2N9BA

Solution nmr structure of antiparallel myosin-10:gcn4 tandem coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
GSHENKQVEEILRLEKEIEDLQRMKERQELSLTEASLQKLQLEDKVEELLSKNYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Competition between Coiled-Coil Structures and the Impact on Myosin-10 Bundle Selection
pubmed doi rcsb
source organism Bos taurus
molecule tags Motor protein/transcription
molecule keywords Unconventional myosin-X, General control protein GCN4 fusion
total genus 31
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n9bA00
2C9NY 3V4WA 3L37A 1CSBA 5AW9B 1FAVA 2YNYA 3NXSA 1T2KC 1GU5A 5AVVB 4C7NA 2XU6A 1CZQA 3A2AA 3NFQA 1SLQA 5APSA 5AVUB 1G2CB 3A5TA 3TNUA 1HUCA 3M9BA 2WTYA 2WWWA 5AVSB 5AW6B 1H8AA 2WPQA 2Z5IA 3TYYA 3M06A 3P8MC 1NAFA 1OWAA 3A7OA 5APYA 5AW3B 1HJBA 1CI6A 3T97A 4AYCA 2E43A 2WPRA 2IPPA 1GD2E 2W27A 5CMZA 5APQA 3M91A 3HE4B 3A3YB 1JUNA 2BASA 2YO2A 3LIEA 1HWTC 4JYBA 1CI6B 3LIDA 1X8YA 3M9HA 2WT7A 3L35A 3V5BA 2P67A 1H88A 1J2JB 3IR9A 4M3LA 2N9BA 5AVQB 2ZXEB 2H7HA 2P2UA 2WT7B 3VMYA 1NWQA 1JNMA 3I5CA 2E42A 2QM8A 4C46A 2Q5UA 3O8ZA 3P7KA 3TK1A 3HE4A 3P32A 3VN0A 4RESB 5APXA 3NTNA 4EOTA 4DZOA 1MV8A 3M0AA 3VMXA 5APVA 2Q7CA 2YO3A 1FOSE 3OAKA 1GU4A 2R5BA 2Z5HA 3MGNA 3NMDA 2QM7A 4XE5B 1YYCA 5AW7B 3KDPB 2WPSA 3VYIA 1A02F 4I6MC 5AW1B 3UIAA 3L36A 4JYCA 3TNUB 2W6AA 1S9KD 1OXZA 3SWFA 2R32A 3V4QA 5AVYB 2XZRA 4HYTB 5AW4B 1H89A 4C7NB 4AUWA 2R3CA 1T2KD 1A02J 1MUUA 5APWA 5AW0B 1GZLA 3VMZA 1MFZA 3B8EB 1HBWA 2JJLA 5AW8B 2KP8A 2R5DA 3KQGA 4LC1A 3M0DA 5AVWB 2C9LY 1S9KE 3VTPC 1IO4A 2XV5A 3HE5A 3MD0A 3HE5B 4I2LC 1SP4A 4AQRD 2P7JA 5AVRB 2ZFCA 2VRSA 1KQLA 2Q3IA 5AVXB 5AW2B 4B86A 4KHXA 5AW5B 1GK6A 5APTA 5AVTB 1GTWA 1GK4A 1FOSF 4GKGA 4GT1A 5AVZB 3HTKA 1DH3A 5APUA
chains in the Genus database with same CATH superfamily
