2N8GA

Nmr structure of the homeodomain transcription factor gbx1[e23r,r58e] from homo sapiens
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
GAPGGKSRRRRTAFTSEQLLELRKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNERAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the homeodomain transcription factor Gbx1[E23R,R58E] from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Homeobox protein GBX-1
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2n8gA00
5IYCJ 5IOZA 2K9NA 2E19A 1W0TA 5EGOA 4DZPA 1TWAJ 1ENHA 2P81A 3RQIA 5EF6A 2VUMJ 4FTHA 2TCTA 3DCFA 2JWTA 1JJ8C 1ETQA 4MFDA 3RZDJ 4DYRA 1XS9A 1MBEA 3S2DJ 1RKTA 4NDLA 2EZLA 2XGCA 2DN0A 3IH3A 1Y1VJ 2Y2ZA 2DTZA 4BY1J 1LE8A 3OSGA 5E3OA 3ZQIA 2LFBA 4XRSA 2WAQN 5E3LA 2L7FP 5IPAA 2E2HJ 5JLXA 2OPTA 4C3IJ 3ZQLA 4HNVA 4B1RA 2DA6A 3S1MJ 4MLOA 4XRSG 3B6AA 4C3HJ 4RBOA 1JUSA 2HXOA 4XK4A 4BXXJ 5EZHA 1MBJA 5FKNA 1IRZA 3HOYJ 1ETXA 2LLKA 4M3GA 1GUUA 2EZHA 5J1RA 2YS9A 3GBGA 2DA7A 1WGXA 5IYBJ 3ZQCA 5FJ8J 2CQXA 2JA8J 2R5ZA 2CU7A 5EG0A 1ZR2A 3PO3J 5DTDA 4ABZA 1QVTA 4MFEA 3TEDA 1JT0A 2VPRA 4BKXA 5M3FJ 1G2HA 1A5JA 2JMWA 1F43A 1TWFJ 2WB1N 2RAEA 1IDYA 1EF4A 1NK3P 2KT0A 1U9NA 2N8GA 1BW6A 4A3CJ 4A3KJ 3BR2A 4JP0A 3TP0A 5E3MA 2Y9YA 4C3JJ 1LFUP 1B72A 1X58A 3GTKJ 4FE4A 2FQ4A 3S15J 3TP3A 2CJJA 2H1KA 2XGEA 3K7AJ 1JUPA 1Q1VA 5GP9A 1VFCA 2OF7A 2O8KA 1A6IA 2MG4A 1PUFA 4LOCA 1JGGA 5J1UA 2CRGA 3ZQGA 2X6OA 4XRMA 4BBRJ 4QSHA 3QPSA 1GVDA 2CUEA 2LVSA 4FE7A 4QIWN 1ZKGA 3H0GJ 3ZOBA 4IEJA 3LSRA 2AO9A 2VI6A 2JK3A 3SFIA 4IHXA 3JRBA 2I10A 4J19A 1MH4A 2O7OA 5J1YA 5F0FA 3BTLA 5IP9J 2KDZA 3BR3A 2E1OA 3WHBA 2X48A 1NTCA 3OIOA 5M5WJ 2DA1A 2DMUA 1OCPA 1MSEC 3BTJA 1JT6A 1SFOJ 2ECBA 3S16J 1IGNA 5EDNA 4QTRA 2WV1A 1BA5A 5C44J 3K2AA 4XICA 1GV5A 4D5FA 4A3IJ 3H3VK 5K7FA 2Y9ZA 4V2FA 2HXIA 2XPWA 5FKMA 1LFBA 1ORKA 1DU6A 1WPKA 2QCOA 2R7ZJ 2K9QA 3S1QJ 2GLOA 2XB5A 1IDZA 1IG7A 1OCTC 2FJ1A 3I4MJ 2HOAA 2XSDC 1Z77A 4JX5A 3C2BA 2X9DA 2JA5J 3BTIA 4RDUA 2YU9J 2DMNA 2DA4A 2M0CA 5DS9A 2Y0SN 2DA2A 1OFCX 1P7IA 2R5YB 5HODA 3JR9A 1GDTA 2LK2A 4MIMA 4M3BA 5EGOB 1MSFC 3HBLA 1BJZA 3TW7A 4JX4A 5EZGA 3MVPA 5C4JJ 3O8HA 1AHDP 3G1MA 3BQZA 1ZGWA 2E2IJ 3GTLJ 4UUTA 5M5XJ 4A3DJ 3HOUJ 3GTMJ 5EYRA 5IOYA 2EZKA 4A3EJ 3HOVJ 3ZQFA 3Q0WA 4MO7A 3MKLA 3D1NI 5F04A 4A3JJ 1I3QJ 1MBKA 1B8IA 5E3NA 1AU7A 1F36A 1ETVA 4BY7J 2EBIA 2LP0A 1U78A 2HOTA 2DA5A 1LE8B 2JA7J 1HDDC 3A03A 4A3BJ 1XC5A 5FKLA 5F27A 3BR1A 3VPRA 3SJMA 1RKWA 1MNMC 2XPUA 2COBA 1GT0C 1JTYA 4L5EA 4I6ZA 3TW6A 2HI3A 2EH3A 1RETA 3NAUA 3LNQA 1Z0XA 1ETOA 2D5VA 3S14J 3Q3SA 3LSGA 1I6HJ 1VI0A 3BT9A 4AUXA 1ITYA 2ID3A 2L9RA 1TWHJ 3A02A 3F0CA 1FIAA 2IAIA 4B3AA 4W97A 1B72B 5GPCA 4FCYA 2LKXA 2HOSA 1HCRA 4DYQA 1ETWA 2M8GX 2M34A 2L7MP 1BW5A 2MSYA 3BR5A 5JLWA 1BL0A 1JKPC 5FKOA 1UHSA 3I4NJ 2R5ZB 1MBGA 5FKKA 4A3MJ 5J3LA 1QRYA 5IP7J 3JRHA 3LOCA 4G12A 4A69C 4IHWA 4D7NA 1T33A 2NS8A 3IV5A 3JREA 1E3OC 4DW6A 2NOGA 3GTJJ 3WHCA 2R5YA 1JJ6C 5FLVA 3CDLA 1IV6A 1YRNA 1VNDA 3O8GA 2G0EA 3JRAA 3SDGA 3CCYA 1XG1A 3S17J 1WCMJ 1IC8A 2HQ5A 3GTOJ 2IBDA 2MGQA 1FJLA 4A3LJ 3BG9A 3CMYA 1IUFA 1X2NA 2XGDA 2AHQA 2ELKA 3FISA 2R0QC 1RR7A 1HF0A 1NK2P 3DEWA 4A93J 3FK7A 3M4OJ 1ZK8A 1D5YA 2NVXJ 1I50J 1P7JA 4M3FA 2DMQA 3HM5A 3S1RJ 1WH5A 4D5CA 1ETKA 4D7MA 2NVQJ 5F1JA 4JX6A 3CQZJ 5C4XJ 2XB0X 4S0HB 5M5YJ 1POGA 2YUSA 2K40A 2TRTA 1ZR4A 4BBSJ 3Q0VA 1UG2A 5F08A 2GM4A 4CYCB 1MBFA 2VKVA 3IH4A 3GTPJ 5C3EJ 2XRLA 5F0CA 1H89C 3W6VA 1YRNB 3S2HJ 1FTZA 2EZIA 1ZQ3P 5F0HA 3A01A 4UUSA 2M9HA 2CUFA 4EEFG 3BTCA 2GBYA 5M3MJ 4X6AJ 2HDDA 3GTGJ 2DA3A 3S1NJ 4DZJA 3FKIJ 1GV2A 3BQYA 4M3DA 1MH3A 3JRDA 1S7EA 1X2MA 2L7ZA 3NARA 4M3EA 4V2GA 3QPLA 2NVTJ 2HYJA 3RKQA 1B8IB 1APLC 1IJWC 1FIPA 2CQQA 3PM1A 1FTTA 3HDDA 1TWGJ 5IP6A 2FX0A 2Y30A 5EEAA 2JJ7A 4GFBA 3GTQJ 4UUSB 2MW8A 3OSFA 4A3GJ 2R93J 2QF7A 4B4CA 1U8BA 1H88C 4FISA 3LSPA 4M6VA 1WI3A 2R92J 3Q0UA 4JYKA 3MN2A 2W48A 2L0KA 2M2EA 3FK6A 1JTXA 1OJLA 2ECCA 1JKRC 5IYDJ 5EG0B 4I76A 1VF9A 2DJNA 3BG3A 3LSJA 2DMPA 3JRCA 2H8RA 2JA6J 2B63J 3HKZN 4CYCA 2LD5A 1ETYA 2ME0A 3HOXJ 2EQRA 1R9TJ 5BNGA 2Y31A 1CQTA 1W0UA 3A01B 1QVUA 3PO2J 5K7ZA 3G1LA 4AC0A 4AYBN 3BR6A 2O9LA 3M3YJ 3HOWJ 3BR0A 1ZTRA 1U9OA 2VKEA 1JKOC 1HDPA 2E2JJ 4W1UA 2LR8A 1MBHA 3B6CA 3HEFA 3BG5A 4X1EA 1Y1WJ 1HLVA 3HOZJ 1RESA 3L1PA 2LY9A 1UMQA 3JRGA 9ANTA 3E7LA 3UKGA 1RPWA 3HGYA 3OOUA 4XIDA 5GPAA 2FD5A 1PUFB 2NS7A 3RZOJ 2IEKA 2ID6A 2NVYJ 4Y7NJ 2ME6A 2K9SA 1O4XA 3JRFA 1H8AC 1FEXA 5K7HA 4A3FJ 3FIWA 4IHVA 5FLMJ 1HOMA 1SANA 2PMZN 1WH7A 2XPVA 3QQAA 1DU0A 4Y52J 2JN6A 3JRIA 1AKHB 3G1OA 2LTPA 3ZQHA 2DMTA 3HGGA 2ZB9A 4IHYA 1JUMA 1TWCJ 4C2MJ 1AKHA 1JKQC 1TC3C 1K61A 1K83J 3HB9A 4DYCA 1T56A 1QPIA 3IH2A
chains in the Genus database with same CATH superfamily
3H92A 5HNFA 1W0TA 5HLTA 4OOIA 5EF6A 1EA3A 3FXKA 4GCVA 2RVCA 4Q48A 4FTHA 2VUMJ 4FX4A 4MFDA 3SFZA 2DXIA 3TQNA 2KIMA 4U88A 4AWXB 1LUJB 2DFIA 1DDNA 2K3PA 3IH3A 2VXDA 1FOXA 1Y1VJ 2DYSH 1TQPA 2DTZA 1YIOA 4BY1J 1LE8A 3WU1B 4PJNA 1J09A 4XRSA 5E3LA 3N05A 2M0MA 5IPAA 2E2HJ 3ZQLA 4HA8A 5EEGA 4WCGA 3IKVA 3B6AA 1Y6IA 3DV8A 4RBOA 2LC2A 2HYFA 2L9NA 4HQMA 2TDXA 3J7ZI 5DD8A 3TMOA 1YG2A 3CCJI 4HLYA 5TRDA 5KK1A 3UR3C 1D1CA 3BPVA 1WKMA 1O57A 2LLKA 2IS6A 4HX8A 1MJBA 4L9NA 2QVOA 2V1XA 1MMDA 4FHTA 2CQXA 4YFNF 1B6AA 2R5ZA 2ETHA 5EG0A 1W1WE 3MD2A 3WTVC 2HWVA 2WAQA 3HTUA 5FLXK 2VPRA 1VQ6I 1Z6RA 3KP6A 1A5JA 2KDOA 1OMIA 2IGMA 3P7NA 2WB1N 2Z16A 2RAEA 4IQJA 3LFUA 1NK3P 3MZ8A 5LBQA 2KT0A 4B44A 1F1ZA 4II3A 3H9QA 3CUQC 1BW6A 4A3CJ 2BY2A 5D4SA 4CCOA 1Z05A 5E8IA 2DPUA 4A3KJ 1O3SA 3TP0A 2Y9YA 1MDMB 1LFUP 1KU2A 1X58A 3E1SA 5TISC 3GTKJ 3T1BA 3IWZA 1WQ2A 2FQ4A 4AD9A 2CJJA 2QSHX 2K9LA 3H9JA 3K7AJ 2VJ4A 1Z9CA 2ZJ2A 5CQGA 1Q1VA 2J5OA 3DKXA 2XSJC 2E60A 3DP7A 4I98B 2OF7A 4CZCA 3IL2A 4UVBA 2CSOA 2MG4A 3ONQA 1PUFA 4OIPF 1D5VA 2CRGA 4QSHA 3K4NA 1IN6A 3B02A 3QPSA 2NRAC 1GVDA 2LVSA 1ZKGA 4IEJA 2FA5A 4KJZA 1LB2A 2ZJPF 2OCEA 3K1PA 5E1XA 3JRBA 1WJAA 1NHAA 2O7OA 3EYYA 5FB2A 1QGPA 5J1YA 2X85A 1CGPA 3BTLA 2E1OA 3CMMA 3WHBA 4BEHB 2F5FA 2EV5A 4E7IA 5M5WJ 2DA1A 2RREA 4XONA 1J59A 3GEZA 1SFUA 1KA8A 4HPQA 1MNDA 4KICA 3BJAA 4YFXF 1JT6A 1DGRM 3S16J 3EQLF 4RB0A 1ULYA 2HOEA 2DLLA 4DIQA 4YRVA 3KYLA 2GXBA 3ZGKA 3C1DA 4P9UA 1GV5A 3ZMSA 4A3IJ 4L0YB 5BOXA 2HPMA 1G3YA 2EFOA 2L9VA 3HSFA 2CV1A 2R7UA 3K2ZA 5ILSA 2EK5A 3V8LA 3DF8A 1VQLI 1N75A 2LREA 3OYAA 1IW7F 1IG7A 2K86A 1FSEA 1Z77A 2XRNA 2X9DA 3C2BA 1K6OA 2DFEA 2E71A 1BI2A 2DA2A 4PCQA 2R5YB 5BMZA 2E5ZA 4NUBA 3V7RA 3A1YA 2VQLA 2LF7A 2WADA 4EGYA 1HKQA 5B5EC 3O8HA 1AHDP 3GWZA 3W2AA 2VODA 3MZYA 3JTGA 5DDGA 3S32A 4MGRA 1DP3A 1N78A 2HGCA 3T5XA 3ERMA 5EYRA 4GGGA 3HTSB 2B9SA 1LDKB 3EPZA 2ADUA 2NOJB 4ZYDA 2HTJA 1SAUA 4A3EJ 2AQFA 2V7FA 2VT2A 3Q0WA 3HUGA 3D1NI 2RNGA 3O2PE 1X1PA 4GYIA 5A2QK 2XF7A 4A3JJ 3HZJA 3SHFA 4RB1A 3CZ6A 3PFYA 3QU6A 5AONA 3KYDB 4BY7J 2F4MB 4GO1A 5DUKA 1MJAA 3E6BA 4P1WA 1Y56A 2M30A 4NNJA 3QRFF 1HDDC 3A2KA 3ESWB 4L9JA 1L0OC 4BS9A 1XMKA 3D5RC 5DYMA 2EFWA 2W1OA 1SEUA 2ELJA 1MMSA 1RKWA 5CVIA 3RYPA 1J75A 2COBA 4M72A 4LK0F 4ENMA 3L2WA 1VQ8I 1V5FA 3K4JA 4M71A 2EH3A 2YPRA 2WWYA 1A04A 4EM1A 1ETOA 3L2VA 3FXLA 1WRJA 2NVUB 2ZNZA 1SFXA 3GF2A 1P4AA 3BT9A 3T8TA 4YG2F 2ID3A 1FOYA 1TWHJ 3A02A 5FLXZ 3F0CA 1ONVA 2HQNA 2OAZA 2L01A 5GPCA 4DYQA 2L7MP 1J0RA 2Y75A 1T0FA 3U21A 1BW5A 3VOEA 2EINH 2DW4A 5CVRA 2AXLA 1JKPC 2QQ9A 3I4NJ 3OYCA 3OY9A 2JUGA 1JE8A 3ABUA 2O5RA 2F5EA 1ZN2A 2PMUA 1Y0UA 5FKKA 5LRRA 4CCKA 3JCUC 3LOCA 1ZYRF 2FNPA 1KZHA 2Z2SB 2EIKH 3JREA 5FD6A 3OYLA 2NOGA 4U7DA 3FXRA 4N4OB 1BOBA 1S72I 5IT9K 3HUGB 1JJ6C 1HA8A 2ZJRF 5FLVA 1T98A 1IV6A 2OUMA 2QKLB 3HHHA 2FE3A 3G6EI 1LEAA 2F4IA 2VIXA 3CCEI 2G0EA 3H36A 1IN5A 3RJPA 3K70C 1P92A 1IC8A 1HSTA 3G2BA 2P5VA 4P9FA 4BQAA 1FSHA 2MGQA 2ZJQF 1FJLA 2JZYA 4B8XA 4I01A 1X2NA 2XGDA 2AHQA 2ELKA 3HIFA 2R0QC 1RR7A 1NK2P 3ULQB 4A5NA 3M4OJ 1ZK8A 4XR6A 2CGPA 4M9ZA 4MEYF 3ZR8X 1P7JA 3W6JB 5J40A 1X3ZB 3OL3A 4C30A 4D5CA 3ZN0A 3A0HC 1EV7A 1OCOH 2FBIA 4D7MA 3REOA 1BC7C 3OYEA 4XKVA 1S29A 2M5WA 2LKPA 4LGWA 4DQ2A 3OS1A 1YI2I 4KN7X 3GYHX 2OZUA 4Z2YA 2KRHA 4E7KA 3GFLA 3GFMA 5C3EJ 3F23A 4HYEA 4RLQA 1H89C 3W6VA 4PDKA 1D3YA 1LNWA 2VE9A 5F0HA 3JSPA 2KIUA 1FOWA 4IHTA 4HRIA 1LPQA 4NC7A 2CUFA 2KL4A 5BPDA 3I56I 4QWQA 4ESFA 1Y8RB 4EEFG 5IT9Z 4M6YA 1OCRH 1ZGJA 4UNOA 4NC8A 2C6YA 4S05A 2MABA 4RGUA 2F48A 2UWMA 1MH3A 3JRDA 2K4BA 3NARA 4ZH4F 2XC7A 5JVGF 4ENNA 5HDKA 2PQ8A 1MMNA 2HTSA 1FNNA 1XMXA 2STWA 3FHZA 1B8IB 1X19A 2M4KA 1APLC 2E1MC 4CDGA 5K5QA 1IJWC 2NNNA 2CQQA 3G3ZA 4BEHA 1SVOA 3S3OA 1FTTA 3CJTB 2M4GA 1QZYA 5B3SH 1OISA 4LJZF 5E1ZB 2FX0A 4BQOA 2O03A 1EKEA 2JJ7A 4GFBA 4FQGA 2ZXIA 1D1AA 4WF2A 3GTQJ 1UZCA 3GZ5A 3EETA 4A3GJ 2EPFA 3CCVI 1U8BA 1H88C 3J81Z 3BP8A 3GZ6A 4JYKA 3MN2A 1OJLA 4CXFA 3G71I 