2N8GA

Nmr structure of the homeodomain transcription factor gbx1[e23r,r58e] from homo sapiens
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
71
structure length
71
Chain Sequence
b'GAPGGKSRRRRTAFTSEQLLELRKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNERAKWKRIKAGNVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1[E23R,R58E] from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2n8gA00
5C44J 5IP7J 5IOYA 4BKXA 1H8AC 2XB5A 2EH3A 1MBHA 2NS8A 2HI3A 3LSJA 1CQTA 2K9SA 1X58A 1HDPA 5F0CA 5M5XJ 4AC0A 3C2BA 3SDGA 1VF9A 2QCOA 5E3OA 1IJWC 1I6HJ 3HOUJ 3NARA 5F04A 1HOMA 3G1LA 4IHWA 2EZIA 3BR3A 1MSFC 3SJMA 3TP3A 4B4CA 3BQZA 3Q3SA 1MH3A 1RETA 3ZQHA 2DA5A 1JGGA 3JRAA 1ETKA 5EF6A 5C4JJ 1O4XA 5EGOA 3QPLA 2L7MP 2E2JJ 1RESA 2HOAA 2VKEA 1NK3P 2E1OA 2M34A 1K61A 3RZDJ 5F08A 1X2NA 5M3FJ 4IHVA 4BXXJ 3CCYA 2JA8J 3S16J 1BL0A 3OIOA 4M3GA 2M0CA 2LKXA 1U9NA 2HDDA 5BNGA 1XG1A 1JJ8C 5C4XJ 1I3QJ 3IV5A 5EDNA 4QSHA 1IDZA 2ME0A 3Q0WA 1GVDA 4MFDA 2DMUA 5IYCJ 1WI3A 3JRCA 1K83J 3S2DJ 4RBOA 2FJ1A 1ETVA 1FIAA 2JWTA 2ECCA 2CRGA 4X6AJ 1VFCA 4MO7A 2LD5A 4FISA 2NVYJ 3OOUA 3HB9A 1SFOJ 2L9RA 1HLVA 3HM5A 3PM1A 4C3IJ 2R5YA 2CUFA 3IH3A 1RPWA 1Y1VJ 3H3VK 2HOSA 1BJZA 2G0EA 5FKLA 4XIDA 3JRDA 1LFUP 3HBLA 4LOCA 3HEFA 2W48A 1Z0XA 1HCRA 1QVUA 4V2GA 2P81A 1BW6A 3GTPJ 1GV5A 2ME6A 1MBJA 1IG7A 1ETQA 1LE8B 3PO2J 2K40A 2R7ZJ 2DMNA 2NOGA 1H88C 4X1EA 3DCFA 5IYBJ 1U9OA 1VNDA 4CYCA 3BT9A 2FD5A 2R93J 5K7HA 2M8GX 5EZHA 3MKLA 3IH2A 4J19A 1PUFA 1HF0A 1F36A 5EG0A 1OCTC 4BY1J 2MG4A 3GTOJ 2EZLA 3NAUA 2XPVA 2LK2A 3VPRA 1MBGA 3D1NI 4UUSA 1U78A 4M6VA 1HDDC 3HDDA 1WH7A 4NDLA 1B72A 4W97A 3BG9A 1JJ6C 1APLC 3FKIJ 5F0HA 2QF7A 1DU0A 2CU7A 2ID6A 1GUUA 2XPUA 1T56A 2DA4A 3S15J 1IC8A 1P7JA 2EZHA 2I10A 2PMZN 4GFBA 1WPKA 2DMTA 2TRTA 1UMQA 1T33A 3FK7A 2JA7J 4FE7A 1RKWA 4EEFG 1JUPA 2ID3A 2WAQN 4MLOA 5EGOB 1X2MA 1JT6A 3FIWA 2DTZA 3G1MA 1RR7A 1G2HA 2HXIA 1GDTA 1TWGJ 3JR9A 1QVTA 1ZR4A 3BTCA 3MN2A 5E3LA 4D7MA 5FKOA 3A01A 2CUEA 3LOCA 1ETOA 2KT0A 4B3AA 3HGGA 2FQ4A 4BBRJ 3JRHA 5EEAA 1RKTA 1IV6A 1ORKA 3HOZJ 5J1RA 2NVTJ 3LNQA 3HOYJ 3MVPA 2CJJA 2OF7A 3RKQA 2DA3A 1Y1WJ 3S1RJ 3G1OA 1B8IA 1ZK8A 3BR2A 4V2FA 3WHBA 3BTJA 2WB1N 1ZQ3P 2XPWA 1F43A 5J1YA 2K9QA 1FIPA 4UUTA 4S0HB 4MIMA 2WV1A 2E2HJ 2X6OA 1TWCJ 1Z77A 2N8GA 1A6IA 4M3BA 1W0TA 4DZPA 2GLOA 2NS7A 3HOVJ 1JTYA 5HODA 3QPSA 1AKHB 1NTCA 3SFIA 4Y7NJ 2R5YB 2EZKA 3LSRA 2IBDA 3TW6A 2X9DA 1MBFA 4XRSG 1TC3C 1BA5A 2TCTA 3HOWJ 2XRLA 5JLXA 1JKRC 1ZTRA 3JRIA 3LSPA 3OSFA 1MBEA 3PO3J 2CQQA 1R9TJ 4A3BJ 1IRZA 4JYKA 4A69C 3GBGA 4A3EJ 2Y0SN 1ETXA 4Y52J 2Y30A 3CDLA 2CQXA 1AKHA 3JRGA 2LTPA 2E19A 1MH4A 1D5YA 3ZQIA 4I76A 4A3LJ 4C2MJ 3WHCA 3K2AA 5EYRA 5FKNA 1QPIA 4JX6A 4L5EA 2ELKA 1ZR2A 1UHSA 1IUFA 4CYCB 1WCMJ 4RDUA 2VUMJ 5IP9J 1PUFB 5M3MJ 5EG0B 1S7EA 2K9NA 2LVSA 1OCPA 3BR1A 2KDZA 2NVXJ 2JN6A 4UUSB 3BTIA 3S2HJ 1JT0A 1B72B 4C3JJ 5F27A 4FE4A 5IPAA 1GT0C 4MFEA 3ZQLA 1JTXA 3Q0VA 3BR5A 5E3NA 1I50J 3BQYA 3L1PA 1JKOC 4IHYA 1TWHJ 2DMQA 4M3FA 4D7NA 2ZB9A 3GTKJ 3A03A 5FKMA 4AYBN 2JMWA 1IDYA 3ZQGA 5K7FA 2HXOA 5J1UA 1OFCX 5K7ZA 1DU6A 1YRNA 3S17J 2GBYA 1POGA 3GTJJ 3GTMJ 1TWAJ 3A01B 2R5ZA 2X48A 2R92J 1WH5A 4XRMA 2Y31A 3HKZN 2L7FP 5IP6A 2OPTA 3RQIA 3E7LA 4ABZA 2XGCA 1P7IA 3IH4A 3FK6A 2XGEA 3BTLA 4JX4A 2O9LA 2LP0A 1B8IB 2HYJA 3RZOJ 4D5FA 3FISA 5GPAA 3GTLJ 2JK3A 3S1MJ 5FLMJ 4BY7J 4BBSJ 3W6VA 4A93J 1ENHA 5DS9A 4A3IJ 3S1NJ 5F1JA 3K7AJ 1IGNA 3ZOBA 2Y9ZA 3HOXJ 2LR8A 3O8HA 2DA7A 1LFBA 2Y9YA 4FTHA 1BW5A 5FLVA 3BG5A 3I4MJ 1EF4A 1MBKA 2COBA 1U8BA 3TP0A 1XC5A 3BR0A 2EBIA 3M4OJ 5DTDA 2HOTA 2XSDC 4M3DA 1AHDP 1JUMA 2M2EA 2YU9J 3O8GA 5F0FA 4A3CJ 3Q0UA 2AHQA 1FTTA 2XGDA 2GM4A 4XK4A 5M5YJ 4A3FJ 3JREA 2D5VA 4FCYA 2B63J 1ETYA 1FEXA 1JKPC 4IEJA 2L0KA 2YUSA 3UKGA 2DA1A 3GTGJ 3TEDA 1QRYA 2O8KA 5JLWA 3TW7A 1E3OC 4C3HJ 2HQ5A 5C3EJ 2H1KA 4A3DJ 2LY9A 1VI0A 3ZQCA 2AO9A 4QTRA 4XRSA 3BG3A 3GTQJ 2DA2A 3S14J 4IHXA 1JUSA 3OSGA 2DJNA 4I6ZA 2JA6J 4A3MJ 4DW6A 1FJLA 2H8RA 2VPRA 1FTZA 1W0UA 1ITYA 3JRBA 3F0CA 5J3LA 4W1UA 2MSYA 1NK2P 2E2IJ 2JA5J 4JP0A 3CQZJ 4AUXA 2L7ZA 1XS9A 4A3GJ 2MGQA 4DYQA 5E3MA 3M3YJ 1YRNB 3QQAA 1H89C 3BR6A 2Y2ZA 1MSEC 1ZGWA 5GPCA 3ZQFA 2R5ZB 4XICA 3H0GJ 1Q1VA 4A3JJ 3JRFA 2NVQJ 1JKQC 4JX5A 4G12A 5M5WJ 1WGXA 2MW8A 2JJ7A 4DZJA 5IOZA 2DA6A 2DN0A 3CMYA 4D5CA 3S1QJ 1GV2A 1TWFJ 2ECBA 2RAEA 5IYDJ 2IAIA 2XB0X 1SANA 1MNMC 2R0QC 3I4NJ 2VKVA 4B1RA 2DMPA 3A02A 2LFBA 4HNVA 5GP9A 1ZKGA 3HGYA 5FKKA 1ETWA 3B6AA 2O7OA 1LE8A 3LSGA 2LLKA 4DYCA 2YS9A 5FJ8J 9ANTA 2FX0A 4DYRA 2IEKA 2VI6A 2M9HA 4QIWN 1A5JA 3B6CA 1OJLA 1UG2A 2EQRA 3DEWA 1AU7A 5EZGA 4A3KJ 4M3EA
chains in the Genus database with same CATH superfamily
3Q9VA 4AVZA 5E18F 3L2UA 2BHZA 2FMLA 1CQTA 1XD7A 3WU0A 4WWCA 2K9SA 2CG4A 1VQNI 4AC0A 1QNTA 4IRGA 4Y33A 5A2QK 2QCOA 2F5CA 2K4JA 4M9XA 2HFHA 2QSGX 1DPUA 2V1UA 1M1EB 5HLTA 1A36A 4UB6C 3PFIA 4OU0A 2DA5A 3ZQHA 1JGGA 3JRAA 3QPHA 4M9SA 4R79A 3ERED 4ZYDA 1O4XA 4XKVA 5HS8A 2J5PA 3QPLA 4UVAA 1G3SA 1WQ2A 2M45A 1MMGA 1HKTA 2OQGA 2M34A 3HXLA 3LAPA 2ICWG 3CCYA 3SHFA 5L3DA 3CUQA 2XF6A 2JA8J 4F55A 2GAUA 1VZ0A 2M0CA 4NC7A 1X19A 5BNGA 3FMRA 4A2UA 1I3QJ 2V4JC 2VLAA 2ME0A 3NEUA 2DTRA 3RSNA 2DT7B 2ZMEA 3RJPA 1GVDA 1NG6A 1BR4A 3W6KB 3JRCA 1G59A 1TNSA 3DXJF 1S3JA 1YW8A 2DYRH 1ZGJA 1U0JA 1ETVA 1FIAA 4RBOA 3HL2A 4PCQA 4LMYA 2QBYA 4MO7A 2LD5A 1E17A 2W00A 4FISA 4PFPA 2NVYJ 1YE9A 2HU9A 2RV8A 3DTIA 4HOBA 1VQLI 3OY9A 1HLVA 4PSWA 3DKWA 4G8XA 3DTKA 2R5YA 3IH3A 4HNUA 3H3VK 2K3PA 1V4RA 3RKYA 4ZTFA 4YEJA 2VOOA 3QOPA 3W2WA 1HXDA 4PUSA 4QLCU 2W48A 1Z0XA 1QVUA 1DP7P 1SVMA 2W25A 2JVHA 2P81A 2RQQA 1IG7A 2V9PA 1WKMA 3WE2A 4HV5A 1H88C 4X1EA 2H27A 2CW0F 3DCFA 4BUPA 2DPDA 1VNDA 3OYJA 1OYIA 3F9KA 4CYCA 2YPRA 5CJ9A 1PP7U 1W4MA 4XLNF 2DBBA 3M1CA 3O3KA 3IH2A 1F36A 5EG0A 3PIPF 2FOWA 4PZJA 3H9JA 2CQ7A 1R5GA 3HHHA 3NAUA 2LK2A 3VPRA 1PJRA 2I8DA 3D1NI 4M6VA 5FROA 1T08B 2K86A 1WH7A 3FXQA 3HRTA 4F91B 1O3SA 2V1XA 4G7ZF 2QF7A 4ZTJA 4YRVA 2FEZA 1Z6TA 3V4GA 1P7JA 2I10A 3QPTA 3OOPA 2QA4I 2LNBA 2ISYA 2JA7J 2QKLB 3F8MA 4FE7A 1YHQI 4L0YB 3WGHA 5HVQC 5BPDA 2G7UA 3K4NA 4ZYEA 5EGOB 3H36A 4IXAA 1JT6A 1OR7C 2DTZA 3FIWA 2VXZA 3G1MA 4RM3A 1GXPA 1G2HA 3OL3A 3JAMZ 2MLGA 4C30A 3JR9A 2EIKH 2ZO4A 1I3AA 5GAHJ 4QPOA 4D7MA 3J7YJ 2HPMA 3PUBA 4Q47A 3A01A 2Z1DA 2E7XA 3P9KA 4UY8I 1ETOA 4HLXA 1H0MA 2FQ4A 4ENJA 3VWBA 2F5FA 5EEAA 3HKZA 4E7IA 3HOYJ 3MVPA 1EV7A 2OF7A 5EJCA 1HW5A 1Y1WJ 3S1RJ 3G1OA 1B1BA 3E5UA 4BEHB 2K9MA 4HBLA 3ZQ7A 2WB1N 5AIPA 1O3RA 2ADUA 1FIPA 3F72A 1JGSA 4BDYA 1IO2A 4RAFA 2X6OA 1Z77A 5J8CA 4M73A 4DJAA 3K10A 3J80Z 1W0TA 4DZPA 4HA8A 4ZDOA 5HLGA 1YW7A 4RS8A 1IXSB 1T6SA 5LRSA 2GIZA 3QPSA 5CQEA 1BBYA 1T0FA 1WFXA 2R7OA 4S05A 1SD4A 1NTCA 4PK4A 4RB3C 2E71A 3DPTA 2WB1A 2DK8A 4D1QA 4CA0A 2JUGA 1RUOA 3TW6A 2X9DA 3RI4A 1OISA 4BS9A 5HLHA 3AG3H 3CCSI 2L02A 5BQTA 3IUOA 4L9JA 3LSPA 3TO6A 1MJAA 2NAZA 2QSHX 2CQQA 4JYKA 4A69C 4A3EJ 2Y0SN 5J47A 3CDLA 2BY3A 2RNGA 1U2WA 2E19A 1EA3A 1LNWA 2L4AA 4BE1A 1MH4A 1R71A 1D5YA 3AAFA 3OYNA 3OMYA 2M8EA 1H9GA 2W24A 4B44A 4YFXF 1QPIA 1MD0A 1SFEA 2VOPA 1VQMI 1LDJA 3KP3A 3W6JB 3F3XA 3GFLA 2W4SA 4B43A 1SFUA 1PDNC 4XN0A 4HDVA 1SMYF 2VIXA 5ICFA 2P5LC 1FOKA 1G3YA 2K9NA 1U3EM 2E5NA 2LVSA 2IS6A 2X4HA 2DW4A 1PYVA 1DP3A 4UUSB 1O3TA 3N4MA 2P5KA 3CMMA 1P6RA 5FRMA 5IPAA 4CO8A 2DT6A 3CP8A 3OR1C 3Q0VA 4LGWA 2QZ8A 4WXCA 3CLOA 4RA2A 1MDMA 3KP5A 4AVPA 3L1PA 3IKTA 1TNTA 3KLOA 1JKOC 2GQQA 5HDNA 4U7BA 1G6NA 3L9FA 2NS0A 2R7WA 1SAXA 1WI9A 3A03A 3E5XA 4AYBN 3OYHA 2WC2A 4CCMA 3ABLH 3QYFA 1WJDA 1FPQA 3K70C 1L3LA 2P0WA 1YRNA 4NHJA 1V54H 4LG3A 3R4KA 2GBYA 3CF5F 2R5ZA 1XDSA 2X48A 2YX7A 4RAGA 1T38A 1FT9A 3WODF 1G4DA 2ESNA 1USSA 2Y31A 4DIQA 5IP6A 2VT2A 3RQIA 4OMZA 1P9QC 4ABZA 5L3GA 4I98B 2QGUA 1XCBA 2KKOA 3GVAA 3L2QA 2DFEA 1Y6IA 5GAEJ 2XGEA 3QYEA 2LP0A 1W7PA 2ZKZA 1B8IB 1ACIA 2MH9A 4UXNA 3QP5A 5FB2A 1QHHD 4KMFA 1QPMA 3S1MJ 5CQGA 3CESA 3DV8A 4BBSJ 1OKRA 3B02A 1HQCA 1ENHA 5F1RA 4KMUX 1YYVA 3S1NJ 4UV8A 5HLIA 1Z05A 1ON2A 4ZC3A 5J8FA 2VE9A 2LR8A 3GW2A 3O8HA 2DA7A 2Y9YA 3W3CA 3SEZA 4B47A 4A5MA 3T8RA 2OZ6A 3ML6A 2LF7A 2ZNZA 1HSJA 1MBKA 3ECHA 2RDPA 1XPXA 1U8BA 2W57A 3Q5FA 2XAJA 5B3SH 1T2KA 2DLLA 4M3DA 2KJCA 2ELHA 3O8GA 5JFRA 4A3CJ 4PDKA 1FMVA 1UHMA 4XOPA 4RGRA 4MHGA 2HVRA 1FTTA 2GM4A 5M5YJ 2H6BA 3JCUC 3JREA 2FSWA 2KP6A 4FCYA 2P6TA 1XMXA 2NNNA 2QEXI 3A0BC 3ZXSA 4OAYA 2AXLA 4LJZF 4UUVA 4XONA 2HZTA 4LLGF 3IP4B 2LH9A 2BEOA 2LBFA 3TEDA 4O3MA 1QRYA 3AFHA 4BDZA 2O8KA 3C18A 4BYYA 5JLWA 2IJLA 1E3OC 1IRGA 4YELA 2HQ5A 5C3EJ 1ZN2A 1R4MB 2Z2SB 5CYVA 1WHUA 1R00A 4A3DJ 2LY9A 2QVOA 3I64A 2CSOA 3CC7I 1U5TB 4IJAA 5L3CA 3BJOA 2XV4S 2Q1ZB 3HG9A 4XKWA 3M8FA 1HW1A 2DJNA 5TGTA 4A3MJ 4DW6A 5BMZA 1HC8A 5LEKA 3IWFA 2JRTA 1TP4A 4ZDPA 1GVJA 2DT5A 