2QJPC 5TISE 4WY4C 1NTMK 1GW3A 3R4YA 4HH2A 2JEEA 4L76A 3RL0D 3V4WA 4DOJA 4GDOA 3GHGC 2YKQA 1IC2A 1SQBG 1NTKG 3GW6A 3IN6A 3MHVA 1NTMG 2XU6A 3SWYA 1YIJP 1W5CE 2B87A 3L75G 1PIXA 5CJ0A 3V2NA 1SQBJ 1QVFO 1LNQA 1HTLC 2XNXA 2KYVA 2WPVB 1N8RQ 2E75C 3FGAD 1NTZE 1M1JB 2FKWB 3B5NA 3H32B 3IF4A 1QEXA 3JCUE 3KPEA 3NFQA 1W2EA 4WB4A 5APSA 1GL2D 2OYIA 2WSCJ 1URQD 1KILD 1YBKA 1LTTC 5AW6B 2JWDA 3RBZA 2ZYGA 4IFDK 4U3FJ 3H1HG 5CCGC 2LKMA 1DEBA 3KHUA 1ZRTD 2E75D 2I1KA 2XKMA 1NAFA 1N7SD 3P8MC 1S4XA 3CXHD 4PD4H 3W67A 1EXIA 4U3FD 1KMIZ 2OTLP 1FS0E 1SQQK 3H25A 5E79H 5APYA 1AA0A 5AW3B 3E7KA 1BGYD 1L4AD 2WPRA 3R2PA 3C1LA 3TGUJ 4W80A 3CCMP 1GD2E 2L91A 1S5LX 2O01N 3HE4B 2N1TD 2WSSH 1GW4A 3A3YB 1JEKA 1LTJA 2ZXXA 3L72G 1NO4A 4ZMDA 3C9IA 2KS1B 1KB9I 3FXDA 3HRNA 1KYOE 1EDIA 2M0BA 3LIDA 3BVHA 4NPDA 1L0NK 1M8OB 3AEAC 3L35A 3V5BA 1FZCA 1VQ9P 5KLIB 2Y0EA 2JP3A 5KLVJ 4K3AA 1DD3A 1IJDB 2N1TC 2BEZF 1IZNB 2ZXEB 3CLQA 3H1KD 3L4FA 3AE4C 2WSCH 2Y0CA 2ZVOB 1FC2C 2KUBA 3I5CA 2YMKA 2Q5UA 2ITAA 1ZP0C 2OYIB 4Y99C 4PV1D 5KJ7C 1RF0C 2D2CD 1ZRTE 3HE4A 3P32A 1EQ7A 2A45G 2IX7C 2P1JA 1M1JA 3AE7C 3B5NB 2QE7H 3H32A 3MTUE 1NTZK 3NTNA 4W7ZA 5C39A 3AEGC 1OFCX 1MV8A 4H44B 1IFDA 4DZOA 1KILE 1GMJA 1ZXGA 4RKUJ 3VMXA 1PGOA 2J59M 5TJHA 5K5GB 3BCCJ 3H1HE 1OW6A 2IZ1A 2OGUA 3SFDC 1VQNP 2R5BA 4PV1C 4H0LD 2Z5HA 3VYIA 5GTIE 2QM7A 3H1KJ 1YYCA 2IZ0A 5AW7B 5GTIH 1VQ8P 3I56P 2WSEJ 5E79E 4H44D 1EXJA 2RH0A 1VDFA 1P84I 3RBXA 2OTKE 1YTZT 4JYCA 1EDLA 1SFCD 2O1JA 2W6AA 1T3UA 1FBMA 1OXZA 2Y9YA 3SWFA 1P84H 1G1IA 1SQPJ 4NPFX 1FDIA 1USDA 3CCRP 3CX5I 4ASVA 1BGYJ 3TGUD 2WQYC 3EWKA 3D71A 3RL0C 2KLVA 1X0TA 2NZ2A 5H2FH 4PV1B 2KI7B 2R3CA 5M1BA 2A45I 2QJYC 1FU1A 2A06D 2WSFJ 2BCCJ 3L74D 5AW0B 1YHQP 5CCHD 1OX3A 3Q5PA 1GDTA 1BCCJ 1ZOYC 1SFCB 1K9MQ 1NTZJ 1NTMD 1LT9B 3HUSB 3ITKA 3O6QB 5KAFH 1L0LJ 2Q3EA 1U7MA 5AW8B 3VMAA 1L0ND 2K37A 2KP8A 1N2DC 2R5DA 3H1LJ 3II6A 1AQTA 2CK3H 