1PVEA 1JKRC 1MD0A 2OD5A 3H5AA 5EG0B 1UFMA 2DJNA 2VJJA 4I76A 3WTZA 1YITI 1RRJA 1ZREA 3HKZN 4CYCA 1U5TB 1ETYA 4ANJA 2P7VB 2Y0MA 4N0BA 3PQKA 3SEZA 4EJOA 2L2OA 1UAAA 3OYHA 1DGWY 2QBYA 2X6YA 3PO2J 2Y48A 4ENJA 2CMPA 3HOWJ 1IXCA 3Q9VA 4QPQA 1B9MA 3V8JA 3OYFA 2M1BA 1XD7A 4XN3A 3VB2A 4C2UA 1Y1WJ 2DU9A 3QPHA 1OR7A 3DU5A 4XL9A 3HOZJ 3DKWA 4NQWB 1QQIA 3EUAA 3IP4B 5E8GA 2GA1A 1ZG3A 4BJ5C 4XN0A 5ICCA 4DJAA 2YR2A 4UHTA 2K27A 5H2FC 1K4TA 3GCMA 4BJ6C 4AVPA 2R7WA 2NAZA 2IEKA 5B1AH 4KN4X 1KU7A 3L2RA 2ID6A 2ME6A 1TQMA 2K9SA 2L5QA 2V1UA 1O4XA 4LLNA 3ZN1A 2OBPA 3RTRA 3WTSC 1H8AC 1KU9A 3H3ZA 4A3FJ 2OCCH 2ESNA 1MZBA 5FLMJ 2Z99A 1HOMA 4XSXF 3QQAA 1EJ9A 4BGDA 2JN6A 3JRIA 4LIVA 2CV0A 5BPIA 3G1OA 3DQVC 2ZB9A 2CO5A 5L3GA 1TWCJ 3L2UA 1R23A 3CJRB 2DK5A 2GQQA 1JKQC 1TTYA 3WGHA 1AKHA 1E17A 2M7BA 4C9YA 1SC7A 2HEOA 2MA3A 2RC4A 1QPIA 3IH2A 4GDFA 1X1DA 1YJNI 2K9NA 2E19A 5EGOA 1TWAJ 4AIHA 5HOOA 5BQTA 3BDDA 3RQIA 3IUOA 2MH9A 4F3QA 4F52A 3DCFA 3Q9SA 1WI9A 1ETQA 2KRFA 3RZDJ 4DYRA 2W7NA 1XS9A 2HYGD 1I39A 1MBEA 3KP3A 3DU6A 3S2DJ 3WTUC 2MYSA 3E5QA 3F8MA 2EZLA 1FOKA 1GHCA 1F5TA 1XDUA 2L4MA 4YELA 4RAZA 5GTHC 1YS7A 2VKDA 2YX7A 3OSGA 4RB3C 3PSIA 2LFBA 4MQVA 4BE1A 3TO6A 2LG4A 2L7FP 4TV7A 2EJRA 1P9QC 3S1MJ 3IKTA 1IXSB 4C3HJ 2F5CA 5DUIA 3AKZA 4G7OF 3BLYA 2HXOA 3PNTA 4XK4A 1HW1A 3L2QA 1ZH5A 2ACJA 4BXXJ 4KITB 5ICFA 2DQRA 4OIOF 2E1CA 3R6SA 1MBJA 3K9TA 4A6EA 1IRZA 3JTHA 3HOYJ 2DPDA 1O3QA 2BW3A 3LFKA 1GUUA 1YX5A 3CLQA 2FMLA 3GBGA 4KDPA 2AQEA 2JRMA 3ZQCA 2PG4A 3GFJA 5GAGJ 2CU7A 4DNCA 2F4OB 3O3KA 4HG2A 1QVTA 1S3JA 2VJ5A 3ZRGA 3TEDA 1JT0A 1G2HA 1SVMA 5JHUA 3CUOA 1F43A 1TWFJ 1BJAA 3ERED 2PJRA 2L3DA 5CPRB 4PJLA 3K69A 1R4NB 3DFGA 3I58A 4HQEA 1R58A 4C3JJ 1E3HA 1B72A 5DCMB 1A6QA 2KHMA 4FE4A 5FRNA 3TP3A 3I71A 2WBMA 1J5YA 2COMA 2H6BA 5TJJA 2Z33A 1KYZA 2X1EA 1D8JA 1JUPA 5D5VB 1XSXA 1G4DA 2HKXA 3MQ0A 5FD5A 2P6SA 2O8KA 3IHUA 1MW7A 2YSRA 4NBQA 3FXJA 3S93A 4XRMA 2QWWA 1RUNA 2A07F 4QIWN 2Z1DA 2AO9A 4H0EA 1UB9A 2DT6A 3SFIA 3J80Z 2X1CA 1OYWA 5A2QZ 4HF2A 1MH4A 2DYRH 4AIDA 4V19K 1BI0A 4ZZLA 5IP9J 3EUHA 2QQAA 2MFZA 3TKYA 2E35A 3AL0B 1NTCA 3HPHA 1QA6A 1Z3YA 3CDIA 3I64A 5HS7A 3TOBA 1SFOJ 2ECBA 2Z9OA 5EDNA 3ROUA 4IOCF 3FM5A 1BA5A 1Q1HA 5LHHA 2EB7A 3K2AA 2PI0A 4P55A 4D5FA 1T2KA 5K7FA 3H3VK 2VB6A 3VODA 3MZHA 3CUQB 5D6EA 1DU6A 1JXSA 1WPKA 2HU9A 4CO8A 1FP1D 2XAQA 2R7ZJ 3S1QJ 1J9IA 5LGTA 2FJ1A 2ZXJA 4G94A 1OCTC 2Q1ZB 4RAGA 5JI6A 4OAZA 2DA4A 2ZSHB 1T95A 4ZDOA 5J8CA 3KE2A 3OL4A 1OFCX 1P7IA 3CF5F 1WZ2A 2DODA 3K1NA 3JR9A 1GDTA 3M7GA 3HSRA 3RSNA 2LK2A 1OYYA 1UHMA 2VL8A 5DCMA 4M3BA 4F91B 2VJIA 3HBLA 5L3BA 3TW7A 4IOAF 3MVPA 2FBKA 2Q0OA 2D1HA 4FASD 4LMYA 3G1MA 1ZGAA 2ICWG 2E2IJ 1VZ0A 4MQ9F 4YIIA 1MMAA 4UUTA 5CJ9A 2A05A 1FP2A 4PJMA 3HOUJ 3V7SA 3GTMJ 5DV5A 4Y33A 1K4SA 1MIJA 2EZKA 4ITVA 5LEJA 1XPXA 4AYBA 3OYDA 4Q5SF 3ZQFA 5BS6A 4MO7A 4IO9F 4ZYHA 4CA0A 4G9YA 4KIGA 4EM2A 4LK1F 1YIJI 2UV1A 3DLLF 1I3QJ 3HRSA 4PJJA 5L3CA 1ETVA 3I3LA 1H9TA 1O3TA 3CCRI 4IKFA 3HRTA 2CUJA 2LP0A 4RM3A 1O3RA 1TW3A 2P6TA 2A5YB 2QUFA 5J4VA 1WFXA 4HDVA 1U78A 4B47A 2X6WA 3A03A 2Q2EA 4KIBA 5FKLA 3BR1A 3HG9A 2EA2A 3VPRA 3SDBA 4AU7A 3FDYA 3QYFA 3SQNA 4IRHA 1O7FA 1ERDA 1KYWA 2HVRA 1Z0XA 5KNLA 1YO5C 3P9KA 3Q3SA 2BGCA 1BIBA 2IT0A 1T6SA 1G8XA 2VBYA 4ON0A 2HQRA 3LAPA 1R6RA 2MD5A 5D4RA 1WJBA 3CCLI 2A5WA 4B3AA 4W97A 2GXGA 1LDJA 2KRCA 1R1TA 1HCRA 3H1CA 1YHQI 4LG0B 3E3VA 1XGSA 3OV8A 3BR5A 1BL0A 4XRFA 1I27A 3P9IA 5D5XB 5FKOA 2DQLA 2WAFA 2EIJH 1ON2A 5AIPA 3TO7A 2R5ZB 1YW8A 2VOOA 4HEA2 4L9VA 1MMGA 3M8FA 3E6DA 4G12A 3CCSI 3E0JB 4A69C 2VONA 2XAGA 3Q5FA 3PNVA 2VE8A 3IV5A 5FGMA 1FY7A 4CZZA 4P96A 1E3OC 3RQ4A 4CYDA 4I0AA 3BPXA 2P7CB 1STZA 1QU3A 1YS6A 3WHCA 2QA4I 4XQFA 4CSWA 1B9NA 4HV5A 4KT5C 1PP8F 2FU4A 3O8GA 2UXXA 1OPCA 2XUBA 5FFZA 3ZMVA 3S17J 4ZC3A 3SEQA 2CQNA 2UXNA 3OYMA 4H4KC 4A3LJ 1Y8QB 1IUFA 5LHIA 5E1WA 5TGTA 3ECOA 5LHGA 1SD6A 1HF0A 3DEWA 1SD4A 3EYIA 3LSMA 1D5YA 2NVXJ 1I50J 2W4SA 2DMQA 4E6KG 4LB6B 3WTTC 4BACA 2P4WA 2BEOA 2MLGA 3OS2A 2PEXA 4AIJA 4BXFA 3CQZJ 5C4XJ 4IVNA 1WJCA 3CO7C 4S0HB 2G7HA 1VQNI 5M5YJ 3LSTA 2PJRB 2DOEA 1V5EA 3ZMTA 2TRTA 2JVGA 3VDXA 5KVRA 2ZMEA 2F2EA 1UG2A 1FPQA 1QPMA 2XF5A 2GM4A 5DD4A 2FBHA 2FRHA 1MBFA 2VKVA 3IH4A 3GTPJ 3TGNA 2XRLA 1FTZA 2R7OA 1VQOI 3FMSA 1LJ9A 3KLNA 4N9HA 1O7LA 4HAMA 3OYGA 1IRGA 1S9HA 4EGZA 3GZNB 3N97A 1G3WA 3H9GA 1S7OA 1HSJA 2Y0SA 4HZFA 2VOPA 1TZLA 1N77A 2R3SA 5LGNA 3F22A 2GBYA 4PFOA 3C18A 2IPQX 4B09A 1JHHA 2DA3A 3S1NJ 1K78B 2KISA 1GV2A 1IRFA 1X2MA 2KFDA 3MCZA 3F8FA 3DKYA 1RNLA 1W4MA 2A6HF 2IXSA 1USTA 4KIFA 2ISZA 3BCAA 4EQQA 3F3XA 4I2OA 1XSVA 2XROA 4IHSA 2I5UA 3LL7A 1Z91A 2LBFB 4M73A 5IP6A 2XAJA 2LMDA 2Y30A 2LYCA 2XIGA 4BHPA 2R93J 2MC3A 2VN2A 3I9V2 3LSPA 4PSXA 1WI3A 2DDBA 3AG4H 4IJAA 2L9SA 3Q0UA 1BR4A 4JQFA 3AL0C 3FMQA 1MNEA 2M2EA 2VQCA 5EEHA 1JTXA 1WHUA 2E1MB 2ECCA 2FOWA 4F7ZA 3K0LA 1QHHD 1LFPA 3QP5A 3DTKA 3HXLA 4A6DA 2CUZA 2OA4A 2ZSIB 3MFKA 3BG3A 3LSJA 1SFEA 4EJUA 3JRCA 2JA6J 1FYKA 3CC4I 4OWRB 2VBXA 1F4KA 2ME0A 1W7PD 3WGGA 4D1QA 4KA4A 3R61A 3LAJA 2LY2A 2LH9A 2W24A 4LIUA 1R9TJ 2BYVE 2O0YA 2QLZA 5ED4A 1V54H 1JGSA 4Q4ZF 3K4CA 1QVUA 3F6OA 1T8IA 1X4OA 2G7UA 1AA7A 2LY1A 1UG0A 3VSKA 1U9OA 1RR8C 3FXOA 4EATA 4HX4A 1IUYA 5FROA 1JKOC 1MBHA 3PFIA 3OIPA 4CUGA 3CMEI 3V7CA 1R4MB 3BWGA 3F8BA 3KZYA 2EIMH 1XDSA 1R36A 3HSEA 3RCOA 2QGUA 1V4RA 4UV9A 3GO5A 5ILVA 2LY9A 1P6RA 2V1DA 1BOAA 1BR2A 2FXAA 2UUZA 2CFOA 3JRGA 3WU0A 1R71A 9ANTA 1LEBA 2L7KA 4EJWA 1QO0D 1QBJA 4JOMA 2P5KA 2DT7B 5GPAA 3G4SI 4RGSA 2FD5A 3W6KB 2W25A 2VPLA 4Z6YA 2PX9A 2LBFA 4Y7NJ 4WXHA 2B7EA 1E0EA 1XGMA 5DM6F 5D8KB 2NXNB 3NQOA 5J8FA 2K02A 5CVJA 4LLGF 3RPQA 2WB1A 1FEXA 5K7HA 4LB5A 3AAFA 1SANA 1SFKA 1WH7A 1V5GA 2IA0A 2CYYA 2IGOA 2KZVA 3ZMDA 4DBQA 2JA2A 3KETA 2LTPA 3ZQHA 2DMTA 4D0PA 3GFIA 4A12A 4XNFA 1S8NA 3S3MA 2AXTC 4OMYA 1K83J 3GMEA 4LLLA 4ENKA 2JUCA 3DPLC 1D0XA 1PDNC 1YFHA 2P81A 3QYBA 1PYVA 3PL8A 4XKWA 4CCMA 2JWTA 2VBWA 4XLAA 1JJ8C 3U2RA 3LSHA 1XMAA 2BE5F 1V55H 1YTYA 1RKTA 3F8CA 5HDNA 2CQKA 2XGCA 5K5RA 2DN0A 1SMYF 3CF2A 4OAYA 3IWFA 4AVZA 5K5OA 4O5VA 5E3OA 2VQHA 1FYMA 2WAQN 1K78A 5JLXA 2OPTA 4C3IJ 4HNVA 2DA6A 3FM3A 2A3SA 2ELHA 4I99C 1JUSA 3WE2A 1KGSA 3VSLA 2FEZA 5EZHA 5FKNA 4BXUA 4CICA 1ETXA 1U3EM 2EZHA 3M1CA 5J1RA 2DA7A 1HBXG 1WGXA 5IYBJ 2A68F 4J00A 3HKZA 3V8KA 3PO3J 2GXAA 5DTDA 2KZGA 4IL6C 3TDUC 5ERIA 4ABZA 3M07A 4L18B 2EV0A 3IRQA 2R7FA 4BKXA 5L3EA 4RAFA 1X4PA 3KPHA 3HOTA 3E5UA 3GX4X 1BM9A 1TW2A 4HW0A 4ZDLA 1J2XA 1EF4A 2LDUA 3E5XA 1QNTA 1TBXA 1MGTA 4UVCA 4EMSA 3KP7A 5D6FA 1TT0A 1YQAA 3JAMZ 4I0BA 2IRFG 3BR2A 4JP0A 5E3MA 3CC2I 3JAMK 1IAWA 3LQRA 2XHKA 2M8EA 5AIQA 1XSDA 3WODF 2H1KA 2V9KA 3D0SA 3HHGA 1I1SA 4OU0A 1VFCA 5GP9A 3RI4A 1QZEA 4WXDA 2HVQA 1JGGA 4NHJA 3P5JA 1VQ9I 3ELKA 3DTEA 1DP7P 1BBYA 3PNYA 4FE7A 2BHZA 3H0GJ 3ZOBA 5GAHJ 3LSRA 2W85A 3RYRA 2VI6A 2Z5UA 2JK3A 5LLQA 2I10A 4J19A 5HDGA 1U5TA 2BOLA 5HLIA 3QOEA 5DCFA 1SD5A 2KDZA 1OYIA 3BR3A 2VC1A 1ZG5A 3U9GA 1VQ4I 4KFCA 3OIOA 4ESBA 1FLIA 2V6CA 1RZ4A 4GRIA 1ZRDA 3ASOH 5EJCA 3HOSA 1K6YA 1MSEC 2GOXB 3BTJA 1Y0NA 2E34A 4N4NB 1LQ1A 5GTIC 4QTRA 3FBNB 2DK8A 2H1LA 5C44J 2XKPA 2WTEA 4F55A 4XICA 2BV6A 1E2XA 5J6XA 3FZVA 4KNYA 2Y9ZA 3FWEA 3BZKA 1LFBA 2K85A 2QQBA 2KMUA 3DEUA 2QCOA 1QZZA 2K9QA 3KZZA 2GLOA 2XB5A 2DBBA 4J01A 3DWLE 1IDZA 3FKJA 3WGIA 3I4MJ 2CW7A 4JX5A 2K5CA 1ZHFA 3VYTB 3BTIA 2MD0A 1TNSA 4RDUA 2YU9J 4HX7A 4QLCU 1RUOA 4BNCA 1OCCH 1ZARA 2M0CA 3ASNH 2Y0SN 4G6QA 5DS9A 3BY6A 1I5ZA 4WWCA 2Q2EB 3NWSA 1WJFA 1JHFA 1ZG1A 1S6LA 2R4GA 2V79A 3QOPA 1W5CC 4JX4A 2FQ3A 5EZGA 2WC2A 2E7WA 4E7HA 1AWCA 3VWBA 2G9WA 1B59A 1VQKI 2IP2A 3BJ6A 2BY0A 2IA2A 2ESHA 2GA2A 2KJCA 1ZGWA 3KCCA 5F64A 3T0YA 5D5UB 2QSFX 1EH6A 1IV8A 1XGOA 1IZ1A 2IGNA 3N4MA 2BW3B 4N9IA 4BU2A 3WTYC 5HS9A 1YLFA 2KJBA 4FT8A 3ABLH 3PJRA 3MKLA 1EH7A 1BI1A 1F9NA 3OYIA 3HYIA 2OZ6A 1B8IA 3W2VA 2AS5F 3NEUA 4IRGA 5HLGA 5E3NA 3L9FA 4XLNF 1FT9A 2EBIA 3HL2A 1J7KA 2RV8A 1QHGA 2YX4A 3CP2A 2HOTA 1TT5B 1WWXA 2JA7J 3W2WA 4BHCA 5CYVA 4A3BJ 1XC5A 2R7TA 5F27A 4XLCA 1MNMC 3VYRB 2XPUA 1GT0C 1JTYA 3BZCA 3DPTA 1XX5A 3C7JA 5JVTA 2JPBA 2HI3A 4A5MA 1RETA 4WXCA 1BI3A 2ZXWH 3LNQA 4BAYA 2D5VA 4G7HF 3S14J 2R7VA 1Y39A 4BE0A 1VI0A 1TNTA 4AUXA 3LQQA 5CVVA 1ITYA 5J4YA 2OQRA 2V1NA 1FIAA 4JK1X 2IAIA 1DPUA 4FCYA 2LKXA 2QYOA 3SXYA 1ZLJA 2M8GX 4GXOA 1KU3A 4EJTA 3LWFA 4G6DA 2CS3A 2LSOA 3CD6I 1C0WA 3RKXA 4EVIA 3OMYA 1UHSA 4IXAA 2OTJI 4U0WA 3BROA 4BQQA 1G3SA 3B73A 4EM0B 5HLHA 4A3MJ 2HPIA 2CFXA 5IP7J 3BZ6A 3KIOA 3JRHA 2HR3A 5F6FA 2DI3A 2QQ8A 4IHWA 4D7NA 3CDHA 2NS0A 3GVAA 3QU3A 4DW6A 5E17F 3OOPA 1DPRA 3MKWB 3AG3H 2IW5A 2KPMA 4U87A 4E7LA 2R5YA 3X2QH 4ZYAA 1B1BA 5E79C 3QYEA 2VC0A 2DAOA 5H20A 4U0YA 1P4XA 3SDGA 3CCYA 2DO7A 1XG1A 4R1HA 2HDWA 3F8NA 3OYNA 