJZ A;  4FCY A;  1H89 C;  2IRF G;  3PNY A;  4I0A A;  1O4X A;  2R3S A;  1FYK A;  3WTS C;  4P5O A;  4A3I J;  2K7L A;  2JWT A;  3CCQ I;  3QRF F;  1G6N A;  2O8X A;  3K70 C;  3ABT A;  1ETQ A;  3C7J A;  1JKP C;  5DCF A;  2CS3 A;  4C3J J;  2JVG A;  4Q4Z F;  1IV6 A;  3UNG C;  3V8K A;  3DKY A;  1HW5 A;  2NVU B;  3TBI A;  2GBY A;  1JKR C;  3K6G A;  3R0J A;  4E70 A;  2BOL A;  2HGC A;  2FUG 2;  3KP3 A;  2VIX A;  2EV0 A;  3LSM A;  4IKF A;  3S1M J;  3K10 A;  4BXF A;  2JT1 A;  2FU4 A;  2DA7 A;  2L9N A;  2F5D A;  3OL4 A;  4U0W A;  3A0B C;  5GAG J;  4OWR B;  2GLO A;  2W82 A;  3BJO A;  2QUF A;  2LK2 A;  1VQP I;  4RAZ A;  4LLG F;  1LPQ A;  4GXO A;  3KP6 A;  4CCN A;  1ETX A;  3SFI A;  3HSE A;  4RLF A;  2R0Q C;  2X1D A;  1MSF C;  2CUF A;  2LY2 A;  5E1Z B;  1D1A A;  3DU6 A;  3IP4 B;  5K5Q A;  2XGD A;  3OYH A;  1I5Z A;  1SC7 A;  2OD5 A;  4ZDL A;  1IUY A;  2CYY A;  4HF2 A;  4FX0 A;  4E7Z A;  1Y6I A;  3GZ5 A;  4CO8 A;  2DFE A;  4KIB A;  2KLO A;  3J7Z I;  2WAD A;  2MW8 A;  2PQ8 A;  1GV2 A;  1JT6 A;  3G4S I;  2W25 A;  4HDU A;  2JVH A;  2MAB A;  3KEY A;  3LQQ A;  1G3S A;  2E5Z A;  1MBJ A;  4H4K C;  4Y7N J;  1Q1H A;  2BHZ A;  2DYS H;  1STZ A;  4XKV A;  3E6C C;  4CZC A;  4EAT A;  3E6B A;  2V7F A;  4EGY A;  3JAM K;  2VAS A;  2BGC A;  2OQG A;  3LL7 A;  3EUH A;  4YII A;  2DQR A;  4JOM A;  2Q0O A;  1RKW A;  2ZME A;  1O3T A;  1UMQ A;  3K1M A;  3L9F A;  1XDU A;  1G3T A;  5E20 A;  3FBN B;  1RIO H;  1WJA A;  3V7S A;  1D8J A;  3HJE A;  4EJU A;  4L5J A;  4LLN A;  5DD4 A;  2HOT A;  1PP8 F;  1HKQ A;  1ZN2 A;  1T95 A;  1YFH A;  1O7F A;  1MMN A;  2CV0 A;  3CF5 F;  4S04 A;  2GM4 A;  5L3F A;  3Q0V A;  2MYS A;  1SVO A;  3AG3 H;  2BW3 A;  2MGQ A;  2LVS A;  3LSK A;  4Q48 A;  1T6S A;  3DXJ F;  5LEK A;  3TED A;  3J7A O;  5IT9 K;  2QSF X;  2RN7 A;  1S6L A;  2NS7 A;  3ABU A;  4F93 B;  1TLH B;  2L01 A;  3VPR A;  2BE5 F;  2RGV A;  4ITV A;  3HOS A;  5D8K B;  4XLN F;  4LK0 F;  3GTL J;  5J1U A;  2HQ5 A;  2E60 A;  2DK8 A;  2Q8K A;  3H35 A;  4ABZ A;  3LNQ A;  1R4N B;  4UVC A;  3GYH X;  1J2X A;  3LSJ A;  2PJR B;  1X1D A;  3I56 I;  3BG6 A;  5E3N A;  3BR0 A;  5K7Z A;  4HLX A;  5GAE J;  4BAC A;  2D2W A;  1HW1 A;  1E2X A;  3GME A;  2VOO A;  4BY1 J;  1UHS A;  1GUU A;  3E97 A;  3FM3 A;  3ONQ A;  3HOT A;  2OTJ I;  1HQC A;  3EUH C;  4BGD A;  1FBQ A;  3CF2 A;  2Y9Y A;  3TGN A;  4FQG A;  5KNL A;  1IG7 A;  1MBF A;  2ZME C;  1B6A A;  3TOA A;  4HV5 A;  1VFC A;  1BR2 A;  2R7Z J;  2KZG A;  2WY7 Q;  3V7C A;  4R79 A;  4DOZ A;  2M3A A;  4UUS B;  4WXD A;  1TNT A;  4EJV A;  4EVI A;  3K4C A;  1OPC A;  1N78 A;  4XMY A;  2DA2 A;  5CVJ A;  3JSP A;  1ZEL A;  5H2F C;  3WTT C;  3LOC A;  5F0C A;  5LRR A;  5JFR A;  1K78 A;  3BG7 A;  4R8H A;  5AON A;  4XOR A;  2DCE A;  1FMW A;  5JVT A;  3DV8 A;  3BPX A;  1H8A C;  3PM1 A;  4V19 K;  1KYW A;  3HZJ A;  3CCY A;  5E18 F;  3J7Y J;  3SDG A;  1PJR A;  1WJC A;  2W84 A;  4O6J A;  1EV7 A;  4D0P A;  2V4J C;  2WA0 A;  2ZXW H;  3S14 J;  4PUS A;  2RAE A;  2QZ8 A;  2RV8 A;  2K5C A;  1MH4 A;  1RZ4 A;  2IA2 A;  4W1U A;  3OYI A;  1VQO I;  2DK5 A;  2OC6 A;  3FBI B;  2PJR A;  1IDY A;  4MFE A;  1OCR H;  5FFX A;  2O6G E;  2DLL A;  3HRM A;  3LFK A;  2ICW G;  2RC4 A;  4Z2Y A;  4AD9 A;  4Z6Y A;  2ISZ A;  3DFG A;  2GAU A;  1BN5 A;  3D5R C;  2KPM A;  3OS2 A;  2JPB A;  3RYP A;  3FKI J;  1EA3 A;  3R60 A;  2F48 A;  2LY1 A;  1R5H A;  4EM1 A;  3PO2 J;  2ZJR F;  3RKQ A;  4QIW N;  1FT9 A;  4BHC A;  3HRS A;  2LKS A;  1KZH A;  3TP0 A;  1RPW A;  2L02 A;  3BCA A;  5J8C A;  5C44 J;  5BS6 A;  4XOT A;  4IVN A;  4LFU A;  3IAM 2;  4B09 A;  1FC3 A;  2VXZ A;  4I2O A;  2DJN A;  1R6R A;  4NQW B;  3RPU D;  2VC0 A;  3FMS A;  