3KQGA 5CCGA 3KYQA 2WITA 3M0DA 3H1ID 1G1JA 1EZVD 1S9KE 3RK3E 1SQXG 2JR8A 2WSEH 5KKZC 1IO4A 2UWJE 4QMAA 5DJTB 4I2LC 1SP4A 1FZEA 2NPSA 2P7JA 2GUSA 4RO0A 2QJKC 2WZ7A 4D6TG 5KLVK 1L0NG 5KLIC 2E76D 2QIWA 3F89A 1NTZD 1JMBA 4N78E 5APTA 5AVTB 2QG4A 2Z4EA 1L2PA 1OWAA 3HTKA 2Y0DA 2ZT9D 3CWBJ 4OGQB 3SFEC 3USSA 4I7ZC 2OTJP 1LWUB 1GL2B 2YIUC 1IFJA 1VQOP 1VQKP 1H0TB 3CI9A 3NXSA 1GU5A 1KILC 4C7NA 4EDFA 1KD1Q 4XA4A 1JCCA 1NU1D 1LTGC 2ZYAA 5CCHC 1T8ZA 1JTHA 1NTZG 1BE3E 3CXHE 1EC5A 2WSFH 1L0LG 1OIPA 1RQVA 3S1KA 3A2AA 2G3AA 1JY3P 2YXQB 5CBOA 3G3ZA 3E1RA 3A5TA 3U1AA 3M9BA 1BE3D 1IFPA 2JO1A 1SQXD 2PGDA 2WWWA 3G6EP 4GOFA 3OW2O 1AJYA 1IFIA 3AEEC 1NTKD 3TYYA 1IK7A 2V7QH 4OVNF 1OMIA 2Q6QA 5EFWB 1MKMA 3RK2B 2E76B 1KZUB 3WUVA 3G9RA 4RJTA 4BRYA 5KLVD 5BVZA 2W6JH 4UB6H 1VF5B 2ZAEB 3H1LD 4W7YA 3T97A 2M5AB 4PD4D 3JC22 1RF1B 1MFTA 3CWBG 3GHGB 5CCGD 3VP9A 5APQA 1BSHA 3H1LE 3H1KG 2QRXA 2QJKB 3P8CE 3GHGA 3CX5E 3TDKA 2BASA 2K3RA 3RK2C 2JDIH 1SS1A 1CI6B 2OYHA 2BCCE 3M9HA 3L70J 3V6IA 3H1LG 4GOEA 2CPSA 2WT7A 1EZVI 1RE3C 1KN7A 1EDKA 1M56D 1NKZB 3CWBD 4OH8B 1BGYE 2KIKA 2G8YA 2P58A 2N9BA 1SQBE 1WRGA 1P84E 2YXRB 4UB6E 2WT7B 1NTME 2H7HA 2A45H 1CW5A 1FDOA 4IL6E 3A0BH 4D6TD 3CMEP 1HGVA 3RK3B 3TGUE 2K9JB 3AE9C 3CWBE 3W68A 4C46A 1KFMA 1IK9A 3P7KA 1JOCA 3Q2YA 3LW5H 3D6ZA 1URQA 3L71J 3VN0A 3CCLP 3KXDA 1LWUC 2M5AA 1JTHB 1K05A 3T97B 1Q90D 1LTAC 4BWNA 2KLUA 3MUDA 1JY2O 1ZN5A 3FX0A 4OGQC 2YO3A 5BU8B 2QEXP 2BEQD 2Q1KA 3CCJP 1GL2A 4Y28J 2D2CC 1L0LD 3MGNA 3NMDA 3A0HE 1LJ2A 4N78D 2XDJA 3KDPB 1A02F 5KAIE 4I6MC 1W2BO 4JQ0D 1NYHA 1BE3G 3UIAA 1ZR4A 3HD7D 1L0LE 3CC2P 3U59A 4L75A 5B66H 3H1JD 3JCUH 4WWIA 4K35A 3RL0g 3TNUB 2PAJA 1PGJA 4KJMA 3H1HD 1S9KD 1OVRA 2ZJSE 3M9QA 1DH3A 4H13D 1USEA 1QVGO 3AEFC 2B9BA 4H44C 2XZRA 4HYTB 3HD7B 2FYUG 3PH0A 2FY8A 2OYOA 1H89A 4C7NB 4N3YB 1KB9D 1SQPE 2N1TA 3HUSC 1A02J 1LWUA 1BGYG 