5IT3A 4L9TA 2BY1A 3I4PA 2M87A 3K4MA 1KQ0A 3KYCB 1GLNA 2BBYA 1B4AA 2HQ5A 3GTOJ 2IS1A 4O6JA 2IBDA 1ZAOA 3FF5A 3ZQQA 3BG9A 4BE2A 3GLXA 4RGRA 3CMYA 5J47A 1HW2A 2X0LA 4PUSA 3FISA 2GAUA 1X3WB 3BOQA 1U8RA 3PUFA 3FK7A 3LA2A 3J7AY 1BR1A 3GXOA 2JTVA 5K1YA 3GLLA 3KZIC 3S1RJ 4BH9A 1WH5A 4BDYA 1ETKA 5ICGA 1XGNA 2NVQJ 5F1JA 2PN6A 3I53A 1Z3XA 1IN8A 3FXQA 1TQIA 3VEPA 1P2FA 2XDVA 2XB0X 3CCUI 2KQRA 1POGA 5DM7F 2YUSA 3IAM2 2K40A 1XB4A 1XTAA 2CW8A 2H6CA 3Q0VA 2V9VA 3J81K 3ZXSA 3HC7A 4CYCB 4UB8C 2VASA 2ZCWA 4UVAA 3LSKA 1YRNB 1OCZH 3IC7A 2EZIA 3ZPLA 1ZQ3P 2NNYA 3A01A 2ZFWA 3ECHA 3H35A 2M7AA 2BHYA 2OU2A 4UUSA 1TLHB 2KIQA 2M9HA 2HZDA 2EILH 3BTCA 1VQPI 1VQ7I 4X6AJ 4E7ZA 2O8XA 1UELB 2CWEA 4DZJA 5H6QA 3CESA 3FKIJ 1XCVA 1K7AA 1K79A 1ACIA 1GXQA 4CCJA 1LKXA 1FC3A 1X3UA 3QPLA 2NVTJ 2BY3A 2I8DA 4A0XA 3GW2A 2ZMEB 1UHWA 3K4LA 3KP4A 3SZTA 3L7WA 1SAXA 1IRXA 1YE9A 3TO9A 4I02A 3K70D 3FX3A 5IY5H 1Z67A 3BJOA 1TWGJ 3I0TA 2FMYA 2ZKZA 4B43A 2XKOA 1D8KA 3NWTA 1FBQA 1NG7A 2MW8A 4AM3A 3OSFA 1FBSA 2UZKA 2M3AA 2HDCA 2QF7A 4B4CA 2RKHA 4PJ0C 2CG4A 4D9JA 2R92J 2F5DA 3U1KA 2STTA 3MAJA 3A4CA 5L3DA 2L0KA 3FK6A 2IJLA 1H0MA 3RIRA 2RNJA 3PQJA 1G6NA 2FOKA 2ZO4A 3CMAI 1VF9A 4BHBA 2DMPA 4HDUA 3D5SC 1Z21A 2ZNYA 2H8RA 4OMZA 2JT1A 3DPUA 2CQ7A 2LD5A 1OR7C 3S2WA 3HOXJ 1TP4A 2PJPA 4HF0A 1WJDA 2EQRA 2FSWA 3SZGA 5LD2C 1CQTA 5B1BH 1WJEA 1W0UA 3A01B 2E1NA 5K7ZA 4ASNA 4Y3OA 3G1LA 3KFWX 4AC0A 4IPAA 2O9LA 3S8PA 1FZPB 3BR0A 2IS2A 2EFPA 1I6XA 3ZMZA 2JPCA 1HDPA 1IO2A 1N25A 3ABKH 4W1UA 2LR8A 3B6CA 3HEFA 3BG5A 1DUXC 2PBIA 2GOMA 4M9XA 2W57A 1RESA 4L5IA 1W36D 3DBLB 4R8HA 3W3CA 1RPWA 5DEQA 2HS5A 2MLKA 3HGYA 1M1EB 2EV6A 1VQ5I 3D5LA 3QWLA 5FFXA 3OWTA 2NS7A 3RZOJ 3E6CC 1U6GA 4RGXA 3PUBA 2NVYJ 2X1DA 3G73A 3CTAA 1YW7A 2K3FA 4EJVA 2XASA 4LFUA 4R79A 1S7AA 2ZBKA 2KIFA 3TBIA 3MMYB 3WG7H 2PMZN 3FBIB 1U0JA 4Y52J 3DBHB 3PIPF 2Q8KA 3F21A 3DLAA 3HGGA 3IRRA 1JUMA 4XSZF 1FWZA 1D0ZA 4EV0A 3FXUA 4ZYGA 1TC3C 2CV2A 3BG7A 5FO5A 3ZP5A 2W00A 1FYLA 6PAXA 1T56A 5IYCJ 5IOZA 4DZPA 4XLHA 1ENHA 3KP5A 2TCTA 3OR2C 2L02A 4F92B 3RKYA 1ODDA 4MEXF 4NDLA 3MKYB 1DQUA 1E3PA 4IQ4A 4IRIA 2FUG2 4E4HA 2Y2ZA 3HRMA 3WG9A 3A0BC 3SZPA 3ZQIA 1U5TC 3O6BB 1HXDA 3UNGC 1BIAA 4B1RA 3NRVA 4JBAA 4MLOA 4XRSG 2DJIA 4DGWB 2GWRA 2LOOA 4IZZA 3M8JA 2A6TA 4LD5A 3TL4X 3TDZC 1GXPA 1A31A 4E7SA 3LSIA 4M3GA 4BL0B 1Z1DA 1OLTA 2YS9A 2DDAA 2DFHA 4QPOA 3JSOA 4NQWA 5E18F 2QKMB 5FJ8J 2JA8J 2K9MA 1R7JA 5LGUA 1ZR2A 2OTLI 4ZJZA 2VT3A 3QAHA 1CF7A 2LNBA 3V42A 4MFEA 4L0ZB 5M3FJ 1FX7A 3I59A 2JMWA 1ZELA 4XORA 3FHNA 2QM3A 5KAIC 4MHGA 3SYTA 3VYUB 3F9KA 1IDYA 4E70A 4G6TB 3TOAA 3OYJA 1U9NA 2N8GA 5LRSA 2V26A 4OINF 4P5OA 4CCNA 4HLXA 2ZXHA 2IVMA 3CCQI 1R1UA 2DTRA 2MH2A 4YIFA 1RIOH 3S15J 1MJ9A 2XGEA 5KCMA 1FMVA 2A61A 3EUHC 2Z3YA 4YEJA 1A6IA 3V4GA 4LOCA 4PGHA 4LITA 5J1UA 1R49A 3ZQGA 4RB2C 2X6OA 4RMNA 4BBRJ 1SMTA 3I5UA 2CUEA 4HBLA 2RQPA 2QSGX 3OYKA 2O3FA 4RM2A 4I7HA 3WU2C 4CHUA 2M45A 4IHXA 5F0FA 2XVCA 4UV8A 4DBRA 4PFPA 4M6XA 2F6CA 1RC9A 2X48A 4NC6A 4XMYA 2P0WA 3BCBA 2PMHA 3RPUD 2XV4S 1YOVB 2DMUA 1W7PB 5FRMA 1LVAA 1OCPA 2H94A 5L3FA 1HKSA 1RI7A 5ICEA 1IGNA 2HNHA 3E6MA 2WV1A 1YYVA 2R7DA 4UXNA 1KQ8A 1V3FA 4V2FA 2HXIA 2XPWA 5FKMA 3H5NA 1ORKA 5LFAA 5H6RA 3PSFA 2ZFUA 2HZTA 5B66C 3J7AO 1KQ9A 3DTIA 4CH7A 5HS8A 2HOAA 2JSPA 2FNAA 3AFHA 2XSDC 4XKBA 2JA5J 1T0FC 4ZYEA 2O61A 2DMNA 4S04A 5KHDA 1LVKA 1NH3A 3AG1H 3KX2A 3R60A 3CUQA 1R5ID 4WX9A 4AIKA 1A35A 4IF4A 3QP6A 4HNUA 5HODA 1ZRCA 3WE3A 3ZQ7A 2PFBA 5JHFA 1T08B 4MIMA 2V9PA 5EGOB 2OC6A 2O6GE 1MSFC 1BJZA 1FBUA 3FMRA 5CKTA 3MKZA 4HF1A 5C4JJ 1TL8A 4MTDA 4UY8I 4L5JA 4KISA 2V4JC 3BQZA 2XAFA 4Y4RA 3GTLJ 3WTWC 2X51A 5M5XJ 4U0VA 4A3DJ 3K10A 3HJEA 5IOYA 4ZTJA 2EFNA 3CCMI 5D5WB 1CF7B 2CH0A 3HOVJ 2R7SA 2WAEA 2BXZA 2DCEA 5F04A 1UJ8A 2WY7Q 5HNHA 3QODA 1MBKA 1AU7A 1F36A 4ZTFA 2PLYA 4G8XA 3H0DA 1D1BA 2KKOA 4UB6C 3LA7A 3AG2H 2DA5A 1LE8B 3EUKL 4HSTA 3CC7I 3VYSB 2EA4A 1R5GA 1W36C 4HV6A 4A0YA 4X0GA 3SJMA 2VLAA 4UUVA 5F1RA 4ESJA 2PMZA 4GYGA 4L5EA 4HSRA 2MC4A 4I6ZA 2VQGA 1I3AA 3TW6A 2QBYB 3NAUA 2DOAA 3R0JA 5CQEA 2GIZA 2X4HA 1WJ5A 2XGXA 3LSGA 1I6HJ 4PGGA 4G7ZF 3I54A 1OQYA 2L9RA 5CVUA 5D8LB 1VTNC 3T8RA 2J5PA 1VQMI 1B72B 3RPUA 3S3NA 2HOSA 3FXMA 2WV0A 1ETWA 2KP6A 1PJRA 3F6VA 3HPGA 2ISYA 2M34A 3CJQB 3F72A 2OJED 2MSYA 4KT6A 4HNTA 2V6EA 3PIOF 5JLWA 3DBRB 5JR3A 2H8WA 2EFQA 4Q47A 3HRUA 1MBGA 4FX0A 3U1DA 3K6GA 2XAUA 5J3LA 2D45A 2NYXA 1QRYA 1X1CA 2XAHA 4I09A 1UCRA 2RDPA 1WVRA 2HVSA 4RAYA 2JQ7A 1T33A 1Z6TA 2NS8A 3KEYA 1R1VA 1ZRFA 4O3MA 4C2TA 2KLOA 3K4KA 2DFFA 2H27A 1SVLA 3L09A 3GTJJ 1L3LA 1HC8A 1R22A 3CDLA 4F93B 3L2CA 1YRNA 4XM3A 4HOBA 1VNDA 2JSCA 3COAC 3JRAA 3DXJF 1W5SA 3L00A 1YX3A 1W7PA 2HKOA 3ABMH 1WCMJ 3M8EA 2B0LA 2R7XA 1G59A 1X1BA 1MKMA 3M1EA 1ON1A 4XKCA 2QEXI 4KMUX 2VBZA 4B3XA 2FF4A 2HQAA 1I1GA 2ZMEC 4A93J 2DOFA 4XLFA 2JVHA 3CP8A 2BVMA 5LEKA 3J7YJ 4M3FA 1H9GA 2IGKA 4Y13A 4FETA 3HM5A 2D2WA 1JI8A 4A0ZA 3JW4A 2IA1A 2LKSA 3J80K 4U7BA 3OR1C 3KEOA 4M9SA 4JX6A 4MTEA 3ABTA 3KEQA 4XOTA 2F5VA 4A2UA 1ZR4A 4BBSJ 3ML6A 5F08A 2E36A 3I59B 1XCBA 4MNUA 5JFRA 2VXZA 5F0CA 2R7QA 3S2HJ 3MWMA 1U2WA 4BUPA 5GAEJ 1A36A 2H09A 1PP7U 4RLFA 5M3MJ 4WK8F 4Y17A 2HDDA 2XF6A 3GTGJ 3OS0A 3IAS2 4M3DA 3BQYA 4ZDPA 1IN4A 1S7EA 2GIVA 2L7ZA 3R0AA 4M3EA 1R5HA 2BZTA 4V2GA 1P4WA 2W82A 3KLOA 2HYJA 3DEEA 3K1MA 1USSA 2WY8Q 3KP2A 3RKQA 1T38A 1HKTA 3M9AA 4OIRF 2E5NA 4OIQF 4KUMA 1FIPA 1Z7UA 2A6EF 2E7XA 2RQQA 1EH8A 4YFKF 3PM1A 3HDDA 4LG0A 2IS4A 5EEAA 3H5RA 3OIQA 4DOZA 4KYWA 2A69F 3OYBA 3C3WA 4K2EA 4UUSB 1BN5A 3QPTA 3BG6A 2X6XA 1R00A 1OKRA 1YW9A 4FISA 4IX7A 4M6VA 4XBFA 2W48A 2HFHA 2D1VA 1HW5A 3E97A 4E7JA 2BVLA 2K4JA 5ILUA 5IYDJ 3CO6C 2JRTA 3GUDA 4BJTA 1AOYA 1D0YA 2DT5A 2RN7A 1YJ9I 4PK4A 2B63J 4XLEA 2R7RA 3ZMUA 1YJWI 1G3TA 2QZ8A 2GZWA 3LMMA 4YIRX 2RGVA 4BQNA 1W5TA 5BNGA 4KMFA 3C2HA 2Y31A 1NG6A 1XN7A 2MBFA 4AYBN 4M74A 3BR6A 3M3YJ 1X1AA 1ZTRA 3H3UA 4XOPA 4RA2A 2VKEA 2E2JJ 3ISPA 3ZCOA 2P5LC 4NB5A 3K4BA 4CGZA 3MEXA 3WTXC 4X1EA 4II2A 1LDDA 1HLVA 5KAFC 1IXRC 2CW0F 4PZJA 1WSUA 2OV7A 2W84A 4ZZDA 3L1PA 1GVJA 1UMQA 5CLSA 4BDZA 3E7LA 3UKGA 1T39A 3RDIA 3OOUA 4XIDA 1IF1A 3CLOA 4Y15A 4CCLA 3LA3A 3R4KA 1KONA 2ZC2A 2VKHA 4LG3A 2L4AA 4ETSA 1PUFB 2LF8A 3VFZA 1MDMA 1REPC 1SD7A 3RKWA 2P8TA 3C2GA 4BYYA 1IN7A 3I55I 1ZLKA 2QENA 2WA0A 5E20A 1PUEE 3JRFA 2YU3A 2EWNA 2BXYA 3FIWA 4IHVA 3BC8A 1FMWA 5HVQC 2XPVA 5GADJ 1Z7LA 4XLPF 1HQCA 2LRDA 4PSWA 4RS8A 1AKHB 1DU0A 2L54A 3CJNA 1BC8C 4IHYA 3EDPA 1S5LC 3P9CA 2K7LA 4C2MJ 2Y69H 1K61A 2OQGA 3HB9A 4B48A 4DYCA
chains in the Genus database with same CATH topology
5IYCJ 5IOZA 2K9NA 2E19A 1W0TA 5EGOA 4DZPA 1TWAJ 1ENHA 2P81A 3RQIA 5EF6A 2VUMJ 4FTHA 2TCTA 3DCFA 2JWTA 1JJ8C 1ETQA 4MFDA 3RZDJ 4DYRA 1XS9A 1MBEA 3S2DJ 1RKTA 4NDLA 2EZLA 2XGCA 2DN0A 3IH3A 1Y1VJ 2Y2ZA 2DTZA 4BY1J 1LE8A 3OSGA 5E3OA 3ZQIA 2LFBA 4XRSA 2WAQN 5E3LA 2L7FP 5IPAA 2E2HJ 5JLXA 2OPTA 4C3IJ 3ZQLA 4HNVA 4B1RA 2DA6A 3S1MJ 4MLOA 4XRSG 3B6AA 4C3HJ 4RBOA 1JUSA 2HXOA 4XK4A 4BXXJ 5EZHA 1MBJA 5FKNA 1IRZA 3HOYJ 1ETXA 2LLKA 4M3GA 1GUUA 2EZHA 5J1RA 2YS9A 3GBGA 2DA7A 1WGXA 5IYBJ 3ZQCA 5FJ8J 2CQXA 2JA8J 2R5ZA 2CU7A 5EG0A 1ZR2A 3PO3J 5DTDA 4ABZA 1QVTA 4MFEA 3TEDA 1JT0A 2VPRA 4BKXA 5M3FJ 1G2HA 1A5JA 2JMWA 1F43A 1TWFJ 2WB1N 2RAEA 1IDYA 1EF4A 1NK3P 2KT0A 1U9NA 2N8GA 1BW6A 4A3CJ 4A3KJ 3BR2A 4JP0A 3TP0A 5E3MA 2Y9YA 4C3JJ 1LFUP 1B72A 1X58A 3GTKJ 4FE4A 2FQ4A 3S15J 3TP3A 2CJJA 2H1KA 2XGEA 3K7AJ 1JUPA 1Q1VA 5GP9A 1VFCA 2OF7A 2O8KA 1A6IA 2MG4A 1PUFA 4LOCA 1JGGA 5J1UA 2CRGA 3ZQGA 2X6OA 4XRMA 4BBRJ 4QSHA 3QPSA 1GVDA 2CUEA 2LVSA 4FE7A 4QIWN 1ZKGA 3H0GJ 3ZOBA 4IEJA 3LSRA 2AO9A 2VI6A 2JK3A 3SFIA 4IHXA 3JRBA 2I10A 4J19A 1MH4A 2O7OA 5J1YA 5F0FA 3BTLA 5IP9J 2KDZA 3BR3A 2E1OA 3WHBA 2X48A 1NTCA 3OIOA 5M5WJ 2DA1A 2DMUA 1OCPA 1MSEC 3BTJA 1JT6A 1SFOJ 2ECBA 3S16J 1IGNA 5EDNA 4QTRA 2WV1A 1BA5A 5C44J 3K2AA 4XICA 1GV5A 4D5FA 4A3IJ 3H3VK 5K7FA 2Y9ZA 4V2FA 2HXIA 2XPWA 5FKMA 1LFBA 1ORKA 1DU6A 1WPKA 2QCOA 2R7ZJ 2K9QA 3S1QJ 2GLOA 2XB5A 1IDZA 1IG7A 1OCTC 2FJ1A 3I4MJ 2HOAA 2XSDC 1Z77A 4JX5A 3C2BA 2X9DA 2JA5J 3BTIA 4RDUA 2YU9J 2DMNA 2DA4A 2M0CA 5DS9A 2Y0SN 2DA2A 1OFCX 1P7IA 2R5YB 5HODA 3JR9A 1GDTA 2LK2A 4MIMA 4M3BA 5EGOB 1MSFC 3HBLA 1BJZA 3TW7A 4JX4A 5EZGA 3MVPA 5C4JJ 3O8HA 1AHDP 3G1MA 3BQZA 1ZGWA 2E2IJ 3GTLJ 4UUTA 5M5XJ 4A3DJ 3HOUJ 3GTMJ 5EYRA 5IOYA 2EZKA 4A3EJ 3HOVJ 3ZQFA 3Q0WA 4MO7A 3MKLA 3D1NI 5F04A 4A3JJ 1I3QJ 1MBKA 1B8IA 5E3NA 1AU7A 1F36A 1ETVA 4BY7J 2EBIA 2LP0A 1U78A 2HOTA 2DA5A 1LE8B 2JA7J 1HDDC 3A03A 4A3BJ 1XC5A 5FKLA 5F27A 3BR1A 3VPRA 3SJMA 1RKWA 1MNMC 2XPUA 2COBA 1GT0C 1JTYA 4L5EA 4I6ZA 3TW6A 2HI3A 2EH3A 1RETA 3NAUA 3LNQA 1Z0XA 1ETOA 2D5VA 3S14J 3Q3SA 3LSGA 1I6HJ 1VI0A 3BT9A 4AUXA 1ITYA 2ID3A 2L9RA 1TWHJ 3A02A 