4XK4 A;  1BW5 A;  1KQ8 A;  1U5T A;  2LTP A;  1HSJ A;  2FA5 A;  3J80 K;  1H9T A;  1ZKG A;  5D5V B;  4IRI A;  2R7T A;  2JA5 J;  2XPW A;  2DA4 A;  5GPA A;  4A3F J;  3LSR A;  1S7E A;  2P6T A;  2R5Y A;  1Y1W J;  1HW2 A;  4RBO A;  2XKP A;  1BC8 C;  1P4X A;  3GW2 A;  5A2Q K;  3HKZ N;  4QLC U;  1VQ5 I;  2KRH A;  1YRN B;  2WAQ A;  3HXL A;  1K79 A;  1FP2 A;  1QHH D;  2VT3 A;  3BR3 A;  4M6Y A;  2VBY A;  4ZC3 A;  3X2Q H;  1IXR C;  2VPL A;  3FXM A;  3JAM Z;  2P5V A;  2R7O A;  3OOU A;  2G9W A;  1I6H J;  3KEO A;  3S8P A;  4A0X A;  2R7X A;  1QVT A;  1JXS A;  1JE8 A;  5F08 A;  5KAI C;  3VFZ A;  5J4Y A;  5IYD J;  2IGK A;  4G6T B;  2A6T A;  3CP8 A;  2P7V B;  2HZT A;  1HKT A;  3QWL A;  1QNT A;  3CTA A;  4C30 A;  1K4S A;  5K7H A;  1FOW A;  2Z99 A;  5IT3 A;  2ME0 A;  3N97 A;  4OIQ F;  1LDJ A;  1TW3 A;  3MN2 A;  3ERE D;  2H27 A;  2FEZ A;  1XN7 A;  4FTH A;  1XCB A;  4I02 A;  5H20 A;  2Z2S B;  3GZ6 A;  1T2K A;  2P81 A;  2W85 A;  2XF7 A;  5DTD A;  3OYG A;  3NEU A;  5J40 A;  4XLF A;  2K9M A;  2HOS A;  1SFE A;  2ELK A;  1MMA A;  3IH4 A;  3F3X A;  3OS1 A;  4ENN A;  1IN4 A;  1U5T C;  4LD5 A;  4J19 A;  3K0L A;  1W4M A;  2DT6 A;  2L4M A;  2PMZ N;  5E8G A;  2K9N A;  3S1Q J;  1AKH A;  1YS6 A;  4KNY A;  3I53 A;  3T5X A;  4B4C A;  1YW9 A;  2I5U A;  4CCM A;  3DPT A;  2CFX A;  1D0Y A;  2K85 A;  2H8R A;  1MBK A;  3GXO A;  5K1Y A;  4GYG A;  5BPD A;  3E3V A;  1ZRD A;  4B47 A;  4A12 A;  5ICE A;  3L2C A;  6PAX A;  4A3M J;  1PUF B;  1D0Z A;  2HS5 A;  2JA6 J;  1S8N A;  2FQ4 A;  3QU6 A;  3F8F A;  2B9S A;  4KIF A;  1K6O A;  4XN3 A;  5M3F J;  3S3N A;  1TWH J;  2O7O A;  3K4L A;  5DS9 A;  2VXD A;  1Z7U A;  4RGX A;  4HAM A;  3ZOB A;  1ETW A;  3C2B A;  4JX6 A;  3ZN1 A;  2ETH A;  2MLG A;  3L2W A;  4UVA A;  3OSF A;  2XUB A;  4C2T A;  3TDU C;  1MKM A;  3D5S C;  2JTV A;  3OV8 A;  3NAR A;  1R71 A;  4PFP A;  3TDZ C;  1TL8 A;  1R23 A;  4L9J A;  3E6D A;  4AIK A;  1SFU A;  2BY1 A;  1W36 C;  1D5Y A;  4E7L A;  2L4A A;  1A6Q A;  4MO7 A;  1BI0 A;  3HSF A;  2M7B A;  3ZQ7 A;  3VDX A;  2GXB A;  2PFB A;  3AFH A;  3G1O A;  3I59 A;  3CLQ A;  2IGN A;  2UXN A;  2E1M C;  3ZMV A;  5LHH A;  1LEB A;  1MSE C;  5F64 A;  3S3M A;  3ZQC A;  4MHG A;  2E2I J;  3GFJ A;  1ULY A;  2IAI A;  3G6E I;  5K5O A;  3QYB A;  2KT0 A;  4OIP F;  2EPF A;  4QTR A;  1V55 H;  2HWV A;  1UAA A;  1BR1 A;  3D1N I;  3TO7 A;  3FIS A;  3KE2 A;  5KK1 A;  2IT0 A;  2LMD A;  3EPZ A;  2Q2E B;  3I4P A;  2L7F P;  4FT8 A;  1OFC X;  5HDK A;  1A36 A;  1Z6T A;  4NNJ A;  1P4W A;  3IHU A;  1VQN I;  4EQQ A;  1AA7 A;  2FJ1 A;  2K27 A;  3K1N A;  1JUM A;  5LEJ A;  1EH8 A;  2HDW A;  4KMU X;  1S7A A;  4O5V A;  3ABK H;  4E7I A;  3QOE A;  3V42 A;  2XAG A;  1QZY A;  2AXL A;  4Y15 A;  2LR8 A;  3G3Z A;  2P5L C;  1D8K A;  3KIO A;  3ECO A;  3ZQF A;  2LD5 A;  1OCO H;  1XG1 A;  4XOP A;  2R4G A;  5EEG A;  3TW7 A;  1VI0 A;  2PEX A;  2CH0 A;  3I71 A;  4CCJ A;  5H6R A;  2M4K A;  1QZZ A;  2CU7 A;  3BQY A;  2O3F A;  1MDM A;  3F23 A;  2XRO A;  3WTX C;  3GTK J;  4HEA 2;  3LWF A;  1SAU A;  5JR3 A;  3J80 Z;  3T8R A;  1SD7 A;  3HDD A;  1X3U A;  1T33 A;  1X2N A;  3HPG A;  3SXY A;  2EIN H;  5GAH J;  1DP3 A;  1ERD A;  5A2Q Z;  3K9T A;  3CO6 C;  1FWZ A;  2FBI A;  2K9L A;  3D5L A;  1RUN A;  3HYI A;  2GXA A;  4B43 A;  2MA3 A;  3BR5 A;  3JRH A;  3CCM I;  2E71 A;  2QQB A;  4OMY A;  2CG4 A;  3CLO A;  5GTH C;  5ICG A;  2IBD A;  3KYD B;  3I58 A;  3ZGK A;  3KCC A;  1UHW A;  2PMZ A;  3KZY A;  2DA3 A;  4CIC A;  3ZQL A;  1IAW A;  2BVM A;  1F9N A;  1TTY A;  1LE8 B;  3KZI C;  4EM0 B;  1VND A;  1LNW A;  1A35 A;  2XGX A;  3HBL A;  2X85 A;  1P7J A;  4EJO A;  4YIR X;  1R00 A;  4L5I A;  3I64 A;  4G6D A;  