3LL7A 4DGWB 1MMDA 3JRBA 2CGPA 5J3LA 1J5YA 4W1UA 4RB1A 3GO5A 2CV0A 3K69A 2MSYA 2E2IJ 2JA5J 1G8XA 3KE2A 2QQBA 1I1GA 2L7ZA 4M71A 4J01A 5EEHA 2O0YA 2HVSA 1H89C 2GXGA 2W7NA 2KJBA 3ZQFA 4XICA 4BACA 3ROUA 1BR1A 4HLYA 3TQNA 3CZ6A 2OUMA 4JX5A 4OINF 1MMAA 2KPMA 2MW8A 1QBJA 4DZJA 5IOZA 1OPCA 1D3YA 1BM9A 2DA6A 2ZBKA 2DN0A 4MTDA 3S1QJ 1GV2A 4HSRA 3AG1H 1FOYA 2E1MB 2IAIA 3HSRA 5IYDJ 2JT1A 2ZC2A 4D9JA 1D1AA 5IY5H 2R0QC 2DXIA 3OWTA 2QKMB 4HNVA 5GP9A 4RMNA 3HGYA 1BOAA 5FKKA 3OYKA 2AXTC 1LE8A 2FUG2 2XRNA 1MZBA 1LEBA 4DYCA 2YS9A 4DYRA 1FOWA 2COMA 3DEUA 2M9HA 3LFUA 1E3PA 3C2HA 2VQHA 2C6YA 3JAMK 1OJLA 3CJQB 2IVMA 3CDIA 2OCEA 2X6XA 4A3KJ 1TW2A 3KLNA 2CUZA 4KJZA 3E5QA 2EH3A 2NS8A 2MLKA 4Y17A 2HI3A 1EH7A 3BPVA 3HSFA 1VQ6I 2K85A 2BE5F 3KP2A 1X58A 2K4BA 1KYWA 4PJMA 1VF9A 2P4WA 1AOYA 1YG2A 5E3OA 4YFKF 1U5TC 1Y8RB 1XTAA 1FMWA 3G1LA 4F93B 5LEJA 1T39A 1FYMA 1R58A 3MZ8A 4MQ9F 2PMZA 1MSFC 2K3FA 3FM5A 3Q3SA 2DFIA 4DBRA 3U1DA 2L01A 4AIKA 5C4JJ 1KGSA 4E7LA 2WAQA 4IPAA 4DNCA 1D0XA 2E2JJ 1RESA 2HOAA 2EK5A 2VKEA 1NK3P 3RYPA 3SYTA 4HF0A 3ZMUA 1K61A 3RZDJ 1PP8F 1D5VA 5M3FJ 2FNPA 2D1VA 3QYBA 4IRIA 2EJRA 1U8RA 3UR3C 3OIOA 2LKXA 2WA0A 2DOAA 2CWEA 1I39A 3OYFA 2R7VA 5H6RA 3IWZA 3M8EA 5HDGA 3CLQA 3LWFA 4XKCA 3JTGA 2FBHA 5C4XJ 5EDNA 4QSHA 2H8WA 3N97A 2MH2A 4LIVA 1TLHB 1FNNA 3Q0WA 4U0YA 2E1MC 3HPGA 4MFDA 2DMUA 5IYCJ 3F8FA 1XX5A 2JTVA 1K83J 3BLYA 1Z7LA 2FOKA 2JWTA 3DFGA 2CRGA 3COAC 4X6AJ 1VFCA 3I58A 1RNLA 6PAXA 5TJJA 2HZDA 4CHUA 2EPFA 3RYRA 4ESJA 3OOUA 1BN5A 5L3EA 1R23A 1SFOJ 2VJ5A 2L5QA 2WTEA 1WZ2A 3LA2A 4NC8A 1Q1HA 3CO6C 3D0SA 4IVNA 5L3BA 4NB5A 1RPWA 3C3WA 1CF7B 3HHGA 2HOSA 1G3WA 3HRUA 2XF7A 3ZR8X 2X1EA 5FKLA 4DBQA 4RM2A 3JRDA 1YJNI 1BR2A 3HBLA 3CMAI 3CCJI 4D0PA 4PGGA 3GFIA 3HEFA 2BW3B 3MAJA 4HV6A 1BW6A 3EQLF 4KFCA 2NVUB 3OYAA 1UHWA 2HWVA 4N0BA 1V55H 2EV6A 4KYWA 3S2WA 4M6YA 4G7HF 2KMUA 1U9OA 1O7LA 1CGPA 4EJVA 4HAMA 5K7HA 4Y3OA 1WJCA 2BYVE 3H5NA 1PUFA 1XSXA 4DOZA 1Z67A 2EZLA 4ZH4F 1YI2I 1YOVB 2Y48A 1U78A 1HDDC 1JHHA 4I0AA 4AD9A 4NDLA 3BG9A 1APLC 4OIOF 1KQ9A 1X1BA 5F0HA 1DU0A 1XCVA 2CU7A 2ID6A 3I59A 1T56A 2DA4A 1IC8A 4GFBA 3K4MA 1LUJB 1UG0A 2BGCA 2KFDA 1UMQA 4MQVA 3FK7A 2BV6A 1WRJA 2ZCWA 4A6DA 1RKWA 3J7ZI 1B6AA 2XAHA 1K78A 1C0WA 2PG4A 4LFUA 5JHUA 1QO0D 3C7JA 4EQQA 5CVVA 1LVKA 2ZSHB 2A6HF 2DOEA 1RR7A 2PLYA 2L9SA 3HSEA 3K2ZA 4M72A 1ZR4A 1GHCA 3V8KA 4N4NB 3CUQB 2CUEA 3GZ5A 1I27A 2W84A 3LOCA 2KT0A 4B3AA 3RKWA 4NUBA 4BBRJ 3OYEA 1B59A 3A2KA 3P5JA 3AG4H 4CXFA 2R7RA 1TZLA 1P4WA 2CJJA 3RKQA 2HQRA 2DA3A 4LK0F 4OOIA 1SEUA 2ZMEB 4Y13A 1WJAA 1ZK8A 3BR2A 5K1YA 4B09A 3BTJA 5D5WB 3VYTB 2K9QA 1PUEE 4EM2A 2XUBA 3QU3A 4MIMA 2NYXA 2M1BA 1TWCJ 2N8GA 2QBYB 1Z6RA 2E34A 3RTRA 3GLXA 1X1DA 4II3A 2MD5A 2GLOA 2NS7A 2P7VB 3HOVJ 3C2GA 2W1OA 1N78A 4LLLA 4KDPA 5J4YA 2BZTA 2BVLA 2XGXA 3SXYA 3VSLA 4A6EA 3F22A 2HPIA 1D8JA 2R5YB 2F6CA 1P4AA 3MFKA 2X0LA 1YJ9I 3FDYA 5DYMA 5JLXA 3GX4X 3GZ6A 2KL4A 3E1SA 2Q2EA 1X3WB 3PO3J 2JSPA 4A0ZA 1R9TJ 4XLCA 4A3BJ 1JXSA 3L2RA 3GBGA 1H9TA 3OS2A 3JRGA 1X1PA 4PGHA 2BXZA 1N77A 4C2UA 1HSTA 1IN4A 2F5EA 2KISA 3WE3A 3NRVA 4A3LJ 2A69F 3K2AA 5EYRA 2LY1A 5FKNA 2ZJQF 3EYIA 1SD6A 2FE3A 5E17F 1ZRDA 1IUFA 3OS0A 4CYCB 4IHTA 1XGOA 2X6WA 1KQ0A 3R0AA 4EJUA 2WBMA 4WX9A 2VBYA 3E6DA 5B66C 5EG0B 1NHAA 1S7EA 3KIOA 4BQAA 5FD5A 2MBFA 2KDZA 1XSVA 3PIOF 3I3LA 2LSOA 3BTIA 3LA3A 4ETSA 2ZXJA 3CUQC 1VQOI 3RPUD 5DDGA 3JSPA 2Z16A 4MFEA 1P2FA 1YW9A 3ZQLA 1I5ZA 1JTXA 2KZGA 1FZPB 3L00A 2WV0A 2GXAA 3VSKA 3BQYA 3G4SI 2LYCA 5BPIA 2ZMEC 1KU9A 2DMQA 1U6GA 4D7NA 2CO5A 5FKMA 1IDYA 4NBQA 4IOCF 2O03A 5IT9K 5K7FA 4KA4A 3PJRA 1MNDA 3WGGA 3DQVC 4F92B 5IT3A 4BHBA 2MYSA 1TQPA 3GTJJ 1TWAJ 3DU5A 3A01B 1LB2A 4EGZA 3BZ6A 3UNGC 1WH5A 2ZJ2A 5H2FC 2DCEA 2IGKA 3I71A 3HKZN 3M1EA 1V5FA 1IW7F 4PJLA 2OPTA 1SVOA 3H3ZA 4CYDA 1WJEA 1P7IA 3IH4A 3FK6A 2HQNA 3KETA 4JX4A 3IHUA 1W36C 2O9LA 4KNYA 2XAQA 2QSFX 3FISA 4KUMA 5D6EA 3ULQB 2IGNA 2KHMA 1BIAA 3CP2A 3SQNA 1W5SA 1ZG3A 3SFZA 5FLMJ 1TTYA 3DKYA 4E7KA 3W6VA 2L7KA 3VEPA 4OIRF 1OCZH 2XKPA 4A93J 1KU2A 3LFKA 5DD8A 2LKPA 5F1JA 1YO5C 2QQ9A 5LHGA 2IA2A 5LGUA 1MKMA 4Y4RA 3ZN0A 1IAWA 2Z9OA 2M4KA 3TOAA 2Y9ZA 4M74A 3HOXJ 1FYKA 4C9YA 2RNJA 1LFBA 4U7DA 3RIRA 1BW5A 2GWRA 4KN7X 1F4KA 2M30A 5AONA 5FLVA 1EF4A 2WADA 2V26A 1OCRH 4HW0A 3TDUC 3CCEI 1X4OA 5DV5A 4BU2A 3OYGA 2EV5A 4E6KG 2HOTA 5HNFA 1AHDP 4CGZA 3M9AA 4ZYAA 2YU9J 4BXUA 3Q0UA 2EFOA 4N9HA 2AHQA 1X4PA 1L0OC 2RC4A 4A3FJ 1VTNC 2HDWA 3KP4A 2UXXA 4HG2A 3FX3A 2A07F 1MNEA 2OC6A 1TT0A 4HEA2 2QQ8A 2O5RA 2IGMA 1FEXA 3NWTA 1Z1DA 2XAUA 1FOXA 4RGXA 3E0JB 4G9YA 4UNOA 3BZCA 1W5TA 5L3FA 4A12A 2L0KA 2YUSA 3QP6A 1ERDA 1A31A 3K4BA 2DA1A 4CUGA 4FX0A 4H4KC 3TW7A 4KIGA 4ASNA 2H1KA 4BNCA 2D1HA 2TDXA 2L4MA 3K4LA 4A0XA 2O6GE 3ZQCA 1ZGAA 3QODA 2KIQA 2LOOA 5JR3A 3BG3A 4GYGA 3R0JA 3S14J 3GWZA 3GFJA 4Z2YA 1STZA 3KPHA 4I6ZA 3I5UA 4QPQA 1FJLA 1JHFA 2B0LA 3WG9A 4AIDA 1MDMB 4XKBA 3IL2A 4EM0B 2F4IA 4PJJA 5JHFA 1ITYA 3TL4X 3F0CA 1RRJA 2QYOA 1LJ9A 5K5OA 2QENA 2MABA 3A1YA 2CH0A 2M87A 3W2AA 4O5VA 2DDAA 1UCRA 3M3YJ 3M8JA 4U88A 1YRNB 1LQ1A 4FETA 5CLSA 3FBIB 4EJWA 5HNHA 1ZGWA 5D6FA 2EA4A 1IN6A 2R5ZB 2VPLA 2JPCA 2A3SA 4E7HA 1Q1VA 2A6TA 1T0FC 2FF4A 2NVQJ 1YITI 1JKQC 4G12A 5KVRA 2K9LA 5HS9A 3RKXA 1WGXA 3I54A 5M5WJ 3GLLA 4BAYA 2CMPA 4BQQA 1ZG1A 1N25A 1XB4A 1REPC 4GYIA 4UVCA 3I4PA 3K6GA 3A0HC 2NOJB 2RAEA 3ZPLA 1W7PB 3ELKA 2Q0OA 2RN7A 2FMYA 3WG7H 4XBFA 3I4NJ 3QRFF 2VKVA 1FX7A 4XN3A 5DD4A 4B1RA 5HOOA 3PQKA 1ZKGA 3T5XA 1QZEA 3F8NA 3V7RA 4F52A 3JSOA 1OLTA 4ON0A 4LG0A 2LLKA 3LSGA 3CCVI 2WWYA 9ANTA 3REOA 2FX0A 3DPUA 4PSXA 1ODDA 2X1DA 2ISZA 5K5QA 3B6CA 4BE0A 3DEWA 5E1XA 2IRFG 4M3EA 5IP7J 5IOYA 4BKXA 3GXOA 2Y75A 4GXOA 2XB5A 1MBHA 1R7JA 2XHKA 5D5VB 2R7TA 3GZNB 3LSJA 1EJ9A 4HX8A 4I7HA 1HDPA 4IRHA 5M5XJ 3D5RC 2R7QA 1Y39A 3C2BA 4R1HA 1IJWC 3SZTA 5HDKA 1HOMA 4I2OA 4BJTA 1UJ8A 4IHWA 3OL4A 1SAUA 2DK5A 4PFOA 3FXLA 3SJMA 4PJ0C 3BQZA 5D4SA 1MH3A 1RETA 1K79A 2JVGA 4IQJA 1IRFA 3FXOA 1ETKA 3FXUA 3M7GA 3PL8A 2L7MP 3CJNA 2LBFB 1VQ9I 2LDUA 2CV1A 1DPRA 5ILVA 3LSTA 3K1NA 5D8KB 1XSDA 3ZMSA 2ETHA 3D5LA 4MTEA 5FD6A 3PNYA 4BXXJ 4XLAA 3ZGKA 2QWWA 2WAEA 3IAM2 1BL0A 1TBXA 4ESBA 2L54A 5LRRA 4MNUA 3RQ4A 1JJ8C 2R7XA 3O2PE 4RAZA 3ZN1A 5GADJ 2YU3A 3MZYA 3ZP5A 1PVEA 1J0RA 1I6XA 1MJBA 1W36D 3E6CC 2E35A 2VKHA 3CF2A 2M3AA 3HRSA 4II2A 3S2DJ 3FXRA 5DCMA 2FJ1A 1YS7A 1Z7UA 2ECCA 2WY8Q 2XVCA 3K1MA 4EGYA 5KCMA 4BXFA 1EKEA 1A04A 3HB9A 3PUFA 2L9RA 4GGGA 3K4CA 3SDBA 1RUNA 5LBQA 1Y1VJ 4E70A 1NH3A 2R3SA 4KN4X 1BC8C 2EFWA 1BJZA 2BXYA 3M07A 4XIDA 1Y0NA 2H94A 1XDUA 1TT5B 4LOCA 2A5YB 2DJIA 5DCFA 5B5EC 4ZYHA 3ZRGA 4V2GA 3BJAA 3LQRA 3SZPA 4CZZA 1B9MA 3WTYC 4JOMA 3BOQA 3KCCA 2ME6A 1MBJA 1ETQA 5GTIC 1LE8B 2K40A 2CV2A 1GXQA 1UFMA 2O3FA 4ZZLA 1IN8A 5CVIA 1AA7A 4OAZA 3ABUA 3KEYA 1S6LA 3ECOA 3ISPA 1FBQA 3VYRB 4HF1A 2DDBA 1FYLA 2FD5A 3TBIA 2R93J 4BE2A 2M8GX 5EZHA 2PJRA 3MKLA 2R7UA 1R22A 4J19A 1HF0A 4BY1J 1OCTC 2XAFA 2E1CA 2ACJA 1IXRC 1VQ7I 4HQMA 3W2VA 1E0EA 3GUDA 5IT9Z 3IAS2 1B72A 4W97A 3J81Z 5CVRA 2CQNA 1E3HA 2CFOA 2XPUA 1GUUA 3K4JA 1TW3A 5LGNA 2EZHA 2V6CA 2PMZN 2DMTA 3OS1A 2TRTA 3V8JA 4P1WA 2A6EF 2IP2A 4J00A 2LREA 2P8TA 4EATA 2Z99A 2DQLA 4MLOA 2WAQN 2XC7A 4NC6A 2AQEA 4PJNA 3P9CA 2KQRA 2HXIA 3EUHA 2VN2A 3KZZA 4B3XA 1GDTA 2A05A 2VBZA 4FX4A 3MZHA 2F4OB 3IRQA 1QVTA 3ZMDA 2IS4A 3AKZA 2G9WA 1S7AA 2IGOA 3BTCA 5FKOA 2HNHA 2HR3A 4UVBA 1VQKI 5GAGJ 3HGGA 3JRHA 1IV6A 1ORKA 5J1RA 3S8PA 3H9QA 5FRNA 3RCOA 3LNQA 3WU1B 3ASOH 3V7CA 1X3UA 1TL8A 2ZNYA 3BG7A 3K70D 1ZH5A 1USTA 1S29A 3GEZA 2X1CA 1OQYA 1YQAA 2XPWA 1T95A 1D1CA 1LPQA 4S0HB 2VODA 2WV1A 2E2HJ 1VQPI 3K9TA 2E5ZA 2R7FA 3HYIA 1UZCA 1HBXG 3L7WA 3LQQA 1LVAA 2JPBA 2VJIA 4HPQA 4I02A 1YS6A 2L3DA 1AKHB 4HQEA 2KLOA 3CC4I 4Y7NJ 4WXDA 1K6YA 3BJ6A 3WTXC 2RREA 3PSIA 3R60A 2IBDA 3U21A 4XRSG 2I5UA 1BA5A 4U87A 2TCTA 3HOWJ 2OCCH 2XRLA 4E7SA 4ZZDA 3HUGA 3T0YA 2OU2A 3JRIA 3OSFA 1MBEA 5CVJA 1LDKB 2VE8A 3P9IA 4IL6C 3EPZA 2Y30A 5KAIC 4P5OA 2CQXA 3F8BA 5FO5A 1AKHA 2LTPA 1MW7A 4A5NA 2BHYA 4IOAF 2HEOA 1A6QA 2X85A 4KICA 1SMTA 4C2MJ 3WHCA 2O61A 3DBLB 4JX6A 2ELKA 2VQCA 4E4HA 3F23A 1ZR2A 1HA8A 2BY0A 1IV8A 4RDUA 2F4MB 5CKTA 4BQOA 2VUMJ 1Z91A 1BI2A 2R7SA 3GCMA 1PUFB 2IA0A 5M3MJ 2UUZA 3P7NA 1V5GA 3FF5A 2L9VA 4ENMA 1OCPA 3BR1A 1ZLJA 2EINH 4BQNA 2NVXJ 2JN6A 3VDXA 2EFPA 2GIVA 4LIUA 1WWXA 2MD0A 4C3JJ 3KYLA 2K02A 5F27A 3TKYA 3J7AO 4BJ5C 2VKDA 2YX4A 4FE4A 3I59B 4C2TA 1FLIA 3S32A 5KK1A 1N75A 3BR5A 3E3VA 5E3NA 1HW2A 4BH9A 3WU2C 4IHYA 2V9KA 2KZVA 1K78B 3U2RA 4BHCA 2XROA 4IO9F 2ZB9A 3GTKJ 4A0YA 2P6SA 3L09A 2JMWA 2V79A 3F8CA 4G6DA 3ZQGA 4HNTA 2HXOA 2M7BA 1J75A 1DGWY 1OFCX 2XKOA 5K7ZA 2LG4A 4G7OF 1DU6A 2EA2A 2HYFA 3S17J 3CC2I 2GA2A 1O7FA 1W1WE 5D8LB 2KIUA 3GTMJ 3T8TA 2R92J 1YTYA 3O6BB 2BY1A 5FFXA 3FXJA 3BWGA 4AWXB 3S93A 3E7LA 2M7AA 5TRDA 1Z21A 2EB7A 1WJBA 3LA7A 1TQIA 1YIJI 3G71I 3FWEA 3E6BA 5E20A 2MC4A 3BTLA 2STWA 3RZOJ 2QUFA 2PMUA 5GPAA 4MEYF 4Q5SF 4GRIA 4N4OB 5B1AH 3GTLJ 4FASD 2JK3A 1K4TA 4KITB 4CICA 3FMSA 1R1VA 3TOBA 1ZRCA 4CCOA 4A3IJ 3H3UA 1VQ5I 4LLNA 2M5WA 1R1TA 3H92A 3FXKA 3K7AJ 4U0VA 3FXMA 3VODA 2P5VA 1IGNA 4EJTA 5DM6F 1UAAA 2UZKA 1D0YA 2HKXA 2ESHA 3KEQA 4L9VA 3V7SA 1BC7C 2VONA 4FTHA 1MGTA 2OTLI 5BS6A 2IS2A 3GF2A 3CCMI 1IN7A 4NQWB 1FSEA 3NWSA 2COBA 3CCUI 2Q2EB 3TP0A 1XC5A 2GXBA 3M4OJ 3KP7A 2ZJRF 4L18B 5DTDA 1JUMA 3FZVA 2M2EA 2IXSA 2KRCA 2OZUA 4ITVA 5F6FA 5DEQA 5DUIA 3FHZA 3OIPA 4CSWA 3SZGA 2XGDA 3E97A 4XK4A 3WTTC 4CCNA 4BHPA 2KRHA 2DFHA 3C1DA 2H1LA 2OD5A 4NQWA 3OYLA 2YR2A 1YFHA 2V1NA 4XLEA 4XL9A 3TMOA 4XQFA 2Z5UA 2YSRA 1SD5A 2WY7Q 2BOLA 4EMSA 1ZLKA 2KDOA 1S5LC 2ZXWH 1RZ4A 3TGNA 4YIFA 3DU6A 2PMHA 2B9SA 3ZMTA 2Y0MA 3ZQQA 4N9IA 3LSKA 2OA4A 3H9GA 1OCOH 2FU4A 2DO7A 3HOTA 1VI0A 2DOFA 1Y56A 5H6QA 2AO9A 1W5CC 5D5UB 4XRSA 4WF2A 4AIHA 1R49A 2L9NA 1K7AA 1JUSA 2JA6J 3LMMA 2X6YA 3K0LA 5HS7A 3V8LA 1FTZA 3DWLE 2JQ7A 3CMEI 1UB9A 3PSFA 1F5TA 3R61A 3F6VA 3T1BA 3BCAA 4JQFA 4NNJA 5LHIA 1OR7A 4JP0A 2FA5A 2UXNA 3CQZJ 4K2EA 5FLXZ 3CCLI 2XAGA 4A3GJ 2OJED 4XLFA 3OYIA 5E3MA 3E6MA 4YG2F 2LRDA 1BOBA 3QQAA 2XIGA 2XSJC 1YX3A 3CUOA 1S72I 3QWLA 3HOSA 4WK8F 5LLQA 3JRFA 2HGCA 3CTAA 3D5SC 5LD2C 1A35A 2KIFA 1MMNA 3HRMA 2AQFA 4CCJA 1RIOH 4GO1A 3CMYA 4D5CA 3J81K 2ECBA 4KISA 4JBAA 4B48A 3A02A 4EV0A 1FBUA 2LY2A 4ENKA 2XASA 2HDCA 2CW8A 2Z3YA 1F1ZA 2DYSH 3KP6A 1ETWA 3ABTA 1J7KA 4V19K 1X1AA 5FJ8J 5ICCA 3AL0B 4I0BA 2IEKA 2VI6A 1XGMA 1O57A 1A5JA 4UHTA 2EV0A 4G94A 1UG2A 1R4NB 3BPXA 4Q4ZF 1AU7A 5EZGA 3EDPA 2VQGA 2RKHA 5C44J 3A4CA 3F21A 1HKQA 1H8AC 3VOEA 1DGRM 1DDNA 3DEEA 4RGUA 3WTSC 4XRFA 2V9VA 1FP1D 1Z9CA 5F0CA 3TO9A 3SDGA 2BY2A 2WAFA 2BVMA 4XSXF 1I6HJ 3HOUJ 3NARA 5F04A 4FHTA 1D0ZA 1WJFA 2XF5A 4E7ZA 1X3ZB 2EZIA 2DFFA 2G7HA 4P55A 1T8IA 1J59A 3BR3A 3TP3A 2B7EA 1ONVA 4B4CA 5E8IA 3I56I 3OV8A 2VC0A 1ON1A 1WJ5A 5EF6A 2EILH 2ZXHA 5EGOA 5LHHA 2FBIA 1LEAA 2CW7A 2F48A 3I9V2 3LSMA 3N05A 2PN6A 3ABMH 5E79C 5FFZA 3VYSB 2E1OA 1B4AA 5F08A 1X2NA 2VBXA 3WGIA 4IHVA 5LGTA 3S16J 1XGNA 2JZYA 4M3GA 1R5HA 1U9NA 2HDDA 2OV7A 3JTHA 4O6JA 1LKXA 5ED4A 1XG1A 5EEGA 1ZELA 2QM3A 5D5XB 3MCZA 1ZRFA 1FWZA 3IV5A 4I99C 1LFPA 3ZMZA 1IDZA 1VQ4I 1J2XA 2DU9A 2FQ3A 4R8HA 4BEHA 3OYMA 1WI3A 1YLFA 4P9UA 1QZYA 3L2CA 4BL0B 2PJPA 2FBKA 2R7DA 3BC8A 1RR8C 2PBIA 2V7FA 3CDHA 3AL0C 2PQ8A 3ERMA 3MD2A 2ZFUA 4IQ4A 1IUYA 5ILUA 5H20A 3FM3A 5E1WA 3HM5A 3B73A 3PM1A 1R6RA 3ABKH 4C3IJ 2CUFA 2DI3A 2DQRA 5J4VA 3DBHB 3KYDB 4UV9A 2G0EA 2ZFWA 4ESFA 1LFUP 5JI6A 2DODA 1QGPA 3OYDA 3DLAA 3H35A 4IX7A 2JA2A 5KAFC 1HCRA 3BROA 3I0TA 4LD5A 4OIQF 4YFNF 2Y0SA 5ERIA 1K4SA 2UV1A 3H0DA 1WVRA 1QA6A 3GTPJ 1GV5A 2MC3A 4ZYGA 3PO2J 4GCVA 3R6SA 4LG0B 2A61A 3KZYA 3NQOA 4MEXF 2R7ZJ 2DMNA 2HYGD 4ZJZA 2NOGA 2GOXB 2KIMA 5IYBJ 3PNTA 4X0GA 2BBYA 3MMYB 3WTUC 3IRRA 1T98A 3BT9A 2AS5F 2HOEA 3GMEA 3QOEA 2DAOA 2PI0A 4M9ZA 4JK1X 2MG4A 3GTOJ 1KYZA 3CCQI 3QU6A 3CO7C 3MEXA 2XPVA 1MBGA 4UUSA 3HDDA 3HJEA 4RB0A 1JJ6C 3BP8A 3FKIJ 1OCCH 3MQ0A 4QWQA 2CUJA 1MIJA 3EETA 3LAJA 3S15J 1UELB 1WPKA 3L2VA 2IPQX 1OYWA 2GA1A 1T33A 1HKSA 4LB5A 3GFMA 4B8XA 3I55I 3G73A 4EEFG 1XGSA 3DP7A 1JUPA 2ID3A 3K4KA 5B1BH 1X2MA 2IS1A 3TDZC 4AYBA 3WTWC 1QQIA 1SD7A 1FP2A 4LB6B 4WCGA 3HTUA 3HC7A 1TWGJ 4ENNA 4EJOA 3F6OA 3Q9SA 1IF1A 2V6EA 3MN2A 5E3LA 4Y15A 4KIBA 2VJ4A 4FT8A 2RGVA 1ZARA 2QQAA 5JVGF 3HOZJ 1RKTA 1IXCA 1IN5A 4BGDA 4KT5C 1FSHA 2OQRA 3LSHA 2NVTJ 5A2QZ 2CQKA 2VT3A 3DTEA 4BJ6C 3WTVC 3MWMA 2F5DA 3QAHA 2F2EA 4Z6YA 1B8IA 2E36A 3WHBA 4TV7A 4V2FA 3LSIA 1ZQ3P 2VL8A 1F43A 5J1YA 4UUTA 5FGMA 5DCMB 2PX9A 1I1SA 1LDDA 2NXNB 1FY7A 1A6IA 4M3BA 3H5AA 3RDIA 3VFZA 1O3QA 2EFQA 4L5JA 1S9HA 1XN7A 4XMYA 4RLFA 1JTYA 5HODA 1DQUA 3OIQA 3OYCA 3MKYB 1QHGA 1QZZA 1D8KA 3SFIA 3DBRB 4U0WA 3FMQA 4CCLA 2EZKA 1G3TA 3OR2C 3LSRA 2VASA 1V3FA 3RPQA 1MBFA 4LITA 5GTHC 1TC3C 4HDUA 1JKRC 1R5ID 1ZTRA 2Q8KA 4HF2A 1Y0UA 1P92A 4GDFA 1IRZA 2CFXA 3EUKL 1ETXA 4Y52J 3VYUB 2P7CB 3JW4A 4XR6A 1D1BA 1XMKA 2FNAA 4XOTA 1TQMA 3ZQIA 1KQ8A 3GYHX 3KZIC 2D45A 3FKJA 2EIJH 4I76A 4S04A 2X51A 2QLZA 4P96A 5FLXK 4L5EA 2OAZA 5D4RA 2JUCA 2NNYA 1UHSA 1WCMJ 2K7LA 1QU3A 5CPRB 2PJRB 5IP9J 4F7ZA 3I53A 1ZREA 1WSUA 2ZXIA 2IT0A 5J6XA 1OYYA 2ZJPF 3S2HJ 5CVUA 3S3MA 1JT0A 1B72B 3MKZA 2FXAA 3HTSB 4UB8C 1GT0C 1U5TA 1BI1A 3U1KA 2PFBA 1I50J 1KONA 4OIPF 1RC9A 2VC1A 4P9FA 2JRMA 1TWHJ 2HTSA 4I09A 4M3FA 4XM3A 1B9NA 4AM3A 3ASNH 1R36A 3PFYA 4RAYA 1IRXA 3CJTB 2DPUA 3BDDA 5J1UA 4LK1F 1KU7A 2M0MA 4CZCA 3V42A 1POGA 2K27A 4HZFA 2STTA 3CJRB 4G6TB 4IHSA 3H5RA 3ONQA 2EIMH 1KU3A 3HIFA 3RPUA 2RQPA 4XRMA 1S7OA 2L7FP 1AWCA 1ZG5A 2KRFA 5ICEA 4EM1A 3CD6I 4HYEA 2GOMA 1SC7A 1ZHFA 2HVQA 4L9NA 3BY6A 2XGCA 4MGRA 4RGSA 2M4GA 2VXDA 2EFNA 5ILSA 3ZCOA 4Q48A 2R4GA 5DUKA 2HYJA 4D5FA 2EWNA 2W82A 1NG7A 2O8XA 3FHNA 5E1ZB 2FRHA 4BY7J 2VQLA 4M6XA 2HKOA 4WXHA 2NRAC 4FQGA 4EVIA 2OTJI 2HS5A 3J7AY 5DS9A 4RB2C 1BI0A 3KX2A 1GLNA 4XNFA 2OBPA 2Y69H 3CCRI 3KYCB 3ZOBA 2E60A 2V1DA 3DPLC 5AIQA 4E7JA 1K6OA 2XDVA 3AG2H 4OMYA 3HZJA 3X2QH 2H09A 3BG5A 3I4MJ 1S8NA 3HUGB 3ZMVA 2VBWA 2MFZA 2W85A 3MKWB 3K1PA 3BR0A 2EBIA 5KHDA 2VB6A 4KIFA 3J80K 2XSDC 1BI3A 1MJ9A 4IKFA 5F0FA 1V5EA 5E8GA 4HX4A 3SEQA 3TO7A 1SFXA 3EYYA 2IA1A 4DQ2A 1SFKA 3S3NA 2D5VA 2B63J 1ETYA 3OYBA 3G2BA 4AU7A 1ZYRF 2IW5A 2K5CA 1KA8A 1JKPC 2JSCA 4IEJA 4IF4A 1VQ8I 1FBSA 5ICGA 2HQAA 5DM7F 3UKGA 3EUHC 3GTGJ 3G3ZA 3BG6A 2CYYA 5JVTA 4YIIA 2LMDA 4L0ZB 3HPHA 4C3HJ 5KNLA 3KEOA 3EUAA 1F9NA 4H0EA 1JI8A 2HTJA 4HRIA 1ZAOA 3ESWB 4ZDLA 1Z3XA 3DF8A 4QTRA 1YIOA 3GTQJ 2ZSIB 2DA2A 3WTZA 4IHXA 3OSGA 1J9IA 2LC2A 4F3QA 2VPRA 2H8RA 4HX7A 2L2OA 1W0UA 3KFWX 3G6EI 2J5OA 4CDGA 4RLQA 3IC7A 1NK2P 3DLLF 5TISC 3IKVA 2GZWA 3L2WA 1MMSA 4I01A 4AUXA 5F64A 2PEXA 4OWRB 2CS3A 1XS9A 4AIJA 2A68F 2MGQA 1KZHA 4DYQA 2H6CA 3H1CA 3BR6A 5J40A 2Y2ZA 2A5WA 1MSEC 5GPCA 3S3OA 1X1CA 2LKSA 3BZKA 1IZ1A 3H0GJ 3PNVA 1Y8QB 1ULYA 4A3JJ 2E7WA 4ANJA 1W7PD 4G6QA 3U9GA 1P4XA 4XSZF 2JJ7A 4L9TA 1EH6A 1XMAA 4L5IA 1J09A 5K5RA 1CF7A 2F5VA 4XLHA 4YIRX 5BOXA 1BIBA 1TWFJ 1OMIA 2D2WA 2E1NA 3PQJA 4XLPF 4IZZA 2XB0X 1EH8A 1SANA 1MNMC 2ELJA 1DUXC 2LF8A 2BW3A 2VJJA 2Z33A 1RI7A 1JE8A 2DMPA 3DKXA 1E2XA 2LFBA 1FC3A 1YJWI 3FBNB 3B6AA 2O7OA 4CH7A 1SVLA 1YX5A 4CCKA 2MA3A 1R1UA 4QIWN 3BCBA 3VB2A 4KT6A 5LFAA 1Z3YA 2UWMA 2EQRA 1BJAA 2RVCA 4XORA 4HSTA
chains in the Genus database with same CATH topology
5C44J 5IP7J 5IOYA 4BKXA 1H8AC 2XB5A 2EH3A 1MBHA 2NS8A 2HI3A 3LSJA 1CQTA 2K9SA 1X58A 1HDPA 5F0CA 5M5XJ 4AC0A 3C2BA 3SDGA 1VF9A 2QCOA 5E3OA 1IJWC 1I6HJ 3HOUJ 3NARA 5F04A 1HOMA 3G1LA 4IHWA 2EZIA 3BR3A 1MSFC 3SJMA 3TP3A 4B4CA 3BQZA 3Q3SA 1MH3A 1RETA 3ZQHA 2DA5A 1JGGA 3JRAA 1ETKA 5EF6A 5C4JJ 1O4XA 5EGOA 3QPLA 2L7MP 2E2JJ 1RESA 2HOAA 2VKEA 1NK3P 2E1OA 2M34A 1K61A 3RZDJ 5F08A 1X2NA 5M3FJ 4IHVA 4BXXJ 3CCYA 2JA8J 3S16J 1BL0A 3OIOA 4M3GA 2M0CA 2LKXA 1U9NA 2HDDA 5BNGA 1XG1A 1JJ8C 5C4XJ 1I3QJ 3IV5A 5EDNA 4QSHA 1IDZA 2ME0A 3Q0WA 1GVDA 4MFDA 2DMUA 5IYCJ 1WI3A 3JRCA 1K83J 3S2DJ 4RBOA 2FJ1A 1ETVA 1FIAA 2JWTA 2ECCA 2CRGA 4X6AJ 1VFCA 4MO7A 2LD5A 4FISA 2NVYJ 3OOUA 3HB9A 1SFOJ 2L9RA 1HLVA 3HM5A 3PM1A 4C3IJ 2R5YA 2CUFA 3IH3A 1RPWA 1Y1VJ 3H3VK 2HOSA 1BJZA 2G0EA 5FKLA 4XIDA 3JRDA 1LFUP 3HBLA 4LOCA 3HEFA 2W48A 1Z0XA 1HCRA 1QVUA 4V2GA 2P81A 1BW6A 3GTPJ 1GV5A 2ME6A 1MBJA 1IG7A 1ETQA 1LE8B 3PO2J 2K40A 2R7ZJ 2DMNA 2NOGA 1H88C 4X1EA 3DCFA 5IYBJ 1U9OA 1VNDA 4CYCA 3BT9A 2FD5A 2R93J 5K7HA 2M8GX 5EZHA 3MKLA 3IH2A 4J19A 1PUFA 1HF0A 1F36A 5EG0A 1OCTC 4BY1J 2MG4A 3GTOJ 2EZLA 3NAUA 2XPVA 2LK2A 3VPRA 1MBGA 3D1NI 4UUSA 1U78A 4M6VA 1HDDC 3HDDA 1WH7A 4NDLA 1B72A 4W97A 3BG9A 1JJ6C 1APLC 3FKIJ 5F0HA 2QF7A 1DU0A 2CU7A 2ID6A 1GUUA 2XPUA 1T56A 2DA4A 3S15J 1IC8A 1P7JA 2EZHA 2I10A 2PMZN 4GFBA 1WPKA 2DMTA 2TRTA 1UMQA 1T33A 3FK7A 2JA7J 4FE7A 1RKWA 4EEFG 1JUPA 2ID3A 2WAQN 4MLOA 5EGOB 1X2MA 1JT6A 3FIWA 2DTZA 3G1MA 1RR7A 1G2HA 2HXIA 1GDTA 1TWGJ 3JR9A 1QVTA 1ZR4A 3BTCA 3MN2A 5E3LA 4D7MA 5FKOA 3A01A 2CUEA 3LOCA 1ETOA 2KT0A 4B3AA 3HGGA 2FQ4A 4BBRJ 3JRHA 5EEAA 1RKTA 1IV6A 1ORKA 3HOZJ 5J1RA 2NVTJ 3LNQA 3HOYJ 3MVPA 2CJJA 2OF7A 3RKQA 2DA3A 1Y1WJ 3S1RJ 3G1OA 1B8IA 1ZK8A 3BR2A 4V2FA 3WHBA 3BTJA 2WB1N 1ZQ3P 2XPWA 1F43A 5J1YA 2K9QA 1FIPA 4UUTA 4S0HB 4MIMA 2WV1A 2E2HJ 2X6OA 1TWCJ 1Z77A 2N8GA 1A6IA 4M3BA 1W0TA 4DZPA 2GLOA 2NS7A 3HOVJ 1JTYA 5HODA 3QPSA 1AKHB 1NTCA 3SFIA 4Y7NJ 2R5YB 2EZKA 3LSRA 2IBDA 3TW6A 2X9DA 1MBFA 4XRSG 1TC3C 1BA5A 2TCTA 3HOWJ 2XRLA 5JLXA 1JKRC 1ZTRA 3JRIA 3LSPA 3OSFA 1MBEA 3PO3J 2CQQA 1R9TJ 4A3BJ 1IRZA 4JYKA 4A69C 3GBGA 4A3EJ 2Y0SN 1ETXA 4Y52J 2Y30A 3CDLA 2CQXA 