3F0CA 1FIAA 2IAIA 4B3AA 4W97A 1B72B 5GPCA 4FCYA 2LKXA 2HOSA 1HCRA 4DYQA 1ETWA 2M8GX 2M34A 2L7MP 1BW5A 2MSYA 3BR5A 5JLWA 1BL0A 1JKPC 5FKOA 1UHSA 3I4NJ 2R5ZB 1MBGA 5FKKA 4A3MJ 5J3LA 1QRYA 5IP7J 3JRHA 3LOCA 4G12A 4A69C 4IHWA 4D7NA 1T33A 2NS8A 3IV5A 3JREA 1E3OC 4DW6A 2NOGA 3GTJJ 3WHCA 2R5YA 1JJ6C 5FLVA 3CDLA 1IV6A 1YRNA 1VNDA 3O8GA 2G0EA 3JRAA 3SDGA 3CCYA 1XG1A 3S17J 1WCMJ 1IC8A 2HQ5A 3GTOJ 2IBDA 2MGQA 1FJLA 4A3LJ 3BG9A 3CMYA 1IUFA 1X2NA 2XGDA 2AHQA 2ELKA 3FISA 2R0QC 1RR7A 1HF0A 1NK2P 3DEWA 4A93J 3FK7A 3M4OJ 1ZK8A 1D5YA 2NVXJ 1I50J 1P7JA 4M3FA 2DMQA 3HM5A 3S1RJ 1WH5A 4D5CA 1ETKA 4D7MA 2NVQJ 5F1JA 4JX6A 3CQZJ 5C4XJ 2XB0X 4S0HB 5M5YJ 1POGA 2YUSA 2K40A 2TRTA 1ZR4A 4BBSJ 3Q0VA 1UG2A 5F08A 2GM4A 4CYCB 1MBFA 2VKVA 3IH4A 3GTPJ 5C3EJ 2XRLA 5F0CA 1H89C 3W6VA 1YRNB 3S2HJ 1FTZA 2EZIA 1ZQ3P 5F0HA 3A01A 4UUSA 2M9HA 2CUFA 4EEFG 3BTCA 2GBYA 5M3MJ 4X6AJ 2HDDA 3GTGJ 2DA3A 3S1NJ 4DZJA 3FKIJ 1GV2A 3BQYA 4M3DA 1MH3A 3JRDA 1S7EA 1X2MA 2L7ZA 3NARA 4M3EA 4V2GA 3QPLA 2NVTJ 2HYJA 3RKQA 1B8IB 1APLC 1IJWC 1FIPA 2CQQA 3PM1A 1FTTA 3HDDA 1TWGJ 5IP6A 2FX0A 2Y30A 5EEAA 2JJ7A 4GFBA 3GTQJ 4UUSB 2MW8A 3OSFA 4A3GJ 2R93J 2QF7A 4B4CA 1U8BA 1H88C 4FISA 3LSPA 4M6VA 1WI3A 2R92J 3Q0UA 4JYKA 3MN2A 2W48A 2L0KA 2M2EA 3FK6A 1JTXA 1OJLA 2ECCA 1JKRC 5IYDJ 5EG0B 4I76A 1VF9A 2DJNA 3BG3A 3LSJA 2DMPA 3JRCA 2H8RA 2JA6J 2B63J 3HKZN 4CYCA 2LD5A 1ETYA 2ME0A 3HOXJ 2EQRA 1R9TJ 5BNGA 2Y31A 1CQTA 1W0UA 3A01B 1QVUA 3PO2J 5K7ZA 3G1LA 4AC0A 4AYBN 3BR6A 2O9LA 3M3YJ 3HOWJ 3BR0A 1ZTRA 1U9OA 2VKEA 1JKOC 1HDPA 2E2JJ 4W1UA 2LR8A 1MBHA 3B6CA 3HEFA 3BG5A 4X1EA 1Y1WJ 1HLVA 3HOZJ 1RESA 3L1PA 2LY9A 1UMQA 3JRGA 9ANTA 3E7LA 3UKGA 1RPWA 3HGYA 3OOUA 4XIDA 5GPAA 2FD5A 1PUFB 2NS7A 3RZOJ 2IEKA 2ID6A 2NVYJ 4Y7NJ 2ME6A 2K9SA 1O4XA 3JRFA 1H8AC 1FEXA 5K7HA 4A3FJ 3FIWA 4IHVA 5FLMJ 1HOMA 1SANA 2PMZN 1WH7A 2XPVA 3QQAA 1DU0A 4Y52J 2JN6A 3JRIA 1AKHB 3G1OA 2LTPA 3ZQHA 2DMTA 3HGGA 2ZB9A 4IHYA 1JUMA 1TWCJ 4C2MJ 1AKHA 1JKQC 1TC3C 1K61A 1K83J 3HB9A 4DYCA 1T56A 1QPIA 3IH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC J;  5IOZ A;  2K9N A;  2E19 A;  1W0T A;  5EGO A;  4DZP A;  1TWA J;  1ENH A;  2P81 A;  3RQI A;  5EF6 A;  2VUM J;  4FTH A;  2TCT A;  3DCF A;  2JWT A;  1JJ8 C;  1ETQ A;  4MFD A;  3RZD J;  4DYR A;  1XS9 A;  1MBE A;  3S2D J;  1RKT A;  4NDL A;  2EZL A;  2XGC A;  2DN0 A;  3IH3 A;  1Y1V J;  2Y2Z A;  2DTZ A;  4BY1 J;  1LE8 A;  3OSG A;  5E3O A;  3ZQI A;  2LFB A;  4XRS A;  2WAQ N;  5E3L A;  2L7F P;  5IPA A;  2E2H J;  5JLX A;  2OPT A;  4C3I J;  3ZQL A;  4HNV A;  4B1R A;  2DA6 A;  3S1M J;  4MLO A;  4XRS G;  3B6A A;  4C3H J;  4RBO A;  1JUS A;  2HXO A;  4XK4 A;  4BXX J;  5EZH A;  1MBJ A;  5FKN A;  1IRZ A;  3HOY J;  1ETX A;  2LLK A;  4M3G A;  1GUU A;  2EZH A;  5J1R A;  2YS9 A;  3GBG A;  2DA7 A;  1WGX A;  5IYB J;  3ZQC A;  5FJ8 J;  2CQX A;  2JA8 J;  2R5Z A;  2CU7 A;  5EG0 A;  1ZR2 A;  3PO3 J;  5DTD A;  4ABZ A;  1QVT A;  4MFE A;  3TED A;  1JT0 A;  2VPR A;  4BKX A;  5M3F J;  1G2H A;  1A5J A;  2JMW A;  1F43 A;  1TWF J;  2WB1 N;  2RAE A;  1IDY A;  1EF4 A;  1NK3 P;  2KT0 A;  1U9N A;  2N8G A;  1BW6 A;  4A3C J;  4A3K J;  3BR2 A;  4JP0 A;  3TP0 A;  5E3M A;  2Y9Y A;  4C3J J;  1LFU P;  1B72 A;  1X58 A;  3GTK J;  4FE4 A;  2FQ4 A;  3S15 J;  3TP3 A;  2CJJ A;  2H1K A;  2XGE A;  3K7A J;  1JUP A;  1Q1V A;  5GP9 A;  1VFC A;  2OF7 A;  2O8K A;  1A6I A;  2MG4 A;  1PUF A;  4LOC A;  1JGG A;  5J1U A;  2CRG A;  3ZQG A;  2X6O A;  4XRM A;  4BBR J;  4QSH A;  3QPS A;  1GVD A;  2CUE A;  2LVS A;  4FE7 A;  4QIW N;  1ZKG A;  3H0G J;  3ZOB A;  4IEJ A;  3LSR A;  2AO9 A;  2VI6 A;  2JK3 A;  3SFI A;  4IHX A;  3JRB A;  2I10 A;  4J19 A;  1MH4 A;  2O7O A;  5J1Y A;  5F0F A;  3BTL A;  5IP9 J;  2KDZ A;  3BR3 A;  2E1O A;  3WHB A;  2X48 A;  1NTC A;  3OIO A;  5M5W J;  2DA1 A;  2DMU A;  1OCP A;  1MSE C;  3BTJ A;  1JT6 A;  1SFO J;  2ECB A;  3S16 J;  1IGN A;  5EDN A;  4QTR A;  2WV1 A;  1BA5 A;  5C44 J;  3K2A A;  4XIC A;  1GV5 A;  4D5F A;  4A3I J;  3H3V K;  5K7F A;  2Y9Z A;  4V2F A;  2HXI A;  2XPW A;  5FKM A;  1LFB A;  1ORK A;  1DU6 A;  1WPK A;  2QCO A;  2R7Z J;  2K9Q A;  3S1Q J;  2GLO A;  2XB5 A;  1IDZ A;  1IG7 A;  1OCT C;  2FJ1 A;  3I4M J;  2HOA A;  2XSD C;  1Z77 A;  4JX5 A;  3C2B A;  2X9D A;  2JA5 J;  3BTI A;  4RDU A;  2YU9 J;  2DMN A;  2DA4 A;  2M0C A;  5DS9 A;  2Y0S N;  2DA2 A;  1OFC X;  1P7I A;  2R5Y B;  5HOD A;  3JR9 A;  1GDT A;  2LK2 A;  4MIM A;  4M3B A;  5EGO B;  1MSF C;  3HBL A;  1BJZ A;  3TW7 A;  4JX4 A;  5EZG A;  3MVP A;  5C4J J;  3O8H A;  1AHD P;  3G1M A;  3BQZ A;  1ZGW A;  2E2I J;  3GTL J;  4UUT A;  5M5X J;  4A3D J;  3HOU J;  3GTM J;  5EYR A;  5IOY A;  2EZK A;  4A3E J;  3HOV J;  3ZQF A;  3Q0W A;  4MO7 A;  3MKL A;  3D1N I;  5F04 A;  4A3J J;  1I3Q J;  1MBK A;  1B8I A;  5E3N A;  1AU7 A;  1F36 A;  1ETV A;  4BY7 J;  2EBI A;  2LP0 A;  1U78 A;  2HOT A;  2DA5 A;  1LE8 B;  2JA7 J;  1HDD C;  3A03 A;  4A3B J;  1XC5 A;  5FKL A;  5F27 A;  3BR1 A;  3VPR A;  3SJM A;  1RKW A;  1MNM C;  2XPU A;  2COB A;  1GT0 C;  1JTY A;  4L5E A;  4I6Z A;  3TW6 A;  2HI3 A;  2EH3 A;  1RET A;  3NAU A;  3LNQ A;  1Z0X A;  1ETO A;  2D5V A;  3S14 J;  3Q3S A;  3LSG A;  1I6H J;  1VI0 A;  3BT9 A;  4AUX A;  1ITY A;  2ID3 A;  2L9R A;  1TWH J;  3A02 A;  3F0C A;  1FIA A;  2IAI A;  4B3A A;  4W97 A;  1B72 B;  5GPC A;  4FCY A;  2LKX A;  2HOS A;  1HCR A;  4DYQ A;  1ETW A;  2M8G X;  2M34 A;  2L7M P;  1BW5 A;  2MSY A;  3BR5 A;  5JLW A;  1BL0 A;  1JKP C;  5FKO A;  1UHS A;  3I4N J;  2R5Z B;  1MBG A;  5FKK A;  4A3M J;  5J3L A;  1QRY A;  5IP7 J;  3JRH A;  3LOC A;  4G12 A;  4A69 C;  4IHW A;  4D7N A;  1T33 A;  2NS8 A;  3IV5 A;  3JRE A;  1E3O C;  4DW6 A;  2NOG A;  3GTJ J;  3WHC A;  2R5Y A;  1JJ6 C;  5FLV A;  3CDL A;  1IV6 A;  1YRN A;  1VND A;  3O8G A;  2G0E A;  3JRA A;  3SDG A;  3CCY A;  1XG1 A;  3S17 J;  1WCM J;  1IC8 A;  2HQ5 A;  3GTO J;  2IBD A;  2MGQ A;  1FJL A;  4A3L J;  3BG9 A;  3CMY A;  1IUF A;  1X2N A;  2XGD A;  2AHQ A;  2ELK A;  3FIS A;  2R0Q C;  1RR7 A;  1HF0 A;  1NK2 P;  3DEW A;  4A93 J;  3FK7 A;  3M4O J;  1ZK8 A;  1D5Y A;  2NVX J;  1I50 J;  1P7J A;  4M3F A;  2DMQ A;  3HM5 A;  3S1R J;  1WH5 A;  4D5C A;  1ETK A;  4D7M A;  2NVQ J;  5F1J A;  4JX6 A;  3CQZ J;  5C4X J;  2XB0 X;  4S0H B;  5M5Y J;  1POG A;  2YUS A;  2K40 A;  2TRT A;  1ZR4 A;  4BBS J;  3Q0V A;  1UG2 A;  5F08 A;  2GM4 A;  4CYC B;  1MBF A;  2VKV A;  3IH4 A;  3GTP J;  5C3E J;  2XRL A;  5F0C A;  1H89 C;  3W6V A;  1YRN B;  3S2H J;  1FTZ A;  2EZI A;  1ZQ3 P;  5F0H A;  3A01 A;  4UUS A;  2M9H A;  2CUF A;  4EEF G;  3BTC A;  2GBY A;  5M3M J;  4X6A J;  2HDD A;  3GTG J;  2DA3 A;  3S1N J;  4DZJ A;  3FKI J;  1GV2 A;  3BQY A;  4M3D A;  1MH3 A;  3JRD A;  1S7E A;  1X2M A;  2L7Z A;  3NAR A;  4M3E A;  4V2G A;  3QPL A;  2NVT J;  2HYJ A;  3RKQ A;  1B8I B;  1APL C;  1IJW C;  1FIP A;  2CQQ A;  3PM1 A;  1FTT A;  3HDD A;  1TWG J;  5IP6 A;  2FX0 A;  2Y30 A;  5EEA A;  2JJ7 A;  4GFB A;  3GTQ J;  4UUS B;  2MW8 A;  3OSF A;  4A3G J;  2R93 J;  2QF7 A;  4B4C A;  1U8B A;  1H88 C;  4FIS A;  3LSP A;  4M6V A;  1WI3 A;  2R92 J;  3Q0U A;  4JYK A;  3MN2 A;  2W48 A;  2L0K A;  2M2E A;  3FK6 A;  1JTX A;  1OJL A;  2ECC A;  1JKR C;  5IYD J;  5EG0 B;  4I76 A;  1VF9 A;  2DJN A;  3BG3 A;  3LSJ A;  2DMP A;  3JRC A;  2H8R A;  2JA6 J;  2B63 J;  3HKZ N;  4CYC A;  2LD5 A;  1ETY A;  2ME0 A;  3HOX J;  2EQR A;  1R9T J;  5BNG A;  2Y31 A;  1CQT A;  1W0U A;  3A01 B;  1QVU A;  3PO2 J;  5K7Z A;  3G1L A;  4AC0 A;  4AYB N;  3BR6 A;  2O9L A;  3M3Y J;  3HOW J;  3BR0 A;  1ZTR A;  1U9O A;  2VKE A;  1JKO C;  1HDP A;  2E2J J;  4W1U A;  2LR8 A;  1MBH A;  3B6C A;  3HEF A;  3BG5 A;  4X1E A;  1Y1W J;  1HLV A;  3HOZ J;  1RES A;  3L1P A;  2LY9 A;  1UMQ A;  3JRG A;  9ANT A;  3E7L A;  3UKG A;  1RPW A;  3HGY A;  3OOU A;  4XID A;  5GPA A;  2FD5 A;  1PUF B;  2NS7 A;  3RZO J;  2IEK A;  2ID6 A;  2NVY J;  4Y7N J;  2ME6 A;  2K9S A;  1O4X A;  3JRF A;  1H8A C;  1FEX A;  5K7H A;  4A3F J;  3FIW A;  4IHV A;  5FLM J;  1HOM A;  1SAN A;  2PMZ N;  1WH7 A;  2XPV A;  3QQA A;  1DU0 A;  4Y52 J;  2JN6 A;  3JRI A;  1AKH B;  3G1O A;  2LTP A;  3ZQH A;  2DMT A;  3HGG A;  2ZB9 A;  4IHY A;  1JUM A;  1TWC J;  4C2M J;  1AKH A;  1JKQ C;  1TC3 C;  1K61 A;  1K83 J;  3HB9 A;  4DYC A;  1T56 A;  1QPI A;  3IH2 A; 
#chains in the Genus database with same CATH topology
