2N9BA

Solution nmr structure of antiparallel myosin-10:gcn4 tandem coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
GSHENKQVEEILRLEKEIEDLQRMKERQELSLTEASLQKLQLEDKVEELLSKNYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Unconventional myosin-X, General control protein GCN4 fusion
publication title Competition between Coiled-Coil Structures and the Impact on Myosin-10 Bundle Selection
pubmed doi rcsb
source organism Bos taurus
molecule tags Motor protein/transcription
total genus 31
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n9bA00
3P8MC 4GT1A 3MGNA 3HTKA 1FOSF 3NFQA 3TK1A 4C7NA 5AVXB 3TYYA 5AW8B 2BASA 1OWAA 1GTWA 3VMYA 5APQA 2WPQA 5APUA 3A2AA 2Q3IA 2C9NY 5APTA 1FAVA 4DZOA 3B8EB 5AW1B 1MFZA 2ZFCA 5AVQB 1NWQA 3NMDA 3KQGA 3M9HA 1OXZA 5AVSB 2E42A 5AVWB 4AUWA 3HE5B 3O8ZA 5AW2B 3VMZA 4B86A 2E43A 2W27A 1NAFA 1KQLA 3HE4A 2Z5HA 3TNUB 2R3CA 3L36A 2C9LY 1X8YA 3SWFA 1IO4A 5AVVB 2Q7CA 3NTNA 5AW6B 2IPPA 4EOTA 3OAKA 4C46A 5AW0B 1HJBA 2ZXEB 5APYA 4AQRD 2YNYA 1SP4A 3KDPB 1GU5A 2WT7A 3L37A 4C7NB 3L35A 3M91A 4GKGA 4JYBA 4M3LA 2Z5IA 2P2UA 3VMXA 5AW9B 2R5BA 2XZRA 1G2CB 2JJLA 4LC1A 1CI6A 1T2KC 3M0AA 1GK6A 1HUCA 3A3YB 1GK4A 5APXA 1HBWA 3T97A 3VN0A 1JUNA 3LIEA 2H7HA 2WPRA 1S9KD 1GD2E 4XE5B 3VTPC 1FOSE 5AW4B 2YO3A 3HE4B 3MD0A 5AVRB 1J2JB 1YYCA 2W6AA 3IR9A 2WTYA 2VRSA 5CMZA 4JYCA 1HWTC 1H88A 1CZQA 4AYCA 1GU4A 3M06A 4KHXA 1DH3A 3P32A 4I2LC 2N9BA 5APSA 1SLQA 1A02F 5AVYB 3LIDA 2XV5A 1GZLA 2P7JA 5AW3B 2WT7B 4HYTB 5AVTB 5AW7B 3I5CA 5APVA 3HE5A 3M0DA 2Q5UA 3M9BA 2R32A 5APWA 1JNMA 3A7OA 2XU6A 2P67A 2QM7A 1A02J 1CI6B 2WPSA 3NXSA 3TNUA 2YO2A 1MUUA 4I6MC 1MV8A 3VYIA 3A5TA 3V4WA 1CSBA 1T2KD 1H8AA 5AVZB 4RESB 2R5DA 1S9KE 3V4QA 1H89A 2WWWA 5AVUB 3UIAA 3V5BA 2KP8A 3P7KA 2QM8A 5AW5B
chains in the Genus database with same CATH superfamily
1EZVD 3BCCD 3P8MC 4EI2A 5BU8B 1BGYD 2M3EA 2W6JH 1ZRTD 1W5CE 5KLIB 1LTTC 1NO4A 3HD7C 1NWQA 3CX5I 2A45G 2OYHC 3D70A 3L36A 3TSIA 3NTNA 2OTKE 4IL6E 3PRJA 2A06D 2XKMA 1LTJB 3L37A 2J5UA 2QVAA 4ZKUA 1WT6A 3U1CA 1L4AB 4N6JA 3WUTA 1T2KC 3SFDC 1BCCG 2J58A 3SWKA 1R5SA 1YJ9P 3T97A 1JTHA 1LP1B 2WPRA 4L73A 1N8RQ 5AVRB 2K88A 2A45I 3HUSA 1QVGO 1AFOA 1URQC 1CW5A 1SFCD 3CWBJ 1KTMA 3H1ID 2XV5A 1JEKA 4R4MA 1ZV8A 4HYTB 5APVA 1GMJA 2HODB 1P84I 2OYHB 1A02J 1R5LA 1NU1J 4W80A 1YI2P 2Z4EA 1KYOD 3H1HD 1BCCE 2HR3A 4IFMA 1L2PA 3HTKA 3L70J 4D6TD 2E76B 3KZIH 5APUA 3TGUJ 3Q5PA 3U1AA 3W68A 1FDMA 1MFZA 1JY3P 4NPDA 1SQQD 3P8CE 2N1TC 1BDCA 1LTIC 2OYIA 5KAFE 1KILB 3L4FA 3CL3D 1IJDB 1N86A 1SFCA 5AVVB 1GL2B 1SQBK 3M9QA 3JCUE 2KSJA 2G8YA 1OIPA 2IZ0A 4IFDK 2P2UA 3VMXA 4N78E 2JJLA 3H1KG 2KLVA 4ZNCA 1Q90D 3HD7D 1YJWP 4XE5B 1DEEG 4YTPC 3HE4B 1FBMA 1Q2NA 2YKQA 1L0LJ 3KXDA 5TJHA 2FYUK 2Y0EA 4JQ0D 4OH8B 1DH3A 2IBZD 3FXEA 3S1KA 2M5AA 1IZNB 1BSHA 1M1KQ 2AXCA 2WPSA 3L71D 3TGUG 1MUUA 2NRGA 3VYIA 3CXHE 2QIWA 1T2KD 4UB8H 3H1KE 1YTZT 4OVNF 5AVUB 5KKZB 3V5BA 4K3AA 1M1JC 3IFMA 3GMAA 4GT1A 2PP6A 3AEEC 3MGNA 4WY4C 3AE2C 2BASA 1EXJA 2BEQD 1NTZJ 3AEFC 1URQD 5C39A 1FZEA 1N7LA 2RH0A 1SVFA 1HTLC 1S5LE 3HD7A 1IK9A 1LTAC 3H32A 5CBOA 2E43A 1EDLA 1FZBA 1NVOA 1N7SC 1LT1A 2LR2A 3JSVC 3TGUE 1KD1Q 3L74D 2ZXEB 4RO0A 1S4XA 5APYA 1L0LG 2WT7A 3L35A 1Q81Q 2QJYC 3M91A 4JYBA 1KFMA 3G3ZA 1NJIQ 1CI6A 1FZFA 1EXIA 1NTMJ 1HBWA 1YTZI 1T3JA 2H7HA 2N1TD 2JWAA 1KQSO 1PFIA 1SQXD 5DJUB 1M1JB 4PD4I 2VRSA 4WY4B 2XDJA 1URQA 4U7JA 1A02F 3W67A 5TISH 1KB9H 1N2DC 4R4LA 3AECC 1FZAA 1J1DB 3M9BA 5APWA 2KNCB 1L0LE 3H1HG 2OQQA 2HLOA 2P67A 2K1AA 4W7ZA 2KS1B 2R5DA 4D6TG 2KYVA 4HKZH 2R3SA 4UB6H 5H2FE 2GUVA 1SQQG 1J1EC 1FC2C 2H8PD 4BRYA 2QJYB 2WPQA 1DD4A 2Q1KA 3A2AA 1PP9J 1L0NK 3KQGA 3MZWB 1VQMP 5AVWB 2PRRA 3CCEP 4B86A 2D2CC 3OW2O 1KQLA 2ZT9C 4PV1D 1KYOE 4H0LB 1NYHA 3H1HE 2FKWB 3L73J 1NTMG 2Q7CA 2NPSB 3SFEC 4C46A 2FYNC 4D6TE 2K3RA 1VQ7P 4GIFA 2XNDH 2R5BA 1G2CB 1SQQE 5K5GB 1X22A 1HUCA 1KORA 1JO5A 3VTPC 3V6IA 4Y99B 2IBZG 1BSNA 1N7SD 4H44B 4IL6H 2YIUC 1J1EB 2Y9ZA 1NTME 3B71A 1NOHA 1GZLA 2E75B 1FZGA 1QL1A 1LGHB 1PP9G 3E7KA 3IAOA 2D2CB 2SPZA 2ZT9B 3V4QA 4WWIA 1RF1A 1FOSF 2FYNB 2CPSA 3L73G 2IBZE 1OWAA 3P8CD 5KLVJ 1VQ8P 1FAVA 4EDFA 2QRXA 3CC7P 1LNQA 3AE3C 1SQPK 2ZYAA 3L71E 1SQVK 2KSEA 