3BR1 A;  2R7F A;  4WK8 F;  1S9H A;  3VWB A;  1IC8 A;  4U87 A;  2ESN A;  4Y3O A;  4DBR A;  2NVX J;  4HRI A;  4ESJ A;  3OYN A;  2LBF A;  2DA5 A;  5LGU A;  2JA2 A;  1P4A A;  2XSJ C;  2EZK A;  4F52 A;  1WPK A;  2CUZ A;  5FKM A;  4NDL A;  5KCM A;  2WB1 A;  4P9U A;  1SD6 A;  1TWC J;  4RS8 A;  3MQ0 A;  4LG3 A;  2W7N A;  1UZC A;  4HDV A;  3FXR A;  2DN0 A;  2HPI A;  4WF2 A;  1MGT A;  2IA1 A;  2BY2 A;  1F1Z A;  2IJL A;  2CQQ A;  1IN8 A;  4XBF A;  4OMZ A;  4S05 A;  2R7R A;  1RR8 C;  4PSX A;  2IS6 A;  1KYZ A;  3GTJ J;  4A5M A;  2AO9 A;  3B02 A;  4U7B A;  3WU1 B;  2WV0 A;  4F3Q A;  2VL8 A;  2VJ5 A;  2MC4 A;  5L3C A;  2XAF A;  4NBQ A;  4KIC A;  1G59 A;  3ZN0 A;  2P8T A;  3WGI A;  1P6R A;  1XGO A;  1LJ9 A;  1QO0 D;  4GRI A;  2A6H F;  3ELK A;  2G0E A;  4DW6 A;  3WHC A;  2HKO A;  2NS0 A;  4HSR A;  4HV6 A;  5J1Y A;  2UUZ A;  1MNM C;  4FE7 A;  4PGH A;  5EGO A;  2MFZ A;  4HZF A;  4KJZ A;  4HBL A;  4A6E A;  4RAY A;  5F04 A;  2X51 A;  1R7J A;  2NVY J;  3MVP A;  3JRE A;  5L3G A;  4I7H A;  4YEJ A;  4BJ5 C;  4BQO A;  3ML6 A;  1VF9 A;  1QHG A;  2Z16 A;  5LRS A;  3RZD J;  1HDD C;  3WU0 A;  4N4O B;  3GTQ J;  2OBP A;  2IA0 A;  3M07 A;  2ECB A;  2KRF A;  1HA8 A;  2ZKZ A;  2CWE A;  4DYC A;  4IOA F;  3GUD A;  4JK1 X;  1W5S A;  4FET A;  2VQG A;  3O8G A;  4ZYG A;  2V6C A;  2VQL A;  2VOD A;  3DQV C;  4XKC A;  2MLK A;  4MNU A;  2BZT A;  3OWT A;  2HDC A;  4RAG A;  2W1O A;  5CPR B;  4UUT A;  2L0K A;  3B6A A;  1MBG A;  5EG0 A;  3K7A J;  1BOA A;  4RA2 A;  2HTS A;  4CXF A;  5EEA A;  3GTM J;  1S3J A;  2G7H A;  5B1B H;  4B3X A;  1NHA A;  1WVR A;  3PQK A;  4MFD A;  3LA2 A;  3WOD F;  2F6C A;  1B1B A;  2F2E A;  1Y56 A;  5FLM J;  4JX4 A;  1YIJ I;  1FTZ A;  1U6G A;  2X48 A;  4C3I J;  1SEU A;  2CW8 A;  1OYW A;  3MCZ A;  4RB1 A;  5HLH A;  3F8N A;  1MMS A;  2VQH A;  1D5V A;  2K40 A;  2EZI A;  5F27 A;  2HQN A;  1HLV A;  4G94 A;  3ERM A;  1F43 A;  3H5R A;  1XSD A;  2P7C B;  5L3D A;  3S1N J;  1H9G A;  1G3W A;  2EFP A;  4U0Y A;  2VLA A;  4KN4 X;  2BHY A;  3KP5 A;  3KLO A;  3H3U A;  4MTE A;  1YI2 I;  1UG2 A;  1USS A;  4RM2 A;  1V5E A;  3DTE A;  4A3J J;  2CV1 A;  4JBA A;  4XN0 A;  3QU3 A;  2ZNY A;  4CDG A;  4KMF A;  5CKT A;  2GA1 A;  5K7F A;  4A3E J;  1ZRF A;  2OA4 A;  2MC3 A;  2V1D A;  3BZ6 A;  5F1J A;  2M87 A;  3UR3 C;  2M0M A;  4OAZ A;  4HF1 A;  3K4B A;  1I3Q J;  3GO5 A;  2IVM A;  3GCM A;  5BPI A;  1R49 A;  1BIA A;  1RET A;  4DIQ A;  3FXJ A;  2VJ4 A;  1T56 A;  3QPH A;  2CUE A;  1IGN A;  2E34 A;  1Z3X A;  5LGN A;  2DXI A;  2O0Y A;  4HNT A;  1MJA A;  4PZJ A;  2ZME B;  3BRO A;  3RKX A;  3IH2 A;  3CME I;  4LG0 A;  1YX5 A;  3W2W A;  3GTP J;  1IO2 A;  3OOP A;  3IRQ A;  2XB0 X;  5J3L A;  1IN7 A;  5BMZ A;  3R4K A;  5E3L A;  3Q9V A;  2XIG A;  3L2Q A;  2C6Y A;  3PQJ A;  2KP6 A;  2PI0 A;  1VQ8 I;  3ASO H;  2A05 A;  4I09 A;  1R22 A;  3W6V A;  2J5P A;  3P9K A;  3HUG A;  1WSU A;  3CUO A;  1A04 A;  1B72 A;  2BW3 B;  5M3M J;  1K4T A;  2KIQ A;  3QPL A;  2OUM A;  2QEN A;  2DMU A;  1TBX A;  1DQU A;  4XRS G;  4J01 A;  1TNS A;  3ECH A;  2RQP A;  1PYV A;  4U0V A;  5JHF A;  2FMY A;  4CH7 A;  5CJ9 A;  4CYC A;  2TDX A;  4GO1 A;  1T0F A;  2G7U A;  3A02 A;  3GZN B;  2LRD A;  1DGW Y;  1JT0 A;  1OCP A;  4QSH A;  3U21 A;  2D5V A;  1W7P A;  5E79 C;  2YX7 A;  1ACI A;  1R58 A;  2KFD A;  4MEY F;  1S72 I;  3B6C A;  5IP7 J;  2Y2Z A;  5HVQ C;  4YFX F;  3ZPL A;  3G71 I;  4M6V A;  1ZK8 A;  1ZRC A;  4A3L J;  3P5J A;  3P9C A;  3F6O A;  2N8G A;  5FKN A;  3H92 A;  5HNH A;  2BVL A;  2IP2 A;  2LDU A;  4CCK A;  4GYI A;  2NNY A;  1XS9 A;  4B48 A;  1OQY A;  1W0U A;  3Q0W A;  2HTJ A;  3ZMZ A;  5E17 F;  3CCR I;  1IRX A;  2IPQ X;  4FHT A;  