 3H92 A;  5HNF A;  1W0T A;  5HLT A;  4OOI A;  5EF6 A;  1EA3 A;  3FXK A;  4GCV A;  2RVC A;  4Q48 A;  4FTH A;  2VUM J;  4FX4 A;  4MFD A;  3SFZ A;  2DXI A;  3TQN A;  2KIM A;  4U88 A;  4AWX B;  1LUJ B;  2DFI A;  1DDN A;  2K3P A;  3IH3 A;  2VXD A;  1FOX A;  1Y1V J;  2DYS H;  1TQP A;  2DTZ A;  1YIO A;  4BY1 J;  1LE8 A;  3WU1 B;  4PJN A;  1J09 A;  4XRS A;  5E3L A;  3N05 A;  2M0M A;  5IPA A;  2E2H J;  3ZQL A;  4HA8 A;  5EEG A;  4WCG A;  3IKV A;  3B6A A;  1Y6I A;  3DV8 A;  4RBO A;  2LC2 A;  2HYF A;  2L9N A;  4HQM A;  2TDX A;  3J7Z I;  5DD8 A;  3TMO A;  1YG2 A;  3CCJ I;  4HLY A;  5TRD A;  5KK1 A;  3UR3 C;  1D1C A;  3BPV A;  1WKM A;  1O57 A;  2LLK A;  2IS6 A;  4HX8 A;  1MJB A;  4L9N A;  2QVO A;  2V1X A;  1MMD A;  4FHT A;  2CQX A;  4YFN F;  1B6A A;  2R5Z A;  2ETH A;  5EG0 A;  1W1W E;  3MD2 A;  3WTV C;  2HWV A;  2WAQ A;  3HTU A;  5FLX K;  2VPR A;  1VQ6 I;  1Z6R A;  3KP6 A;  1A5J A;  2KDO A;  1OMI A;  2IGM A;  3P7N A;  2WB1 N;  2Z16 A;  2RAE A;  4IQJ A;  3LFU A;  1NK3 P;  3MZ8 A;  5LBQ A;  2KT0 A;  4B44 A;  1F1Z A;  4II3 A;  3H9Q A;  3CUQ C;  1BW6 A;  4A3C J;  2BY2 A;  5D4S A;  4CCO A;  1Z05 A;  5E8I A;  2DPU A;  4A3K J;  1O3S A;  3TP0 A;  2Y9Y A;  1MDM B;  1LFU P;  1KU2 A;  1X58 A;  3E1S A;  5TIS C;  3GTK J;  3T1B A;  3IWZ A;  1WQ2 A;  2FQ4 A;  4AD9 A;  2CJJ A;  2QSH X;  2K9L A;  3H9J A;  3K7A J;  2VJ4 A;  1Z9C A;  2ZJ2 A;  5CQG A;  1Q1V A;  2J5O A;  3DKX A;  2XSJ C;  2E60 A;  3DP7 A;  4I98 B;  2OF7 A;  4CZC A;  3IL2 A;  4UVB A;  2CSO A;  2MG4 A;  3ONQ A;  1PUF A;  4OIP F;  1D5V A;  2CRG A;  4QSH A;  3K4N A;  1IN6 A;  3B02 A;  3QPS A;  2NRA C;  1GVD A;  2LVS A;  1ZKG A;  4IEJ A;  2FA5 A;  4KJZ A;  1LB2 A;  2ZJP F;  2OCE A;  3K1P A;  5E1X A;  3JRB A;  1WJA A;  1NHA A;  2O7O A;  3EYY A;  5FB2 A;  1QGP A;  5J1Y A;  2X85 A;  1CGP A;  3BTL A;  2E1O A;  3CMM A;  3WHB A;  4BEH B;  2F5F A;  2EV5 A;  4E7I A;  5M5W J;  2DA1 A;  2RRE A;  4XON A;  1J59 A;  3GEZ A;  1SFU A;  1KA8 A;  4HPQ A;  1MND A;  4KIC A;  3BJA A;  4YFX F;  1JT6 A;  1DGR M;  3S16 J;  3EQL F;  4RB0 A;  1ULY A;  2HOE A;  2DLL A;  4DIQ A;  4YRV A;  3KYL A;  2GXB A;  3ZGK A;  3C1D A;  4P9U A;  1GV5 A;  3ZMS A;  4A3I J;  4L0Y B;  5BOX A;  2HPM A;  1G3Y A;  2EFO A;  2L9V A;  3HSF A;  2CV1 A;  2R7U A;  3K2Z A;  5ILS A;  2EK5 A;  3V8L A;  3DF8 A;  1VQL I;  1N75 A;  2LRE A;  3OYA A;  1IW7 F;  1IG7 A;  2K86 A;  1FSE A;  1Z77 A;  2XRN A;  2X9D A;  3C2B A;  1K6O A;  2DFE A;  2E71 A;  1BI2 A;  2DA2 A;  4PCQ A;  2R5Y B;  5BMZ A;  2E5Z A;  4NUB A;  3V7R A;  3A1Y A;  2VQL A;  2LF7 A;  2WAD A;  4EGY A;  1HKQ A;  5B5E C;  3O8H A;  1AHD P;  3GWZ A;  3W2A A;  2VOD A;  3MZY A;  3JTG A;  5DDG A;  3S32 A;  4MGR A;  1DP3 A;  1N78 A;  2HGC A;  3T5X A;  3ERM A;  5EYR A;  4GGG A;  3HTS B;  2B9S A;  1LDK B;  3EPZ A;  2ADU A;  2NOJ B;  4ZYD A;  2HTJ A;  1SAU A;  4A3E J;  2AQF A;  2V7F A;  2VT2 A;  3Q0W A;  3HUG A;  3D1N I;  2RNG A;  3O2P E;  1X1P A;  4GYI A;  5A2Q K;  2XF7 A;  4A3J J;  3HZJ A;  3SHF A;  4RB1 A;  3CZ6 A;  3PFY A;  3QU6 A;  5AON A;  3KYD B;  4BY7 J;  2F4M B;  4GO1 A;  5DUK A;  1MJA A;  3E6B A;  4P1W A;  1Y56 A;  2M30 A;  4NNJ A;  3QRF F;  1HDD C;  3A2K A;  3ESW B;  4L9J A;  1L0O C;  4BS9 A;  1XMK A;  3D5R C;  5DYM A;  2EFW A;  2W1O A;  1SEU A;  2ELJ A;  1MMS A;  1RKW A;  5CVI A;  3RYP A;  1J75 A;  2COB A;  4M72 A;  4LK0 F;  4ENM A;  3L2W A;  1VQ8 I;  1V5F A;  3K4J A;  4M71 A;  2EH3 A;  2YPR A;  2WWY A;  1A04 A;  4EM1 A;  1ETO A;  3L2V A;  3FXL A;  1WRJ A;  2NVU B;  2ZNZ A;  1SFX A;  3GF2 A;  1P4A A;  3BT9 A;  3T8T A;  4YG2 F;  2ID3 A;  1FOY A;  1TWH J;  3A02 A;  5FLX Z;  3F0C A;  1ONV A;  2HQN A;  2OAZ A;  2L01 A;  5GPC A;  4DYQ A;  2L7M P;  1J0R A;  2Y75 A;  1T0F A;  3U21 A;  1BW5 A;  3VOE A;  2EIN H;  2DW4 A;  5CVR A;  2AXL A;  1JKP C;  2QQ9 A;  3I4N J;  3OYC A;  3OY9 A;  2JUG A;  1JE8 A;  3ABU A;  2O5R A;  2F5E A;  1ZN2 A;  2PMU A;  1Y0U A;  5FKK A;  5LRR A;  4CCK A;  3JCU C;  3LOC A;  1ZYR F;  2FNP A;  1KZH A;  2Z2S B;  2EIK H;  3JRE A;  5FD6 A;  3OYL A;  2NOG A;  4U7D A;  3FXR A;  4N4O B;  1BOB A;  1S72 I;  5IT9 K;  3HUG B;  1JJ6 C;  1HA8 A;  2ZJR F;  5FLV A;  1T98 A;  1IV6 A;  2OUM A;  2QKL B;  3HHH A;  2FE3 A;  3G6E I;  1LEA A;  2F4I A;  2VIX A;  3CCE I;  2G0E A;  3H36 A;  1IN5 A;  3RJP A;  3K70 C;  1P92 A;  1IC8 A;  1HST A;  3G2B A;  2P5V A;  4P9F A;  4BQA A;  1FSH A;  2MGQ A;  2ZJQ F;  1FJL A;  2JZY A;  4B8X A;  4I01 A;  1X2N A;  2XGD A;  2AHQ A;  2ELK A;  3HIF A;  2R0Q C;  1RR7 A;  1NK2 P;  3ULQ B;  4A5N A;  3M4O J;  1ZK8 A;  4XR6 A;  2CGP A;  4M9Z A;  4MEY F;  3ZR8 X;  1P7J A;  3W6J B;  5J40 A;  1X3Z B;  3OL3 A;  4C30 A;  4D5C A;  3ZN0 A;  3A0H C;  1EV7 A;  1OCO H;  2FBI A;  4D7M A;  3REO A;  1BC7 C;  3OYE A;  4XKV A;  1S29 A;  2M5W A;  2LKP A;  4LGW A;  4DQ2 A;  3OS1 A;  1YI2 I;  4KN7 X;  3GYH X;  2OZU A;  4Z2Y A;  2KRH A;  4E7K A;  3GFL A;  3GFM A;  5C3E J;  3F23 A;  4HYE A;  4RLQ A;  1H89 C;  3W6V A;  4PDK A;  1D3Y A;  1LNW A;  2VE9 A;  5F0H A;  3JSP A;  2KIU A;  1FOW A;  4IHT A;  4HRI A;  1LPQ A;  4NC7 A;  2CUF A;  2KL4 A;  5BPD A;  3I56 I;  4QWQ A;  4ESF A;  1Y8R B;  4EEF G;  5IT9 Z;  4M6Y A;  1OCR H;  1ZGJ A;  4UNO A;  4NC8 A;  2C6Y A;  4S05 A;  2MAB A;  4RGU A;  2F48 A;  2UWM A;  1MH3 A;  3JRD A;  2K4B A;  3NAR A;  4ZH4 F;  2XC7 A;  5JVG F;  4ENN A;  5HDK A;  2PQ8 A;  1MMN A;  2HTS A;  1FNN A;  1XMX A;  2STW A;  3FHZ A;  1B8I B;  1X19 A;  2M4K A;  1APL C;  2E1M C;  4CDG A;  5K5Q A;  1IJW C;  2NNN A;  2CQQ A;  3G3Z A;  4BEH A;  1SVO A;  3S3O A;  1FTT A;  3CJT B;  2M4G A;  1QZY A;  5B3S H;  1OIS A;  4LJZ F;  5E1Z B;  2FX0 A;  4BQO A;  2O03 A;  1EKE A;  2JJ7 A;  4GFB A;  4FQG A;  2ZXI A;  1D1A A;  4WF2 A;  3GTQ J;  1UZC A;  3GZ5 A;  3EET A;  4A3G J;  2EPF A;  3CCV I;  1U8B A;  1H88 C;  3J81 Z;  3BP8 A;  3GZ6 A;  4JYK A;  3MN2 A;  1OJL A;  4CXF A;  3G71 I;  1PVE A;  1JKR C;  1MD0 A;  2OD5 A;  3H5A A;  5EG0 B;  1UFM A;  2DJN A;  2VJJ A;  4I76 A;  3WTZ A;  1YIT I;  1RRJ A;  1ZRE A;  3HKZ N;  4CYC A;  1U5T B;  1ETY A;  4ANJ A;  2P7V B;  2Y0M A;  4N0B A;  3PQK A;  3SEZ A;  4EJO A;  2L2O A;  1UAA A;  3OYH A;  1DGW Y;  2QBY A;  2X6Y A;  3PO2 J;  2Y48 A;  4ENJ A;  2CMP A;  3HOW J;  1IXC A;  3Q9V A;  4QPQ A;  1B9M A;  3V8J A;  3OYF A;  2M1B A;  1XD7 A;  4XN3 A;  3VB2 A;  4C2U A;  1Y1W J;  2DU9 A;  3QPH A;  1OR7 A;  3DU5 A;  4XL9 A;  3HOZ J;  3DKW A;  4NQW B;  1QQI A;  3EUA A;  3IP4 B;  5E8G A;  2GA1 A;  1ZG3 A;  4BJ5 C;  4XN0 A;  5ICC A;  4DJA A;  2YR2 A;  4UHT A;  2K27 A;  5H2F C;  1K4T A;  3GCM A;  4BJ6 C;  4AVP A;  2R7W A;  2NAZ A;  2IEK A;  5B1A H;  4KN4 X;  1KU7 A;  3L2R A;  2ID6 A;  2ME6 A;  1TQM A;  2K9S A;  2L5Q A;  2V1U A;  1O4X A;  4LLN A;  3ZN1 A;  2OBP A;  3RTR A;  3WTS C;  1H8A C;  1KU9 A;  3H3Z A;  4A3F J;  2OCC H;  2ESN A;  1MZB A;  5FLM J;  2Z99 A;  1HOM A;  4XSX F;  3QQA A;  1EJ9 A;  4BGD A;  2JN6 A;  3JRI A;  4LIV A;  2CV0 A;  5BPI A;  3G1O A;  3DQV C;  2ZB9 A;  2CO5 A;  5L3G A;  1TWC J;  3L2U A;  1R23 A;  3CJR B;  2DK5 A;  2GQQ A;  1JKQ C;  1TTY A;  3WGH A;  1AKH A;  1E17 A;  2M7B A;  4C9Y A;  1SC7 A;  2HEO A;  2MA3 A;  2RC4 A;  1QPI A;  3IH2 A;  4GDF A;  1X1D A;  1YJN I;  2K9N A;  2E19 A;  5EGO A;  1TWA J;  4AIH A;  5HOO A;  5BQT A;  3BDD A;  3RQI A;  3IUO A;  2MH9 A;  4F3Q A;  4F52 A;  3DCF A;  3Q9S A;  1WI9 A;  1ETQ A;  2KRF A;  3RZD J;  4DYR A;  2W7N A;  1XS9 A;  2HYG D;  1I39 A;  1MBE A;  3KP3 A;  3DU6 A;  3S2D J;  3WTU C;  2MYS A;  3E5Q A;  3F8M A;  2EZL A;  1FOK A;  1GHC A;  1F5T A;  1XDU A;  2L4M A;  4YEL A;  4RAZ A;  5GTH C;  1YS7 A;  2VKD A;  2YX7 A;  3OSG A;  4RB3 C;  3PSI A;  2LFB A;  4MQV A;  4BE1 A;  3TO6 A;  2LG4 A;  2L7F P;  4TV7 A;  2EJR A;  1P9Q C;  3S1M J;  3IKT A;  1IXS B;  4C3H J;  2F5C A;  5DUI A;  3AKZ A;  4G7O F;  3BLY A;  2HXO A;  3PNT A;  4XK4 A;  1HW1 A;  3L2Q A;  1ZH5 A;  2ACJ A;  4BXX J;  4KIT B;  5ICF A;  2DQR A;  4OIO F;  2E1C A;  3R6S A;  1MBJ A;  3K9T A;  4A6E A;  1IRZ A;  3JTH A;  3HOY J;  2DPD A;  1O3Q A;  2BW3 A;  3LFK A;  1GUU A;  1YX5 A;  3CLQ A;  2FML A;  3GBG A;  4KDP A;  2AQE A;  2JRM A;  3ZQC A;  2PG4 A;  3GFJ A;  5GAG J;  2CU7 A;  4DNC A;  2F4O B;  3O3K A;  4HG2 A;  1QVT A;  1S3J A;  2VJ5 A;  3ZRG A;  3TED A;  1JT0 A;  1G2H A;  1SVM A;  5JHU A;  3CUO A;  1F43 A;  1TWF J;  1BJA A;  3ERE D;  2PJR A;  2L3D A;  5CPR B;  4PJL A;  3K69 A;  1R4N B;  3DFG A;  3I58 A;  4HQE A;  1R58 A;  4C3J J;  1E3H A;  1B72 A;  5DCM B;  1A6Q A;  2KHM A;  4FE4 A;  5FRN A;  3TP3 A;  3I71 A;  2WBM A;  1J5Y A;  2COM A;  2H6B A;  5TJJ A;  2Z33 A;  1KYZ A;  2X1E A;  1D8J A;  1JUP A;  5D5V B;  1XSX A;  1G4D A;  2HKX A;  3MQ0 A;  5FD5 A;  2P6S A;  2O8K A;  3IHU A;  1MW7 A;  2YSR A;  4NBQ A;  3FXJ A;  3S93 A;  4XRM A;  2QWW A;  1RUN A;  2A07 F;  4QIW N;  2Z1D A;  2AO9 A;  4H0E A;  1UB9 A;  2DT6 A;  3SFI A;  3J80 Z;  2X1C A;  1OYW A;  5A2Q Z;  4HF2 A;  1MH4 A;  2DYR