3TNUB 2R3CA 5M1BA 2WSFJ 1PP9E 4EOTA 2ITAA 1HJBA 1PGOA 4N78D 2YIUB 3CCUP 3O6QA 3AEAC 4DJGA 1AJYA 1UIXA 1IFNA 1KV4A 3GF3A 3L73E 3GHGA 1LT9C 1RF0C 3MUDC 3L72J 3F89A 1SQXG 1ZN5A 5KAFH 4IOIH 2IYPA 3BASA 1GD2E 1OMIA 2YO3A 1J2JB 1GW3A 1T6AA 4JYCA 1VQNP 3OA7A 1Y47A 3RL0B 2K9YA 3JCUH 3CCSP 1ZOYC 5KLIC 1NH4A 1DD3A 5AW7B 1Q82Q 3CMAP 2KB7P 2G3AA 3CWBD 4Z1MH 2GA1A 4I6MC 1VF5B 1Q86Q 1SQXE 4GOFA 3MHVA 4JBZA 1NU1D 1LTJC 1LWUB 3TK1A 4C7NA 4Y28J 3BRTB 1RE3C 4QMAA 1L4AC 3RK2C 5CCHC 1FZCA 4WBAA 2KI7B 3Q2YA 1AQ5A 3L70D 4BXLA 3NMDA 3Q3DA 1LT9B 1W2BO 4U3FD 3TGUD 4YPCA 2BCCJ 1VQOP 3CXHH 1G1IA 1OX3A 3G9RA 3L72G 1N73B 3H1JJ 3CCJP 1HF9A 1ZXGA 3AE9C 3CX5E 3I55P 2QEXP 1IFIA 1Z56A 3FXDA 2POHA 1S5LH 3S9OA 3LW5H 3ITKA 3V2RA 2L91A 3C1LA 3H6PA 2E76C 2FFDC 5L8RJ 3EFFK 3L72E 1ZW0A 2B89A 3RK2B 1L0LD 3A0BE 3M0DC 3CC2P 1KILC 3PLNA 1SS1A 1X9VA 4ASVA 1PPJG 4OWFA 3FGAD 5AVZB 1GL2C 2WWWA 3RBZA 4XA4A 3RK3B 1NKNA 1E79H 3WMM0 1K04A 2BCCG 1QEXA 4JPZB 1JY2N 3H1JG 4MN4C 1P84E 1SQBJ 2HG5D 3SSUA 1MZ9A 2Y0CA 3SWYA 3M9HA 1NTZD 3TDKA 1IO4A 1PPJE 2HYNA 3RBXA 2IPPA 5EFWB 2FFDB 1AQTA 5H2FH 4U3FJ 3KDPB 2OARA 1VQ6P 2K9JB 2BCCE 2FYUJ 1L4AD 1AA0A 1OW7A 1W2EA 4NPEA 5KKZC 4H13D 1JUNA 3H1LJ 3R2PA 3LIEA 1S9KD 1HGVA 1KYOH 4WB4A 5B5EE 1NTMD 2ZVNB 3CCVP 1USDA 3CWBG 2W90A 4OGQB 3GLMA 2KXPB 1MFTA 3CCMP 3I5CA 2E74C 3EQ2A 1PL5A 1IFPA 1SQBG 2V7QH 3NXSA 3AE4C 1NU1G 5E79E 4IL6X 3RL0g 1M90Q 1JMMA 1KQFB 1LTJA 1FS0E 3L70G 1T8ZA 2E76D 1G1JA 1U57A 1GTWA 1L4AA 5CCGC 4U3FG 3MTUE 4HB1A 3CWBE 2QG4A 2E42A 1LP1A 1LJ2A 2YKOA 1KILD 1PP9D 2ZXXA 5GTHE 2C9LY 2O01H 1GL2D 1NU1E 3OAKA 4BWNA 3FX0A 5CJ0A 2Q6QA 2IFNA 2YXQB 1J1DC 3L73D 2OYHA 5B66H 3L70E 2E74B 2GUSA 3CCQP 1GK6A 3CD6P 5APXA 3GG2A 4U3FE 3AE1C 1LTSC 3KYQA 1H88A 2B87B 3IF4A 4L75A 1SLQA 2JP3A 1FE6A 1IK7A 1UIIA 2OGUA 3M0DA 1EZVI 1YITP 1KILA 5KAIE 1FJKA 4H0LC 1SQVD 2HPCB 4PD4E 1MV8A 2NPSC 2QE7H 1L0NJ 2ZJSE 2E5YA 1GL2A 3P7KA 2WVRA 1PZQA 4GOEA 2R44A 2JDIH 4LLHA 5AVXB 1WRGA 2PFXA 1K8AQ 1RF1B 4EYYQ 5APQA 1NTZG 5APTA 1U7JA 5AW1B 1KMIZ 1JM0A 1RQUA 3O8ZA 3VMZA 4Y99C 5KLVD 2Q3EA 3HE4A 2Z5HA 1SQQK 4H44C 2YXRB 3CX5D 1S72P 2RMZA 1QLED 1MKMA 1U7MA 1M57D 3V2PA 1NKZB 2E75C 1T3UA 2YMKA 2B9BA 4GKGA 3KZIE 2N1TA 1VQPP 1PV3A 3BRVB 3AE7C 1M7LA 5CCGD 2IFMA 1NTZE 3VN0A 3B5NB 2WSEH 3GHGB 1FOSE 1ZP0C 3L72D 1D7MA 1RY3A 2WTYA 1BE3J 1L0NG 4WY4D 1S5LX 1ZR2A 2MKVA 5AVYB 3AEGC 3I56P 5CBNA 5AVTB 1OW6A 1VQ4P 2WSFH 1KC8Q 2I1JA 2Y0DA 1OZHA 2JWDA 1S9KE 1DEBA 1SQPJ 3FWNA 1LTGC 2ZVOB 2H89C 3PH0A 3IN6A 1SQVJ 1P84D 2WSCH 2W6BA 3A0HE 2WZ7A 1IFMA 1L0NE 3A0BH 5CCGA 2ZFCA 2JO1A 1NTKK 3S4RA 2UWJE 3HE5B 1M8OB 2W27A 2A45H 1YIJP 1PPJD 1M1JA 1VQ5P 4H0LD 1VDFA 4WY4A 3RL0C 2NPSD 4I7ZC 3Q1MA 3II6A 2BCCD 1H0TA 3VMAA 2M0BA 5CJ4A 3H1JD 3E1RA 1P84H 1BE3G 2Z5IA 2KNCA 1VF5C 2B88A 4DOJA 4YXWH 2KS1A 1N7SA 1VPCA 1KILE 3QH9A 4EIJA 1LWUC 1AVYA 2LKMA 4HH2A 2FXOA 1CZQA 1Y8AA 2QJKB 4H44D 1SQPG 2N9BA 1QGKB 1SQXK 2DW3A 1SQVG 4YXDC 2E75D 1LTBC 2QA4P 2Q5UA 1JOCA 3AE6C 2QM7A 1N73C 1BE3E 3VP8A 2D2CD 1M56D 2NPSA 2AEFA 2ZT9D 3RGUA 3T97B 1JTHB 1ZR4A 2QM8A 5KTBA 2O1KA 2QSIA 1AVOA 4I7ZB 2OTLP 1R8EA 5B5EH 3V2QA 3HUSB 2HFED 1G2CA 2P10A 5KLVG 1SQPE 3C9IA 2LXBA 1KB9I 3AE8C 2N9YB 1RE4C 4AUWA 2O01N 1SQVE 1SQBD 2KZIA 2NZ2A 4KJMA 5E79H 3ABVC 1XTGB 1QL2A 1FDOA 4IFFA 4PJ0E 1QX8A 1RHZB 5AW0B 4AQRD 1IFDA 3HTKB 4O9BA 4ZKPA 2M3BA 1K73Q 2W83C 2IZ1A 1E5WA 2FYUD 5KLVE 3RK3C 2OYIB 1K05A 3D6ZA 2CPBA 4L76A 5GTHH 3AEDC 3H1LD 1DIPA 1SFCB 3M06A 3RL0D 4I2LC 3VP9A 1JY2O 2GM4A 1KQGB 5AW3B 3CI9A 4RJTA 2PGDA 3N7NA 4PD4D 2KUBA 2R32A 2H43A 3WUUA 1S1CX 2AEMA 3TNUA 3E1IA 3V4WA 1VF5D 1OVVA 3BATA 3NFQA 1AV1A 2LXCB 2CK3H 1ZMEC 2I1KA 5AW8B 1VQLP 3KPEA 2M5AB 3PP5A 1NAYA 5AVQB 1OXZA 5AVSB 5KAIH 5AW2B 4DT0A 4PD4H 1QVFO 2H88C 4H13B 3SWFA 2WMMA 1BDDA 3AE5C 4OGQC 1JCCA 2L5GB 3H1KJ 1YHQP 3HRNA 3HD7B 1S2EA 4TLFA 1HJ0A 3L75J 3H32B 1X0TA 5AW4B 2YMYA 1LWUA 4A7PA 4K35A 3WU2E 1GU4A 3LW5J 1RH5B 2IX7C 2BEZF 3H1JE 3RK2D 5CCHD 2ZAEB 2P7JA 2WT7B 1LT9A 1RF0A 3MUDA 2C0XA 2M8RA 3OJAB 3BCCJ 1CI6B 2FY8A 3B4SA 1BGYJ 1N73A 1CSBA 1H89A 5AW5B 3VOPA 3RK3D 1JCDA 4N3YB 1L0ND 2AXTE 1TU3F 1OW8A 1URQB 3CMEP 1NU1K 2RN0A 1RE4A 1KFNA 5GTIE 2XNXA 1RE3A 3L75G 5CCHA 4GODA 2YNYA 