1ORK A;  3QP5 A;  3FK7 A;  3PIP F;  1A31 A;  3OYJ A;  4GDF A;  2L2O A;  5GAD J;  2MH2 A;  1KON A;  1CGP A;  4C9Y A;  2M1B A;  4IEJ A;  3KET A;  1DP7 P;  3WE3 A;  1BM9 A;  1K78 B;  4XQF A;  3EYI A;  1HC8 A;  1B9M A;  2GQQ A;  5HOO A;  2LKP A;  4DGW B;  2WAQ N;  2HI3 A;  1FX7 A;  2HVR A;  2YX4 A;  3CMA I;  1Z1D A;  4LB6 B;  1J9I A;  5CQE A;  2V1U A;  4RDU A;  4E7K A;  3JR9 A;  1W0T A;  3MKY B;  3PSI A;  1GVD A;  5B66 C;  1T0F C;  1NK3 P;  3AAF A;  3WTY C;  4IHV A;  1KU2 A;  1V5F A;  3M8J A;  2AHQ A;  3M1E A;  3RCO A;  2VT2 A;  4GFB A;  4H0E A;  4E7S A;  5HLI A;  2AS5 F;  4C2U A;  2BBY A;  2QQA A;  2VKH A;  3OR1 C;  4UB6 C;  2DMT A;  4AC0 A;  2L7M P;  3IL2 A;  3LST A;  2YU3 A;  4OOI A;  4NHJ A;  3JRA A;  1X58 A;  4IPA A;  3TMO A;  3KX2 A;  4G9Y A;  1LFP A;  4G7O F;  1P92 A;  4UHT A;  1ETO A;  2IS1 A;  2KKO A;  3I5U A;  1LVA A;  1LDD A;  1JJ8 C;  1FTT A;  5DM6 F;  1J0R A;  1J59 A;  4ZZD A;  3EYY A;  2LFB A;  1FOY A;  1ZAO A;  1U5T B;  3Q3S A;  1JUS A;  3CJN A;  5FD5 A;  1VQM I;  3CC4 I;  1JGG A;  1YG2 A;  1FLI A;  5FLX K;  4ZYH A;  2KRC A;  4XLP F;  1YO5 C;  4M72 A;  2R5Y B;  2MD0 A;  5E1X A;  1WI3 A;  2Y9Z A;  1WJD A;  1Z3Y A;  3S1R J;  2GXG A;  2CRG A;  1TT5 B;  1ZYR F;  3I3L A;  3S3O A;  2FOK A;  2NVT J;  4OU0 A;  4M9Z A;  2EFO A;  1HDP A;  1XGS A;  2RNJ A;  3Q5F A;  2MH9 A;  2R92 J;  2JZY A;  1WCM J;  4BUP A;  3FHZ A;  3NWS A;  3JRD A;  2M30 A;  1CF7 A;  3ZMD A;  1XC5 A;  1XD7 A;  1JHF A;  1DU6 A;  2J5O A;  5DEQ A;  3MKZ A;  1FSE A;  2QWW A;  4CZZ A;  4PCQ A;  1U9N A;  3OR2 C;  2EBI A;  2K4J A;  3IWZ A;  3AL0 C;  5JHU A;  2H8W A;  2KIU A;  3LAP A;  2LNB A;  3MAJ A;  1KGS A;  2B63 J;  4RAF A;  1I1S A;  3CCJ I;  3BZC A;  3QOD A;  5FRO A;  1ON2 A;  4CSW A;  2OPT A;  1VQL I;  4AU7 A;  2MD5 A;  1LKX A;  5EZG A;  2GWR A;  2KHM A;  3A03 A;  3ABM H;  3JRI A;  3SQN A;  2E1M B;  2VOP A;  1AKH B;  3TKY A;  2D45 A;  1RKT A;  3CCS I;  1MW7 A;  4E4H A;  1TWA J;  1OYY A;  1RUO A;  1SAN A;  1J5Y A;  1PDN C;  2M4G A;  2DOF A;  2XB5 A;  3S32 A;  2O5R A;  4HOB A;  1D3Y A;  3DTK A;  4ZZL A;  1DU0 A;  4BE2 A;  5FLV A;  5LFA A;  3A1Y A;  1CQT A;  5FKO A;  1V3F A;  1OLT A;  2L5Q A;  2F4M B;  3VYU B;  5M5X J;  2EV6 A;  3GFL A;  4M9X A;  5IOY A;  3EDP A;  3L1P A;  2K4B A;  2Y0M A;  1S7O A;  1HF0 A;  2YPR A;  3P9I A;  4IX7 A;  1XTA A;  1MNE A;  1SFK A;  2HYJ A;  1A5J A;  2HQR A;  4ZDO A;  2D1V A;  2XAU A;  3IAS 2;  2L9S A;  3T0Y A;  4ZYE A;  1L3L A;  2E35 A;  2XF5 A;  3OYF A;  1N75 A;  2IS4 A;  2DFF A;  4XNF A;  3HOX J;  2PG4 A;  1RI7 A;  3VSK A;  2HR3 A;  3OIQ A;  2QQ9 A;  3F9K A;  4UUV A;  2FE3 A;  3WGG A;  1XCV A;  2ISY A;  1PP7 U;  4ENJ A;  1ZG5 A;  1ZH5 A;  1SVL A;  2JUC A;  2LOO A;  2EIM H;  2OV7 A;  1IDZ A;  3ZQQ A;  2RRE A;  2HDD A;  4W97 A;  3WTV C;  4IXA A;  5EZH A;  2F5C A;  3I59 B;  5LGT A;  2QQ8 A;  4KUM A;  4IHY A;  4A3D J;  1SD4 A;  5CLS A;  2A69 F;  2X1C A;  1LEA A;  1KU3 A;  1JTY A;  2LSO A;  3FWE A;  4NUB A;  2A07 F;  1GV5 A;  4UVB A;  1GVJ A;  3ESW B;  3Q9S A;  2NNN A;  4RM3 A;  1UB9 A;  1K7A A;  2K02 A;  3PNT A;  3WTW C;  1KA8 A;  1RR7 A;  3CP2 A;  4V2G A;  2EFW A;  1KQ0 A;  4EGZ A;  2FBH A;  3GF2 A;  3LMM A;  2B7E A;  3F72 A;  2Y75 A;  3HM5 A;  4FAS D;  1OCC H;  4HYE A;  2MSY A;  2QKL B;  4LIV A;  4PJM A;  3OSG A;  5HS7 A;  5AIQ A;  5HLG A;  2WBM A;  5DUK A;  3RPU A;  2M34 A;  3CJQ B;  4A93 J;  2WB1 N;  1WQ2 A;  2VKV A;  2HXO A;  5BOX A;  2WAF A;  4HLY A;  3K2A A;  2WC2 A;  4DNC A;  4A2U A;  1WH7 A;  2X0L A;  4IJA A;  2PX9 A;  4A3C J;  2MBF A;  3MFK A;  1MDM B;  4XLA A;  3WTU C;  3SYT A;  1FIP A;  1YHQ I;  1FP1 D;  3S17 J;  3IWF A;  1MJB A;  