H;  4AID A;  4V19 K;  1BI0 A;  4ZZL A;  5IP9 J;  3EUH A;  2QQA A;  2MFZ A;  3TKY A;  2E35 A;  3AL0 B;  1NTC A;  3HPH A;  1QA6 A;  1Z3Y A;  3CDI A;  3I64 A;  5HS7 A;  3TOB A;  1SFO J;  2ECB A;  2Z9O A;  5EDN A;  3ROU A;  4IOC F;  3FM5 A;  1BA5 A;  1Q1H A;  5LHH A;  2EB7 A;  3K2A A;  2PI0 A;  4P55 A;  4D5F A;  1T2K A;  5K7F A;  3H3V K;  2VB6 A;  3VOD A;  3MZH A;  3CUQ B;  5D6E A;  1DU6 A;  1JXS A;  1WPK A;  2HU9 A;  4CO8 A;  1FP1 D;  2XAQ A;  2R7Z J;  3S1Q J;  1J9I A;  5LGT A;  2FJ1 A;  2ZXJ A;  4G94 A;  1OCT C;  2Q1Z B;  4RAG A;  5JI6 A;  4OAZ A;  2DA4 A;  2ZSH B;  1T95 A;  4ZDO A;  5J8C A;  3KE2 A;  3OL4 A;  1OFC X;  1P7I A;  3CF5 F;  1WZ2 A;  2DOD A;  3K1N A;  3JR9 A;  1GDT A;  3M7G A;  3HSR A;  3RSN A;  2LK2 A;  1OYY A;  1UHM A;  2VL8 A;  5DCM A;  4M3B A;  4F91 B;  2VJI A;  3HBL A;  5L3B A;  3TW7 A;  4IOA F;  3MVP A;  2FBK A;  2Q0O A;  2D1H A;  4FAS D;  4LMY A;  3G1M A;  1ZGA A;  2ICW G;  2E2I J;  1VZ0 A;  4MQ9 F;  4YII A;  1MMA A;  4UUT A;  5CJ9 A;  2A05 A;  1FP2 A;  4PJM A;  3HOU J;  3V7S A;  3GTM J;  5DV5 A;  4Y33 A;  1K4S A;  1MIJ A;  2EZK A;  4ITV A;  5LEJ A;  1XPX A;  4AYB A;  3OYD A;  4Q5S F;  3ZQF A;  5BS6 A;  4MO7 A;  4IO9 F;  4ZYH A;  4CA0 A;  4G9Y A;  4KIG A;  4EM2 A;  4LK1 F;  1YIJ I;  2UV1 A;  3DLL F;  1I3Q J;  3HRS A;  4PJJ A;  5L3C A;  1ETV A;  3I3L A;  1H9T A;  1O3T A;  3CCR I;  4IKF A;  3HRT A;  2CUJ A;  2LP0 A;  4RM3 A;  1O3R A;  1TW3 A;  2P6T A;  2A5Y B;  2QUF A;  5J4V A;  1WFX A;  4HDV A;  1U78 A;  4B47 A;  2X6W A;  3A03 A;  2Q2E A;  4KIB A;  5FKL A;  3BR1 A;  3HG9 A;  2EA2 A;  3VPR A;  3SDB A;  4AU7 A;  3FDY A;  3QYF A;  3SQN A;  4IRH A;  1O7F A;  1ERD A;  1KYW A;  2HVR A;  1Z0X A;  5KNL A;  1YO5 C;  3P9K A;  3Q3S A;  2BGC A;  1BIB A;  2IT0 A;  1T6S A;  1G8X A;  2VBY A;  4ON0 A;  2HQR A;  3LAP A;  1R6R A;  2MD5 A;  5D4R A;  1WJB A;  3CCL I;  2A5W A;  4B3A A;  4W97 A;  2GXG A;  1LDJ A;  2KRC A;  1R1T A;  1HCR A;  3H1C A;  1YHQ I;  4LG0 B;  3E3V A;  1XGS A;  3OV8 A;  3BR5 A;  1BL0 A;  4XRF A;  1I27 A;  3P9I A;  5D5X B;  5FKO A;  2DQL A;  2WAF A;  2EIJ H;  1ON2 A;  5AIP A;  3TO7 A;  2R5Z B;  1YW8 A;  2VOO A;  4HEA 2;  4L9V A;  1MMG A;  3M8F A;  3E6D A;  4G12 A;  3CCS I;  3E0J B;  4A69 C;  2VON A;  2XAG A;  3Q5F A;  3PNV A;  2VE8 A;  3IV5 A;  5FGM A;  1FY7 A;  4CZZ A;  4P96 A;  1E3O C;  3RQ4 A;  4CYD A;  4I0A A;  3BPX A;  2P7C B;  1STZ A;  1QU3 A;  1YS6 A;  3WHC A;  2QA4 I;  4XQF A;  4CSW A;  1B9N A;  4HV5 A;  4KT5 C;  1PP8 F;  2FU4 A;  3O8G A;  2UXX A;  1OPC A;  2XUB A;  5FFZ A;  3ZMV A;  3S17 J;  4ZC3 A;  3SEQ A;  2CQN A;  2UXN A;  3OYM A;  4H4K C;  4A3L J;  1Y8Q B;  1IUF A;  5LHI A;  5E1W A;  5TGT A;  3ECO A;  5LHG A;  1SD6 A;  1HF0 A;  3DEW A;  1SD4 A;  3EYI A;  3LSM A;  1D5Y A;  2NVX J;  1I50 J;  2W4S A;  2DMQ A;  4E6K G;  4LB6 B;  3WTT C;  4BAC A;  2P4W A;  2BEO A;  2MLG A;  3OS2 A;  2PEX A;  4AIJ A;  4BXF A;  3CQZ J;  5C4X J;  4IVN A;  1WJC A;  3CO7 C;  4S0H B;  2G7H A;  1VQN I;  5M5Y J;  3LST A;  2PJR B;  2DOE A;  1V5E A;  3ZMT A;  2TRT A;  2JVG A;  3VDX A;  5KVR A;  2ZME A;  2F2E A;  1UG2 A;  1FPQ A;  1QPM A;  2XF5 A;  2GM4 A;  5DD4 A;  2FBH A;  2FRH A;  1MBF A;  2VKV A;  3IH4 A;  3GTP J;  3TGN A;  2XRL A;  1FTZ A;  2R7O A;  1VQO I;  3FMS A;  1LJ9 A;  3KLN A;  4N9H A;  1O7L A;  4HAM A;  3OYG A;  1IRG A;  1S9H A;  4EGZ A;  3GZN B;  3N97 A;  1G3W A;  3H9G A;  1S7O A;  1HSJ A;  2Y0S A;  4HZF A;  2VOP A;  1TZL A;  1N77 A;  2R3S A;  5LGN A;  3F22 A;  2GBY A;  4PFO A;  3C18 A;  2IPQ X;  4B09 A;  1JHH A;  2DA3 A;  3S1N J;  1K78 B;  2KIS A;  1GV2 A;  1IRF A;  1X2M A;  2KFD A;  3MCZ A;  3F8F A;  3DKY A;  1RNL A;  1W4M A;  2A6H F;  2IXS A;  1UST A;  4KIF A;  2ISZ A;  3BCA A;  4EQQ A;  3F3X A;  4I2O A;  1XSV A;  2XRO A;  4IHS A;  2I5U A;  3LL7 A;  1Z91 A;  2LBF B;  4M73 A;  5IP6 A;  2XAJ A;  2LMD A;  2Y30 A;  2LYC A;  2XIG A;  4BHP A;  2R93 J;  2MC3 A;  2VN2 A;  3I9V 2;  3LSP A;  4PSX A;  1WI3 A;  2DDB A;  3AG4 H;  4IJA A;  2L9S A;  3Q0U A;  1BR4 A;  4JQF A;  3AL0 C;  3FMQ A;  1MNE A;  2M2E A;  2VQC A;  5EEH A;  1JTX A;  1WHU A;  2E1M B;  2ECC A;  2FOW A;  4F7Z A;  3K0L A;  1QHH D;  1LFP A;  3QP5 A;  3DTK A;  3HXL A;  4A6D A;  2CUZ A;  2OA4 A;  2ZSI B;  3MFK A;  3BG3 A;  3LSJ A;  1SFE A;  4EJU A;  3JRC A;  2JA6 J;  1FYK A;  3CC4 I;  4OWR B;  2VBX A;  1F4K A;  2ME0 A;  1W7P D;  3WGG A;  4D1Q A;  4KA4 A;  3R61 A;  3LAJ A;  2LY2 A;  2LH9 A;  2W24 A;  4LIU A;  1R9T J;  2BYV E;  2O0Y A;  2QLZ A;  5ED4 A;  1V54 H;  1JGS A;  4Q4Z F;  3K4C A;  1QVU A;  3F6O A;  1T8I A;  1X4O A;  2G7U A;  1AA7 A;  2LY1 A;  1UG0 A;  3VSK A;  1U9O A;  1RR8 C;  3FXO A;  4EAT A;  4HX4 A;  1IUY A;  5FRO A;  1JKO C;  1MBH A;  3PFI A;  3OIP A;  4CUG A;  3CME I;  3V7C A;  1R4M B;  3BWG A;  3F8B A;  3KZY A;  2EIM H;  1XDS A;  1R36 A;  3HSE A;  3RCO A;  2QGU A;  1V4R A;  4UV9 A;  3GO5 A;  5ILV A;  2LY9 A;  1P6R A;  2V1D A;  1BOA A;  1BR2 A;  2FXA A;  2UUZ A;  2CFO A;  3JRG A;  3WU0 A;  1R71 A;  9ANT A;  1LEB A;  2L7K A;  4EJW A;  1QO0 D;  1QBJ A;  4JOM A;  2P5K A;  2DT7 B;  5GPA A;  3G4S I;  4RGS A;  2FD5 A;  3W6K B;  2W25 A;  2VPL A;  4Z6Y A;  2PX9 A;  2LBF A;  4Y7N J;  4WXH A;  2B7E A;  1E0E A;  1XGM A;  5DM6 F;  5D8K B;  2NXN B;  3NQO A;  5J8F A;  2K02 A;  5CVJ A;  4LLG F;  3RPQ A;  2WB1 A;  1FEX A;  5K7H A;  4LB5 A;  3AAF A;  1SAN A;  1SFK A;  1WH7 A;  1V5G A;  2IA0 A;  2CYY A;  2IGO A;  2KZV A;  3ZMD A;  4DBQ A;  2JA2 A;  3KET A;  2LTP A;  3ZQH A;  2DMT A;  4D0P A;  3GFI A;  4A12 A;  4XNF A;  1S8N A;  3S3M A;  2AXT C;  4OMY A;  1K83 J;  3GME A;  4LLL A;  4ENK A;  2JUC A;  3DPL C;  1D0X A;  1PDN C;  1YFH A;  2P81 A;  3QYB A;  1PYV A;  3PL8 A;  4XKW A;  4CCM A;  2JWT A;  2VBW A;  4XLA A;  1JJ8 C;  3U2R A;  3LSH A;  1XMA A;  2BE5 F;  1V55 H;  1YTY A;  1RKT A;  3F8C A;  5HDN A;  2CQK A;  2XGC A;  5K5R A;  2DN0 A;  1SMY F;  3CF2 A;  4OAY A;  3IWF A;  4AVZ A;  5K5O A;  4O5V A;  5E3O A;  2VQH A;  1FYM A;  2WAQ N;  1K78 A;  5JLX A;  2OPT A;  4C3I J;  4HNV A;  2DA6 A;  3FM3 A;  2A3S A;  2ELH A;  4I99 C;  1JUS A;  3WE2 A;  1KGS A;  3VSL A;  2FEZ A;  5EZH A;  5FKN A;  4BXU A;  4CIC A;  1ETX A;  1U3E M;  2EZH A;  3M1C A;  5J1R A;  2DA7 A;  1HBX G;  1WGX A;  5IYB J;  2A68 F;  4J00 A;  3HKZ A;  3V8K A;  3PO3 J;  2GXA A;  5DTD A;  2KZG A;  4IL6 C;  3TDU C;  5ERI A;  4ABZ A;  3M07 A;  4L18 B;  2EV0 A;  3IRQ A;  2R7F A;  4BKX A;  5L3E A;  4RAF A;  1X4P A;  3KPH A;  3HOT A;  3E5U A;  3GX4 X;  1BM9 A;  1TW2 A;  4HW0 A;  4ZDL A;  1J2X A;  1EF4 A;  2LDU A;  3E5X A;  1QNT A;  1TBX A;  1MGT A;  4UVC A;  4EMS A;  3KP7 A;  5D6F A;  1TT0 A;  1YQA A;  3JAM Z;  4I0B A;  2IRF G;  3BR2 A;  4JP0 A;  5E3M A;  3CC2 I;  3JAM K;  1IAW A;  3LQR A;  2XHK A;  2M8E A;  5AIQ A;  1XSD A;  3WOD F;  2H1K A;  2V9K A;  3D0S A;  3HHG A;  1I1S A;  4OU0 A;  1VFC A;  5GP9 A;  3RI4 A;  1QZE A;  4WXD A;  2HVQ A;  1JGG A;  4NHJ A;  3P5J A;  1VQ9 I;  3ELK A;  3DTE A;  1DP7 P;  1BBY A;  3PNY A;  4FE7 A;  2BHZ A;  3H0G J;  3ZOB A;  5GAH J;  3LSR A;  2W85 A;  3RYR A;  2VI6 A;  2Z5U A;  2JK3 A;  5LLQ A;  2I10 A;  4J19 A;  5HDG A;  1U5T A;  2BOL A;  5HLI A;  3QOE A;  5DCF A;  1SD5 A;  2KDZ A;  1OYI A;  3BR3 A;  2VC1 A;  1ZG5 A;  3U9G A;  1VQ4 I;  4KFC A;  3OIO A;  4ESB A;  1FLI A;  2V6C A;  1RZ4 A;  4GRI A;  1ZRD A;  3ASO H;  5EJC A;  3HOS A;  1K6Y A;  1MSE C;  2GOX B;  3BTJ A;  1Y0N A;  2E34 A;  4N4N B;  1LQ1 A;  5GTI C;  4QTR A;  3FBN B;  2DK8 A;  2H1L A;  5C44 J;  2XKP A;  2WTE A;  4F55 A;  4XIC A;  2BV6 A;  1E2X A;  5J6X A;  3FZV A;  4KNY A;  2Y9Z A;  3FWE A;  3BZK A;  1LFB A;  2K85 A;  2QQB A;  2KMU A;  3DEU A;  2QCO A;  1QZZ A;  2K9Q A;  3KZZ A;  2GLO A;  2XB5 A;  2DBB A;  4J01 A;  3DWL E;  1IDZ A;  3FKJ A;  3WGI A;  3I4M J;  2CW7 A;  4JX5 A;  2K5C A;  1ZHF A;  3VYT B;  3BTI A;  2MD0 A;  1TNS A;  4RDU A;  2YU9 J;  4HX7 A;  4QLC U;  1RUO A;  4BNC A;  1OCC H;  1ZAR A;  2M0C A;  3ASN H;  2Y0S N;  4G6Q A;  5DS9 A;  3BY6 A;  1I5Z A;  4WWC A;  2Q2E B;  3NWS A;  1WJF A;  1JHF A;  1ZG1 A;  1S6L A;  2R4G A;  2V79 A;  3QOP A;  1W5C C;  4JX4 A;  2FQ3 A;  5EZG A;  2WC2 A;  2E7W A;  4E7H A;  1AWC A;  3VWB A;  2G9W A;  1B59 A;  1VQK I;  2IP2 A;  3BJ6 A;  2BY0 A;  2IA2 A;  2ESH A;  2GA2 A;  2KJC A;  1ZGW A;  3KCC A;  5F64 A;  3T0Y A;  5D5U B;  2QSF X;  1EH6 A;  1IV8 A;  1XGO A;  1IZ1 A;  2IGN A;  3N4M A;  2BW3 B;  4N9I A;  4BU2 A;  3WTY C;  5HS9 A;  1YLF A;  2KJB A;  4FT8 A;  3ABL H;  3PJR A;  3MKL A;  1EH7 A;  1BI1 A;  1F9N A;  3OYI A;  3HYI A;  2OZ6 A;  1B8I A;  3W2V A;  2AS5 F;  3NEU A;  4IRG A;  5HLG A;  5E3N