1AKHA 3JRGA 2LTPA 2E19A 1MH4A 1D5YA 3ZQIA 4I76A 4A3LJ 4C2MJ 3WHCA 3K2AA 5EYRA 5FKNA 1QPIA 4JX6A 4L5EA 2ELKA 1ZR2A 1UHSA 1IUFA 4CYCB 1WCMJ 4RDUA 2VUMJ 5IP9J 1PUFB 5M3MJ 5EG0B 1S7EA 2K9NA 2LVSA 1OCPA 3BR1A 2KDZA 2NVXJ 2JN6A 4UUSB 3BTIA 3S2HJ 1JT0A 1B72B 4C3JJ 5F27A 4FE4A 5IPAA 1GT0C 4MFEA 3ZQLA 1JTXA 3Q0VA 3BR5A 5E3NA 1I50J 3BQYA 3L1PA 1JKOC 4IHYA 1TWHJ 2DMQA 4M3FA 4D7NA 2ZB9A 3GTKJ 3A03A 5FKMA 4AYBN 2JMWA 1IDYA 3ZQGA 5K7FA 2HXOA 5J1UA 1OFCX 5K7ZA 1DU6A 1YRNA 3S17J 2GBYA 1POGA 3GTJJ 3GTMJ 1TWAJ 3A01B 2R5ZA 2X48A 2R92J 1WH5A 4XRMA 2Y31A 3HKZN 2L7FP 5IP6A 2OPTA 3RQIA 3E7LA 4ABZA 2XGCA 1P7IA 3IH4A 3FK6A 2XGEA 3BTLA 4JX4A 2O9LA 2LP0A 1B8IB 2HYJA 3RZOJ 4D5FA 3FISA 5GPAA 3GTLJ 2JK3A 3S1MJ 5FLMJ 4BY7J 4BBSJ 3W6VA 4A93J 1ENHA 5DS9A 4A3IJ 3S1NJ 5F1JA 3K7AJ 1IGNA 3ZOBA 2Y9ZA 3HOXJ 2LR8A 3O8HA 2DA7A 1LFBA 2Y9YA 4FTHA 1BW5A 5FLVA 3BG5A 3I4MJ 1EF4A 1MBKA 2COBA 1U8BA 3TP0A 1XC5A 3BR0A 2EBIA 3M4OJ 5DTDA 2HOTA 2XSDC 4M3DA 1AHDP 1JUMA 2M2EA 2YU9J 3O8GA 5F0FA 4A3CJ 3Q0UA 2AHQA 1FTTA 2XGDA 2GM4A 4XK4A 5M5YJ 4A3FJ 3JREA 2D5VA 4FCYA 2B63J 1ETYA 1FEXA 1JKPC 4IEJA 2L0KA 2YUSA 3UKGA 2DA1A 3GTGJ 3TEDA 1QRYA 2O8KA 5JLWA 3TW7A 1E3OC 4C3HJ 2HQ5A 5C3EJ 2H1KA 4A3DJ 2LY9A 1VI0A 3ZQCA 2AO9A 4QTRA 4XRSA 3BG3A 3GTQJ 2DA2A 3S14J 4IHXA 1JUSA 3OSGA 2DJNA 4I6ZA 2JA6J 4A3MJ 4DW6A 1FJLA 2H8RA 2VPRA 1FTZA 1W0UA 1ITYA 3JRBA 3F0CA 5J3LA 4W1UA 2MSYA 1NK2P 2E2IJ 2JA5J 4JP0A 3CQZJ 4AUXA 2L7ZA 1XS9A 4A3GJ 2MGQA 4DYQA 5E3MA 3M3YJ 1YRNB 3QQAA 1H89C 3BR6A 2Y2ZA 1MSEC 1ZGWA 5GPCA 3ZQFA 2R5ZB 4XICA 3H0GJ 1Q1VA 4A3JJ 3JRFA 2NVQJ 1JKQC 4JX5A 4G12A 5M5WJ 1WGXA 2MW8A 2JJ7A 4DZJA 5IOZA 2DA6A 2DN0A 3CMYA 4D5CA 3S1QJ 1GV2A 1TWFJ 2ECBA 2RAEA 5IYDJ 2IAIA 2XB0X 1SANA 1MNMC 2R0QC 3I4NJ 2VKVA 4B1RA 2DMPA 3A02A 2LFBA 4HNVA 5GP9A 1ZKGA 3HGYA 5FKKA 1ETWA 3B6AA 2O7OA 1LE8A 3LSGA 2LLKA 4DYCA 2YS9A 5FJ8J 9ANTA 2FX0A 4DYRA 2IEKA 2VI6A 2M9HA 4QIWN 1A5JA 3B6CA 1OJLA 1UG2A 2EQRA 3DEWA 1AU7A 5EZGA 4A3KJ 4M3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 J;  5IP7 J;  5IOY A;  4BKX A;  1H8A C;  2XB5 A;  2EH3 A;  1MBH A;  2NS8 A;  2HI3 A;  3LSJ A;  1CQT A;  2K9S A;  1X58 A;  1HDP A;  5F0C A;  5M5X J;  4AC0 A;  3C2B A;  3SDG A;  1VF9 A;  2QCO A;  5E3O A;  1IJW C;  1I6H J;  3HOU J;  3NAR A;  5F04 A;  1HOM A;  3G1L A;  4IHW A;  2EZI A;  3BR3 A;  1MSF C;  3SJM A;  3TP3 A;  4B4C A;  3BQZ A;  3Q3S A;  1MH3 A;  1RET A;  3ZQH A;  2DA5 A;  1JGG A;  3JRA A;  1ETK A;  5EF6 A;  5C4J J;  1O4X A;  5EGO A;  3QPL A;  2L7M P;  2E2J J;  1RES A;  2HOA A;  2VKE A;  1NK3 P;  2E1O A;  2M34 A;  1K61 A;  3RZD J;  5F08 A;  1X2N A;  5M3F J;  4IHV A;  4BXX J;  3CCY A;  2JA8 J;  3S16 J;  1BL0 A;  3OIO A;  4M3G A;  2M0C A;  2LKX A;  1U9N A;  2HDD A;  5BNG A;  1XG1 A;  1JJ8 C;  5C4X J;  1I3Q J;  3IV5 A;  5EDN A;  4QSH A;  1IDZ A;  2ME0 A;  3Q0W A;  1GVD A;  4MFD A;  2DMU A;  5IYC J;  1WI3 A;  3JRC A;  1K83 J;  3S2D J;  4RBO A;  2FJ1 A;  1ETV A;  1FIA A;  2JWT A;  2ECC A;  2CRG A;  4X6A J;  1VFC A;  4MO7 A;  2LD5 A;  4FIS A;  2NVY J;  3OOU A;  3HB9 A;  1SFO J;  2L9R A;  1HLV A;  3HM5 A;  3PM1 A;  4C3I J;  2R5Y A;  2CUF A;  3IH3 A;  1RPW A;  1Y1V J;  3H3V K;  2HOS A;  1BJZ A;  2G0E A;  5FKL A;  4XID A;  3JRD A;  1LFU P;  3HBL A;  4LOC A;  3HEF A;  2W48 A;  1Z0X A;  1HCR A;  1QVU A;  4V2G A;  2P81 A;  1BW6 A;  3GTP J;  1GV5 A;  2ME6 A;  1MBJ A;  1IG7 A;  1ETQ A;  1LE8 B;  3PO2 J;  2K40 A;  2R7Z J;  2DMN A;  2NOG A;  1H88 C;  4X1E A;  3DCF A;  5IYB J;  1U9O A;  1VND A;  4CYC A;  3BT9 A;  2FD5 A;  2R93 J;  5K7H A;  2M8G X;  5EZH A;  3MKL A;  3IH2 A;  4J19 A;  1PUF A;  1HF0 A;  1F36 A;  5EG0 A;  1OCT C;  4BY1 J;  2MG4 A;  3GTO J;  2EZL A;  3NAU A;  2XPV A;  2LK2 A;  3VPR A;  1MBG A;  3D1N I;  4UUS A;  1U78 A;  4M6V A;  1HDD C;  3HDD A;  1WH7 A;  4NDL A;  1B72 A;  4W97 A;  3BG9 A;  1JJ6 C;  1APL C;  3FKI J;  5F0H A;  2QF7 A;  1DU0 A;  2CU7 A;  2ID6 A;  1GUU A;  2XPU A;  1T56 A;  2DA4 A;  3S15 J;  1IC8 A;  1P7J A;  2EZH A;  2I10 A;  2PMZ N;  4GFB A;  1WPK A;  2DMT A;  2TRT A;  1UMQ A;  1T33 A;  3FK7 A;  2JA7 J;  4FE7 A;  1RKW A;  4EEF G;  1JUP A;  2ID3 A;  2WAQ N;  4MLO A;  5EGO B;  1X2M A;  1JT6 A;  3FIW A;  2DTZ A;  3G1M A;  1RR7 A;  1G2H A;  2HXI A;  1GDT A;  1TWG J;  3JR9 A;  1QVT A;  1ZR4 A;  3BTC A;  3MN2 A;  5E3L A;  4D7M A;  5FKO A;  3A01 A;  2CUE A;  3LOC A;  1ETO A;  2KT0 A;  4B3A A;  3HGG A;  2FQ4 A;  4BBR J;  3JRH A;  5EEA A;  1RKT A;  1IV6 A;  1ORK A;  3HOZ J;  5J1R A;  2NVT J;  3LNQ A;  3HOY J;  3MVP A;  2CJJ A;  2OF7 A;  3RKQ A;  2DA3 A;  1Y1W J;  3S1R J;  3G1O A;  1B8I A;  1ZK8 A;  3BR2 A;  4V2F A;  3WHB A;  3BTJ A;  2WB1 N;  1ZQ3 P;  2XPW A;  1F43 A;  5J1Y A;  2K9Q A;  1FIP A;  4UUT A;  4S0H B;  4MIM A;  2WV1 A;  2E2H J;  2X6O A;  1TWC J;  1Z77 A;  2N8G A;  1A6I A;  4M3B A;  1W0T A;  4DZP A;  2GLO A;  2NS7 A;  3HOV J;  1JTY A;  5HOD A;  3QPS A;  1AKH B;  1NTC A;  3SFI A;  4Y7N J;  2R5Y B;  2EZK A;  3LSR A;  2IBD A;  3TW6 A;  2X9D A;  1MBF A;  4XRS G;  1TC3 C;  1BA5 A;  2TCT A;  3HOW J;  2XRL A;  5JLX A;  1JKR C;  1ZTR A;  3JRI A;  3LSP A;  3OSF A;  1MBE A;  3PO3 J;  2CQQ A;  1R9T J;  4A3B J;  1IRZ A;  4JYK A;  4A69 C;  3GBG A;  4A3E J;  2Y0S N;  1ETX A;  4Y52 J;  2Y30 A;  3CDL A;  2CQX A;  1AKH A;  3JRG A;  2LTP A;  2E19 A;  1MH4 A;  1D5Y A;  3ZQI A;  4I76 A;  4A3L J;  4C2M J;  3WHC A;  3K2A A;  5EYR A;  5FKN A;  1QPI A;  4JX6 A;  4L5E A;  2ELK A;  1ZR2 A;  1UHS A;  1IUF A;  4CYC B;  1WCM J;  4RDU A;  2VUM J;  5IP9 J;  1PUF B;  5M3M J;  5EG0 B;  1S7E A;  2K9N A;  2LVS A;  1OCP A;  3BR1 A;  2KDZ A;  2NVX J;  2JN6 A;  4UUS B;  3BTI A;  3S2H J;  1JT0 A;  1B72 B;  4C3J J;  5F27 A;  4FE4 A;  5IPA A;  1GT0 C;  4MFE A;  3ZQL A;  1JTX A;  3Q0V A;  3BR5 A;  5E3N A;  1I50 J;  3BQY A;  3L1P A;  1JKO C;  4IHY A;  1TWH J;  2DMQ A;  4M3F A;  4D7N A;  2ZB9 A;  3GTK J;  3A03 A;  5FKM A;  4AYB N;  2JMW A;  1IDY A;  3ZQG A;  5K7F A;  2HXO A;  5J1U A;  1OFC X;  5K7Z A;  1DU6 A;  1YRN A;  3S17 J;  2GBY A;  1POG A;  3GTJ J;  3GTM J;  1TWA J;  3A01 B;  2R5Z A;  2X48 A;  2R92 J;  1WH5 A;  4XRM A;  2Y31 A;  3HKZ N;  2L7F P;  5IP6 A;  2OPT A;  3RQI A;  3E7L A;  4ABZ A;  2XGC A;  1P7I A;  3IH4 A;  3FK6 A;  2XGE A;  3BTL A;  4JX4 A;  2O9L A;  2LP0 A;  1B8I B;  2HYJ A;  3RZO J;  4D5F A;  3FIS A;  5GPA A;  3GTL J;  2JK3 A;  3S1M J;  5FLM J;  4BY7 J;  4BBS J;  3W6V A;  4A93 J;  1ENH A;  5DS9 A;  4A3I J;  3S1N J;  5F1J A;  3K7A J;  1IGN A;  3ZOB A;  2Y9Z A;  3HOX J;  2LR8 A;  3O8H A;  2DA7 A;  1LFB A;  2Y9Y A;  4FTH A;  1BW5 A;  5FLV A;  3BG5 A;  3I4M J;  1EF4 A;  1MBK A;  2COB A;  1U8B A;  3TP0 A;  1XC5 A;  3BR0 A;  2EBI A;  3M4O J;  5DTD A;  2HOT A;  2XSD C;  4M3D A;  1AHD P;  1JUM A;  2M2E A;  2YU9 J;  3O8G A;  5F0F A;  4A3C J;  3Q0U A;  2AHQ A;  1FTT A;  2XGD A;  2GM4 A;  4XK4 A;  5M5Y J;  4A3F J;  3JRE A;  2D5V A;  4FCY A;  2B63 J;  1ETY A;  1FEX A;  1JKP C;  4IEJ A;  2L0K A;  2YUS A;  3UKG A;  2DA1 A;  3GTG J;  3TED A;  1QRY A;  2O8K A;  5JLW A;  3TW7 A;  1E3O C;  4C3H J;  2HQ5 A;  5C3E J;  2H1K A;  4A3D J;  2LY9 A;  1VI0 A;  3ZQC A;  2AO9 A;  4QTR A;  4XRS A;  3BG3 A;  3GTQ J;  2DA2 A;  3S14 J;  4IHX A;  1JUS A;  3OSG A;  2DJN A;  4I6Z A;  2JA6 J;  4A3M J;  4DW6 A;  1FJL A;  2H8R A;  2VPR A;  1FTZ A;  1W0U A;  1ITY A;  3JRB A;  3F0C A;  5J3L A;  4W1U A;  2MSY A;  1NK2 P;  2E2I J;  2JA5 J;  4JP0 A;  3CQZ J;  4AUX A;  2L7Z A;  1XS9 A;  4A3G J;  2MGQ A;  4DYQ A;  5E3M A;  3M3Y J;  1YRN B;  3QQA A;  1H89 C;  3BR6 A;  2Y2Z A;  1MSE C;  1ZGW A;  5GPC A;  3ZQF A;  2R5Z B;  4XIC A;  3H0G J;  1Q1V A;  4A3J J;  3JRF A;  2NVQ J;  1JKQ C;  4JX5 A;  4G12 A;  5M5W J;  1WGX A;  2MW8 A;  2JJ7 A;  4DZJ A;  5IOZ A;  2DA6 A;  2DN0 A;  3CMY A;  4D5C A;  3S1Q J;  1GV2 A;  1TWF J;  2ECB A;  2RAE A;  5IYD J;  2IAI A;  2XB0 X;  1SAN A;  1MNM C;  2R0Q C;  3I4N J;  2VKV A;  4B1R A;  2DMP A;  3A02 A;  2LFB A;  4HNV A;  5GP9 A;  1ZKG A;  3HGY A;  5FKK A;  1ETW A;  3B6A A;  2O7O A;  1LE8 A;  3LSG A;  2LLK A;  4DYC A;  2YS9 A;  5FJ8 J;  9ANT A;  2FX0 A;  4DYR A;  2IEK A;  2VI6 A;  2M9H A;  4QIW N;  1A5J A;  3B6C A;  1OJL A;  1UG2 A;  2EQR A;  3DEW A;  1AU7 A;  5EZG A;  4A3K J;  4M3E A; 
#chains in the Genus database with same CATH topology