3B5ND 5APWA 3G4SP 1L0NE 2AEMA 2OYIC 3AE8C 1Q2NA 3H6PA 3MZWB 4LGDE 3VMZA 1LTJC 3WUUA 1KILB 2KNCA 2BCCG 1MFZA 1HBWA 1Z56A 1N7LA 2AXCA 3L70G 1NTKJ 1LP1A 3L73D 4I7ZB 2E75B 4LC1A 4EI2A 1FDMA 2O01J 2OARA 2P10A 2NPSB 3FXEA 5GTHE 2D2CB 2GUVA 3HE5A 1RF1C 1K04A 1RH5B 2QVAA 3PHLA 1VF5D 3RK3D 2ZFCA 3H1IE 4BXLA 2Q3IA 1Q81Q 1KV4A 1XTGB 2PFXA 3EFGA 5AW2B 4HKZH 5DJUB 2JWAA 3BRTB 3L75D 3AEBC 1EZVE 1JO5A 3CCEP 2KSEA 3GG2A 3H1IJ 4GT1A 1FZBA 1NOHA 3FWLA 1SFCA 4MN4C 5AVZB 3BCCD 2K1AA 3TGUG 3BASA 4ASWA 5APUA 1R8EA 3RK3C 2KZJA 3QWOC 2C9NY 3L71G 1QLED 1PGQA 2OQQA 5AW9B 4WBAA 1L0LK 2LR2A 5AVVB 3B5NC 1AVOA 2IBZI 4JPZB 4R4LA 1DIPA 3AECC 2YMYA 3N7NA 2KB7P 4TLFA 4YPCA 1E79H 1NU1E 1AQ5A 1SLQA 2IYOA 5AVUB 1U7JA 5KLVG 4PJ0H 1KQGB 1HUCA 1X22A 3H1KE 3PTZA 1EDJA 2HODA 2PRRA 1RE4A 3GMAA 1SQPK 3L71D 2NRGA 5AVSB 1BDCA 3RGUA 2WPQA 2WVRA 1FE6A 2Z5IA 1H8AA 2H43A 1AFOA 1AVYA 1YI2P 3L71E 2E5TA 2NPSC 2O01H 4JF7A 4EIJA 4D6TJ 1JB0J 2JKVA 4IFFA 5CCHA 1KB9H 1VQLP 2E76C 1RHZB 5B5EE 2B88A 2POHA 4I1LA 2I1JA 4NPEA 1DX7A 2DW3A 3L73J 2KS1A 4OGQD 3BCCG 3EQ2A 1PL5A 2IPPA 1PFIA 1LTJB 2M8RA 4Z1MH 5B66E 1FZCB 1YQ4C 1JY3N 2W27A 3AE6C 3M91A 2FYUK 4WY4D 1M57D 2L5GB 1YJNP 1SQBD 2HLOA 4CPGA 1JUNA 4R4MA 3LIEA 2FFDA 5KAIH 1HWTC 3HD7C 1Y47A 3AE5C 1KQFB 2ZVNB 3B71A 1LT9C 4LLHA 4PD4I 1SFCC 3U1CA 1FZFA 3OA7A 2H89C 1J2JB 3IR9A 4M3LA 3JSVC 1LTBC 1ZW0A 5AVQB 3ZDMA 2P2UA 3RL0B 1X9VA 1WT6A 1NWQA 1JNMA 3QH9A 3CCSP 1KYOD 1OZHA 3CPWO 3O8ZA 1SQVD 2IBZD 4PD4E 2HODB 2FBWC 2N9YB 3AE2C 1BCCE 1U57A 2Q9IA 3L73G 4KT0J 2K9YA 3TK1A 1SQPG 3CXHI 1N7SC 2A06G 3L74G 4RESB 4EOTA 1PP9E 3A0BE 1PV3A 3L74J 3M0AA 3CCVP 1PP9D 3L72J 1HF9A 5APVA 2Q7CA 3CC4P 4H0LB 4L73A 1KORA 1NU1G 3OAKA 3Q5RA 1FOSE 4AUWA 1S5LE 4HJGH 4A7PA 1JY3O 3SWKA 2WPSA 1SQPD 4IL6X 4L74A 1SQXJ 1HVVA 1QGKB 2AXTH 4ZNCA 1L4AA 3CX5H 3E1IA 1JCDA 3M0DC 1X79B 1SQQJ 2QA4P 1VQPP 5TISH 