A;  3L9F A;  4XLN F;  1FT9 A;  2EBI A;  3HL2 A;  1J7K A;  2RV8 A;  1QHG A;  2YX4 A;  3CP2 A;  2HOT A;  1TT5 B;  1WWX A;  2JA7 J;  3W2W A;  4BHC A;  5CYV A;  4A3B J;  1XC5 A;  2R7T A;  5F27 A;  4XLC A;  1MNM C;  3VYR B;  2XPU A;  1GT0 C;  1JTY A;  3BZC A;  3DPT A;  1XX5 A;  3C7J A;  5JVT A;  2JPB A;  2HI3 A;  4A5M A;  1RET A;  4WXC A;  1BI3 A;  2ZXW H;  3LNQ A;  4BAY A;  2D5V A;  4G7H F;  3S14 J;  2R7V A;  1Y39 A;  4BE0 A;  1VI0 A;  1TNT A;  4AUX A;  3LQQ A;  5CVV A;  1ITY A;  5J4Y A;  2OQR A;  2V1N A;  1FIA A;  4JK1 X;  2IAI A;  1DPU A;  4FCY A;  2LKX A;  2QYO A;  3SXY A;  1ZLJ A;  2M8G X;  4GXO A;  1KU3 A;  4EJT A;  3LWF A;  4G6D A;  2CS3 A;  2LSO A;  3CD6 I;  1C0W A;  3RKX A;  4EVI A;  3OMY A;  1UHS A;  4IXA A;  2OTJ I;  4U0W A;  3BRO A;  4BQQ A;  1G3S A;  3B73 A;  4EM0 B;  5HLH A;  4A3M J;  2HPI A;  2CFX A;  5IP7 J;  3BZ6 A;  3KIO A;  3JRH A;  2HR3 A;  5F6F A;  2DI3 A;  2QQ8 A;  4IHW A;  4D7N A;  3CDH A;  2NS0 A;  3GVA A;  3QU3 A;  4DW6 A;  5E17 F;  3OOP A;  1DPR A;  3MKW B;  3AG3 H;  2IW5 A;  2KPM A;  4U87 A;  4E7L A;  2R5Y A;  3X2Q H;  4ZYA A;  1B1B A;  5E79 C;  3QYE A;  2VC0 A;  2DAO A;  5H20 A;  4U0Y A;  1P4X A;  3SDG A;  3CCY A;  2DO7 A;  1XG1 A;  4R1H A;  2HDW A;  3F8N A;  3OYN A;  5IT3 A;  4L9T A;  2BY1 A;  3I4P A;  2M87 A;  3K4M A;  1KQ0 A;  3KYC B;  1GLN A;  2BBY A;  1B4A A;  2HQ5 A;  3GTO J;  2IS1 A;  4O6J A;  2IBD A;  1ZAO A;  3FF5 A;  3ZQQ A;  3BG9 A;  4BE2 A;  3GLX A;  4RGR A;  3CMY A;  5J47 A;  1HW2 A;  2X0L A;  4PUS A;  3FIS A;  2GAU A;  1X3W B;  3BOQ A;  1U8R A;  3PUF A;  3FK7 A;  3LA2 A;  3J7A Y;  1BR1 A;  3GXO A;  2JTV A;  5K1Y A;  3GLL A;  3KZI C;  3S1R J;  4BH9 A;  1WH5 A;  4BDY A;  1ETK A;  5ICG A;  1XGN A;  2NVQ J;  5F1J A;  2PN6 A;  3I53 A;  1Z3X A;  1IN8 A;  3FXQ A;  1TQI A;  3VEP A;  1P2F A;  2XDV A;  2XB0 X;  3CCU I;  2KQR A;  1POG A;  5DM7 F;  2YUS A;  3IAM 2;  2K40 A;  1XB4 A;  1XTA A;  2CW8 A;  2H6C A;  3Q0V A;  2V9V A;  3J81 K;  3ZXS A;  3HC7 A;  4CYC B;  4UB8 C;  2VAS A;  2ZCW A;  4UVA A;  3LSK A;  1YRN B;  1OCZ H;  3IC7 A;  2EZI A;  3ZPL A;  1ZQ3 P;  2NNY A;  3A01 A;  2ZFW A;  3ECH A;  3H35 A;  2M7A A;  2BHY A;  2OU2 A;  4UUS A;  1TLH B;  2KIQ A;  2M9H A;  2HZD A;  2EIL H;  3BTC A;  1VQP I;  1VQ7 I;  4X6A J;  4E7Z A;  2O8X A;  1UEL B;  2CWE A;  4DZJ A;  5H6Q A;  3CES A;  3FKI J;  1XCV A;  1K7A A;  1K79 A;  1ACI A;  1GXQ A;  4CCJ A;  1LKX A;  1FC3 A;  1X3U A;  3QPL A;  2NVT J;  2BY3 A;  2I8D A;  4A0X A;  3GW2 A;  2ZME B;  1UHW A;  3K4L A;  3KP4 A;  3SZT A;  3L7W A;  1SAX A;  1IRX A;  1YE9 A;  3TO9 A;  4I02 A;  3K70 D;  3FX3 A;  5IY5 H;  1Z67 A;  3BJO A;  1TWG J;  3I0T A;  2FMY A;  2ZKZ A;  4B43 A;  2XKO A;  1D8K A;  3NWT A;  1FBQ A;  1NG7 A;  2MW8 A;  4AM3 A;  3OSF A;  1FBS A;  2UZK A;  2M3A A;  2HDC A;  2QF7 A;  4B4C A;  2RKH A;  4PJ0 C;  2CG4 A;  4D9J A;  2R92 J;  2F5D A;  3U1K A;  2STT A;  3MAJ A;  3A4C A;  5L3D A;  2L0K A;  3FK6 A;  2IJL A;  1H0M A;  3RIR A;  2RNJ A;  3PQJ A;  1G6N A;  2FOK A;  2ZO4 A;  3CMA I;  1VF9 A;  4BHB A;  2DMP A;  4HDU A;  3D5S C;  1Z21 A;  2ZNY A;  2H8R A;  4OMZ A;  2JT1 A;  3DPU A;  2CQ7 A;  2LD5 A;  1OR7 C;  3S2W A;  3HOX J;  1TP4 A;  2PJP A;  4HF0 A;  1WJD A;  2EQR A;  2FSW A;  3SZG A;  5LD2 C;  1CQT A;  5B1B H;  1WJE A;  1W0U A;  3A01 B;  2E1N A;  5K7Z A;  4ASN A;  4Y3O A;  3G1L A;  3KFW X;  4AC0 A;  4IPA A;  2O9L A;  3S8P A;  1FZP B;  3BR0 A;  2IS2 A;  2EFP A;  1I6X A;  3ZMZ A;  2JPC A;  1HDP A;  1IO2 A;  1N25 A;  3ABK H;  4W1U A;  2LR8 A;  3B6C A;  3HEF A;  3BG5 A;  1DUX C;  2PBI A;  2GOM A;  4M9X A;  2W57 A;  1RES A;  4L5I A;  1W36 D;  3DBL B;  4R8H A;  3W3C A;  1RPW A;  5DEQ A;  2HS5 A;  2MLK A;  3HGY A;  1M1E B;  2EV6 A;  1VQ5 I;  3D5L A;  3QWL A;  5FFX A;  3OWT A;  2NS7 A;  3RZO J;  3E6C C;  1U6G A;  4RGX A;  3PUB A;  2NVY J;  2X1D A;  3G73 A;  3CTA A;  1YW7 A;  2K3F A;  4EJV A;  2XAS A;  4LFU A;  4R79 A;  1S7A A;  2ZBK A;  2KIF A;  3TBI A;  3MMY B;  3WG7 H;  2PMZ N;  3FBI B;  1U0J A;  4Y52 J;  3DBH B;  3PIP F;  2Q8K A;  3F21 A;  3DLA A;  3HGG A;  3IRR A;  1JUM A;  4XSZ F;  1FWZ A;  1D0Z A;  4EV0 A;  3FXU A;  4ZYG A;  1TC3 C;  2CV2 A;  3BG7 A;  5FO5 A;  3ZP5 A;  2W00 A;  1FYL A;  6PAX A;  1T56 A;  5IYC J;  5IOZ A;  4DZP A;  4XLH A;  1ENH A;  3KP5 A;  2TCT A;  3OR2 C;  2L02 A;  4F92 B;  3RKY A;  1ODD A;  4MEX F;  4NDL A;  3MKY B;  1DQU A;  1E3P A;  4IQ4 A;  4IRI A;  2FUG 2;  4E4H A;  2Y2Z A;  3HRM A;  3WG9 A;  3A0B C;  3SZP A;  3ZQI A;  1U5T C;  3O6B B;  1HXD A;  3UNG C;  1BIA A;  4B1R A;  3NRV A;  4JBA A;  4MLO A;  4XRS G;  2DJI A;  4DGW B;  2GWR A;  2LOO A;  4IZZ A;  3M8J A;  2A6T A;  4LD5 A;  3TL4 X;  3TDZ C;  1GXP A;  1A31 A;  4E7S A;  3LSI A;  4M3G A;  4BL0 B;  1Z1D A;  1OLT A;  2YS9 A;  2DDA A;  2DFH A;  4QPO A;  3JSO A;  4NQW A;  5E18 F;  2QKM B;  5FJ8 J;  2JA8 J;  2K9M A;  1R7J A;  5LGU A;  1ZR2 A;  2OTL I;  4ZJZ A;  2VT3 A;  3QAH A;  1CF7 A;  2LNB A;  3V42 A;  4MFE A;  4L0Z B;  5M3F J;  1FX7 A;  3I59 A;  2JMW A;  1ZEL A;  4XOR A;  3FHN A;  2QM3 A;  5KAI C;  4MHG A;  3SYT A;  3VYU B;  3F9K A;  1IDY A;  4E70 A;  4G6T B;  3TOA A;  3OYJ A;  1U9N A;  2N8G A;  5LRS A;  2V26 A;  4OIN F;  4P5O A;  4CCN A;  4HLX A;  2ZXH A;  2IVM A;  3CCQ I;  1R1U A;  2DTR A;  2MH2 A;  4YIF A;  1RIO H;  3S15 J;  1MJ9 A;  2XGE A;  5KCM A;  1FMV A;  2A61 A;  3EUH C;  2Z3Y A;  4YEJ A;  1A6I A;  3V4G A;  4LOC A;  4PGH A;  4LIT A;  5J1U A;  1R49 A;  3ZQG A;  4RB2 C;  2X6O A;  4RMN A;  4BBR J;  1SMT A;  3I5U A;  2CUE A;  4HBL A;  2RQP A;  2QSG X;  3OYK A;  2O3F A;  4RM2 A;  4I7H A;  3WU2 C;  4CHU A;  2M45 A;  4IHX A;  5F0F A;  2XVC A;  4UV8 A;  4DBR A;  4PFP A;  4M6X A;  2F6C A;  1RC9 A;  2X48 A;  4NC6 A;  4XMY A;  2P0W A;  3BCB A;  2PMH A;  3RPU D;  2XV4 S;  1YOV B;  2DMU A;  1W7P B;  5FRM A;  1LVA A;  1OCP A;  2H94 A;  5L3F A;  1HKS A;  1RI7 A;  5ICE A;  1IGN A;  2HNH A;  3E6M A;  2WV1 A;  1YYV A;  2R7D A;  4UXN A;  1KQ8 A;  1V3F A;  4V2F A;  2HXI A;  2XPW A;  5FKM A;  3H5N A;  1ORK A;  5LFA A;  5H6R A;  3PSF A;  2ZFU A;  2HZT A;  5B66 C;  3J7A O;  1KQ9 A;  3DTI A;  4CH7 A;  5HS8 A;  2HOA A;  2JSP A;  2FNA A;  3AFH A;  2XSD C;  4XKB A;  2JA5 J;  1T0F C;  4ZYE A;  2O61 A;  2DMN A;  4S04 A;  5KHD A;  1LVK A;  1NH3 A;  3AG1 H;  3KX2 A;  3R60 A;  3CUQ A;  1R5I D;  4WX9 A;  4AIK A;  1A35 A;  4IF4 A;  3QP6 A;  4HNU A;  5HOD A;  1ZRC A;  3WE3 A;  3ZQ7 A;  2PFB A;  5JHF A;  1T08 B;  4MIM A;  2V9P A;  5EGO B;  2OC6 A;  2O6G E;  1MSF C;  1BJZ A;  1FBU A;  3FMR A;  5CKT A;  3MKZ A;  4HF1 A;  5C4J J;  1TL8 A;  4MTD A;  4UY8 I;  4L5J A;  4KIS A;  2V4J C;  3BQZ A;  2XAF A;  4Y4R A;  3GTL J;  3WTW C;  2X51 A;  5M5X J;  4U0V A;  4A3D J;  3K10 A;  3HJE A;  5IOY A;  4ZTJ A;  2EFN A;  3CCM I;  5D5W B;  1CF7 B;  2CH0 A;  3HOV J;  2R7S A;  2WAE A;  2BXZ A;  2DCE A;  5F04 A;  1UJ8 A;  2WY7 Q;  5HNH A;  3QOD A;  1MBK A;  1AU7 A;  1F36 A;  4ZTF A;  2PLY A;  4G8X A;  3H0D A;  1D1B A;  2KKO A;  4UB6 C;  3LA7 A;  3AG2 H;  2DA5 A;  1LE8 B;  3EUK L;  4HST A;  3CC7 I;  3VYS B;  2EA4 A;  1R5G A;  1W36 C;  4HV6 A;  4A0Y A;  4X0G A;  3SJM A;  2VLA A;  4UUV A;  5F1R A;  4ESJ A;  2PMZ A;  4GYG A;  4L5E A;  4HSR A;  2MC4 A;  4I6Z A;  2VQG A;  1I3A A;  3TW6 A;  2QBY B;  3NAU A;  2DOA A;  3R0J A;  5CQE A;  2GIZ A;  2X4H A;  1WJ5 A;  2XGX A;  3LSG A;  1I6H J;  4PGG A;  4G7Z F;  3I54 A;  1OQY A;  2L9R A;  5CVU A;  5D8L B;  1VTN C;  3T8R A;  2J5P A;  1VQM I;  1B72 B;  3RPU A;  3S3N A;  2HOS A;  3FXM A;  2WV0 A;  1ETW A;  2KP6 A;  1PJR A;  3F6V A;  3HPG A;  2ISY A;  2M34 A;  3CJQ B;  3F72 A;  2OJE D;  2MSY A;  4KT6 A;  4HNT A;  2V6E A;  3PIO F;  5JLW A;  3DBR B;  5JR3 A;  2H8W A;  2EFQ A;  4Q47 A;  3HRU A;  1MBG A;  4FX0 A;  3U1D A;  3K6G A;  2XAU A;  5J3L A;  2D45 A;  2NYX A;  1QRY A;  1X1C A;  2XAH A;  4I09 A;  1UCR A;  2RDP A;  1WVR A;  2HVS A;  4RAY A;  2JQ7 A;  1T33 A;  1Z6T A;  2NS8 A;  3KEY A;  1R1V A;  1ZRF A;  4O3M A;  4C2T A;  2KLO A;  3K4K A;  2DFF A;  2H27 A;  1SVL A;  3L09 A;  3GTJ J;  1L3L A;  1HC8 A;  1R22 A;  3CDL A;  4F93 B;  3L2C A;  1YRN A;  4XM3 A;  4HOB A;  1VND A;  2JSC A;  3COA C;  3JRA A;  3DXJ F;  1W5S A;  3L00 A;  1YX3 A;  1W7P A;  2HKO A;  3ABM H;  1WCM J;  3M8E A;  2B0L A;  2R7X A;  1G59 A;  1X1B A;  1MKM A;  3M1E A;  1ON1 A;  4XKC A;  2QEX I;  4KMU X;  2VBZ A;  4B3X A;  2FF4 A;  2HQA A;  1I1G A;  2ZME C;  4A93 J;  2DOF A;  4XLF A;  2JVH A;  3CP8 A;  2BVM A;  5LEK A;  3J7Y J;  4M3F A;  1H9G A;  2IGK A;  4Y13 A;  4FET A;  3HM5 A;  2D2W A;  1JI8 A;  4A0Z A;  3JW4 A;  2IA1 A;  2LKS A;  3J80 K;  4U7B