 3Q9V A;  4AVZ A;  5E18 F;  3L2U A;  2BHZ A;  2FML A;  1CQT A;  1XD7 A;  3WU0 A;  4WWC A;  2K9S A;  2CG4 A;  1VQN I;  4AC0 A;  1QNT A;  4IRG A;  4Y33 A;  5A2Q K;  2QCO A;  2F5C A;  2K4J A;  4M9X A;  2HFH A;  2QSG X;  1DPU A;  2V1U A;  1M1E B;  5HLT A;  1A36 A;  4UB6 C;  3PFI A;  4OU0 A;  2DA5 A;  3ZQH A;  1JGG A;  3JRA A;  3QPH A;  4M9S A;  4R79 A;  3ERE D;  4ZYD A;  1O4X A;  4XKV A;  5HS8 A;  2J5P A;  3QPL A;  4UVA A;  1G3S A;  1WQ2 A;  2M45 A;  1MMG A;  1HKT A;  2OQG A;  2M34 A;  3HXL A;  3LAP A;  2ICW G;  3CCY A;  3SHF A;  5L3D A;  3CUQ A;  2XF6 A;  2JA8 J;  4F55 A;  2GAU A;  1VZ0 A;  2M0C A;  4NC7 A;  1X19 A;  5BNG A;  3FMR A;  4A2U A;  1I3Q J;  2V4J C;  2VLA A;  2ME0 A;  3NEU A;  2DTR A;  3RSN A;  2DT7 B;  2ZME A;  3RJP A;  1GVD A;  1NG6 A;  1BR4 A;  3W6K B;  3JRC A;  1G59 A;  1TNS A;  3DXJ F;  1S3J A;  1YW8 A;  2DYR H;  1ZGJ A;  1U0J A;  1ETV A;  1FIA A;  4RBO A;  3HL2 A;  4PCQ A;  4LMY A;  2QBY A;  4MO7 A;  2LD5 A;  1E17 A;  2W00 A;  4FIS A;  4PFP A;  2NVY J;  1YE9 A;  2HU9 A;  2RV8 A;  3DTI A;  4HOB A;  1VQL I;  3OY9 A;  1HLV A;  4PSW A;  3DKW A;  4G8X A;  3DTK A;  2R5Y A;  3IH3 A;  4HNU A;  3H3V K;  2K3P A;  1V4R A;  3RKY A;  4ZTF A;  4YEJ A;  2VOO A;  3QOP A;  3W2W A;  1HXD A;  4PUS A;  4QLC U;  2W48 A;  1Z0X A;  1QVU A;  1DP7 P;  1SVM A;  2W25 A;  2JVH A;  2P81 A;  2RQQ A;  1IG7 A;  2V9P A;  1WKM A;  3WE2 A;  4HV5 A;  1H88 C;  4X1E A;  2H27 A;  2CW0 F;  3DCF A;  4BUP A;  2DPD A;  1VND A;  3OYJ A;  1OYI A;  3F9K A;  4CYC A;  2YPR A;  5CJ9 A;  1PP7 U;  1W4M A;  4XLN F;  2DBB A;  3M1C A;  3O3K A;  3IH2 A;  1F36 A;  5EG0 A;  3PIP F;  2FOW A;  4PZJ A;  3H9J A;  2CQ7 A;  1R5G A;  3HHH A;  3NAU A;  2LK2 A;  3VPR A;  1PJR A;  2I8D A;  3D1N I;  4M6V A;  5FRO A;  1T08 B;  2K86 A;  1WH7 A;  3FXQ A;  3HRT A;  4F91 B;  1O3S A;  2V1X A;  4G7Z F;  2QF7 A;  4ZTJ A;  4YRV A;  2FEZ A;  1Z6T A;  3V4G A;  1P7J A;  2I10 A;  3QPT A;  3OOP A;  2QA4 I;  2LNB A;  2ISY A;  2JA7 J;  2QKL B;  3F8M A;  4FE7 A;  1YHQ I;  4L0Y B;  3WGH A;  5HVQ C;  5BPD A;  2G7U A;  3K4N A;  4ZYE A;  5EGO B;  3H36 A;  4IXA A;  1JT6 A;  1OR7 C;  2DTZ A;  3FIW A;  2VXZ A;  3G1M A;  4RM3 A;  1GXP A;  1G2H A;  3OL3 A;  3JAM Z;  2MLG A;  4C30 A;  3JR9 A;  2EIK H;  2ZO4 A;  1I3A A;  5GAH J;  4QPO A;  4D7M A;  3J7Y J;  2HPM A;  3PUB A;  4Q47 A;  3A01 A;  2Z1D A;  2E7X A;  3P9K A;  4UY8 I;  1ETO A;  4HLX A;  1H0M A;  2FQ4 A;  4ENJ A;  3VWB A;  2F5F A;  5EEA A;  3HKZ A;  4E7I A;  3HOY J;  3MVP A;  1EV7 A;  2OF7 A;  5EJC A;  1HW5 A;  1Y1W J;  3S1R J;  3G1O A;  1B1B A;  3E5U A;  4BEH B;  2K9M A;  4HBL A;  3ZQ7 A;  2WB1 N;  5AIP A;  1O3R A;  2ADU A;  1FIP A;  3F72 A;  1JGS A;  4BDY A;  1IO2 A;  4RAF A;  2X6O A;  1Z77 A;  5J8C A;  4M73 A;  4DJA A;  3K10 A;  3J80 Z;  1W0T A;  4DZP A;  4HA8 A;  4ZDO A;  5HLG A;  1YW7 A;  4RS8 A;  1IXS B;  1T6S A;  5LRS A;  2GIZ A;  3QPS A;  5CQE A;  1BBY A;  1T0F A;  1WFX A;  2R7O A;  4S05 A;  1SD4 A;  1NTC A;  4PK4 A;  4RB3 C;  2E71 A;  3DPT A;  2WB1 A;  2DK8 A;  4D1Q A;  4CA0 A;  2JUG A;  1RUO A;  3TW6 A;  2X9D A;  3RI4 A;  1OIS A;  4BS9 A;  5HLH A;  3AG3 H;  3CCS I;  2L02 A;  5BQT A;  3IUO A;  4L9J A;  3LSP A;  3TO6 A;  1MJA A;  2NAZ A;  2QSH X;  2CQQ A;  4JYK A;  4A69 C;  4A3E J;  2Y0S N;  5J47 A;  3CDL A;  2BY3 A;  2RNG A;  1U2W A;  2E19 A;  1EA3 A;  1LNW A;  2L4A A;  4BE1 A;  1MH4 A;  1R71 A;  1D5Y A;  3AAF A;  3OYN A;  3OMY A;  2M8E A;  1H9G A;  2W24 A;  4B44 A;  4YFX F;  1QPI A;  1MD0 A;  1SFE A;  2VOP A;  1VQM I;  1LDJ A;  3KP3 A;  3W6J B;  3F3X A;  3GFL A;  2W4S A;  4B43 A;  1SFU A;  1PDN C;  4XN0 A;  4HDV A;  1SMY F;  2VIX A;  5ICF A;  2P5L C;  1FOK A;  1G3Y A;  2K9N A;  1U3E M;  2E5N A;  2LVS A;  2IS6 A;  2X4H A;  2DW4 A;  1PYV A;  1DP3 A;  4UUS B;  1O3T A;  3N4M A;  2P5K A;  3CMM A;  1P6R A;  5FRM A;  5IPA A;  4CO8 A;  2DT6 A;  3CP8 A;  3OR1 C;  3Q0V A;  4LGW A;  2QZ8 A;  4WXC A;  3CLO A;  4RA2 A;  1MDM A;  3KP5 A;  4AVP A;  3L1P A;  3IKT A;  1TNT A;  3KLO A;  1JKO C;  2GQQ A;  5HDN A;  4U7B A;  1G6N A;  3L9F A;  2NS0 A;  2R7W A;  1SAX A;  1WI9 A;  3A03 A;  3E5X A;  4AYB N;  3OYH A;  2WC2 A;  4CCM A;  3ABL H;  3QYF A;  1WJD A;  1FPQ A;  3K70 C;  1L3L A;  2P0W A;  1YRN A;  4NHJ A;  1V54 H;  4LG3 A;  3R4K A;  2GBY A;  3CF5 F;  2R5Z A;  1XDS A;  2X48 A;  2YX7 A;  4RAG A;  1T38 A;  1FT9 A;  3WOD F;  1G4D A;  2ESN A;  1USS A;  2Y31 A;  4DIQ A;  5IP6 A;  2VT2 A;  3RQI A;  4OMZ A;  1P9Q C;  4ABZ A;  5L3G A;  4I98 B;  2QGU A;  1XCB A;  2KKO A;  3GVA A;  3L2Q A;  2DFE A;  1Y6I A;  5GAE J;  2XGE A;  3QYE A;  2LP0 A;  1W7P A;  2ZKZ A;  1B8I B;  1ACI A;  2MH9 A;  4UXN A;  3QP5 A;  5FB2 A;  1QHH D;  4KMF A;  1QPM A;  3S1M J;  5CQG A;  3CES A;  3DV8 A;  4BBS J;  1OKR A;  3B02 A;  1HQC A;  1ENH A;  5F1R A;  4KMU X;  1YYV A;  3S1N J;  4UV8 A;  5HLI A;  1Z05 A;  1ON2 A;  4ZC3 A;  5J8F A;  2VE9 A;  2LR8 A;  3GW2 A;  3O8H A;  2DA7 A;  2Y9Y A;  3W3C A;  3SEZ A;  4B47 A;  4A5M A;  3T8R A;  2OZ6 A;  3ML6 A;  2LF7 A;  2ZNZ A;  1HSJ A;  1MBK A;  3ECH A;  2RDP A;  1XPX A;  1U8B A;  2W57 A;  3Q5F A;  2XAJ A;  5B3S H;  1T2K A;  2DLL A;  4M3D A;  2KJC A;  2ELH A;  3O8G A;  5JFR A;  4A3C J;  4PDK A;  1FMV A;  1UHM A;  4XOP A;  4RGR A;  4MHG A;  2HVR A;  1FTT A;  2GM4 A;  5M5Y J;  2H6B A;  3JCU C;  3JRE A;  2FSW A;  2KP6 A;  4FCY A;  2P6T A;  1XMX A;  2NNN A;  2QEX I;  3A0B C;  3ZXS A;  4OAY A;  2AXL A;  4LJZ F;  4UUV A;  4XON A;  2HZT A;  4LLG F;  3IP4 B;  2LH9 A;  2BEO A;  2LBF A;  3TED A;  4O3M A;  1QRY A;  3AFH A;  4BDZ A;  2O8K A;  3C18 A;  4BYY A;  5JLW A;  2IJL A;  1E3O C;  1IRG A;  4YEL A;  2HQ5 A;  5C3E J;  1ZN2 A;  1R4M B;  2Z2S B;  5CYV A;  1WHU A;  1R00 A;  4A3D J;  2LY9 A;  2QVO A;  3I64 A;  2CSO A;  3CC7 I;  1U5T B;  4IJA A;  5L3C A;  3BJO A;  2XV4 S;  2Q1Z B;  3HG9 A;  4XKW A;  3M8F A;  1HW1 A;  2DJN A;  5TGT A;  4A3M J;  4DW6 A;  5BMZ A;  1HC8 A;  5LEK A;  3IWF A;  2JRT A;  1TP4 A;  4ZDP A;  1GVJ A;  2DT5 A;  3LL7 A;  4DGW B;  1MMD A;  3JRB A;  2CGP A;  5J3L A;  1J5Y A;  4W1U A;  4RB1 A;  3GO5 A;  2CV0 A;  3K69 A;  2MSY A;  2E2I J;  2JA5 J;  1G8X A;  3KE2 A;  2QQB A;  1I1G A;  2L7Z A;  4M71 A;  4J01 A;  5EEH A;  2O0Y A;  2HVS A;  1H89 C;  2GXG A;  2W7N A;  2KJB A;  3ZQF A;  4XIC A;  4BAC A;  3ROU A;  1BR1 A;  4HLY A;  3TQN A;  3CZ6 A;  2OUM A;  4JX5 A;  4OIN F;  1MMA A;  2KPM A;  2MW8 A;  1QBJ A;  4DZJ A;  5IOZ A;  1OPC A;  1D3Y A;  1BM9 A;  2DA6 A;  2ZBK A;  2DN0 A;  4MTD A;  3S1Q J;  1GV2 A;  4HSR A;  3AG1 H;  1FOY A;  2E1M B;  2IAI A;  3HSR A;  5IYD J;  2JT1 A;  2ZC2 A;  4D9J A;  1D1A A;  5IY5 H;  2R0Q C;  2DXI A;  3OWT A;  2QKM B;  4HNV A;  5GP9 A;  4RMN A;  3HGY A;  1BOA A;  5FKK A;  3OYK A;  2AXT C;  1LE8 A;  2FUG 2;  2XRN A;  1MZB A;  1LEB A;  4DYC A;  2YS9 A;  4DYR A;  1FOW A;  2COM A;  3DEU A;  2M9H A;  3LFU A;  1E3P A;  3C2H A;  2VQH A;  2C6Y A;  3JAM K;  1OJL A;  3CJQ B;  2IVM A;  3CDI A;  2OCE A;  2X6X A;  4A3K J;  1TW2 A;  3KLN A;  2CUZ A;  4KJZ A;  3E5Q A;  2EH3 A;  2NS8 A;  2MLK A;  4Y17 A;  2HI3 A;  1EH7 A;  3BPV A;  3HSF A;  1VQ6 I;  2K85 A;  2BE5 F;  3KP2 A;  1X58 A;  2K4B A;  1KYW A;  4PJM A;  1VF9 A;  2P4W A;  1AOY A;  1YG2 A;  5E3O A;  4YFK F;  1U5T C;  1Y8R B;  1XTA A;  1FMW A;  3G1L A;  4F93 B;  5LEJ A;  1T39 A;  1FYM A;  1R58 A;  3MZ8 A;  4MQ9 F;  2PMZ A;  1MSF C;  2K3F A;  3FM5 A;  3Q3S A;  2DFI A;  4DBR A;  3U1D A;  2L01 A;  4AIK A;  5C4J J;  1KGS A;  4E7L A;  2WAQ A;  4IPA A;  4DNC A;  1D0X A;  2E2J J;  1RES A;  2HOA A;  2EK5 A;  2VKE A;  1NK3 P;  3RYP A;  3SYT A;  4HF0 A;  3ZMU A;  1K61 A;  3RZD J;  1PP8 F;  1D5V A;  5M3F J;  2FNP A;  2D1V A;  3QYB A;  4IRI A;  2EJR A;  1U8R A;  3UR3 C;  3OIO A;  2LKX A;  2WA0 A;  2DOA A;  2CWE A;  1I39 A;  3OYF A;  2R7V A;  5H6R A;  3IWZ A;  3M8E A;  5HDG A;  3CLQ A;  3LWF A;  4XKC A;  3JTG A;  2FBH A;  5C4X J;  5EDN A;  4QSH A;  2H8W A;  3N97 A;  2MH2 A;  4LIV A;  1TLH B;  1FNN A;  3Q0W A;  4U0Y A;  2E1M C;  3HPG A;  4MFD A;  2DMU A;  5IYC J;  3F8F A;  1XX5 A;  2JTV A;  1K83 J;  3BLY A;  1Z7L A;  2FOK A;  2JWT A;  3DFG A;  2CRG A;  3COA C;  4X6A J;  1VFC A;  3I58 A;  1RNL A;  6PAX A;  5TJJ A;  2HZD A;  4CHU A;  2EPF A;  3RYR A;  4ESJ A;  3OOU A;  1BN5 A;  5L3E A;  1R23 A;  1SFO J;  2VJ5 A;  2L5Q A;  2WTE A;  1WZ2 A;  3LA2 A;  4NC8 A;  1Q1H A;  3CO6 C;  3D0S A;  4IVN A;  5L3B A;  4NB5 A;  1RPW A;  3C3W A;  1CF7 B;  3HHG A;  2HOS A;  1G3W A;  3HRU A;  2XF7 A;  3ZR8 X;  2X1E A;  5FKL A;  4DBQ A;  4RM2 A;  3JRD A;  1YJN I;  1BR2 A;  3HBL A;  3CMA I;  3CCJ I;  4D0P A;  4PGG A;  3GFI A;  3HEF A;  2BW3 B;  3MAJ A;  4HV6 A;  1BW6 A;  3EQL F;  4KFC A;  2NVU B;  3OYA A;  1UHW A;  2HWV A;  4N0B A;  1V55 H;  2EV6 A;  4KYW A;  3S2W A;  4M6Y A;  4G7H F;  2KMU A;  1U9O A;  1O7L A;  1CGP A;  4EJV A;  4HAM A;  5K7H A;  4Y3O A;  1WJC A;  2BYV E;  3H5N A;  1PUF A;  1XSX A;  4DOZ A;  1Z67 A;  2EZL A;  4ZH4 F;  1YI2 I;  1YOV B;  2Y48 