1Z91 A;  5FLX Z;  4K2E A;  4DZJ A;  4ENK A;  3OYA A;  1XGN A;  3DBL B;  4HX8 A;  1G8X A;  1MND A;  4A3K J;  1ZRE A;  2BY0 A;  3JW4 A;  5FKL A;  1XB4 A;  1KQ9 A;  3FX3 A;  4IHS A;  3KLN A;  1DUX C;  2VON A;  2Y0S A;  2Q1Z B;  3V8L A;  4ZTJ A;  3IH3 A;  3ZQG A;  5E3O A;  5FJ8 J;  2W48 A;  2NYX A;  4XLC A;  2HVQ A;  3S93 A;  2E1N A;  2W4S A;  5E1W A;  3ZQH A;  2OTL I;  1IRZ A;  1WZ2 A;  2HNH A;  2ZB9 A;  4E7J A;  2E7X A;  2COM A;  2P4W A;  4QPQ A;  4AVP A;  4G7H F;  2DDA A;  2D1H A;  3GWZ A;  2V26 A;  3IRR A;  1VQ9 I;  3WE2 A;  3DLL F;  1OR7 A;  4RB2 C;  2NVQ J;  3CUQ A;  1R9T J;  5H6Q A;  1ETK A;  3F6V A;  5HNF A;  1K83 J;  1JHH A;  2A68 F;  4IRH A;  1FEX A;  1X3W B;  3NWT A;  4BS9 A;  2FML A;  2LBF B;  3HOZ J;  3CO7 C;  3N4M A;  4YFK F;  5L3B A;  5GPC A;  5FD6 A;  1E3H A;  2IW5 A;  2DYR H;  4C3H J;  5HS8 A;  2CUJ A;  3FIW A;  1XMA A;  3TQN A;  3SDB A;  4WXH A;  1IZ1 A;  4KN7 X;  2JSC A;  1KU9 A;  5ERI A;  1GXQ A;  4M3G A;  1O57 A;  5L3E A;  1FZP B;  1I50 J;  2V79 A;  4I99 C;  2K9Q A;  2ZXJ A;  4MTD A;  1YJW I;  2UXX A;  3S2D J;  3SJM A;  5EF6 A;  2W57 A;  2VJI A;  2OQR A;  2V9V A;  3DTI A;  1RC9 A;  2OAZ A;  2E36 A;  5J8F A;  1R1T A;  3HTS B;  2M9H A;  2AXT C;  3BPV A;  2M45 A;  1ZG3 A;  2K3P A;  2ZJ2 A;  3CDL A;  3GVA A;  1QPM A;  1MBH A;  3ROU A;  3CC2 I;  3LQR A;  1YIT I;  4Y13 A;  3GFI A;  2STT A;  1D1C A;  4EJW A;  2GA2 A;  1GLN A;  4BEH A;  1Z05 A;  3U1K A;  2ZNZ A;  1DPU A;  1WI9 A;  3HG9 A;  2E2J J;  2DMP A;  1Y0N A;  2RDP A;  5EGO B;  5C4J J;  1U78 A;  3CC7 I;  3MD2 A;  2DFH A;  1OYI A;  2NXN B;  1OR7 C;  1XMX A;  1QBJ A;  3CUQ C;  1XSX A;  2KJB A;  2ELH A;  3WTZ A;  2CW0 F;  1F36 A;  4MGR A;  4YRV A;  3E6M A;  4S0H B;  1GDT A;  2LY9 A;  2ZJP F;  3K1P A;  4RGU A;  3JTH A;  1TP4 A;  2DTZ A;  1P9Q C;  2EH3 A;  2KDO A;  2DMN A;  2IGM A;  3K70 D;  4X1E A;  2WTE A;  2IGO A;  2FXA A;  3BJA A;  4BL0 B;  1ONV A;  3RI4 A;  3FXK A;  2R5Z A;  1O7L A;  5TIS C;  4G12 A;  3CMY A;  2V1N A;  1FOX A;  4MQV A;  5EG0 B;  1WKM A;  2F5E A;  3RDI A;  2EZL A;  2QF7 A;  3AG2 H;  5J4V A;  3OS0 A;  1UHM A;  2QKM B;  1BR4 A;  3TOB A;  2HU9 A;  3HIF A;  5D6F A;  1X19 A;  2ZSI B;  3IV5 A;  3ZP5 A;  4XL9 A;  1P7I A;  3H3Z A;  2EIK H;  2TCT A;  4D9J A;  3FMR A;  2CQK A;  4N4N B;  4KDP A;  2XV4 S;  1QVU A;  1ITY A;  4G7Z F;  1JGS A;  5IP6 A;  4AYB N;  4U88 A;  2KMU A;  1QQI A;  2R93 J;  2CSO A;  3LSI A;  3V4G A;  2LF7 A;  3CZ6 A;  4L9V A;  3FKJ A;  3FDY A;  3EQL F;  1FYL A;  4KT6 A;  1XSV A;  1MIJ A;  2Z1D A;  2X4H A;  3LSG A;  2VB6 A;  3E5U A;  5F6F A;  3ZMU A;  4A69 C;  3ABL H;  1T98 A;  4KFC A;  4KA4 A;  1TW2 A;  5D6E A;  1HXD A;  5FGM A;  4HA8 A;  2M8G X;  5CVR A;  1KU7 A;  1R5G A;  4BXU A;  1TQP A;  2V9P A;  2MG4 A;  1BI1 A;  3EUK L;  2ZXI A;  2DI3 A;  3BG5 A;  3OMY A;  4DYR A;  2DO7 A;  4EEF G;  3JSO A;  1Y8Q B;  1XMK A;  2K86 A;  3VYR B;  3DF8 A;  1YOV B;  4JX5 A;  3KP7 A;  1Z7L A;  3K4M A;  1X4P A;  2W24 A;  2WY8 Q;  3J81 K;  1AU7 A;  5FRM A;  2H94 A;  3FK6 A;  1TWG J;  1MD0 A;  2DQL A;  2VC1 A;  4NB5 A;  5DCM B;  1E17 A;  1I39 A;  5EEH A;  4IL6 C;  3HC7 A;  3CJR B;  3M7G A;  2YR2 A;  1ETV A;  4UB8 C;  3EET A;  2JA8 J;  1HOM A;  2HQA A;  3C2G A;  4N9I A;  4WXC A;  3OYC A;  4PJN A;  2EA2 A;  2NAZ A;  4F92 B;  5C4X J;  5IPA A;  2NS8 A;  2Y48 A;  3C1D A;  2H1L A;  2QCO A;  3E5X A;  1EJ9 A;  1TWF J;  3COA C;  4LG0 B;  1TQI A;  2L7Z A;  2XHK A;  3CCL I;  2EWN A;  2IXS A;  2DPU A;  1B9N A;  3BTC A;  4XID A;  3U2R A;  4HQE A;  4XSZ F;  3CES A;  3VSL A;  1IV8 A;  2CQ7 A;  5CYV A;  2M7A A;  3GBG A;  2Z33 A;  1SFO J;  3HUG B;  2IS2 A;  3W2V A;  2QVO A;  3WG7 H;  