2OYOA 2IYOA 2MJZA 1JY3O 3A0HH 4M3LA 4RKUJ 5AW9B 4BRYB 1IFJA 1KZUB 2FYUG 2FXPA 3CPWO 4TT3H 4W7YA 5KJ7C 3M0AA 1GK4A 1SQBE 1GDTA 3G71P 2N1TB 3H1LG 4PV1C 4ZMDA 1HGZA 3H1IJ 1EZVG 3BCCG 1YQ4C 3MD0A 1BGYG 2E5TA 3CXHI 3GF7A 3F5HA 1RF1C 2KOGA 5APSA 2HODA 3FWLA 3MP7B 4OGQD 1NTKD 3L75E 1BE3D 2KIKA 3H1HJ 3A7OA 4DCKA 1L0LK 2P1JA 3A5TA 2FYUE 2QJPC 1VL2A 1H8AA 4D6TJ 2FFDA 1K9MQ 1JY3N 3GW6A 3H1LE 1SQQJ 2A06G 2K9JA 2V7QJ 1KB9D 1EZVE 3BCCE 1SQPD 1PGQA 1BGYE 3VMYA 2W8ZA 3WUVA 3ZDMA 2Q3IA 1OFCX 3B8EB 4WVZA 1X79B 3C8VA 3B5NC 2KK7A 1ZRTE 3GHGC 3PJSK 1NAFA 4PV1B 4NPFX 4I1LA 3U59A 1NTZK 3PTZA 3H1IG 1SP4A 3JC22 2A06E 2O01J 1H0TB 2E74D 1OVUA 1EDJA 2ZYDA 2V4HA 2QJPB 4L74A 1VQKP 1YYCA 2W6AA 3BVHA 1N7SB 3G4SP 1HWTC 4PJ0H 2Y9YA 2PAJA 4LGDE 1ZLLA 3L71J 1HH0A 1NTMK 3EFGA 3O6QB 1S3JA 3H1IE 2O1JA 1FZCC 2KLUA 2AEJA 5KJ7D 1NTKJ 3UIAA 2KP8A 2JKVA 2FYZA 3CX5H 3CCRP 1KYOI 1EC5A 2C9NY 4HJGH 1JB0J 1HVVA 3PHLA 3H25A 2RKLA 1EQ7A 3L74J 4ASWA 3G6EP 2QJKC 1X8YA 2B87A 1Y9BA 1PIXA 3RK3E 1GU5A 3D71A 3D6YA 4C7NB 3QWOC 2XZRA 1FZCB 1SQXJ 2HPCA 3L71G 5KJ7A 4UB8E 3B5ND 5BU5A 1BCCD 2P58A 4KT0J 3R4YA 3HUSC 1GW4A 5CMZA 2YKPA 2FBWC 1NTKG 3LIDA 2WSEJ 3V2NA 1YQ3C 2IBZI 2IDBA 1WMKA 1KN7A 2XU6A 2Q9IA 3Q5SA 5B66E 1IC2A 2YO2A 1OVRA 3CC4P 1FDIA 4GDOA 2WITA 1Q7YQ 1PGJA 3CCLP 3L74G 2WSSH 3EWKA 1PGPA 1RQVA 2ZYGA 3WU2H 3AEBC 3TYYA 5BVZA 2WPVB 4DZOA 1NTKE 3N4XA 2JR8A 2OYIC 3B5NA 2WSCJ 2C0WA 3KHUA 1SFCC 1YBKA 5AW6B 4CPGA 1NHLA 4C7RA 3K5BA 5KLVK 5TISE 1KB9E 3TF5A 2JEEA 3L74E 2AXTH 3Q5RA 1EDKA 1JY2P 3MIWA 4LC1A 3USSA 1NGMB 4XFJA 3A3YB 3CXHD 2I8DA 3H1KD 1FJPA 5DJTB 4UB6E 3IR9A 5GTIH 4AYCA 2WQYC 4KHXA 3P32A 3L75D 2OTJP 1USEA 1BCCJ 4JF7A 2KZJA 2J59M 1FU1A 1JMBA 3HE5A 1JNMA 2K37A 1YJNP 2FXMA 4H13C 1EDIA 1XTCC 4RESB 5CHXA 1VQ9P 1DX7A 3CLQA 2O3JA
chains in the Genus database with same CATH topology
3P8MC 3RK3D 5BU8B 4LLHA 1FOSF 1JCDA 4N3YB 5AVXB 1WRGA 2CPSA 1OWAA 1RF1B 1URQB 3P8CD 5APQA 1NU1K 5APTA 1FAVA 1LTTC 5AW1B 1NO4A 3HD7C 1NWQA 2A45G 1SQPK 2OYHC 3O8ZA 1RE4A 3VMZA 4Y99C 1KFNA 1SQVK 3HE4A 2Z5HA 3TNUB 2R3CA 3L36A 1SQQK 3TSIA 3NTNA 4EOTA 2XNXA 1RE3A 1HJBA 3V2PA 1NKZB 5CCHA 2YNYA 4N78D 1T3UA 2XKMA 1LTJB 3L37A 2MJZA 1JY3O 4GKGA 4M3LA 4ZKUA 1WT6A 3U1CA 5AW9B 2N1TA 1KZUB 1IFJA 1L4AB 1IFNA 4N6JA 3BRVB 3GHGA 1T2KC 1M7LA 1LT9C 4W7YA 1RF0C 3M0AA 5KJ7C 1ZN5A 2J58A 5CCGD 1GK4A 2IFMA 3T97A 3VN0A 1JTHA 3B5NB 1GDTA 2WSEH 2N1TB 2WPRA 1HGZA 3BASA 1GD2E 3GHGB 1FOSE 2YO3A 3MD0A 5AVRB 1J2JB 1GW3A 2A45I 1RY3A 3HUSA 2WTYA 4JYCA 1RF1C 1AFOA 1URQC 3OA7A 1CW5A 4WY4D 1SFCD 2KOGA 3RL0B 1ZR2A 5APSA 2HODA 5AVYB 2XV5A 1NH4A 1ZV8A 4HYTB 5AVTB 5AW7B 5APVA 2KB7P 3A7OA 2HODB 2OYHB 2WSFH 1A02J 1L0LK 2P1JA 4W80A 4I6MC 3A5TA 2Z4EA 2I1JA 1H8AA 1S9KE 1DEBA 2FFDA 1LTGC 1JY3N 4IFMA 1LTJC 3HTKA 2WSCH 1LWUB 3TK1A 4C7NA 3BRTB 1RE3C 2W6BA 1L4AC 3RK2C 5CCHC 2WZ7A 3VMYA 5APUA 1FZCA 4WBAA 2Q3IA 1IFMA 3U1AA 1FDMA 3B8EB 5CCGA 1AQ5A 1MFZA 1JY3P 2ZFCA 1X79B 3B5NC 3P8CE 3NMDA 1NTKK 1LT9B 2N1TC 1LTIC 2OYIA 3HE5B 3GHGC 1KILB 2W27A 2A45H 3L4FA 1NAFA 1M1JA 1G1IA 3CL3D 1IJDB 1N86A 1N73B 1VDFA 4I1LA 4WY4A 3RL0C 1SFCA 5AVVB 3U59A 2NPSD 1NTZK 1GL2B 3II6A 1SQBK 3M9QA 2KSJA 1SP4A 4IFDK 5CJ4A 1IFIA 2Z5IA 2P2UA 3VMXA 4N78E 2JJLA 1Z56A 2POHA 4DOJA 2KLVA 3LW5H 1N7SA 1VPCA 3V2RA 3HD7D 4XE5B 4EIJA 1LWUC 3HE4B 1FBMA 2YKQA 3H6PA 1YYCA 2W6AA 2LKMA 3BVHA 4HH2A 1N7SB 2FFDC 1HWTC 1CZQA 2FYUK 4OH8B 1DH3A 2PAJA 4LGDE 2N9BA 1ZLLA 1SQXK 3RK2B 1HH0A 1NTMK 3EFGA 3M0DC 1LTBC 1KILC 2O1JA 1FZCC 2Q5UA 1JOCA 1X9VA 2QM7A 2WPSA 1N73C 1MUUA 3VP8A 3VYIA 1T2KD 5AVZB 1GL2C 5KJ7D 2NPSA 1ZR4A 1YTZT 1JTHB 2WWWA 5AVUB 3UIAA 3V5BA 1M1JC 4XA4A 3IFMA 2KP8A 4GT1A 2QM8A 5KTBA 3RK3B 2PP6A 2O1KA 1NKNA 3WMM0 3MGNA 4WY4C 2FYZA 3V2QA 1JY2N 3HUSB 2BASA 2HFED 1G2CA 1URQD 2HG5D 1FZEA 2C9NY 1N7LA 1HVVA 1SVFA 3C9IA 1MZ9A 1HTLC 3SWYA 3HD7A 1IK9A 3M9HA 1EQ7A 1RE4C 4AUWA 1LTAC 3H32A 2E43A 1FZBA 1N7SC 1X8YA 1IO4A 1XTGB 1QL2A 2HYNA 2IPPA 4IFFA 2FFDB 5AW0B 2ZXEB 5APYA 4AQRD 3KDPB 1IFDA 2OARA 3HTKB 4O9BA 1GU5A 2WT7A 4C7NB 3L35A 3M91A 4JYBA 1KFMA 2XZRA 4ZKPA 3G3ZA 2M3BA 1L4AD 1CI6A 1FZCB 2HPCA 1FZFA 1W2EA 5KJ7A 1HBWA 1JUNA 1E5WA 3R2PA 3LIEA 3B5ND 1YTZI 3RK3C 1T3JA 2OYIB 2H7HA 2N1TD 