1HJ0A 1YQ3C 1NVOA 1RE3A 1J1EB 4YXWH 3PJSK 1M1KQ 4JBZA 1VQMP 3N4XA 1PP9G 2O1KA 1KFNA 3F5HA 1Q86Q 3H1JE 3GLMA 2QJYB 2E5YA 5AVYB 2ZT9C 3BCCE 2MKVA 3H1HJ 2B87B 5AW4B 4DJGA 2O3JA 2HR3A 1M1JC 1BDDA 1N73C 2R44A 1LTSC 1RY3A 3CD6P 3H1IG 1LP1B 2B89A 1OVVA 3AEDC 1YJWP 1N73A 3S9OA 4IL6H 2E74C 2KNCB 3B8EB 3D6YA 1KILA 1VF5C 2JJLA 5KAFE 3S4RA 3AE3C 4HB1A 2QJPB 1SQVE 2IBZE 1NTMJ 1XTCC 1QL2A 3V2PA 3TF5A 3MP7B 1FJPA 2AXTE 2K88A 1S5LH 1LT1A 1N7SA 1OVUA 5AVWB 5KLVE 2IYPA 1PPJE 1QL1A 2LXCB 3VTPC 2XV5A 1ZMEC 1OW7A 2FYNB 3L70E 3HE5B 3BATA 2Y9ZA 2HPCB 1R5SA 5AVRB 3OJAB 1NKNA 1KQLA 4IFMA 5CJ4A 2FFDB 1KB9E 1M90Q 2FXPA 2RN0A 4XFJA 2A06E 3L74E 4KHXA 5AW5B 1Q82Q 4ZKUA 1GTWA 4GKGA 2IDBA 3G71P 1RF0A 1BCCG 2FYUJ 1SQQD 1VQ6P 3L37A 1CSBA 1NU1J 3C8VA 1VL2A 2H88C 1FAVA 1GL2C 2YIUB 2N1TB 2C0WA 2YNYA 3L75J 3PRJA 4PJ0E 3TSIA 1YJ9P 1T2KC 1CZQA 3HD7A 1KQSO 1Q7YQ 1RQUA 1JY2P 3GF3A 2FYUD 1YTZI 3L75E 2GM4A 1IFMA 1TU3F 3PP5A 1G2CB 2HG5D 3TNUA 3Q3DA 3V2QA 3KZIH 1T6AA 4WY4B 2I8DA 2WTYA 1FZAA 4GODA 2LXBA 4YXDC 1L4AC 1T3JA 1ZLLA 5KKZB 1K8AQ 3M06A 1D7MA 2SPZA 2AEFA 1HGZA 1JMMA 1PP9J 3L72D 5H2FE 4DT0A 3A7OA 2ZT9B 5B5EH 3CMAP 3BRVB 1VQ5P 3RK2D 3CCUP 2W83C 1SQVK 1URQC 1HJBA 2OYHB 1CI6A 4TT3H 3IAOA 1P84D 4AYCA 1VQ4P 2E43A 1J1DB 1J1EC 1J1DC 2KZIA 4D6TE 5CMZA 3K5BA 1SQVJ 2M3EA 1S72P 1URQB 2OYHC 2MJZA 3CC7P 1KYOI 2R3SA 2BCCD 1JM0A 2YO2A 1WMKA 2K9JA 1DEEG 4JYBA 3Q1MA 3EFFK 4GIFA 1KTMA 1X8YA 3CX5D 3WMM0 2P67A 5KJ7A 1H88A 2H8PD 2RMZA 1KC8Q 1NAYA 3GF7A 2PP6A 1BE3J 2YKOA 3AE1C 2ZYDA 2J58A 3P8CD 3VMYA 4O9BA 3PLNA 2IFNA 3I55P 2E42A 1ZV8A 2QM8A 3L73E 1S1CX 3CXHH 3SSUA 2FYZA 4H13B 1NTKK 1G2CA 2NPSD 2QSIA 2W8ZA 3MUDC 2YKPA 5APXA 4U3FE 1NU1K 3KZIE 2E74D 1AV1A 1RF1A 3H1JG 3CCQP 1OW8A 1SQXE 4WVZA 1SVFA 3CL3D 4OWFA 3B4SA 2HFED 3V2RA 1UIXA 4BRYB 1S3JA 1VPCA 1GU4A 1Y8AA 5KTBA 1HH0A 1E5WA 1NHLA 1DD4A 1SQVG 2IBZG 1R5LA 