A;  1U78 A;  1HDD C;  1JHH A;  4I0A A;  4AD9 A;  4NDL A;  3BG9 A;  1APL C;  4OIO F;  1KQ9 A;  1X1B A;  5F0H A;  1DU0 A;  1XCV A;  2CU7 A;  2ID6 A;  3I59 A;  1T56 A;  2DA4 A;  1IC8 A;  4GFB A;  3K4M A;  1LUJ B;  1UG0 A;  2BGC A;  2KFD A;  1UMQ A;  4MQV A;  3FK7 A;  2BV6 A;  1WRJ A;  2ZCW A;  4A6D A;  1RKW A;  3J7Z I;  1B6A A;  2XAH A;  1K78 A;  1C0W A;  2PG4 A;  4LFU A;  5JHU A;  1QO0 D;  3C7J A;  4EQQ A;  5CVV A;  1LVK A;  2ZSH B;  2A6H F;  2DOE A;  1RR7 A;  2PLY A;  2L9S A;  3HSE A;  3K2Z A;  4M72 A;  1ZR4 A;  1GHC A;  3V8K A;  4N4N B;  3CUQ B;  2CUE A;  3GZ5 A;  1I27 A;  2W84 A;  3LOC A;  2KT0 A;  4B3A A;  3RKW A;  4NUB A;  4BBR J;  3OYE A;  1B59 A;  3A2K A;  3P5J A;  3AG4 H;  4CXF A;  2R7R A;  1TZL A;  1P4W A;  2CJJ A;  3RKQ A;  2HQR A;  2DA3 A;  4LK0 F;  4OOI A;  1SEU A;  2ZME B;  4Y13 A;  1WJA A;  1ZK8 A;  3BR2 A;  5K1Y A;  4B09 A;  3BTJ A;  5D5W B;  3VYT B;  2K9Q A;  1PUE E;  4EM2 A;  2XUB A;  3QU3 A;  4MIM A;  2NYX A;  2M1B A;  1TWC J;  2N8G A;  2QBY B;  1Z6R A;  2E34 A;  3RTR A;  3GLX A;  1X1D A;  4II3 A;  2MD5 A;  2GLO A;  2NS7 A;  2P7V B;  3HOV J;  3C2G A;  2W1O A;  1N78 A;  4LLL A;  4KDP A;  5J4Y A;  2BZT A;  2BVL A;  2XGX A;  3SXY A;  3VSL A;  4A6E A;  3F22 A;  2HPI A;  1D8J A;  2R5Y B;  2F6C A;  1P4A A;  3MFK A;  2X0L A;  1YJ9 I;  3FDY A;  5DYM A;  5JLX A;  3GX4 X;  3GZ6 A;  2KL4 A;  3E1S A;  2Q2E A;  1X3W B;  3PO3 J;  2JSP A;  4A0Z A;  1R9T J;  4XLC A;  4A3B J;  1JXS A;  3L2R A;  3GBG A;  1H9T A;  3OS2 A;  3JRG A;  1X1P A;  4PGH A;  2BXZ A;  1N77 A;  4C2U A;  1HST A;  1IN4 A;  2F5E A;  2KIS A;  3WE3 A;  3NRV A;  4A3L J;  2A69 F;  3K2A A;  5EYR A;  2LY1 A;  5FKN A;  2ZJQ F;  3EYI A;  1SD6 A;  2FE3 A;  5E17 F;  1ZRD A;  1IUF A;  3OS0 A;  4CYC B;  4IHT A;  1XGO A;  2X6W A;  1KQ0 A;  3R0A A;  4EJU A;  2WBM A;  4WX9 A;  2VBY A;  3E6D A;  5B66 C;  5EG0 B;  1NHA A;  1S7E A;  3KIO A;  4BQA A;  5FD5 A;  2MBF A;  2KDZ A;  1XSV A;  3PIO F;  3I3L A;  2LSO A;  3BTI A;  3LA3 A;  4ETS A;  2ZXJ A;  3CUQ C;  1VQO I;  3RPU D;  5DDG A;  3JSP A;  2Z16 A;  4MFE A;  1P2F A;  1YW9 A;  3ZQL A;  1I5Z A;  1JTX A;  2KZG A;  1FZP B;  3L00 A;  2WV0 A;  2GXA A;  3VSK A;  3BQY A;  3G4S I;  2LYC A;  5BPI A;  2ZME C;  1KU9 A;  2DMQ A;  1U6G A;  4D7N A;  2CO5 A;  5FKM A;  1IDY A;  4NBQ A;  4IOC F;  2O03 A;  5IT9 K;  5K7F A;  4KA4 A;  3PJR A;  1MND A;  3WGG A;  3DQV C;  4F92 B;  5IT3 A;  4BHB A;  2MYS A;  1TQP A;  3GTJ J;  1TWA J;  3DU5 A;  3A01 B;  1LB2 A;  4EGZ A;  3BZ6 A;  3UNG C;  1WH5 A;  2ZJ2 A;  5H2F C;  2DCE A;  2IGK A;  3I71 A;  3HKZ N;  3M1E A;  1V5F A;  1IW7 F;  4PJL A;  2OPT A;  1SVO A;  3H3Z A;  4CYD A;  1WJE A;  1P7I A;  3IH4 A;  3FK6 A;  2HQN A;  3KET A;  4JX4 A;  3IHU A;  1W36 C;  2O9L A;  4KNY A;  2XAQ A;  2QSF X;  3FIS A;  4KUM A;  5D6E A;  3ULQ B;  2IGN A;  2KHM A;  1BIA A;  3CP2 A;  3SQN A;  1W5S A;  1ZG3 A;  3SFZ A;  5FLM J;  1TTY A;  3DKY A;  4E7K A;  3W6V A;  2L7K A;  3VEP A;  4OIR F;  1OCZ H;  2XKP A;  4A93 J;  1KU2 A;  3LFK A;  5DD8 A;  2LKP A;  5F1J A;  1YO5 C;  2QQ9 A;  5LHG A;  2IA2 A;  5LGU A;  1MKM A;  4Y4R A;  3ZN0 A;  1IAW A;  2Z9O A;  2M4K A;  3TOA A;  2Y9Z A;  4M74 A;  3HOX J;  1FYK A;  4C9Y A;  2RNJ A;  1LFB A;  4U7D A;  3RIR A;  1BW5 A;  2GWR A;  4KN7 X;  1F4K A;  2M30 A;  5AON A;  5FLV A;  1EF4 A;  2WAD A;  2V26 A;  1OCR H;  4HW0 A;  3TDU C;  3CCE I;  1X4O A;  5DV5 A;  4BU2 A;  3OYG A;  2EV5 A;  4E6K G;  2HOT A;  5HNF A;  1AHD P;  4CGZ A;  3M9A A;  4ZYA A;  2YU9 J;  4BXU A;  3Q0U A;  2EFO A;  4N9H A;  2AHQ A;  1X4P A;  1L0O C;  2RC4 A;  4A3F J;  1VTN C;  2HDW A;  3KP4 A;  2UXX A;  4HG2 A;  3FX3 A;  2A07 F;  1MNE A;  2OC6 A;  1TT0 A;  4HEA 2;  2QQ8 A;  2O5R A;  2IGM A;  1FEX A;  3NWT A;  1Z1D A;  2XAU A;  1FOX A;  4RGX A;  3E0J B;  4G9Y A;  4UNO A;  3BZC A;  1W5T A;  5L3F A;  4A12 A;  2L0K A;  2YUS A;  3QP6 A;  1ERD A;  1A31 A;  3K4B A;  2DA1 A;  4CUG A;  4FX0 A;  4H4K C;  3TW7 A;  4KIG A;  4ASN A;  2H1K A;  4BNC A;  2D1H A;  2TDX A;  2L4M A;  3K4L A;  4A0X A;  2O6G E;  3ZQC A;  1ZGA A;  3QOD A;  2KIQ A;  2LOO A;  5JR3 A;  3BG3 A;  4GYG A;  3R0J A;  3S14 J;  3GWZ A;  3GFJ A;  4Z2Y A;  1STZ A;  3KPH A;  4I6Z A;  3I5U A;  4QPQ A;  1FJL A;  1JHF A;  2B0L A;  3WG9 A;  4AID A;  1MDM B;  4XKB A;  3IL2 A;  4EM0 B;  2F4I A;  4PJJ A;  5JHF A;  1ITY A;  3TL4 X;  3F0C A;  1RRJ A;  2QYO A;  1LJ9 A;  5K5O A;  2QEN A;  2MAB A;  3A1Y A;  2CH0 A;  2M87 A;  3W2A A;  4O5V A;  2DDA A;  1UCR A;  3M3Y J;  3M8J A;  4U88 A;  1YRN B;  1LQ1 A;  4FET A;  5CLS A;  3FBI B;  4EJW A;  5HNH A;  1ZGW A;  5D6F A;  2EA4 A;  1IN6 A;  2R5Z B;  2VPL A;  2JPC A;  2A3S A;  4E7H A;  1Q1V A;  2A6T A;  1T0F C;  2FF4 A;  2NVQ J;  1YIT I;  1JKQ C;  4G12 A;  5KVR A;  2K9L A;  5HS9 A;  3RKX A;  1WGX A;  3I54 A;  5M5W J;  3GLL A;  4BAY A;  2CMP A;  4BQQ A;  1ZG1 A;  1N25 A;  1XB4 A;  1REP C;  4GYI A;  4UVC A;  3I4P A;  3K6G A;  3A0H C;  2NOJ B;  2RAE A;  3ZPL A;  1W7P B;  3ELK A;  2Q0O A;  2RN7 A;  2FMY A;  3WG7 H;  4XBF A;  3I4N J;  3QRF F;  2VKV A;  1FX7 A;  4XN3 A;  5DD4 A;  4B1R A;  5HOO A;  3PQK A;  1ZKG A;  3T5X A;  1QZE A;  3F8N A;  3V7R A;  4F52 A;  3JSO A;  1OLT A;  4ON0 A;  4LG0 A;  2LLK A;  3LSG A;  3CCV I;  2WWY A;  9ANT A;  3REO A;  2FX0 A;  3DPU A;  4PSX A;  1ODD A;  2X1D A;  2ISZ A;  5K5Q A;  3B6C A;  4BE0 A;  3DEW A;  5E1X A;  2IRF G;  4M3E A;  5IP7 J;  5IOY A;  4BKX A;  3GXO A;  2Y75 A;  4GXO A;  2XB5 A;  1MBH A;  1R7J A;  2XHK A;  5D5V B;  2R7T A;  3GZN B;  3LSJ A;  1EJ9 A;  4HX8 A;  4I7H A;  1HDP A;  4IRH A;  5M5X J;  3D5R C;  2R7Q A;  1Y39 A;  3C2B A;  4R1H A;  1IJW C;  3SZT A;  5HDK A;  1HOM A;  4I2O A;  4BJT A;  1UJ8 A;  4IHW A;  3OL4 A;  1SAU A;  2DK5 A;  4PFO A;  3FXL A;  3SJM A;  4PJ0 C;  3BQZ A;  5D4S A;  1MH3 A;  1RET A;  1K79 A;  2JVG A;  4IQJ A;  1IRF A;  3FXO A;  1ETK A;  3FXU A;  3M7G A;  3PL8 A;  2L7M P;  3CJN A;  2LBF B;  1VQ9 I;  2LDU A;  2CV1 A;  1DPR A;  5ILV A;  3LST A;  3K1N A;  5D8K B;  1XSD A;  3ZMS A;  2ETH A;  3D5L A;  4MTE A;  5FD6 A;  3PNY A;  4BXX J;  4XLA A;  3ZGK A;  2QWW A;  2WAE A;  3IAM 2;  1BL0 A;  1TBX A;  4ESB A;  2L54 A;  5LRR A;  4MNU A;  3RQ4 A;  1JJ8 C;  2R7X A;  3O2P E;  4RAZ A;  3ZN1 A;  5GAD J;  2YU3 A;  3MZY A;  3ZP5 A;  1PVE A;  1J0R A;  1I6X A;  1MJB A;  1W36 D;  3E6C C;  2E35 A;  2VKH A;  3CF2 A;  2M3A A;  3HRS A;  4II2 A;  3S2D J;  3FXR A;  5DCM A;  2FJ1 A;  1YS7 A;  1Z7U A;  2ECC A;  2WY8 Q;  2XVC A;  3K1M A;  4EGY A;  5KCM A;  4BXF A;  1EKE A;  1A04 A;  3HB9 A;  3PUF A;  2L9R A;  4GGG A;  3K4C A;  3SDB A;  1RUN A;  5LBQ A;  1Y1V J;  4E70 A;  1NH3 A;  2R3S A;  4KN4 X;  1BC8 C;  2EFW A;  1BJZ A;  2BXY A;  3M07 A;  4XID A;  1Y0N A;  2H94 A;  1XDU A;  1TT5 B;  4LOC A;  2A5Y B;  2DJI A;  5DCF A;  5B5E C;  4ZYH A;  3ZRG A;  4V2G A;  3BJA A;  3LQR A;  3SZP A;  4CZZ A;  1B9M A;  3WTY C;  4JOM A;  3BOQ A;  3KCC A;  2ME6 A;  1MBJ A;  1ETQ A;  5GTI C;  1LE8 B;  2K40 A;  2CV2 A;  1GXQ A;  1UFM A;  2O3F A;  4ZZL A;  1IN8 A;  5CVI A;  1AA7 A;  4OAZ A;  3ABU A;  3KEY A;  1S6L A;  3ECO A;  3ISP A;  1FBQ A;  3VYR B;  4HF1 A;  2DDB A;  1FYL A;  2FD5 A;  3TBI A;  2R93 J;  4BE2 A;  2M8G X;  5EZH A;  2PJR A;  3MKL A;  2R7U A;  1R22 A;  4J19 A;  1HF0 A;  4BY1 J;  1OCT C;  2XAF A;  2E1C A;  2ACJ A;  1IXR C;  1VQ7 I;  4HQM A;  3W2V A;  1E0E A;  3GUD A;  5IT9 Z;  3IAS 2;  1B72 A;  4W97 A;  3J81 Z;  5CVR A;  2CQN A;  1E3H A;  2CFO A;  2XPU A;  1GUU A;  3K4J A;  1TW3 A;  5LGN A;  2EZH A;  2V6C A;  2PMZ N;  2DMT A;  3OS1 A;  2TRT A;  3V8J A;  4P1W A;  2A6E F;  2IP2 A;  4J00 A;  2LRE A;  2P8T A;  4EAT A;  2Z99 A;  2DQL A;  4MLO A;  2WAQ N;  2XC7 A;  4NC6 A;  2AQE A;  4PJN A;  3P9C A;  2KQR A;  2HXI A;  3EUH A;  2VN2 A;  3KZZ A;  4B3X A;  1GDT A;  2A05 A;  2VBZ A;  4FX4 A;  3MZH A;  2F4O B;  3IRQ A;  1QVT A;  3ZMD A;  2IS4 A;  3AKZ A;  2G9W A;  1S7A A;  2IGO A;  3BTC A;  5FKO A;  2HNH A;  2HR3 A;  4UVB A;  1VQK I;  5GAG J;  3HGG A;  3JRH A;  1IV6 A;  1ORK A;  5J1R A;  3S8P A;  3H9Q A;  5FRN A;  3RCO A;  3LNQ A;  3WU1 B;  3ASO H;  3V7C A;  1X3U A;  1TL8 A;  2ZNY A;  3BG7 A;  3K70 D;  1ZH5 A;  1UST A;  1S29 A;  3GEZ A;  2X1C A;  1OQY A;  1YQA A;  2XPW A;  1T95 A;  1D1C A;  1LPQ A;  4S0H B;  2VOD A;  2WV1 A;  2E2H J;  1VQP I;  3K9T A;  2E5Z A;  2R7F A;  3HYI A;  1UZC A;  1HBX G;  3L7W A;  3LQQ A;  1LVA A;  2JPB A;  2VJI A;  4HPQ A;  4I02 A;  1YS6 A;  2L3D A;  1AKH B;  4HQE A;  2KLO A;  3CC4 I;  4Y7N J;  4WXD A;  1K6Y A;  3BJ6 A;  3WTX C;  2RRE A;  3PSI A;  3R60 A;  2IBD A;  3U21 A;  4XRS G;  2I5U A;  1BA5 A;  4U87 A;  2TCT