5BU5A 1S9KD 1HGVA 2CPBA 1PFIA 1M1JB 3HUSC 4WB4A 1GW4A 2VRSA 5CMZA 2YKPA 4WY4B 1SFCB 2XDJA 3M06A 1URQA 3RL0D 4I2LC 3VP9A 1A02F 3LIDA 1JY2O 3V2NA 2GM4A 1N2DC 5AW3B 3CI9A 3N7NA 1FZAA 3I5CA 1J1DB 3M9BA 5APWA 2R32A 2H43A 3EQ2A 2HLOA 2XU6A 2Q9IA 2P67A 3NXSA 3TNUA 1IC2A 2YO2A 3E1IA 3V4WA 4W7ZA 2R5DA 2WITA 2KYVA 1JMMA 1LTJA 3BATA 3NFQA 2GUVA 3TYYA 1J1EC 1T8ZA 2I1KA 5AW8B 1G1JA 5BVZA 2H8PD 1GTWA 1L4AA 3KPEA 2WPQA 3A2AA 5CCGC 4DZOA 3PP5A 3N4XA 5AVQB 3MTUE 1L0NK 3KQGA 2OYIC 3B5NA 1OXZA 5AVSB 2E42A 5AVWB 5AW2B 2YKOA 4B86A 2C0WA 1KILD 1KQLA 2C9LY 2O01H 1SFCC 3SWFA 2FKWB 2Q7CA 2NPSB 5AW6B 1NHLA 1GL2D 3OAKA 4C46A 4C7RA 5KLVK 5CJ0A 1JCCA 2IFNA 2L5GB 2JEEA 1J1DC 4GIFA 2R5BA 1G2CB 1JY2P 3MIWA 2OYHA 4LC1A 2GUSA 3HRNA 1GK6A 1HUCA 3A3YB 5APXA 3HD7B 1FJPA 1JO5A 3H32B 3VTPC 1LTSC 5AW4B 4Y99B 3KYQA 2YMYA 1LWUA 3IR9A 1H88A 1N7SD 4AYCA 1GU4A 4KHXA 2IX7C 3P32A 1J1EB 1SLQA 1NOHA 4JF7A 3RK2D 5CCHD 1GZLA 2P7JA 2J59M 1FU1A 2WT7B 1LT9A 1RF0A 3MUDA 2C0XA 1FZGA 3HE5A 3M0DA 1JNMA 1QL1A 1KILA 2M8RA 1LGHB 3OJAB 1FJKA 1CI6B 2FXMA 2HPCB 1MV8A 1XTCC 1N73A 2NPSC 1CSBA 4RESB 5CHXA 3V4QA 1H89A 1GL2A 1DX7A 3CLQA 1RF1A 3P7KA 5AW5B 3VOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8M C;  4GT1 A;  3MGN A;  3HTK A;  1FOS F;  3NFQ A;  3TK1 A;  4C7N A;  5AVX B;  3TYY A;  5AW8 B;  2BAS A;  1OWA A;  1GTW A;  3VMY A;  5APQ A;  2WPQ A;  5APU A;  3A2A A;  2Q3I A;  2C9N Y;  5APT A;  1FAV A;  4DZO A;  3B8E B;  5AW1 B;  1MFZ A;  2ZFC A;  5AVQ B;  1NWQ A;  3NMD A;  3KQG A;  3M9H A;  1OXZ A;  5AVS B;  2E42 A;  5AVW B;  4AUW A;  3HE5 B;  3O8Z A;  5AW2 B;  3VMZ A;  4B86 A;  2E43 A;  2W27 A;  1NAF A;  1KQL A;  3HE4 A;  2Z5H A;  3TNU B;  2R3C A;  3L36 A;  2C9L Y;  1X8Y A;  3SWF A;  1IO4 A;  5AVV B;  2Q7C A;  3NTN A;  5AW6 B;  2IPP A;  4EOT A;  3OAK A;  4C46 A;  5AW0 B;  1HJB A;  2ZXE B;  5APY A;  4AQR D;  2YNY A;  1SP4 A;  3KDP B;  1GU5 A;  2WT7 A;  3L37 A;  4C7N B;  3L35 A;  3M91 A;  4GKG A;  4JYB A;  4M3L A;  2Z5I A;  2P2U A;  3VMX A;  5AW9 B;  2R5B A;  2XZR A;  1G2C B;  2JJL A;  4LC1 A;  1CI6 A;  1T2K C;  3M0A A;  1GK6 A;  1HUC A;  3A3Y B;  1GK4 A;  5APX A;  1HBW A;  3T97 A;  3VN0 A;  1JUN A;  3LIE A;  2H7H A;  2WPR A;  1S9K D;  1GD2 E;  4XE5 B;  3VTP C;  1FOS E;  5AW4 B;  2YO3 A;  3HE4 B;  3MD0 A;  5AVR B;  1J2J B;  1YYC A;  2W6A A;  3IR9 A;  2WTY A;  2VRS A;  5CMZ A;  4JYC A;  1HWT C;  1H88 A;  1CZQ A;  4AYC A;  1GU4 A;  3M06 A;  4KHX A;  1DH3 A;  3P32 A;  4I2L C;  2N9B A;  5APS A;  1SLQ A;  1A02 F;  5AVY B;  3LID A;  2XV5 A;  1GZL A;  2P7J A;  5AW3 B;  2WT7 B;  4HYT B;  5AVT B;  5AW7 B;  3I5C A;  5APV A;  3HE5 A;  3M0D A;  2Q5U A;  3M9B A;  2R32 A;  5APW A;  1JNM A;  3A7O A;  2XU6 A;  2P67 A;  2QM7 A;  1A02 J;  1CI6 B;  2WPS A;  3NXS A;  3TNU A;  2YO2 A;  1MUU A;  4I6M C;  1MV8 A;  3VYI A;  3A5T A;  3V4W A;  1CSB A;  1T2K D;  1H8A A;  5AVZ B;  4RES B;  2R5D A;  1S9K E;  3V4Q A;  1H89 A;  2WWW A;  5AVU B;  3UIA A;  3V5B A;  2KP8 A;  3P7K A;  2QM8 A;  5AW5 B; 
#chains in the Genus database with same CATH topology
 1EZV D;  3BCC D;  3P8M C;  4EI2 A;  5BU8 B;  1BGY D;  2M3E A;  2W6J H;  1ZRT D;  1W5C E;  5KLI B;  1LTT C;  1NO4 A;  3HD7 C;  1NWQ A;  3CX5 I;  2A45 G;  2OYH C;  3D70 A;  3L36 A;  3TSI A;  3NTN A;  2OTK E;  4IL6 E;  3PRJ A;  2A06 D;  2XKM A;  1LTJ B;  3L37 A;  2J5U A;  2QVA A;  4ZKU A;  1WT6 A;  3U1C A;  1L4A B;  4N6J A;  3WUT A;  1T2K C;  3SFD C;  1BCC G;  2J58 A;  3SWK A;  1R5S A;  1YJ9 P;  3T97 A;  1JTH A;  1LP1 B;  2WPR A;  4L73 A;  1N8R Q;  5AVR B;  2K88 A;  2A45 I;  3HUS A;  1QVG O;  1AFO A;  1URQ C;  1CW5 A;  1SFC D;  3CWB J;  1KTM A;  3H1I D;  2XV5 A;  1JEK A;  4R4M A;  1ZV8 A;  4HYT B;  5APV A;  1GMJ A;  2HOD B;  1P84 I;  2OYH B;  1A02 J;  1R5L A;  1NU1 J;  4W80 A;  1YI2 P;  2Z4E A;  1KYO D;  3H1H D;  1BCC E;  2HR3 A;  4IFM A;  1L2P A;  3HTK A;  3L70 J;  4D6T D;  2E76 B;  3KZI H;  5APU A;  3TGU J;  3Q5P A;  3U1A A;  3W68 A;  1FDM A;  1MFZ A;  1JY3 P;  4NPD A;  1SQQ D;  3P8C E;  2N1T C;  1BDC A;  1LTI C;  2OYI A;  5KAF E;  1KIL B;  3L4F A;  3CL3 D;  1IJD B;  1N86 A;  1SFC A;  5AVV B;  1GL2 B;  1SQB K;  3M9Q A;  3JCU E;  2KSJ A;  2G8Y A;  1OIP A;  2IZ0 A;  4IFD K;  2P2U A;  3VMX A;  4N78 E;  2JJL A;  3H1K G;  2KLV A;  4ZNC A;  1Q90 D;  3HD7 D;  1YJW P;  4XE5 B;  1DEE G;  4YTP C;  3HE4 B;  1FBM A;  1Q2N A;  2YKQ A;  1L0L J;  3KXD A;  5TJH A;  2FYU K;  2Y0E A;  4JQ0 D;  4OH8 B;  1DH3 A;  2IBZ D;  3FXE A;  3S1K A;  2M5A A;  1IZN B;  1BSH A;  1M1K Q;  2AXC A;  2WPS A;  3L71 D;  3TGU G;  1MUU A;  2NRG A;  3VYI A;  3CXH E;  2QIW A;  1T2K D;  4UB8 H;  3H1K E;  1YTZ T;  4OVN F;  5AVU B;  5KKZ B;  3V5B A;  4K3A A;  1M1J C;  3IFM A;  3GMA A;  4GT1 A;  2PP6 A;  3AEE C;  3MGN A;  4WY4 C;  3AE2 C;  2BAS A;  1EXJ A;  2BEQ D;  1NTZ J;  3AEF C;  1URQ D;  5C39 A;  1FZE A;  1N7L A;  2RH0 A;  1SVF A;  1HTL C;  1S5L E;  3HD7 A;  1IK9 A;  1LTA C;  3H32 A;  5CBO A;  2E43 A;  1EDL A;  1FZB A;  1NVO A;  1N7S C;  1LT1 A;  2LR2 A;  3JSV C;  3TGU E;  1KD1 Q;  3L74 D;  2ZXE B;  4RO0 A;  1S4X A;  5APY A;  1L0L G;  2WT7 A;  3L35 A;  1Q81 Q;  2QJY C;  3M91 A;  4JYB A;  1KFM A;  3G3Z A;  1NJI Q;  1CI6 A;  1FZF A;  1EXI A;  1NTM J;  1HBW A;  1YTZ I;  1T3J A;  2H7H A;  2N1T D;  2JWA A;  1KQS O;  1PFI A;  1SQX D;  5DJU B;  1M1J B;  4PD4 I;  2VRS A;  4WY4 B;  2XDJ A;  1URQ A;  4U7J A;  1A02 F;  3W67 A;  5TIS H;  1KB9 H;  1N2D C;  4R4L A;  3AEC C;  1FZA A;  1J1D B;  3M9B A;  5APW A;  2KNC B;  1L0L E;  3H1H G;  2OQQ A;  2HLO A;  2P67 A;  2K1A A;  4W7Z A;  2KS1 B;  2R5D A;  4D6T G;  2KYV A;  4HKZ H;  2R3S A;  4UB6 H;  5H2F E;  2GUV A;  1SQQ G;  1J1E C;  1FC2 C;  2H8P D;  4BRY A;  2QJY B;  2WPQ A;  1DD4 A;  2Q1K A;  3A2A A;  1PP9 J;  1L0N K;  3KQG A;  3MZW B;  1VQM P;  5AVW B;  2PRR A;  3CCE P;  4B86 A;  2D2C C;  3OW2 O;  1KQL A;  2ZT9 C;  4PV1 D;  1KYO E;  4H0L B;  1NYH A;  3H1H E;  2FKW B;  3L73 J;  1NTM G;  2Q7C A;  2NPS B;  3SFE C;  4C46 A;  2FYN C;  4D6T E;  2K3R A;  1VQ7 P;  4GIF A;  2XND H;  2R5B A;  1G2C B;  1SQQ E;  5K5G B;  1X22 A;  1HUC A;  1KOR A;  1JO5 A;  3VTP C;  3V6I A;  4Y99 B;  2IBZ G;  1BSN A;  1N7S D;  4H44 B;  4IL6 H;  2YIU C;  1J1E B;  2Y9Z A;  1NTM E;  3B71 A;  1NOH A;  1GZL A;  2E75 B;  1FZG A;  1QL1 A;  1LGH B;  1PP9 G;  3E7K A;  3IAO A;  2D2C B;  2SPZ A;  2ZT9 B;  3V4Q A;  4WWI A;  1RF1 A;  1FOS F;  2FYN B;  2CPS A;  3L73 G;  2IBZ E;  1OWA A;  3P8C D;  5KLV J;  1VQ8 P;  1FAV A;  4EDF A;  2QRX A;  3CC7 P;  1LNQ A;  3AE3 C;  1SQP K;  2ZYA A;  3L71 E;  1SQV K;  2KSE A;  3TNU B;  2R3C A;  5M1B A;  2WSF J;  1PP9 E;  4EOT A;  2ITA A;  1HJB A;  1PGO A;  4N78 D;  2YIU B;  3CCU P;  3O6Q A;  3AEA C;  4DJG A;  1AJY A;  1UIX A;  1IFN A;  1KV4 A;  3GF3 A;  3L73 E;  3GHG A;  1LT9 C;  1RF0 C;  3MUD C;  3L72 J;  3F89 A;  1SQX G;  1ZN5 A;  5KAF H;  4IOI H;  2IYP A;  3BAS A;  1GD2 E;  1OMI A;  2YO3 A;  1J2J B;  1GW3 A;  1T6A A;  4JYC A;  1VQN P;  3OA7 A;  1Y47 A;  3RL0 B;  2K9Y A;  3JCU H;  3CCS P;  1ZOY C;  5KLI C;  1NH4 A;  1DD3 A;  5AW7 B;  1Q82 Q;  3CMA P;  2KB7 P;  2G3A A;  3CWB D;  4Z1M H;  2GA1 A;  4I6M C;  1VF5 B;  1Q86 Q;  1SQX E;  4GOF A;  3MHV A;  4JBZ A;  1NU1 D;  1LTJ C;  1LWU B;  3TK1 A;  4C7N A;  4Y28 J;  3BRT B;  1RE3 C;  4QMA A;  1L4A C;  3RK2 C;  5CCH C;  1FZC A;  4WBA A;  2KI7 B;  3Q2Y A;  1AQ5 A;  3L70 D;  4BXL A;  3NMD A;  3Q3D A;  1LT9 B;  1W2B O;  4U3F D;  3TGU D;  4YPC A;  2BCC J;  1VQO P;  3CXH H;  1G1I A;  1OX3 A;  3G9R A;  3L72 G;  1N73 B;  3H1J J;  3CCJ P;  1HF9 A;  1ZXG A;  3AE9 C;  3CX5 E;  3I55 P;  2QEX P;  1IFI A;  1Z56 A;  3FXD A;  2POH A;  1S5L H;  3S9O A;  3LW5 H;  3ITK A;  3V2R A;  2L91 A;  3C1L A;  3H6P A;  2E76 C;  2FFD C;  5L8R J;  3EFF K;  3L72 E;  1ZW0 A;  2B89 A;  3RK2 B;  1L0L D;  3A0B E;  3M0D C;  3CC2 P;  1KIL C;  3PLN A;  1SS1 A;  1X9V A;  4ASV A;  1PPJ G;  4OWF A;  3FGA D;  5AVZ B;  1GL2 C;  2WWW A;  3RBZ A;  4XA4 A;  3RK3 B;  1NKN A;  1E79 H;  3WMM 0;  1K04 A;  2BCC G;  1QEX A;  4JPZ B;  1JY2 N;  3H1J G;  4MN4 C;  1P84 E;  1SQB J;  2HG5 D;  3SSU A;  1MZ9 A;  2Y0C A;  3SWY A;  3M9H A;  1NTZ D;  3TDK A;  1IO4 A;  1PPJ E;  2HYN A;  3RBX A;  2IPP A;  5EFW B;  2FFD B;  1AQT A;  5H2F H;  4U3F J;  3KDP B;  2OAR A;  1VQ6 P;  2K9J B;  2BCC E;  2FYU J;  1L4A D;  1AA0 A;  1OW7 A;  1W2E A;  4NPE A;  5KKZ C;  