1RE4C 3A0HH 3L72E 4XE5B 5GTHH 1NJIQ 4Y99B 3MIWA 4IOIH 1LGHB 1S2EA 2FXMA 5AW1B 2J5UA 3ABVC 1NH4A 2KXPB 3L36A 2WMMA 3LW5J 4WY4A 3VP8A 1UIIA 2HYNA 2FYNC 2KSJA 1SQQG 1LTIC 1FZCC 3WU2H 2GA1A 1ZR2A 4H0LC 3IFMA 2R32A 2CPBA 3V4QA 2KOGA 2FYUE 2XNDH 1JY2N 1L0NJ 1N86A 1PPJD 1N7SB 1NGMB 3D70A 2AEJA 1QX8A 2E74B 5CBNA 1BCCD 1T2KD 1H0TA 5CHXA 1MUUA 3FWNA 2M3BA 1GZLA 1Y9BA 4ZKPA 5BU5A 2FFDC 2FXOA 2W90A 3HTKB 1IFNA 1LT9A 3O6QA 4U7JA 3Q5SA 1VQ7P 1N73B 2IFMA 5KJ7D 1SQQE 1FJKA 5L8RJ 4YTPC 1PZQA 1PPJG 2W6BA 2C9LY 1FZGA 1PGPA 1BSNA 2HPCA 1NTKE 1KYOH 1K73Q 2V4HA 3MD0A 4C7RA 2C0XA 2V7QJ 3VOPA 4AQRD 1M7LA 2VRSA 4N6JA 4UB8E 4EYYQ 5AVXB 1SQXK 3L70D 4B86A 4U3FG 3WU2E 1YITP 4DCKA 2RKLA 1GK6A 1FOSF 1GK4A 4H13C 3WUTA 1MZ9A 1EZVG 1L4AB 3H1JJ 2KK7A 3HUSA 1SQBK 4UB8H
chains in the Genus database with same CATH topology
4WY4C 1NTMK 1GW3A 3V4WA 4HH2A 2JEEA 4DOJA 3RL0D 3GHGC 2YKQA 1IC2A 3SWYA 2XU6A 5CJ0A 3V2NA 1HTLC 2XNXA 2KYVA 5KJ7C 1M1JB 2FKWB 3B5NA 3H32B 3NFQA 3KPEA 5APSA 4WB4A 1W2EA 1GL2D 2OYIA 1URQD 1KILD 5AW6B 1LTTC 5CCGC 2LKMA 1DEBA 2I1KA 2XKMA 1NAFA 1N7SD 3P8MC 1SQQK 5APYA 5AW3B 2WPRA 1L4AD 3R2PA 4W80A 1GD2E 3HE4B 2N1TD 3A3YB 1GW4A 1LTJA 1NO4A 3C9IA 3HRNA 3BVHA 3LIDA 1L0NK 3L35A 3V5BA 1FZCA 3CLQA 1IJDB 2N1TC 2ZXEB 3L4FA 1FZCB 2WSCH 3I5CA 2Q5UA 2OYIB 4Y99C 1RF0C 3HE4A 3P32A 1EQ7A 2A45G 2IX7C 2P1JA 1M1JA 3B5NB 3H32A 3MTUE 3NTNA 2GM4A 1NTZK 4W7ZA 4DZOA 4IFDK 1MV8A 1IFDA 3VMXA 2J59M 2R5BA 2Z5HA 3VYIA 2QM7A 1YYCA 5AW7B 1VDFA 1YTZT 4JYCA 1SFCD 2O1JA 2W6AA 1T3UA 1FBMA 1OXZA 3SWFA 1G1IA 4AUWA 3RL0C 2KLVA 2R3CA 2A45I 1FU1A 5AW0B 5CCHD 1GDTA 1SFCB 3HUSB 1LT9B 5AW8B 2KP8A 2R5DA 1N2DC 3II6A 3KQGA 5CCGA 3KYQA 2WITA 3M0DA 1G1JA 1S9KE 2WSEH 1IO4A 4I2LC 1SP4A 1FZEA 2NPSA 2P7JA 2GUSA 2WZ7A 4N78E 5APTA 5AVTB 2Z4EA 3HTKA 1OWAA 1LWUB 1GL2B 1IFJA 3CI9A 3NXSA 1GU5A 1KILC 4C7NA 4XA4A 1JCCA 5CCHC 