4A3G J;  1B72 B;  3HHG A;  1X1A A;  1B8I A;  3HEF A;  5TGT A;  1X1B A;  1OKR A;  5TJJ A;  4F91 B;  4ENM A;  4IOC F;  3FMQ A;  3TO9 A;  4V2F A;  5EYR A;  4PSW A;  3MZ8 A;  4A0Z A;  4WWC A;  4I0B A;  3R61 A;  1G2H A;  5FB2 A;  4YFN F;  4Y4R A;  3SZP A;  1I27 A;  4CYC B;  2L9V A;  3BZK A;  1ZHF A;  1X2M A;  1G4D A;  1FNN A;  1M1E B;  1W5C C;  2HOA A;  2P6S A;  3DP7 A;  3TW6 A;  5JVG F;  4ZTF A;  2CQN A;  2DA6 A;  1W7P B;  5FKK A;  1BL0 A;  2QYO A;  3BR6 A;  3I4N J;  5FFZ A;  1J09 A;  1MMG A;  5DCM A;  2XF6 A;  2DA1 A;  1WH5 A;  5JLW A;  4MEX F;  1MBE A;  3O2P E;  1ZGW A;  4IHT A;  2FBK A;  2NOJ B;  1R4M B;  1ENH A;  2Y30 A;  3SZG A;  3H3V K;  2VE8 A;  1A6I A;  2VKD A;  2QBY A;  4II3 A;  4FE4 A;  1NG7 A;  4P1W A;  1U3E M;  3JTG A;  1XGM A;  4I01 A;  3RYR A;  1GHC A;  2XAH A;  2BY3 A;  1PUE E;  2FX0 A;  4XKB A;  1YIO A;  4J00 A;  3RKY A;  1YLF A;  3CMM A;  4XKW A;  1FYM A;  4BY7 J;  3AG1 H;  2O8K A;  2XGC A;  4AM3 A;  4XR6 A;  3A01 A;  3FF5 A;  4PFO A;  3JRC A;  3RQI A;  4NC7 A;  3H9J A;  5ED4 A;  4M9S A;  2L3D A;  3L2R A;  3V8J A;  5DYM A;  4D5F A;  1MH3 A;  4P9F A;  2ZJQ F;  2M8E A;  5DV5 A;  2PBI A;  2XDV A;  1ZGA A;  5HLT A;  1IRF A;  3ZR8 X;  2COB A;  5JI6 A;  4AYB A;  1POG A;  2V6E A;  5CVV A;  4BHB A;  3BTI A;  3FXO A;  4HST A;  3ZMS A;  1Z9C A;  1Z0X A;  2ZO4 A;  3RPQ A;  3SEZ A;  4M71 A;  3MEX A;  1FBS A;  4QPO A;  4B44 A;  1FOK A;  2EK5 A;  4HX7 A;  2X6W A;  1ZLK A;  3OY9 A;  2VN2 A;  1BA5 A;  3K2Z A;  1MZB A;  3S2H J;  4MQ9 F;  1NK2 P;  3IUO A;  5GP9 A;  2Z3Y A;  2OZ6 A;  2GIZ A;  4R1H A;  4KYW A;  3S16 J;  4M6X A;  1QGP A;  4OAY A;  3O6B B;  4M74 A;  1RRJ A;  2EIL H;  2X6X A;  1QPI A;  4BE0 A;  1ZQ3 P;  3H5A A;  2M0C A;  3PFY A;  2R7W A;  4BYY A;  4NC6 A;  3AL0 B;  5D4R A;  1T08 B;  3JRF A;  2AQF A;  1FSH A;  2XVC A;  5KVR A;  2FNA A;  2FRH A;  3U9G A;  4PGG A;  5EDN A;  3KZZ A;  3F0C A;  4EMS A;  3BG3 A;  3I0T A;  5D5X B;  2JSP A;  4ON0 A;  1BBY A;  3HPH A;  4UV8 A;  1IXC A;  3QAH A;  4XLH A;  4RB0 A;  1IXS B;  3TO6 A;  1Z6R A;  4WCG A;  1I3A A;  2P0W A;  2QM3 A;  4LIU A;  2M2E A;  2R7U A;  2RNG A;  3H0G J;  3L09 A;  2EIJ H;  3QQA A;  1ZGJ A;  4IF4 A;  1AOY A;  4RMN A;  2ZSH B;  4YIF A;  1YYV A;  5B1A H;  3J81 Z;  3RJP A;  1EH7 A;  4ZYA A;  1X3Z B;  4ANJ A;  1BC7 C;  4IQJ A;  5M5Y J;  3ZRG A;  2VUM J;  4LIT A;  4M73 A;  2VKE A;  3CCE I;  3KFW X;  4ASN A;  4ESF A;  3CD6 I;  5M5W J;  5LHG A;  2EFN A;  3F21 A;  3OYB A;  1T39 A;  1O3Q A;  2I10 A;  1R36 A;  4TV7 A;  1CF7 B;  1E0E A;  2A6E F;  3DKW A;  3G73 A;  1OJL A;  3BOQ A;  2KIM A;  3HOY J;  3E0J B;  1S29 A;  1LUJ B;  4O3M A;  1T38 A;  5IOZ A;  4ESB A;  1UCR A;  2WWY A;  2CMP A;  3K69 A;  2GOM A;  2Y31 A;  5AIP A;  3W6J B;  1DDN A;  5BQT A;  2XAS A;  3FXQ A;  3OL3 A;  4MLO A;  3H9Q A;  2CGP A;  1NH3 A;  4BU2 A;  2A61 A;  1N77 A;  4HNU A;  1MMD A;  3K4K A;  5ICC A;  5LBQ A;  2LKX A;  4DZP A;  4A5N A;  4A6D A;  1SD5 A;  2H09 A;  5IYB J;  4JQF A;  2VQC A;  4D7M A;  4F55 A;  1FPQ A;  1ZR4 A;  1JUP A;  3MKL A;  3NQO A;  2ZBK A;  3PO3 J;  1UST A;  4KT5 C;  4FIS A;  3QYE A;  1Z21 A;  2ZFU A;  2JQ7 A;  5B5E C;  3I55 I;  4HQM A;  3HOW J;  4IO9 F;  3HOV J;  2DBB A;  3HB9 A;  2DDB A;  3DWL E;  1B59 A;  1Y0U A;  1XDS A;  2X6O A;  2DT7 B;  4RB3 C;  3KYL A;  3VYS B;  4LJZ F;  4BBR J;  2EJR A;  2EQR A;  4DJA A;  1FJL A;  2HOE A;  3OIO A;  4AUX A;  1J75 A;  4LB5 A;  5LLQ A;  1VZ0 A;  3WG9 A;  1U8B A;  1F5T A;  1IUF A;  2XRL A;  3A4C A;  3PIO F;  3UKG A;  1QZE A;  1YJN I;  1AHD P;  4IQ4 A;  1HCR A;  1VQ6 I;  2TRT A;  1P2F A;  1LQ1 A;  3IKV A;  2HVS A;  4YG2 F;  1HST A;  2E19 A;  2M5W A;  5ILS A;  