4H13 D;  1JUN A;  3H1L J;  3R2P A;  3LIE A;  1S9K D;  1HGV A;  1KYO H;  4WB4 A;  5B5E E;  1NTM D;  2ZVN B;  3CCV P;  1USD A;  3CWB G;  2W90 A;  4OGQ B;  3GLM A;  2KXP B;  1MFT A;  3CCM P;  3I5C A;  2E74 C;  3EQ2 A;  1PL5 A;  1IFP A;  1SQB G;  2V7Q H;  3NXS A;  3AE4 C;  1NU1 G;  5E79 E;  4IL6 X;  3RL0 g;  1M90 Q;  1JMM A;  1KQF B;  1LTJ A;  1FS0 E;  3L70 G;  1T8Z A;  2E76 D;  1G1J A;  1U57 A;  1GTW A;  1L4A A;  5CCG C;  4U3F G;  3MTU E;  4HB1 A;  3CWB E;  2QG4 A;  2E42 A;  1LP1 A;  1LJ2 A;  2YKO A;  1KIL D;  1PP9 D;  2ZXX A;  5GTH E;  2C9L Y;  2O01 H;  1GL2 D;  1NU1 E;  3OAK A;  4BWN A;  3FX0 A;  5CJ0 A;  2Q6Q A;  2IFN A;  2YXQ B;  1J1D C;  3L73 D;  2OYH A;  5B66 H;  3L70 E;  2E74 B;  2GUS A;  3CCQ P;  1GK6 A;  3CD6 P;  5APX A;  3GG2 A;  4U3F E;  3AE1 C;  1LTS C;  3KYQ A;  1H88 A;  2B87 B;  3IF4 A;  4L75 A;  1SLQ A;  2JP3 A;  1FE6 A;  1IK7 A;  1UII A;  2OGU A;  3M0D A;  1EZV I;  1YIT P;  1KIL A;  5KAI E;  1FJK A;  4H0L C;  1SQV D;  2HPC B;  4PD4 E;  1MV8 A;  2NPS C;  2QE7 H;  1L0N J;  2ZJS E;  2E5Y A;  1GL2 A;  3P7K A;  2WVR A;  1PZQ A;  4GOE A;  2R44 A;  2JDI H;  4LLH A;  5AVX B;  1WRG A;  2PFX A;  1K8A Q;  1RF1 B;  4EYY Q;  5APQ A;  1NTZ G;  5APT A;  1U7J A;  5AW1 B;  1KMI Z;  1JM0 A;  1RQU A;  3O8Z A;  3VMZ A;  4Y99 C;  5KLV D;  2Q3E A;  3HE4 A;  2Z5H A;  1SQQ K;  4H44 C;  2YXR B;  3CX5 D;  1S72 P;  2RMZ A;  1QLE D;  1MKM A;  1U7M A;  1M57 D;  3V2P A;  1NKZ B;  2E75 C;  1T3U A;  2YMK A;  2B9B A;  4GKG A;  3KZI E;  2N1T A;  1VQP P;  1PV3 A;  3BRV B;  3AE7 C;  1M7L A;  5CCG D;  2IFM A;  1NTZ E;  3VN0 A;  3B5N B;  2WSE H;  3GHG B;  1FOS E;  1ZP0 C;  3L72 D;  1D7M A;  1RY3 A;  2WTY A;  1BE3 J;  1L0N G;  4WY4 D;  1S5L X;  1ZR2 A;  2MKV A;  5AVY B;  3AEG C;  3I56 P;  5CBN A;  5AVT B;  1OW6 A;  1VQ4 P;  2WSF H;  1KC8 Q;  2I1J A;  2Y0D A;  1OZH A;  2JWD A;  1S9K E;  1DEB A;  1SQP J;  3FWN A;  1LTG C;  2ZVO B;  2H89 C;  3PH0 A;  3IN6 A;  1SQV J;  1P84 D;  2WSC H;  2W6B A;  3A0H E;  2WZ7 A;  1IFM A;  1L0N E;  3A0B H;  5CCG A;  2ZFC A;  2JO1 A;  1NTK K;  3S4R A;  2UWJ E;  3HE5 B;  1M8O B;  2W27 A;  2A45 H;  1YIJ P;  1PPJ D;  1M1J A;  1VQ5 P;  4H0L D;  1VDF A;  4WY4 A;  3RL0 C;  2NPS D;  4I7Z C;  3Q1M A;  3II6 A;  2BCC D;  1H0T A;  3VMA A;  2M0B A;  5CJ4 A;  3H1J D;  3E1R A;  1P84 H;  1BE3 G;  2Z5I A;  2KNC A;  1VF5 C;  2B88 A;  4DOJ A;  4YXW H;  2KS1 A;  1N7S A;  1VPC A;  1KIL E;  3QH9 A;  4EIJ A;  1LWU C;  1AVY A;  2LKM A;  4HH2 A;  2FXO A;  1CZQ A;  1Y8A A;  2QJK B;  4H44 D;  1SQP G;  2N9B A;  1QGK B;  1SQX K;  2DW3 A;  1SQV G;  4YXD C;  2E75 D;  1LTB C;  2QA4 P;  2Q5U A;  1JOC A;  3AE6 C;  2QM7 A;  1N73 C;  1BE3 E;  3VP8 A;  2D2C D;  1M56 D;  2NPS A;  2AEF A;  2ZT9 D;  3RGU A;  3T97 B;  1JTH B;  1ZR4 A;  2QM8 A;  5KTB A;  2O1K A;  2QSI A;  1AVO A;  4I7Z B;  2OTL P;  1R8E A;  5B5E H;  3V2Q A;  3HUS B;  2HFE D;  1G2C A;  2P10 A;  5KLV G;  1SQP E;  3C9I A;  2LXB A;  1KB9 I;  3AE8 C;  2N9Y B;  1RE4 C;  4AUW A;  2O01 N;  1SQV E;  1SQB D;  2KZI A;  2NZ2 A;  4KJM A;  5E79 H;  3ABV C;  1XTG B;  1QL2 A;  1FDO A;  4IFF A;  4PJ0 E;  1QX8 A;  1RHZ B;  5AW0 B;  4AQR D;  1IFD A;  3HTK B;  4O9B A;  4ZKP A;  2M3B A;  1K73 Q;  2W83 C;  2IZ1 A;  1E5W A;  2FYU D;  5KLV E;  3RK3 C;  2OYI B;  1K05 A;  3D6Z A;  2CPB A;  4L76 A;  5GTH H;  3AED C;  3H1L D;  1DIP A;  1SFC B;  3M06 A;  3RL0 D;  4I2L C;  3VP9 A;  1JY2 O;  2GM4 A;  1KQG B;  5AW3 B;  3CI9 A;  4RJT A;  2PGD A;  3N7N A;  4PD4 D;  2KUB A;  2R32 A;  2H43 A;  3WUU A;  1S1C X;  2AEM A;  3TNU A;  3E1I A;  3V4W A;  1VF5 D;  1OVV A;  3BAT A;  3NFQ A;  1AV1 A;  2LXC B;  2CK3 H;  1ZME C;  2I1K A;  5AW8 B;  1VQL P;  3KPE A;  2M5A B;  3PP5 A;  1NAY A;  5AVQ B;  1OXZ A;  5AVS B;  5KAI H;  5AW2 B;  4DT0 A;  4PD4 H;  1QVF O;  2H88 C;  4H13 B;  3SWF A;  2WMM A;  1BDD A;  3AE5 C;  4OGQ C;  1JCC A;  2L5G B;  3H1K J;  1YHQ P;  3HRN A;  3HD7 B;  1S2E A;  4TLF A;  1HJ0 A;  3L75 J;  3H32 B;  1X0T A;  5AW4 B;  2YMY A;  1LWU A;  4A7P A;  4K35 A;  3WU2 E;  1GU4 A;  3LW5 J;  1RH5 B;  2IX7 C;  2BEZ F;  3H1J E;  3RK2 D;  5CCH D;  2ZAE B;  2P7J A;  2WT7 B;  1LT9 A;  1RF0 A;  3MUD A;  2C0X