1LTGC 1T8ZA 1JTHA 2WSFH 3A2AA 1JY3P 3G3ZA 3A5TA 3U1AA 3M9BA 2WWWA 1IFIA 3TYYA 3RK2B 1KZUB 5BVZA 4W7YA 3T97A 1RF1B 3GHGB 5CCGD 3VP9A 5APQA 3P8CE 3GHGA 2BASA 3RK2C 1CI6B 2OYHA 3M9HA 2WT7A 2CPSA 1RE3C 1NKZB 4OH8B 2N9BA 1WRGA 1CW5A 2H7HA 2WT7B 2A45H 1HGVA 3RK3B 4C46A 1KFMA 1IK9A 3P7KA 1JOCA 3LW5H 1URQA 3VN0A 1LWUC 1JTHB 1LTAC 3MUDA 1JY2O 1ZN5A 2YO3A 1GL2A 3NMDA 3MGNA 1A02F 4N78D 2XDJA 3KDPB 4I6MC 3UIAA 1ZR4A 3HD7D 3U59A 3TNUB 2PAJA 1S9KD 3M9QA 2XZRA 4HYTB 3HD7B 1H89A 4C7NB 4N3YB 2N1TA 3HUSC 1A02J 1LWUA 3B5ND 5APWA 2OYIC 3H6PA 4LGDE 3VMZA 1LTJC 1KILB 1MFZA 1HBWA 1Z56A 1N7LA 4LC1A 1FDMA 2OARA 2NPSB 2GUVA 3HE5A 1RF1C 3RK3D 2ZFCA 2Q3IA 1XTGB 3EFGA 5AW2B 3BRTB 1JO5A 4GT1A 1FZBA 1NOHA 5AVZB 1SFCA 1AQ5A 3BASA 5APUA 2C9NY 3RK3C 5AW9B 4WBAA 1L0LK 5AVVB 3B5NC 2YMYA 3N7NA 2KB7P 1SLQA 5AVUB 1HUCA 2HODA 1RE4A 5AVSB 1SQPK 1H8AA 2WPQA 1AFOA 2Z5IA 2H43A 2NPSC 2O01H 4JF7A 4EIJA 4IFFA 5CCHA 2POHA 4I1LA 2I1JA 1DX7A 3EQ2A 2IPPA 1PFIA 1LTJB 2M8RA 2W27A 1JY3N 3M91A 2FYUK 4WY4D 2L5GB 2HLOA 1JUNA 3LIEA 2FFDA 1HWTC 3HD7C 1LT9C 4LLHA 3U1CA 1SFCC 1FZFA 3OA7A 1J2JB 3IR9A 4M3LA 1LTBC 5AVQB 2P2UA 3RL0B 1X9VA 1WT6A 1NWQA 1JNMA 3O8ZA 5KLVK 2FFDB 2HODB 2Q9IA 3TK1A 1N7SC 4RESB 4EOTA 3M0AA 5APVA 2Q7CA 1FOSE 3OAKA 1JY3O 2WPSA 1HVVA 1L4AA 3E1IA 1JCDA 3M0DC 1X79B 1RE3A 1J1EB 3N4XA 2O1KA 1KFNA 5AVYB 5AW4B 1M1JC 1N73C 1LTSC 1RY3A 1N73A 3B8EB 1KILA 2JJLA 1XTCC 1QL2A 3V2PA 1FJPA 5AVWB 1N7SA 3VTPC 1QL1A 2XV5A 3HE5B 3BATA 2HPCB 5AVRB 3OJAB 1NKNA 1KQLA 4IFMA 5CJ4A 4KHXA 5AW5B 4ZKUA 1GTWA 4GKGA 1RF0A 3L37A 1CSBA 1FAVA 1GL2C 2YNYA 2N1TB 2C0WA 1T2KC 3TSIA 1CZQA 3HD7A 1JY2P 1YTZI 1IFMA 3PP5A 1G2CB 2HG5D 3TNUA 3V2QA 2WTYA 4WY4B 1FZAA 1L4AC 1T3JA 1ZLLA 3M06A 1HGZA 1JMMA 3A7OA 3BRVB 3RK2D 1SQVK 1URQC 1HJBA 2OYHB 1CI6A 4AYCA 2E43A 1J1DB 1J1EC 1J1DC 5CMZA 1URQB 2OYHC 2MJZA 2YO2A 4JYBA 4GIFA 1X8YA 3WMM0 