2RKH A;  3AG4 H;  1W36 D;  2VBZ A;  3BQZ A;  2DMQ A;  3L00 A;  2GZW A;  1WHU A;  4GGG A;  2W00 A;  3REO A;  1BJA A;  2STW A;  2Y0S N;  2LYC A;  4XRS A;  1AWC A;  3DBR B;  3ZMT A;  1QU3 A;  4F7Z A;  3L2U A;  2R7D A;  4CYD A;  2AQE A;  2HYF A;  1J7K A;  2H6C A;  3PUB A;  3W3C A;  4AWX B;  5ICF A;  4RLQ A;  4BE1 A;  2Y69 H;  3QPS A;  4E7H A;  1U9O A;  3ZQI A;  4ZYD A;  1SMT A;  2R7S A;  4IZZ A;  3L7W A;  2HYG D;  2XAJ A;  5D5U B;  2NRA C;  4L18 B;  4I6Z A;  1XX5 A;  3R0A A;  3F8C A;  3MMY B;  1MJ9 A;  2H6B A;  2L9R A;  2KJC A;  4IRG A;  4BKX A;  2O9L A;  3BCB A;  1BIB A;  3GEZ A;  4C2M J;  4FX4 A;  4QWQ A;  1HBX G;  2ME6 A;  3CJT B;  1K6Y A;  2DTR A;  1V4R A;  4UUS A;  3OYL A;  3MZH A;  1VQ4 I;  1WJF A;  1IW7 F;  3E5Q A;  1YTY A;  2FD5 A;  5ILU A;  2E7W A;  2L7K A;  2QA4 I;  4I76 A;  2HXI A;  2Z5U A;  3O3K A;  4ZDP A;  3G1L A;  3DU5 A;  4XRM A;  1UEL B;  4JYK A;  4BAY A;  1ZR2 A;  3FXU A;  1WJB A;  1FBU A;  5D8L B;  3HGY A;  3KYC B;  5HOD A;  2DW4 A;  5F1R A;  1JI8 A;  4L0Y B;  3A2K A;  2FF4 A;  4M3D A; 
#chains in the Genus database with same CATH homology
 2MGQ A;  1FTZ A;  2LVS A;  1I50 J;  2X48 A;  4C3I J;  2K9Q A;  3TED A;  3S2D J;  3SJM A;  5EF6 A;  2NS7 A;  3VPR A;  2K40 A;  2EZI A;  5F27 A;  1HLV A;  1F43 A;  3GTL J;  2M9H A;  5J1U A;  3S1N J;  2HQ5 A;  3CDL A;  2XPV A;  1MBH A;  3HGG A;  4ABZ A;  3LNQ A;  1Y1V J;  3LSJ A;  2JJ7 A;  2XGE A;  5E3N A;  3BR0 A;  5K7Z A;  4A3B J;  1UG2 A;  4A3J J;  2E2J J;  2DMP A;  2LLK A;  4BY1 J;  1UHS A;  5EGO B;  5C4J J;  1U78 A;  1GUU A;  2JMW A;  5J1R A;  5K7F A;  4A3E J;  2H1K A;  1F36 A;  5F1J A;  4S0H B;  1GDT A;  2LY9 A;  2Y9Y A;  1IG7 A;  1MBF A;  3BT9 A;  1WGX A;  1I3Q J;  3E7L A;  1VFC A;  1RET A;  2DTZ A;  2EH3 A;  2R7Z J;  2DMN A;  1T56 A;  1IGN A;  2CUE A;  4X1E A;  4UUS B;  3M4O J;  2EZH A;  1JKO C;  2JA7 J;  4M3E A;  2DA2 A;  2R5Z A;  3IH2 A;  3LOC A;  5F0C A;  4G12 A;  3CMY A;  3GTP J;  2XB0 X;  5J3L A;  1YRN A;  5E3L A;  5EG0 B;  2EZL A;  2QF7 A;  2XSD C;  1H8A C;  3PM1 A;  3GTO J;  3CCY A;  5F0H A;  4BXX J;  3NAU A;  3W6V A;  3IV5 A;  3SDG A;  1P7I A;  1B72 A;  2TCT A;  5BNG A;  5M3M J;  3S14 J;  2RAE A;  3QPL A;  1MH4 A;  1QVU A;  1ITY A;  5IP6 A;  2DMU A;  4W1U A;  4AYB N;  2R93 J;  1IDY A;  4XRS G;  4MFE A;  2IEK A;  5IYC J;  3Q0U A;  3LSG A;  4CYC A;  3DCF A;  4A69 C;  3A02 A;  1JT0 A;  2M8G X;  1OCP A;  4QSH A;  3FKI J;  2D5V A;  4L5E A;  2MG4 A;  3PO2 J;  3RKQ A;  3B6C A;  5IP7 J;  2Y2Z A;  3BG5 A;  4DYR A;  4EEF G;  4QIW N;  4M6V A;  1ZK8 A;  3TP0 A;  4A3L J;  1RPW A;  4JX5 A;  2N8G A;  5FKN A;  5C44 J;  1AU7 A;  2KDZ A;  3FK6 A;  3HOU J;  1TWG J;  3S15 J;  2DJN A;  1XS9 A;  3O8H A;  2VI6 A;  1W0U A;  4XK4 A;  1BW5 A;  3Q0W A;  1ETV A;  2LTP A;  2JA8 J;  1HOM A;  3I4M J;  1ORK A;  1ZKG A;  3FK7 A;  4JP0 A;  1PUF A;  5C4X J;  5IPA A;  2JA5 J;  2NS8 A;  2XPW A;  2DA4 A;  2QCO A;  5GPA A;  2R5Z B;  3LSR A;  1S7E A;  4A3F J;  1TWF J;  2R5Y A;  2L7Z A;  4IEJ A;  1Y1W J;  1TC3 C;  4RBO A;  3HKZ N;  1YRN B;  5C3E J;  2JN6 A;  2WAQ N;  3BTC A;  4XID A;  2HI3 A;  1QRY A;  1K61 A;  3BR3 A;  3BG9 A;  3GBG A;  1SFO J;  3OOU A;  4A3G J;  3CQZ J;  1I6H J;  4RDU A;  1B72 B;  3JR9 A;  1B8I A;  1QVT A;  1W0T A;  3HEF A;  5E3M A;  1E3O C;  5F08 A;  1GVD A;  5IYD J;  1NK3 P;  1FIA A;  2VPR A;  4V2F A;  5EYR A;  1IJW C;  4IHV A;  2AHQ A;  2E1O A;  3GTG J;  4GFB A;  4Y52 J;  5K7H A;  1G2H A;  2ME0 A;  4AC0 A;  2DMT A;  4CYC B;  2L7M P;  3JRB A;  1JTX A;  1X2M A;  3MN2 A;  2HOA A;  3TW6 A;  4FTH A;  1ZTR A;  3JRA A;  1X58 A;  2ID3 A;  2DA6 A;  2P81 A;  5FKK A;  5DTD A;  1BL0 A;  3BR6 A;  1JJ6 