A;  2M8R A;  3OJA B;  3BCC J;  1CI6 B;  2FY8 A;  3B4S A;  1BGY J;  1N73 A;  1CSB A;  1H89 A;  5AW5 B;  3VOP A;  3RK3 D;  1JCD A;  4N3Y B;  1L0N D;  2AXT E;  1TU3 F;  1OW8 A;  1URQ B;  3CME P;  1NU1 K;  2RN0 A;  1RE4 A;  1KFN A;  5GTI E;  2XNX A;  1RE3 A;  3L75 G;  5CCH A;  4GOD A;  2YNY A;  2OYO A;  2IYO A;  2MJZ A;  1JY3 O;  3A0H H;  4M3L A;  4RKU J;  5AW9 B;  4BRY B;  1IFJ A;  1KZU B;  2FYU G;  2FXP A;  3CPW O;  4TT3 H;  4W7Y A;  5KJ7 C;  3M0A A;  1GK4 A;  1SQB E;  1GDT A;  3G71 P;  2N1T B;  3H1L G;  4PV1 C;  4ZMD A;  1HGZ A;  3H1I J;  1EZV G;  3BCC G;  1YQ4 C;  3MD0 A;  1BGY G;  2E5T A;  3CXH I;  3GF7 A;  3F5H A;  1RF1 C;  2KOG A;  5APS A;  2HOD A;  3FWL A;  3MP7 B;  4OGQ D;  1NTK D;  3L75 E;  1BE3 D;  2KIK A;  3H1H J;  3A7O A;  4DCK A;  1L0L K;  2P1J A;  3A5T A;  2FYU E;  2QJP C;  1VL2 A;  1H8A A;  4D6T J;  2FFD A;  1K9M Q;  1JY3 N;  3GW6 A;  3H1L E;  1SQQ J;  2A06 G;  2K9J A;  2V7Q J;  1KB9 D;  1EZV E;  3BCC E;  1SQP D;  1PGQ A;  1BGY E;  3VMY A;  2W8Z A;  3WUV A;  3ZDM A;  2Q3I A;  1OFC X;  3B8E B;  4WVZ A;  1X79 B;  3C8V A;  3B5N C;  2KK7 A;  1ZRT E;  3GHG C;  3PJS K;  1NAF A;  4PV1 B;  4NPF X;  4I1L A;  3U59 A;  1NTZ K;  3PTZ A;  3H1I G;  1SP4 A;  3JC2 2;  2A06 E;  2O01 J;  1H0T B;  2E74 D;  1OVU A;  1EDJ A;  2ZYD A;  2V4H A;  2QJP B;  4L74 A;  1VQK P;  1YYC A;  2W6A A;  3BVH A;  1N7S B;  3G4S P;  1HWT C;  4PJ0 H;  2Y9Y A;  2PAJ A;  4LGD E;  1ZLL A;  3L71 J;  1HH0 A;  1NTM K;  3EFG A;  3O6Q B;  1S3J A;  3H1I E;  2O1J A;  1FZC C;  2KLU A;  2AEJ A;  5KJ7 D;  1NTK J;  3UIA A;  2KP8 A;  2JKV A;  2FYZ A;  3CX5 H;  3CCR P;  1KYO I;  1EC5 A;  2C9N Y;  4HJG H;  1JB0 J;  1HVV A;  3PHL A;  3H25 A;  2RKL A;  1EQ7 A;  3L74 J;  4ASW A;  3G6E P;  2QJK C;  1X8Y A;  2B87 A;  1Y9B A;  1PIX A;  3RK3 E;  1GU5 A;  3D71 A;  3D6Y A;  4C7N B;  3QWO C;  2XZR A;  1FZC B;  1SQX J;  2HPC A;  3L71 G;  5KJ7 A;  4UB8 E;  3B5N D;  5BU5 A;  1BCC D;  2P58 A;  4KT0 J;  3R4Y A;  3HUS C;  1GW4 A;  5CMZ A;  2YKP A;  2FBW C;  1NTK G;  3LID A;  2WSE J;  3V2N A;  1YQ3 C;  2IBZ I;  2IDB A;  1WMK A;  1KN7 A;  2XU6 A;  2Q9I A;  3Q5S A;  5B66 E;  1IC2 A;  2YO2 A;  1OVR A;  3CC4 P;  1FDI A;  4GDO A;  2WIT A;  1Q7Y Q;  1PGJ A;  3CCL P;  3L74 G;  2WSS H;  3EWK A;  1PGP A;  1RQV A;  2ZYG A;  3WU2 H;  3AEB C;  3TYY A;  5BVZ A;  2WPV B;  4DZO A;  1NTK E;  3N4X A;  2JR8 A;  2OYI C;  3B5N A;  2WSC J;  2C0W A;  3KHU A;  1SFC C;  1YBK A;  5AW6 B;  4CPG A;  1NHL A;  4C7R A;  3K5B A;  5KLV K;  5TIS E;  1KB9 E;  3TF5 A;  2JEE A;  3L74 E;  2AXT H;  3Q5R A;  1EDK A;  1JY2 P;  3MIW A;  4LC1 A;  3USS A;  1NGM B;  4XFJ A;  3A3Y B;  3CXH D;  2I8D A;  3H1K D;  1FJP A;  5DJT B;  4UB6 E;  3IR9 A;  5GTI H;  4AYC A;  2WQY C;  4KHX A;  3P32 A;  3L75 D;  2OTJ P;  1USE A;  1BCC J;  4JF7 A;  2KZJ A;  2J59 M;  1FU1 A;  1JMB A;  3HE5 A;  1JNM A;  2K37 A;  1YJN P;  2FXM A;  4H13 C;  1EDI A;  1XTC C;  4RES B;  5CHX A;  1VQ9 P;  1DX7 A;  3CLQ A;  2O3J A; 
#chains in the Genus database with same CATH homology
 3P8M C;  3RK3 D;  5BU8 B;  4LLH A;  1FOS F;  1JCD A;  4N3Y B;  5AVX B;  1WRG A;  2CPS A;  1OWA A;  1RF1 B;  1URQ B;  3P8C D;  5APQ A;  1NU1 K;  5APT A;  1FAV A;  1LTT C;  5AW1 B;  1NO4 A;  3HD7 C;  1NWQ A;  2A45 G;  1SQP K;  2OYH C;  3O8Z A;  1RE4 A;  3VMZ A;  4Y99 C;  1KFN A;  1SQV K;  3HE4 A;  2Z5H A;  3TNU B;  2R3C A;  3L36 A;  1SQQ K;  3TSI A;  3NTN A;  4EOT A;  2XNX A;  1RE3 A;  1HJB A;  3V2P A;  1NKZ B;  5CCH A;  2YNY A;  4N78 D;  1T3U A;  2XKM A;  1LTJ B;  3L37 A;  2MJZ A;  1JY3 O;  4GKG A;  4M3L A;  4ZKU A;  1WT6 A;  3U1C A;  5AW9 B;  2N1T A;  1KZU B;  1IFJ A;  1L4A B;  1IFN A;  4N6J A;  3BRV B;  3GHG A;  1T2K C;  1M7L A;  1LT9 C;  4W7Y A;  1RF0 C;  3M0A A;  5KJ7 C;  1ZN5 A;  2J58 A;  5CCG D;  1GK4 A;  2IFM A;  3T97 A;  3VN0 A;  1JTH A;  3B5N B;  1GDT A;  2WSE H;  2N1T B;  2WPR A;  1HGZ A;  3BAS A;  1GD2 E;  3GHG B;  1FOS E;  2YO3 A;  3MD0 A;  5AVR B;  1J2J B;  1GW3 A;  2A45 I;  1RY3 A;  3HUS A;  2WTY A;  4JYC A;  1RF1 C;  1AFO A;  1URQ C;  3OA7 A;  1CW5 A;  4WY4 D;  1SFC D;  2KOG A;  3RL0 B;  1ZR2 A;  5APS A;  2HOD A;  5AVY B;  2XV5 A;  1NH4 A;  