A;  3HOW J;  2OCC H;  2XRL A;  4E7S A;  4ZZD A;  3HUG A;  3T0Y A;  2OU2 A;  3JRI A;  3OSF A;  1MBE A;  5CVJ A;  1LDK B;  2VE8 A;  3P9I A;  4IL6 C;  3EPZ A;  2Y30 A;  5KAI C;  4P5O A;  2CQX A;  3F8B A;  5FO5 A;  1AKH A;  2LTP A;  1MW7 A;  4A5N A;  2BHY A;  4IOA F;  2HEO A;  1A6Q A;  2X85 A;  4KIC A;  1SMT A;  4C2M J;  3WHC A;  2O61 A;  3DBL B;  4JX6 A;  2ELK A;  2VQC A;  4E4H A;  3F23 A;  1ZR2 A;  1HA8 A;  2BY0 A;  1IV8 A;  4RDU A;  2F4M B;  5CKT A;  4BQO A;  2VUM J;  1Z91 A;  1BI2 A;  2R7S A;  3GCM A;  1PUF B;  2IA0 A;  5M3M J;  2UUZ A;  3P7N A;  1V5G A;  3FF5 A;  2L9V A;  4ENM A;  1OCP A;  3BR1 A;  1ZLJ A;  2EIN H;  4BQN A;  2NVX J;  2JN6 A;  3VDX A;  2EFP A;  2GIV A;  4LIU A;  1WWX A;  2MD0 A;  4C3J J;  3KYL A;  2K02 A;  5F27 A;  3TKY A;  3J7A O;  4BJ5 C;  2VKD A;  2YX4 A;  4FE4 A;  3I59 B;  4C2T A;  1FLI A;  3S32 A;  5KK1 A;  1N75 A;  3BR5 A;  3E3V A;  5E3N A;  1HW2 A;  4BH9 A;  3WU2 C;  4IHY A;  2V9K A;  2KZV A;  1K78 B;  3U2R A;  4BHC A;  2XRO A;  4IO9 F;  2ZB9 A;  3GTK J;  4A0Y A;  2P6S A;  3L09 A;  2JMW A;  2V79 A;  3F8C A;  4G6D A;  3ZQG A;  4HNT A;  2HXO A;  2M7B A;  1J75 A;  1DGW Y;  1OFC X;  2XKO A;  5K7Z A;  2LG4 A;  4G7O F;  1DU6 A;  2EA2 A;  2HYF A;  3S17 J;  3CC2 I;  2GA2 A;  1O7F A;  1W1W E;  5D8L B;  2KIU A;  3GTM J;  3T8T A;  2R92 J;  1YTY A;  3O6B B;  2BY1 A;  5FFX A;  3FXJ A;  3BWG A;  4AWX B;  3S93 A;  3E7L A;  2M7A A;  5TRD A;  1Z21 A;  2EB7 A;  1WJB A;  3LA7 A;  1TQI A;  1YIJ I;  3G71 I;  3FWE A;  3E6B A;  5E20 A;  2MC4 A;  3BTL A;  2STW A;  3RZO J;  2QUF A;  2PMU A;  5GPA A;  4MEY F;  4Q5S F;  4GRI A;  4N4O B;  5B1A H;  3GTL J;  4FAS D;  2JK3 A;  1K4T A;  4KIT B;  4CIC A;  3FMS A;  1R1V A;  3TOB A;  1ZRC A;  4CCO A;  4A3I J;  3H3U A;  1VQ5 I;  4LLN A;  2M5W A;  1R1T A;  3H92 A;  3FXK A;  3K7A J;  4U0V A;  3FXM A;  3VOD A;  2P5V A;  1IGN A;  4EJT A;  5DM6 F;  1UAA A;  2UZK A;  1D0Y A;  2HKX A;  2ESH A;  3KEQ A;  4L9V A;  3V7S A;  1BC7 C;  2VON A;  4FTH A;  1MGT A;  2OTL I;  5BS6 A;  2IS2 A;  3GF2 A;  3CCM I;  1IN7 A;  4NQW B;  1FSE A;  3NWS A;  2COB A;  3CCU I;  2Q2E B;  3TP0 A;  1XC5 A;  2GXB A;  3M4O J;  3KP7 A;  2ZJR F;  4L18 B;  5DTD A;  1JUM A;  3FZV A;  2M2E A;  2IXS A;  2KRC A;  2OZU A;  4ITV A;  5F6F A;  5DEQ A;  5DUI A;  3FHZ A;  3OIP A;  4CSW A;  3SZG A;  2XGD A;  3E97 A;  4XK4 A;  3WTT C;  4CCN A;  4BHP A;  2KRH A;  2DFH A;  3C1D A;  2H1L A;  2OD5 A;  4NQW A;  3OYL A;  2YR2 A;  1YFH A;  2V1N A;  4XLE A;  4XL9 A;  3TMO A;  4XQF A;  2Z5U A;  2YSR A;  1SD5 A;  2WY7 Q;  2BOL A;  4EMS A;  1ZLK A;  2KDO A;  1S5L C;  2ZXW H;  1RZ4 A;  3TGN A;  4YIF A;  3DU6 A;  2PMH A;  2B9S A;  3ZMT A;  2Y0M A;  3ZQQ A;  4N9I A;  3LSK A;  2OA4 A;  3H9G A;  1OCO H;  2FU4 A;  2DO7 A;  3HOT A;  1VI0 A;  2DOF A;  1Y56 A;  5H6Q A;  2AO9 A;  1W5C C;  5D5U B;  4XRS A;  4WF2 A;  4AIH A;  1R49 A;  2L9N A;  1K7A A;  1JUS A;  2JA6 J;  3LMM A;  2X6Y A;  3K0L A;  5HS7 A;  3V8L A;  1FTZ A;  3DWL E;  2JQ7 A;  3CME I;  1UB9 A;  3PSF A;  1F5T A;  3R61 A;  3F6V A;  3T1B A;  3BCA A;  4JQF A;  4NNJ A;  5LHI A;  1OR7 A;  4JP0 A;  2FA5 A;  2UXN A;  3CQZ J;  4K2E A;  5FLX Z;  3CCL I;  2XAG A;  4A3G J;  2OJE D;  4XLF A;  3OYI A;  5E3M A;  3E6M A;  4YG2 F;  2LRD A;  1BOB A;  3QQA A;  2XIG A;  2XSJ C;  1YX3 A;  3CUO A;  1S72 I;  3QWL A;  3HOS A;  4WK8 F;  5LLQ A;  3JRF A;  2HGC A;  3CTA A;  3D5S C;  5LD2 C;  1A35 A;  2KIF A;  1MMN A;  3HRM A;  2AQF A;  4CCJ A;  1RIO H;  4GO1 A;  3CMY A;  4D5C A;  3J81 K;  2ECB A;  4KIS A;  4JBA A;  4B48 A;  3A02 A;  4EV0 A;  1FBU A;  2LY2 A;  4ENK A;  2XAS A;  2HDC A;  2CW8 A;  2Z3Y A;  1F1Z A;  2DYS H;  3KP6 A;  1ETW A;  3ABT A;  1J7K A;  4V19 K;  1X1A A;  5FJ8 J;  5ICC A;  3AL0 B;  4I0B A;  2IEK A;  2VI6 A;  1XGM A;  1O57 A;  1A5J A;  4UHT A;  2EV0 A;  4G94 A;  1UG2 A;  1R4N B;  3BPX A;  4Q4Z F;  1AU7 A;  5EZG A;  3EDP A;  2VQG A;  2RKH A;  5C44 J;  3A4C A;  3F21 A;  1HKQ A;  1H8A C;  3VOE A;  1DGR M;  1DDN A;  3DEE A;  4RGU A;  3WTS C;  4XRF A;  2V9V A;  1FP1 D;  1Z9C A;  5F0C A;  3TO9 A;  3SDG A;  2BY2 A;  2WAF A;  2BVM A;  4XSX F;  1I6H J;  3HOU J;  3NAR A;  5F04 A;  4FHT A;  1D0Z A;  1WJF A;  2XF5 A;  4E7Z A;  1X3Z B;  2EZI A;  2DFF A;  2G7H A;  4P55 A;  1T8I A;  1J59 A;  3BR3 A;  3TP3 A;  2B7E A;  1ONV A;  4B4C A;  5E8I A;  3I56 I;  3OV8 A;  2VC0 A;  1ON1 A;  1WJ5 A;  5EF6 A;  2EIL H;  2ZXH A;  5EGO A;  5LHH A;  2FBI A;  1LEA A;  2CW7 A;  2F48 A;  3I9V 2;  3LSM A;  3N05 A;  2PN6 A;  3ABM H;  5E79 C;  5FFZ A;  3VYS B;  2E1O A;  1B4A A;  5F08 A;  1X2N A;  2VBX A;  3WGI A;  4IHV A;  5LGT A;  3S16 J;  1XGN A;  2JZY A;  4M3G A;  1R5H A;  1U9N A;  2HDD A;  2OV7 A;  3JTH A;  4O6J A;  1LKX A;  5ED4 A;  1XG1 A;  5EEG A;  1ZEL A;  2QM3 A;  5D5X B;  3MCZ A;  1ZRF A;  1FWZ A;  3IV5 A;  4I99 C;  1LFP A;  3ZMZ A;  1IDZ A;  1VQ4 I;  1J2X A;  2DU9 A;  2FQ3 A;  4R8H A;  4BEH A;  3OYM A;  1WI3 A;  1YLF A;  4P9U A;  1QZY A;  3L2C A;  4BL0 B;  2PJP A;  2FBK A;  2R7D A;  3BC8 A;  1RR8 C;  2PBI A;  2V7F A;  3CDH A;  3AL0 C;  2PQ8 A;  3ERM A;  3MD2 A;  2ZFU A;  4IQ4 A;  1IUY A;  5ILU A;  5H20 A;  3FM3 A;  5E1W A;  3HM5 A;  3B73 A;  3PM1 A;  1R6R A;  3ABK H;  4C3I J;  2CUF A;  2DI3 A;  2DQR A;  5J4V A;  3DBH B;  3KYD B;  4UV9 A;  2G0E A;  2ZFW A;  4ESF A;  1LFU P;  5JI6 A;  2DOD A;  1QGP A;  3OYD A;  3DLA A;  3H35 A;  4IX7 A;  2JA2 A;  5KAF C;  1HCR A;  3BRO A;  3I0T A;  4LD5 A;  4OIQ F;  4YFN F;  2Y0S A;  5ERI A;  1K4S A;  2UV1 A;  3H0D A;  1WVR A;  1QA6 A;  3GTP J;  1GV5 A;  2MC3 A;  4ZYG A;  3PO2 J;  4GCV A;  3R6S A;  4LG0 B;  2A61 A;  3KZY A;  3NQO A;  4MEX F;  2R7Z J;  2DMN A;  2HYG D;  4ZJZ A;  2NOG A;  2GOX B;  2KIM A;  5IYB J;  3PNT A;  4X0G A;  2BBY A;  3MMY B;  3WTU C;  3IRR A;  1T98 A;  3BT9 A;  2AS5 F;  2HOE A;  3GME A;  3QOE A;  2DAO A;  2PI0 A;  4M9Z A;  4JK1 X;  2MG4 A;  3GTO J;  1KYZ A;  3CCQ I;  3QU6 A;  3CO7 C;  3MEX A;  2XPV A;  1MBG A;  4UUS A;  3HDD A;  3HJE A;  4RB0 A;  1JJ6 C;  3BP8 A;  3FKI J;  1OCC H;  3MQ0 A;  4QWQ A;  2CUJ A;  1MIJ A;  3EET A;  3LAJ A;  3S15 J;  1UEL B;  1WPK A;  3L2V A;  2IPQ X;  1OYW A;  2GA1 A;  1T33 A;  1HKS A;  4LB5 A;  3GFM A;  4B8X A;  3I55 I;  3G73 A;  4EEF G;  1XGS A;  3DP7 A;  1JUP A;  2ID3 A;  3K4K A;  5B1B H;  1X2M A;  2IS1 A;  3TDZ C;  4AYB A;  3WTW C;  1QQI A;  1SD7 A;  1FP2 A;  4LB6 B;  4WCG A;  3HTU A;  3HC7 A;  1TWG J;  4ENN A;  4EJO A;  3F6O A;  3Q9S A;  1IF1 A;  2V6E A;  3MN2 A;  5E3L A;  4Y15 A;  4KIB A;  2VJ4 A;  4FT8 A;  2RGV A;  1ZAR A;  2QQA A;  5JVG F;  3HOZ J;  1RKT A;  1IXC A;  1IN5 A;  4BGD A;  4KT5 C;  1FSH A;  2OQR A;  3LSH A;  2NVT J;  5A2Q Z;  2CQK A;  2VT3 A;  3DTE A;  4BJ6 C;  3WTV C;  3MWM A;  2F5D A;  3QAH A;  2F2E A;  4Z6Y A;  1B8I A;  2E36 A;  3WHB A;  4TV7 A;  4V2F A;  3LSI A;  1ZQ3 P;  2VL8 A;  1F43 A;  5J1Y A;  4UUT A;  5FGM A;  5DCM B;  2PX9 A;  1I1S A;  1LDD A;  2NXN B;  1FY7 A;  1A6I A;  4M3B A;  3H5A A;  3RDI A;  3VFZ A;  1O3Q A;  2EFQ A;  4L5J A;  1S9H A;  1XN7 A;  4XMY A;  4RLF A;  1JTY A;  5HOD A;  1DQU A;  3OIQ A;  3OYC A;  3MKY B;  1QHG A;  1QZZ A;  1D8K A;  3SFI A;  3DBR B;  4U0W A;  3FMQ A;  4CCL A;  2EZK A;  1G3T A;  3OR2 C;  3LSR A;  2VAS A;  1V3F A;  3RPQ A;  1MBF A;  4LIT A;  5GTH C;  1TC3 C;  4HDU A;  1JKR C;  1R5I D;  1ZTR A;  2Q8K A;  4HF2 A;  1Y0U A;  1P92 A;  4GDF A;  1IRZ A;  2CFX A;  3EUK L;  1ETX A;  4Y52 J;  3VYU B;  2P7C B;  3JW4 A;  4XR6 A;  1D1B A;  1XMK A;  2FNA A;  4XOT A;  1TQM A;  3ZQI A;  1KQ8 A;  3GYH X;  3KZI C;  2D45 A;  3FKJ A;  2EIJ H;  4I76 A;  4S04 A;  2X51 A;  2QLZ A;  4P96 A;  5FLX K;  4L5E A;  2OAZ A;  5D4R A;  2JUC A;  2NNY A;  1UHS A;  1WCM J;  2K7L A;  1QU3 A;  5CPR B;  2PJR B;  5IP9 J;  4F7Z A;  3I53 A;  1ZRE A;  1WSU A;  2ZXI A;  2IT0 A;  5J6X A;  1OYY A;  2ZJP F;  3S2H J;  5CVU A;  3S3M A;  1JT0 A;  1B72 B;  3MKZ A;  2FXA A;  3HTS B;  4UB8 C;  1GT0 C;  1U5T A;  1BI1 A;  3U1K A;  2PFB A;  1I50 J;  1KON A;  4OIP F;  1RC9 A;  2VC1 A;  4P9F A;  2JRM A;  1TWH J;  2HTS A;  4I09 A;  4M3F A;  4XM3 A;  1B9N A;  4AM3 A;  3ASN H;  1R36 A;  3PFY A;  4RAY A;  1IRX A;  3CJT B;  2DPU A;  3BDD A;  5J1U A;  4LK1 F;  1KU7 A;  2M0M A;  4CZC A;  3V42 A;  1POG A;  2K27 A;  4HZF A;  2STT A;  3CJR B;  4G6T B;  4IHS A;  3H5R A;  3ONQ A;  2EIM H;  1KU3 A;  3HIF A;  3RPU A;  2RQP A;  4XRM A;  1S7O A;  2L7F P;  1AWC A;  1ZG5 A;  2KRF A;  5ICE A;  4EM1 A;  3CD6 I;  4HYE A;  2GOM A;  1SC7 A;  1ZHF A;  2HVQ A;  4L9N A;  3BY6 A;  2XGC A;  4MGR A;  4RGS A;  2M4G A;  2VXD A;  2EFN A;  5ILS A;  3ZCO A;  4Q48 A;  2R4G A;  5DUK