C;  2HOS A;  3I4N J;  2ELK A;  3IH4 A;  1ETO A;  4D5C A;  2DA1 A;  4IHX A;  1WH5 A;  5JLW A;  1Z77 A;  1MBE A;  1LFU P;  1ZGW A;  4J19 A;  1JJ8 C;  1FTT A;  2PMZ N;  1ETY A;  2JK3 A;  2K9N A;  3S1Q J;  1ENH A;  2Y30 A;  1AKH A;  5JLX A;  4B4C A;  3H3V K;  1RES A;  1A6I A;  3BR2 A;  2H8R A;  1MBK A;  2YU9 J;  2LFB A;  4FE4 A;  3RZO J;  3Q3S A;  1JUS A;  4HNV A;  4IHW A;  4A3M J;  1PUF B;  2JA6 J;  1JGG A;  2FX0 A;  2FQ4 A;  3WHB A;  2R5Y B;  4BY7 J;  3BTJ A;  2O8K A;  2XGC A;  1WI3 A;  2Y9Z A;  3A01 A;  5F0F A;  5M3F J;  3S1R J;  3JRC A;  2ID6 A;  2X9D A;  3RQI A;  2CRG A;  1TWH J;  2O7O A;  5DS9 A;  4D5F A;  1MH3 A;  2NVT J;  4M3F A;  1HDP A;  1Q1V A;  3ZOB A;  1ETW A;  3C2B A;  4JX6 A;  3OSF A;  2R92 J;  2COB A;  1WCM J;  4XIC A;  1POG A;  1B8I B;  3BTI A;  3JRD A;  2ECC A;  1XC5 A;  3NAR A;  2E2H J;  1Z0X A;  3M3Y J;  1DU6 A;  2LP0 A;  1D5Y A;  1U9N A;  4M3B A;  3LSP A;  2EBI A;  4MO7 A;  1BA5 A;  2K9S A;  3S2H J;  3G1M A;  1NK2 P;  1BW6 A;  5GP9 A;  3G1O A;  3TP3 A;  2B63 J;  3S16 J;  1MSE C;  3DEW A;  2OPT A;  1QPI A;  3ZQC A;  1LFB A;  1ZQ3 P;  2E2I J;  2M0C A;  5EZG A;  3JRF A;  2IAI A;  3A03 A;  1LE8 A;  2KT0 A;  1NTC A;  3JRI A;  4QTR A;  2NOG A;  1GT0 C;  5EDN A;  3D1N I;  3FIS A;  1AKH B;  3F0C A;  1RKT A;  3BG3 A;  2L7F P;  1OFC X;  1TWA J;  2OF7 A;  1SAN A;  4LOC A;  2FJ1 A;  2XB5 A;  3JRG A;  1JUM A;  1DU0 A;  5FLV A;  4D7N A;  1CQT A;  2M2E A;  5FKO A;  2LR8 A;  3H0G J;  3ZQF A;  2LD5 A;  5M5X J;  5IOY A;  9ANT A;  1XG1 A;  3QQA A;  3L1P A;  3A01 B;  1HF0 A;  4B3A A;  3TW7 A;  1VI0 A;  2HYJ A;  1A5J A;  2CU7 A;  3BQY A;  2VUM J;  1JKQ C;  2YUS A;  5M5Y J;  2WV1 A;  1EF4 A;  2VKE A;  4DYQ A;  3HOX J;  3GTK J;  5M5W J;  1H88 C;  1BJZ A;  2I10 A;  4B1R A;  3HDD A;  1T33 A;  1OJL A;  1X2N A;  5IP9 J;  4MIM A;  2XPU A;  3HOY J;  1IDZ A;  2YS9 A;  2HDD A;  4W97 A;  3BR5 A;  5IOZ A;  3JRH A;  2CQX A;  1OCT C;  5EZH A;  4BBS J;  3BTL A;  2Y31 A;  1APL C;  2IBD A;  4MLO A;  2DA3 A;  3ZQL A;  4IHY A;  4A3D J;  2CJJ A;  1LE8 B;  1JTY A;  4X6A J;  1VND A;  1GV5 A;  3HBL A;  2LKX A;  4DZP A;  1P7J A;  4D7M A;  5IYB J;  4FCY A;  3BR1 A;  1H89 C;  1ZR4 A;  1JUP A;  3MKL A;  1RR7 A;  1O4X A;  3PO3 J;  4V2G A;  1IC8 A;  4A3I J;  4FIS A;  2JWT A;  2NVX J;  3HOW J;  3HOV J;  1ETQ A;  1JKP C;  3HB9 A;  2DA5 A;  4C3J J;  3HM5 A;  1IV6 A;  2MSY A;  2EZK A;  2X6O A;  2GBY A;  3OSG A;  1WPK A;  1JKR C;  4BBR J;  5FKM A;  2EQR A;  4A93 J;  2M34 A;  4NDL A;  1FJL A;  2WB1 N;  2VKV A;  3OIO A;  4AUX A;  2HXO A;  1TWC J;  1U8B A;  1IUF A;  2XRL A;  3K2A A;  3UKG A;  1AHD P;  3S1M J;  1WH7 A;  4A3C J;  2DN0 A;  1HCR A;  2DA7 A;  2TRT A;  2CQQ A;  2GLO A;  1FIP A;  2E19 A;  2LK2 A;  3GTJ J;  2AO9 A;  3S17 J;  3BQZ A;  2DMQ A;  1ETX A;  4DZJ A;  4A3K J;  3SFI A;  2R0Q C;  1MSF C;  5FKL A;  2CUF A;  2Y0S N;  4XRS A;  2XGD A;  2G0E A;  3IH3 A;  3ZQG A;  4DW6 A;  5E3O A;  2W48 A;  3WHC A;  5FJ8 J;  5J1Y A;  1MNM C;  4FE7 A;  5EGO A;  2MW8 A;  3QPS A;  1U9O A;  3ZQI A;  1GV2 A;  3ZQH A;  1IRZ A;  5F04 A;  1JT6 A;  2ZB9 A;  2NVY J;  3MVP A;  3JRE A;  4I6Z A;  1MBJ A;  4Y7N J;  2L9R A;  2O9L A;  4BKX A;  1VF9 A;  1HDD C;  3RZD J;  4C2M J;  2NVQ J;  3GTQ J;  2ME6 A;  2ECB A;  4UUS A;  4DYC A;  1R9T J;  1ETK A;  3O8G A;  1RKW A;  1K83 J;  2FD5 A;  1FEX A;  1UMQ A;  3HOZ J;  4I76 A;  2HXI A;  3G1L A;  4UUT A;  2L0K A;  3B6A A;  1MBG A;  5GPC A;  4JYK A;  4XRM A;  5EG0 A;  3K7A J;  4C3H J;  5EEA A;  1ZR2 A;  2HOT A;  3GTM J;  3FIW A;  3HGY A;  4MFD A;  5HOD A;  2GM4 A;  3Q0V A;  5FLM J;  4M3G A;  4M3D A;  4JX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...