1ZV8 A;  4HYT B;  5AVT B;  5AW7 B;  5APV A;  2KB7 P;  3A7O A;  2HOD B;  2OYH B;  2WSF H;  1A02 J;  1L0L K;  2P1J A;  4W80 A;  4I6M C;  3A5T A;  2Z4E A;  2I1J A;  1H8A A;  1S9K E;  1DEB A;  2FFD A;  1LTG C;  1JY3 N;  4IFM A;  1LTJ C;  3HTK A;  2WSC H;  1LWU B;  3TK1 A;  4C7N A;  3BRT B;  1RE3 C;  2W6B A;  1L4A C;  3RK2 C;  5CCH C;  2WZ7 A;  3VMY A;  5APU A;  1FZC A;  4WBA A;  2Q3I A;  1IFM A;  3U1A A;  1FDM A;  3B8E B;  5CCG A;  1AQ5 A;  1MFZ A;  1JY3 P;  2ZFC A;  1X79 B;  3B5N C;  3P8C E;  3NMD A;  1NTK K;  1LT9 B;  2N1T C;  1LTI C;  2OYI A;  3HE5 B;  3GHG C;  1KIL B;  2W27 A;  2A45 H;  3L4F A;  1NAF A;  1M1J A;  1G1I A;  3CL3 D;  1IJD B;  1N86 A;  1N73 B;  1VDF A;  4I1L A;  4WY4 A;  3RL0 C;  1SFC A;  5AVV B;  3U59 A;  2NPS D;  1NTZ K;  1GL2 B;  3II6 A;  1SQB K;  3M9Q A;  2KSJ A;  1SP4 A;  4IFD K;  5CJ4 A;  1IFI A;  2Z5I A;  2P2U A;  3VMX A;  4N78 E;  2JJL A;  1Z56 A;  2POH A;  4DOJ A;  2KLV A;  3LW5 H;  1N7S A;  1VPC A;  3V2R A;  3HD7 D;  4XE5 B;  4EIJ A;  1LWU C;  3HE4 B;  1FBM A;  2YKQ A;  3H6P A;  1YYC A;  2W6A A;  2LKM A;  3BVH A;  4HH2 A;  1N7S B;  2FFD C;  1HWT C;  1CZQ A;  2FYU K;  4OH8 B;  1DH3 A;  2PAJ A;  4LGD E;  2N9B A;  1ZLL A;  1SQX K;  3RK2 B;  1HH0 A;  1NTM K;  3EFG A;  3M0D C;  1LTB C;  1KIL C;  2O1J A;  1FZC C;  2Q5U A;  1JOC A;  1X9V A;  2QM7 A;  2WPS A;  1N73 C;  1MUU A;  3VP8 A;  3VYI A;  1T2K D;  5AVZ B;  1GL2 C;  5KJ7 D;  2NPS A;  1ZR4 A;  1YTZ T;  1JTH B;  2WWW A;  5AVU B;  3UIA A;  3V5B A;  1M1J C;  4XA4 A;  3IFM A;  2KP8 A;  4GT1 A;  2QM8 A;  5KTB A;  3RK3 B;  2PP6 A;  2O1K A;  1NKN A;  3WMM 0;  3MGN A;  4WY4 C;  2FYZ A;  3V2Q A;  1JY2 N;  3HUS B;  2BAS A;  2HFE D;  1G2C A;  1URQ D;  2HG5 D;  1FZE A;  2C9N Y;  1N7L A;  1HVV A;  1SVF A;  3C9I A;  1MZ9 A;  1HTL C;  3SWY A;  3HD7 A;  1IK9 A;  3M9H A;  1EQ7 A;  1RE4 C;  4AUW A;  1LTA C;  3H32 A;  2E43 A;  1FZB A;  1N7S C;  1X8Y A;  1IO4 A;  1XTG B;  1QL2 A;  2HYN A;  2IPP A;  4IFF A;  2FFD B;  5AW0 B;  2ZXE B;  5APY A;  4AQR D;  3KDP B;  1IFD A;  2OAR A;  3HTK B;  4O9B A;  1GU5 A;  2WT7 A;  4C7N B;  3L35 A;  3M91 A;  4JYB A;  1KFM A;  2XZR A;  4ZKP A;  3G3Z A;  2M3B A;  1L4A D;  1CI6 A;  1FZC B;  2HPC A;  1FZF A;  1W2E A;  5KJ7 A;  1HBW A;  1JUN A;  1E5W A;  3R2P A;  3LIE A;  3B5N D;  1YTZ I;  3RK3 C;  1T3J A;  2OYI B;  2H7H A;  2N1T D;  5BU5 A;  1S9K D;  1HGV A;  2CPB A;  1PFI A;  1M1J B;  3HUS C;  4WB4 A;  1GW4 A;  2VRS A;  5CMZ A;  2YKP A;  4WY4 B;  1SFC B;  2XDJ A;  3M06 A;  1URQ A;  3RL0 D;  4I2L C;  3VP9 A;  1A02 F;  3LID A;  1JY2 O;  3V2N A;  2GM4 A;  1N2D C;  5AW3 B;  3CI9 A;  3N7N A;  1FZA A;  3I5C A;  1J1D B;  3M9B A;  5APW A;  2R32 A;  2H43 A;  3EQ2 A;  2HLO A;  2XU6 A;  2Q9I A;  2P67 A;  3NXS A;  3TNU A;  1IC2 A;  2YO2 A;  3E1I A;  3V4W A;  4W7Z A;  2R5D A;  2WIT A;  2KYV A;  1JMM A;  1LTJ A;  3BAT A;  3NFQ A;  2GUV A;  3TYY A;  1J1E C;  1T8Z A;  2I1K A;  5AW8 B;  1G1J A;  5BVZ A;  2H8P D;  1GTW A;  1L4A A;  3KPE A;  2WPQ A;  3A2A A;  5CCG C;  4DZO A;  3PP5 A;  3N4X A;  5AVQ B;  3MTU E;  1L0N K;  3KQG A;  2OYI C;  3B5N A;  1OXZ A;  5AVS B;  2E42 A;  5AVW B;  5AW2 B;  2YKO A;  4B86 A;  2C0W A;  1KIL D;  1KQL A;  2C9L Y;  2O01 H;  1SFC C;  3SWF A;  2FKW B;  2Q7C A;  2NPS B;  5AW6 B;  1NHL A;  1GL2 D;  3OAK A;  4C46 A;  4C7R A;  5KLV K;  5CJ0 A;  1JCC A;  2IFN A;  2L5G B;  2JEE A;  1J1D C;  4GIF A;  2R5B A;  1G2C B;  1JY2 P;  3MIW A;  2OYH A;  4LC1 A;  2GUS A;  3HRN A;  1GK6 A;  1HUC A;  3A3Y B;  5APX A;  3HD7 B;  1FJP A;  1JO5 A;  3H32 B;  3VTP C;  1LTS C;  5AW4 B;  4Y99 B;  3KYQ A;  2YMY A;  1LWU A;  3IR9 A;  1H88 A;  1N7S D;  4AYC A;  1GU4 A;  4KHX A;  2IX7 C;  3P32 A;  1J1E B;  1SLQ A;  1NOH A;  4JF7 A;  3RK2 D;  5CCH D;  1GZL A;  2P7J A;  2J59 M;  1FU1 A;  2WT7 B;  1LT9 A;  1RF0 A;  3MUD A;  2C0X A;  1FZG A;  3HE5 A;  3M0D A;  1JNM A;  1QL1 A;  1KIL A;  2M8R A;  1LGH B;  3OJA B;  1FJK A;  1CI6 B;  2FXM A;  2HPC B;  1MV8 A;  1XTC C;  1N73 A;  2NPS C;  1CSB A;  4RES B;  5CHX A;  3V4Q A;  1H89 A;  1GL2 A;  1DX7 A;  3CLQ A;  1RF1 A;  3P7K A;  5AW5 B;  3VOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...