A;  2HYJ A;  4D5F A;  2EWN A;  2W82 A;  1NG7 A;  2O8X A;  3FHN A;  5E1Z B;  2FRH A;  4BY7 J;  2VQL A;  4M6X A;  2HKO A;  4WXH A;  2NRA C;  4FQG A;  4EVI A;  2OTJ I;  2HS5 A;  3J7A Y;  5DS9 A;  4RB2 C;  1BI0 A;  3KX2 A;  1GLN A;  4XNF A;  2OBP A;  2Y69 H;  3CCR I;  3KYC B;  3ZOB A;  2E60 A;  2V1D A;  3DPL C;  5AIQ A;  4E7J A;  1K6O A;  2XDV A;  3AG2 H;  4OMY A;  3HZJ A;  3X2Q H;  2H09 A;  3BG5 A;  3I4M J;  1S8N A;  3HUG B;  3ZMV A;  2VBW A;  2MFZ A;  2W85 A;  3MKW B;  3K1P A;  3BR0 A;  2EBI A;  5KHD A;  2VB6 A;  4KIF A;  3J80 K;  2XSD C;  1BI3 A;  1MJ9 A;  4IKF A;  5F0F A;  1V5E A;  5E8G A;  4HX4 A;  3SEQ A;  3TO7 A;  1SFX A;  3EYY A;  2IA1 A;  4DQ2 A;  1SFK A;  3S3N A;  2D5V A;  2B63 J;  1ETY A;  3OYB A;  3G2B A;  4AU7 A;  1ZYR F;  2IW5 A;  2K5C A;  1KA8 A;  1JKP C;  2JSC A;  4IEJ A;  4IF4 A;  1VQ8 I;  1FBS A;  5ICG A;  2HQA A;  5DM7 F;  3UKG A;  3EUH C;  3GTG J;  3G3Z A;  3BG6 A;  2CYY A;  5JVT A;  4YII A;  2LMD A;  4L0Z B;  3HPH A;  4C3H J;  5KNL A;  3KEO A;  3EUA A;  1F9N A;  4H0E A;  1JI8 A;  2HTJ A;  4HRI A;  1ZAO A;  3ESW B;  4ZDL A;  1Z3X A;  3DF8 A;  4QTR A;  1YIO A;  3GTQ J;  2ZSI B;  2DA2 A;  3WTZ A;  4IHX A;  3OSG A;  1J9I A;  2LC2 A;  4F3Q A;  2VPR A;  2H8R A;  4HX7 A;  2L2O A;  1W0U A;  3KFW X;  3G6E I;  2J5O A;  4CDG A;  4RLQ A;  3IC7 A;  1NK2 P;  3DLL F;  5TIS C;  3IKV A;  2GZW A;  3L2W A;  1MMS A;  4I01 A;  4AUX A;  5F64 A;  2PEX A;  4OWR B;  2CS3 A;  1XS9 A;  4AIJ A;  2A68 F;  2MGQ A;  1KZH A;  4DYQ A;  2H6C A;  3H1C A;  3BR6 A;  5J40 A;  2Y2Z A;  2A5W A;  1MSE C;  5GPC A;  3S3O A;  1X1C A;  2LKS A;  3BZK A;  1IZ1 A;  3H0G J;  3PNV A;  1Y8Q B;  1ULY A;  4A3J J;  2E7W A;  4ANJ A;  1W7P D;  4G6Q A;  3U9G A;  1P4X A;  4XSZ F;  2JJ7 A;  4L9T A;  1EH6 A;  1XMA A;  4L5I A;  1J09 A;  5K5R A;  1CF7 A;  2F5V A;  4XLH A;  4YIR X;  5BOX A;  1BIB A;  1TWF J;  1OMI A;  2D2W A;  2E1N A;  3PQJ A;  4XLP F;  4IZZ A;  2XB0 X;  1EH8 A;  1SAN A;  1MNM C;  2ELJ A;  1DUX C;  2LF8 A;  2BW3 A;  2VJJ A;  2Z33 A;  1RI7 A;  1JE8 A;  2DMP A;  3DKX A;  1E2X A;  2LFB A;  1FC3 A;  1YJW I;  3FBN B;  3B6A A;  2O7O A;  4CH7 A;  1SVL A;  1YX5 A;  4CCK A;  2MA3 A;  1R1U A;  4QIW N;  3BCB A;  3VB2 A;  4KT6 A;  5LFA A;  1Z3Y A;  2UWM A;  2EQR A;  1BJA A;  2RVC A;  4XOR A;  4HST A; 
#chains in the Genus database with same CATH homology
 5C44 J;  5IP7 J;  5IOY A;  4BKX A;  1H8A C;  2XB5 A;  2EH3 A;  1MBH A;  2NS8 A;  2HI3 A;  3LSJ A;  1CQT A;  2K9S A;  1X58 A;  1HDP A;  5F0C A;  5M5X J;  4AC0 A;  3C2B A;  3SDG A;  1VF9 A;  2QCO A;  5E3O A;  1IJW C;  1I6H J;  3HOU J;  3NAR A;  5F04 A;  1HOM A;  3G1L A;  4IHW A;  2EZI A;  3BR3 A;  1MSF C;  3SJM A;  3TP3 A;  4B4C A;  3BQZ A;  3Q3S A;  1MH3 A;  1RET A;  3ZQH A;  2DA5 A;  1JGG A;  3JRA A;  1ETK A;  5EF6 A;  5C4J J;  1O4X A;  5EGO A;  3QPL A;  2L7M P;  2E2J J;  1RES A;  2HOA A;  2VKE A;  1NK3 P;  2E1O A;  2M34 A;  1K61 A;  3RZD J;  5F08 A;  1X2N A;  5M3F J;  4IHV A;  4BXX J;  3CCY A;  2JA8 J;  3S16 J;  1BL0 A;  3OIO A;  4M3G A;  2M0C A;  2LKX A;  1U9N A;  2HDD A;  5BNG A;  1XG1 A;  1JJ8 C;  5C4X J;  1I3Q J;  3IV5 A;  5EDN A;  4QSH A;  1IDZ A;  2ME0 A;  3Q0W A;  1GVD A;  4MFD A;  2DMU A;  5IYC J;  1WI3 A;  3JRC A;  1K83 J;  3S2D J;  4RBO A;  2FJ1 A;  1ETV A;  1FIA A;  2JWT A;  2ECC A;  2CRG A;  4X6A J;  1VFC A;  4MO7 A;  2LD5 A;  4FIS A;  2NVY J;  3OOU A;  3HB9 A;  1SFO J;  2L9R A;  1HLV A;  3HM5 A;  3PM1 A;  4C3I J;  2R5Y A;  2CUF A;  3IH3 A;  1RPW A;  1Y1V J;  3H3V K;  2HOS A;  1BJZ A;  2G0E A;  5FKL A;  4XID A;  3JRD A;  1LFU P;  3HBL A;  4LOC A;  3HEF A;  2W48 A;  1Z0X A;  1HCR A;  1QVU A;  4V2G A;  2P81 A;  1BW6 A;  3GTP J;  1GV5 A;  2ME6 A;  1MBJ A;  1IG7 A;  1ETQ A;  1LE8 B;  3PO2 J;  2K40 A;  2R7Z J;  2DMN A;  2NOG A;  1H88 C;  4X1E A;  3DCF A;  5IYB J;  1U9O A;  1VND A;  4CYC A;  3BT9 A;  2FD5 A;  2R93 J;  5K7H A;  2M8G X;  5EZH A;  3MKL A;  3IH2 A;  4J19 A;  1PUF A;  1HF0 A;  1F36 A;  5EG0 A;  1OCT C;  4BY1 J;  2MG4 A;  3GTO J;  2EZL A;  3NAU A;  2XPV A;  2LK2 A;  3VPR A;  1MBG A;  3D1N I;  4UUS A;  1U78 A;  4M6V A;  1HDD C;  3HDD A;  1WH7 A;  4NDL A;  1B72 A;  4W97 A;  3BG9 A;  1JJ6 C;  1APL C;  3FKI J;  5F0H A;  2QF7 A;  1DU0 A;  2CU7 A;  2ID6 A;  1GUU A;  2XPU A;  1T56 A;  2DA4 A;  3S15 J;  1IC8 A;  1P7J A;  2EZH A;  2I10 A;  2PMZ N;  4GFB A;  1WPK A;  2DMT A;  2TRT A;  1UMQ A;  1T33 A;  3FK7 A;  2JA7 J;  4FE7 A;  1RKW A;  4EEF G;  1JUP A;  2ID3 A;  2WAQ N;  4MLO A;  5EGO B;  1X2M A;  1JT6 A;  3FIW A;  2DTZ A;  3G1M A;  1RR7 A;  1G2H A;  2HXI A;  1GDT A;  1TWG J;  3JR9 A;  1QVT A;  1ZR4 A;  3BTC A;  3MN2 A;  5E3L A;  4D7M A;  5FKO A;  3A01 A;  2CUE A;  3LOC A;  1ETO A;  2KT0 A;  4B3A A;  3HGG A;  2FQ4 A;  4BBR J;  3JRH A;  5EEA A;  1RKT A;  1IV6 A;  1ORK A;  3HOZ J;  5J1R A;  2NVT J;  3LNQ A;  3HOY J;  3MVP A;  2CJJ A;  2OF7 A;  3RKQ A;  2DA3 A;  1Y1W J;  3S1R J;  3G1O A;  1B8I A;  1ZK8 A;  3BR2 A;  4V2F A;  3WHB A;  3BTJ A;  2WB1 N;  1ZQ3 P;  2XPW A;  1F43 A;  5J1Y A;  2K9Q A;  1FIP A;  4UUT A;  4S0H B;  4MIM A;  2WV1 A;  2E2H J;  2X6O A;  1TWC J;  1Z77 A;  2N8G A;  1A6I A;  4M3B A;  1W0T A;  4DZP A;  2GLO A;  2NS7 A;  3HOV J;  1JTY A;  5HOD A;  3QPS A;  1AKH B;  1NTC A;  3SFI A;  4Y7N J;  2R5Y B;  2EZK A;  3LSR A;  2IBD A;  3TW6 A;  2X9D A;  1MBF A;  4XRS G;  1TC3 C;  1BA5 A;  2TCT A;  3HOW J;  2XRL A;  5JLX A;  1JKR C;  1ZTR A;  3JRI A;  3LSP A;  3OSF A;  1MBE A;  3PO3 J;  2CQQ A;  1R9T J;  4A3B J;  1IRZ A;  4JYK A;  4A69 C;  3GBG A;  4A3E J;  2Y0S N;  1ETX A;  4Y52 J;  2Y30 A;  3CDL A;  2CQX A;  1AKH A;  3JRG A;  2LTP A;  2E19 A;  1MH4 A;  1D5Y A;  3ZQI A;  4I76 A;  4A3L J;  4C2M J;  3WHC A;  3K2A A;  5EYR A;  5FKN A;  1QPI A;  4JX6 A;  4L5E A;  2ELK A;  1ZR2 A;  1UHS A;  1IUF A;  4CYC B;  1WCM J;  4RDU A;  2VUM J;  5IP9 J;  1PUF B;  5M3M J;  5EG0 B;  1S7E A;  2K9N A;  2LVS A;  1OCP A;  3BR1 A;  2KDZ A;  2NVX J;  2JN6 A;  4UUS B;  3BTI A;  3S2H J;  1JT0 A;  1B72 B;  4C3J J;  5F27 A;  4FE4 A;  5IPA A;  1GT0 C;  4MFE A;  3ZQL A;  1JTX A;  3Q0V A;  3BR5 A;  5E3N A;  1I50 J;  3BQY A;  3L1P A;  1JKO C;  4IHY A;  1TWH J;  2DMQ A;  4M3F A;  4D7N A;  2ZB9 A;  3GTK J;  3A03 A;  5FKM A;  4AYB N;  2JMW A;  1IDY A;  3ZQG A;  5K7F A;  2HXO A;  5J1U A;  1OFC X;  5K7Z A;  1DU6 A;  1YRN A;  3S17 J;  2GBY A;  1POG A;  3GTJ J;  3GTM J;  1TWA J;  3A01 B;  2R5Z A;  2X48 A;  2R92 J;  1WH5 A;  4XRM A;  2Y31 A;  3HKZ N;  2L7F P;  5IP6 A;  2OPT A;  3RQI A;  3E7L A;  4ABZ A;  2XGC A;  1P7I A;  3IH4 A;  3FK6 A;  2XGE A;  3BTL A;  4JX4 A;  2O9L A;  2LP0 A;  1B8I B;  2HYJ A;  3RZO J;  4D5F A;  3FIS A;  5GPA A;  3GTL J;  2JK3 A;  3S1M J;  5FLM J;  4BY7 J;  4BBS J;  3W6V A;  4A93 J;  1ENH A;  5DS9 A;  4A3I J;  3S1N J;  5F1J A;  3K7A J;  1IGN A;  3ZOB A;  2Y9Z A;  3HOX J;  2LR8 A;  3O8H A;  2DA7 A;  1LFB A;  2Y9Y A;  4FTH A;  1BW5 A;  5FLV A;  3BG5 A;  3I4M J;  1EF4 A;  1MBK A;  2COB A;  1U8B A;  3TP0 A;  1XC5 A;  3BR0 A;  2EBI A;  3M4O J;  5DTD A;  2HOT A;  2XSD C;  4M3D A;  1AHD P;  1JUM A;  2M2E A;  2YU9 J;  3O8G A;  5F0F A;  4A3C J;  3Q0U A;  2AHQ A;  1FTT A;  2XGD A;  2GM4 A;  4XK4 A;  5M5Y J;  4A3F J;  3JRE A;  2D5V A;  4FCY A;  2B63 J;  1ETY A;  1FEX A;  1JKP C;  4IEJ A;  2L0K A;  2YUS A;  3UKG A;  2DA1 A;  3GTG J;  3TED A;  1QRY A;  2O8K A;  5JLW A;  3TW7 A;  1E3O C;  4C3H J;  2HQ5 A;  5C3E J;  2H1K A;  4A3D J;  2LY9 A;  1VI0 A;  3ZQC A;  2AO9 A;  4QTR A;  4XRS A;  3BG3 A;  3GTQ J;  2DA2 A;  3S14 J;  4IHX A;  1JUS A;  3OSG A;  2DJN A;  4I6Z A;  2JA6 J;  4A3M J;  4DW6 A;  1FJL A;  2H8R A;  2VPR A;  1FTZ A;  1W0U A;  1ITY A;  3JRB A;  3F0C A;  5J3L A;  4W1U A;  2MSY A;  1NK2 P;  2E2I J;  2JA5 J;  4JP0 A;  3CQZ J;  4AUX A;  2L7Z A;  1XS9 A;  4A3G J;  2MGQ A;  4DYQ A;  5E3M A;  3M3Y J;  1YRN B;  3QQA A;  1H89 C;  3BR6 A;  2Y2Z A;  1MSE C;  1ZGW A;  5GPC A;  3ZQF A;  2R5Z B;  4XIC A;  3H0G J;  1Q1V A;  4A3J J;  3JRF A;  2NVQ J;  1JKQ C;  4JX5 A;  4G12 A;  5M5W J;  1WGX A;  2MW8 A;  2JJ7 A;  4DZJ A;  5IOZ A;  2DA6 A;  2DN0 A;  3CMY A;  4D5C A;  3S1Q J;  1GV2 A;  1TWF J;  2ECB A;  2RAE A;  5IYD J;  2IAI A;  2XB0 X;  1SAN A;  1MNM C;  2R0Q C;  3I4N J;  2VKV A;  4B1R A;  2DMP A;  3A02 A;  2LFB A;  4HNV A;  5GP9 A;  1ZKG A;  3HGY A;  5FKK A;  1ETW A;  3B6A A;  2O7O A;  1LE8 A;  3LSG A;  2LLK A;  4DYC A;  2YS9 A;  5FJ8 J;  9ANT A;  2FX0 A;  4DYR A;  2IEK A;  2VI6 A;  2M9H A;  4QIW N;  1A5J A;  3B6C A;  1OJL A;  1UG2 A;  2EQR A;  3DEW A;  1AU7 A;  5EZG A;  4A3K J;  4M3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...