A;  3OR1 C;  3KEO A;  4M9S A;  4JX6 A;  4MTE A;  3ABT A;  3KEQ A;  4XOT A;  2F5V A;  4A2U A;  1ZR4 A;  4BBS J;  3ML6 A;  5F08 A;  2E36 A;  3I59 B;  1XCB A;  4MNU A;  5JFR A;  2VXZ A;  5F0C A;  2R7Q A;  3S2H J;  3MWM A;  1U2W A;  4BUP A;  5GAE J;  1A36 A;  2H09 A;  1PP7 U;  4RLF A;  5M3M J;  4WK8 F;  4Y17 A;  2HDD A;  2XF6 A;  3GTG J;  3OS0 A;  3IAS 2;  4M3D A;  3BQY A;  4ZDP A;  1IN4 A;  1S7E A;  2GIV A;  2L7Z A;  3R0A A;  4M3E A;  1R5H A;  2BZT A;  4V2G A;  1P4W A;  2W82 A;  3KLO A;  2HYJ A;  3DEE A;  3K1M A;  1USS A;  2WY8 Q;  3KP2 A;  3RKQ A;  1T38 A;  1HKT A;  3M9A A;  4OIR F;  2E5N A;  4OIQ F;  4KUM A;  1FIP A;  1Z7U A;  2A6E F;  2E7X A;  2RQQ A;  1EH8 A;  4YFK F;  3PM1 A;  3HDD A;  4LG0 A;  2IS4 A;  5EEA A;  3H5R A;  3OIQ A;  4DOZ A;  4KYW A;  2A69 F;  3OYB A;  3C3W A;  4K2E A;  4UUS B;  1BN5 A;  3QPT A;  3BG6 A;  2X6X A;  1R00 A;  1OKR A;  1YW9 A;  4FIS A;  4IX7 A;  4M6V A;  4XBF A;  2W48 A;  2HFH A;  2D1V A;  1HW5 A;  3E97 A;  4E7J A;  2BVL A;  2K4J A;  5ILU A;  5IYD J;  3CO6 C;  2JRT A;  3GUD A;  4BJT A;  1AOY A;  1D0Y A;  2DT5 A;  2RN7 A;  1YJ9 I;  4PK4 A;  2B63 J;  4XLE A;  2R7R A;  3ZMU A;  1YJW I;  1G3T A;  2QZ8 A;  2GZW A;  3LMM A;  4YIR X;  2RGV A;  4BQN A;  1W5T A;  5BNG A;  4KMF A;  3C2H A;  2Y31 A;  1NG6 A;  1XN7 A;  2MBF A;  4AYB N;  4M74 A;  3BR6 A;  3M3Y J;  1X1A A;  1ZTR A;  3H3U A;  4XOP A;  4RA2 A;  2VKE A;  2E2J J;  3ISP A;  3ZCO A;  2P5L C;  4NB5 A;  3K4B A;  4CGZ A;  3MEX A;  3WTX C;  4X1E A;  4II2 A;  1LDD A;  1HLV A;  5KAF C;  1IXR C;  2CW0 F;  4PZJ A;  1WSU A;  2OV7 A;  2W84 A;  4ZZD A;  3L1P A;  1GVJ A;  1UMQ A;  5CLS A;  4BDZ A;  3E7L A;  3UKG A;  1T39 A;  3RDI A;  3OOU A;  4XID A;  1IF1 A;  3CLO A;  4Y15 A;  4CCL A;  3LA3 A;  3R4K A;  1KON A;  2ZC2 A;  2VKH A;  4LG3 A;  2L4A A;  4ETS A;  1PUF B;  2LF8 A;  3VFZ A;  1MDM A;  1REP C;  1SD7 A;  3RKW A;  2P8T A;  3C2G A;  4BYY A;  1IN7 A;  3I55 I;  1ZLK A;  2QEN A;  2WA0 A;  5E20 A;  1PUE E;  3JRF A;  2YU3 A;  2EWN A;  2BXY A;  3FIW A;  4IHV A;  3BC8 A;  1FMW A;  5HVQ C;  2XPV A;  5GAD J;  1Z7L A;  4XLP F;  1HQC A;  2LRD A;  4PSW A;  4RS8 A;  1AKH B;  1DU0 A;  2L54 A;  3CJN A;  1BC8 C;  4IHY A;  3EDP A;  1S5L C;  3P9C A;  2K7L A;  4C2M J;  2Y69 H;  1K61 A;  2OQG A;  3HB9 A;  4B48 A;  4DYC A; 
#chains in the Genus database with same CATH homology
 5IYC J;  5IOZ A;  2K9N A;  2E19 A;  1W0T A;  5EGO A;  4DZP A;  1TWA J;  1ENH A;  2P81 A;  3RQI A;  5EF6 A;  2VUM J;  4FTH A;  2TCT A;  3DCF A;  2JWT A;  1JJ8 C;  1ETQ A;  4MFD A;  3RZD J;  4DYR A;  1XS9 A;  1MBE A;  3S2D J;  1RKT A;  4NDL A;  2EZL A;  2XGC A;  2DN0 A;  3IH3 A;  1Y1V J;  2Y2Z A;  2DTZ A;  4BY1 J;  1LE8 A;  3OSG A;  5E3O A;  3ZQI A;  2LFB A;  4XRS A;  2WAQ N;  5E3L A;  2L7F P;  5IPA A;  2E2H J;  5JLX A;  2OPT A;  4C3I J;  3ZQL A;  4HNV A;  4B1R A;  2DA6 A;  3S1M J;  4MLO A;  4XRS G;  3B6A A;  4C3H J;  4RBO A;  1JUS A;  2HXO A;  4XK4 A;  4BXX J;  5EZH A;  1MBJ A;  5FKN A;  1IRZ A;  3HOY J;  1ETX A;  2LLK A;  4M3G A;  1GUU A;  2EZH A;  5J1R A;  2YS9 A;  3GBG A;  2DA7 A;  1WGX A;  5IYB J;  3ZQC A;  5FJ8 J;  2CQX A;  2JA8 J;  2R5Z A;  2CU7 A;  5EG0 A;  1ZR2 A;  3PO3 J;  5DTD A;  4ABZ A;  1QVT A;  4MFE A;  3TED A;  1JT0 A;  2VPR A;  4BKX A;  5M3F J;  1G2H A;  1A5J A;  2JMW A;  1F43 A;  1TWF J;  2WB1 N;  2RAE A;  1IDY A;  1EF4 A;  1NK3 P;  2KT0 A;  1U9N A;  2N8G A;  1BW6 A;  4A3C J;  4A3K J;  3BR2 A;  4JP0 A;  3TP0 A;  5E3M A;  2Y9Y A;  4C3J J;  1LFU P;  1B72 A;  1X58 A;  3GTK J;  4FE4 A;  2FQ4 A;  3S15 J;  3TP3 A;  2CJJ A;  2H1K A;  2XGE A;  3K7A J;  1JUP A;  1Q1V A;  5GP9 A;  1VFC A;  2OF7 A;  2O8K A;  1A6I A;  2MG4 A;  1PUF A;  4LOC A;  1JGG A;  5J1U A;  2CRG A;  3ZQG A;  2X6O A;  4XRM A;  4BBR J;  4QSH A;  3QPS A;  1GVD A;  2CUE A;  2LVS A;  4FE7 A;  4QIW N;  1ZKG A;  3H0G J;  3ZOB A;  4IEJ A;  3LSR A;  2AO9 A;  2VI6 A;  2JK3 A;  3SFI A;  4IHX A;  3JRB A;  2I10 A;  4J19 A;  1MH4 A;  2O7O A;  5J1Y A;  5F0F A;  3BTL A;  5IP9 J;  2KDZ A;  3BR3 A;  2E1O A;  3WHB A;  2X48 A;  1NTC A;  3OIO A;  5M5W J;  2DA1 A;  2DMU A;  1OCP A;  1MSE C;  3BTJ A;  1JT6 A;  1SFO J;  2ECB A;  3S16 J;  1IGN A;  5EDN A;  4QTR A;  2WV1 A;  1BA5 A;  5C44 J;  3K2A A;  4XIC A;  1GV5 A;  4D5F A;  4A3I J;  3H3V K;  5K7F A;  2Y9Z A;  4V2F A;  2HXI A;  2XPW A;  5FKM A;  1LFB A;  1ORK A;  1DU6 A;  1WPK A;  2QCO A;  2R7Z J;  2K9Q A;  3S1Q J;  2GLO A;  2XB5 A;  1IDZ A;  1IG7 A;  1OCT C;  2FJ1 A;  3I4M J;  2HOA A;  2XSD C;  1Z77 A;  4JX5 A;  3C2B A;  2X9D A;  2JA5 J;  3BTI A;  4RDU A;  2YU9 J;  2DMN A;  2DA4 A;  2M0C A;  5DS9 A;  2Y0S N;  2DA2 A;  1OFC X;  1P7I A;  2R5Y B;  5HOD A;  3JR9 A;  1GDT A;  2LK2 A;  4MIM A;  4M3B A;  5EGO B;  1MSF C;  3HBL A;  1BJZ A;  3TW7 A;  4JX4 A;  5EZG A;  3MVP A;  5C4J J;  3O8H A;  1AHD P;  3G1M A;  3BQZ A;  1ZGW A;  2E2I J;  3GTL J;  4UUT A;  5M5X J;  4A3D J;  3HOU J;  3GTM J;  5EYR A;  5IOY A;  2EZK A;  4A3E J;  3HOV J;  3ZQF A;  3Q0W A;  4MO7 A;  3MKL A;  3D1N I;  5F04 A;  4A3J J;  1I3Q J;  1MBK A;  1B8I A;  5E3N A;  1AU7 A;  1F36 A;  1ETV A;  4BY7 J;  2EBI A;  2LP0 A;  1U78 A;  2HOT A;  2DA5 A;  1LE8 B;  2JA7 J;  1HDD C;  3A03 A;  4A3B J;  1XC5 A;  5FKL A;  5F27 A;  3BR1 A;  3VPR A;  3SJM A;  1RKW A;  1MNM C;  2XPU A;  2COB A;  1GT0 C;  1JTY A;  4L5E A;  4I6Z A;  3TW6 A;  2HI3 A;  2EH3 A;  1RET A;  3NAU A;  3LNQ A;  1Z0X A;  1ETO A;  2D5V A;  3S14 J;  3Q3S A;  3LSG A;  1I6H J;  1VI0 A;  3BT9 A;  4AUX A;  1ITY A;  2ID3 A;  2L9R A;  1TWH J;  3A02 A;  3F0C A;  1FIA A;  2IAI A;  4B3A A;  4W97 A;  1B72 B;  5GPC A;  4FCY A;  2LKX A;  2HOS A;  1HCR A;  4DYQ A;  1ETW A;  2M8G X;  2M34 A;  2L7M P;  1BW5 A;  2MSY A;  3BR5 A;  5JLW A;  1BL0 A;  1JKP C;  5FKO A;  1UHS A;  3I4N J;  2R5Z B;  1MBG A;  5FKK A;  4A3M J;  5J3L A;  1QRY A;  5IP7 J;  3JRH A;  3LOC A;  4G12 A;  4A69 C;  4IHW A;  4D7N A;  1T33 A;  2NS8 A;  3IV5 A;  3JRE A;  1E3O C;  4DW6 A;  2NOG A;  3GTJ J;  3WHC A;  2R5Y A;  1JJ6 C;  5FLV A;  3CDL A;  1IV6 A;  1YRN A;  1VND A;  3O8G A;  2G0E A;  3JRA A;  3SDG A;  3CCY A;  1XG1 A;  3S17 J;  1WCM J;  1IC8 A;  2HQ5 A;  3GTO J;  2IBD A;  2MGQ A;  1FJL A;  4A3L J;  3BG9 A;  3CMY A;  1IUF A;  1X2N A;  2XGD A;  2AHQ A;  2ELK A;  3FIS A;  2R0Q C;  1RR7 A;  1HF0 A;  1NK2 P;  3DEW A;  4A93 J;  3FK7 A;  3M4O J;  1ZK8 A;  1D5Y A;  2NVX J;  1I50 J;  1P7J A;  4M3F A;  2DMQ A;  3HM5 A;  3S1R J;  1WH5 A;  4D5C A;  1ETK A;  4D7M A;  2NVQ J;  5F1J A;  4JX6 A;  3CQZ J;  5C4X J;  2XB0 X;  4S0H B;  5M5Y J;  1POG A;  2YUS A;  2K40 A;  2TRT A;  1ZR4 A;  4BBS J;  3Q0V A;  1UG2 A;  5F08 A;  2GM4 A;  4CYC B;  1MBF A;  2VKV A;  3IH4 A;  3GTP J;  5C3E J;  2XRL A;  5F0C A;  1H89 C;  3W6V A;  1YRN B;  3S2H J;  1FTZ A;  2EZI A;  1ZQ3 P;  5F0H A;  3A01 A;  4UUS A;  2M9H A;  2CUF A;  4EEF G;  3BTC A;  2GBY A;  5M3M J;  4X6A J;  2HDD A;  3GTG J;  2DA3 A;  3S1N J;  4DZJ A;  3FKI J;  1GV2 A;  3BQY A;  4M3D A;  1MH3 A;  3JRD A;  1S7E A;  1X2M A;  2L7Z A;  3NAR A;  4M3E A;  4V2G A;  3QPL A;  2NVT J;  2HYJ A;  3RKQ A;  1B8I B;  1APL C;  1IJW C;  1FIP A;  2CQQ A;  3PM1 A;  1FTT A;  3HDD A;  1TWG J;  5IP6 A;  2FX0 A;  2Y30 A;  5EEA A;  2JJ7 A;  4GFB A;  3GTQ J;  4UUS B;  2MW8 A;  3OSF A;  4A3G J;  2R93 J;  2QF7 A;  4B4C A;  1U8B A;  1H88 C;  4FIS A;  3LSP A;  4M6V A;  1WI3 A;  2R92 J;  3Q0U A;  4JYK A;  3MN2 A;  2W48 A;  2L0K A;  2M2E A;  3FK6 A;  1JTX A;  1OJL A;  2ECC A;  1JKR C;  5IYD J;  5EG0 B;  4I76 A;  1VF9 A;  2DJN A;  3BG3 A;  3LSJ A;  2DMP A;  3JRC A;  2H8R A;  2JA6 J;  2B63 J;  3HKZ N;  4CYC A;  2LD5 A;  1ETY A;  2ME0 A;  3HOX J;  2EQR A;  1R9T J;  5BNG A;  2Y31 A;  1CQT A;  1W0U A;  3A01 B;  1QVU A;  3PO2 J;  5K7Z A;  3G1L A;  4AC0 A;  4AYB N;  3BR6 A;  2O9L A;  3M3Y J;  3HOW J;  3BR0 A;  1ZTR A;  1U9O A;  2VKE A;  1JKO C;  1HDP A;  2E2J J;  4W1U A;  2LR8 A;  1MBH A;  3B6C A;  3HEF A;  3BG5 A;  4X1E A;  1Y1W J;  1HLV A;  3HOZ J;  1RES A;  3L1P A;  2LY9 A;  1UMQ A;  3JRG A;  9ANT A;  3E7L A;  3UKG A;  1RPW A;  3HGY A;  3OOU A;  4XID A;  5GPA A;  2FD5 A;  1PUF B;  2NS7 A;  3RZO J;  2IEK A;  2ID6 A;  2NVY J;  4Y7N J;  2ME6 A;  2K9S A;  1O4X A;  3JRF A;  1H8A C;  1FEX A;  5K7H A;  4A3F J;  3FIW A;  4IHV A;  5FLM J;  1HOM A;  1SAN A;  2PMZ N;  1WH7 A;  2XPV A;  3QQA A;  1DU0 A;  4Y52 J;  2JN6 A;  3JRI A;  1AKH B;  3G1O A;  2LTP A;  3ZQH A;  2DMT A;  3HGG A;  2ZB9 A;  4IHY A;  1JUM A;  1TWC J;  4C2M J;  1AKH A;  1JKQ C;  1TC3 C;  1K61 A;  1K83 J;  3HB9 A;  4DYC A;  1T56 A;  1QPI A;  3IH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...