2P67A 5KJ7A 1H88A 2H8PD 2PP6A 2YKOA 3P8CD 2J58A 3VMYA 4O9BA 2IFNA 2E42A 1ZV8A 2QM8A 2FYZA 1NTKK 1G2CA 2NPSD 2YKPA 5APXA 1NU1K 1RF1A 1SVFA 3CL3D 2HFED 3V2RA 1VPCA 1GU4A 5KTBA 1HH0A 1E5WA 1NHLA 4XE5B 4B86A 1RE4C 4Y99B 3MIWA 1LGHB 2FXMA 5AW1B 1NH4A 3L36A 4WY4A 3VP8A 2HYNA 2KSJA 1FZCC 1LTIC 1ZR2A 3IFMA 2R32A 2CPBA 3V4QA 2KOGA 1JY2N 1N86A 1N7SB 1T2KD 5CHXA 1MUUA 4ZKPA 2M3BA 1GZLA 5BU5A 2FFDC 3HTKB 1IFNA 1LT9A 1N73B 2IFMA 5KJ7D 1FJKA 2W6BA 2C9LY 1FZGA 2HPCA 3MD0A 4C7RA 2C0XA 4AQRD 3VOPA 1M7LA 2VRSA 4N6JA 5AVXB 1SQXK 1GK6A 1FOSF 1GK4A 1MZ9A 3HUSA 1L4AB 5BU8B 1DH3A 1SQBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9N Y;  3V4W A;  3L37 A;  1CSB A;  5AW9 B;  1FAV A;  2YNY A;  3NXS A;  1T2K C;  1GU5 A;  5AVV B;  4C7N A;  2XU6 A;  1CZQ A;  3A2A A;  3NFQ A;  1SLQ A;  5APS A;  5AVU B;  1G2C B;  3A5T A;  3TNU A;  1HUC A;  3M9B A;  2WTY A;  2WWW A;  5AVS B;  5AW6 B;  1H8A A;  2WPQ A;  2Z5I A;  3TYY A;  3M06 A;  3P8M C;  1NAF A;  1OWA A;  3A7O A;  5APY A;  5AW3 B;  1HJB A;  1CI6 A;  3T97 A;  4AYC A;  2E43 A;  2WPR A;  2IPP A;  1GD2 E;  2W27 A;  5CMZ A;  5APQ A;  3M91 A;  3HE4 B;  3A3Y B;  1JUN A;  2BAS A;  2YO2 A;  3LIE A;  1HWT C;  4JYB A;  1CI6 B;  3LID A;  1X8Y A;  3M9H A;  2WT7 A;  3L35 A;  3V5B A;  2P67 A;  1H88 A;  1J2J B;  3IR9 A;  4M3L A;  2N9B A;  5AVQ B;  2ZXE B;  2H7H A;  2P2U A;  2WT7 B;  3VMY A;  1NWQ A;  1JNM A;  3I5C A;  2E42 A;  2QM8 A;  4C46 A;  2Q5U A;  3O8Z A;  3P7K A;  3TK1 A;  3HE4 A;  3P32 A;  3VN0 A;  4RES B;  5APX A;  3NTN A;  4EOT A;  4DZO A;  1MV8 A;  3M0A A;  3VMX A;  5APV A;  2Q7C A;  2YO3 A;  1FOS E;  3OAK A;  1GU4 A;  2R5B A;  2Z5H A;  3MGN A;  3NMD A;  2QM7 A;  4XE5 B;  1YYC A;  5AW7 B;  3KDP B;  2WPS A;  3VYI A;  1A02 F;  4I6M C;  5AW1 B;  3UIA A;  3L36 A;  4JYC A;  3TNU B;  2W6A A;  1S9K D;  1OXZ A;  3SWF A;  2R32 A;  3V4Q A;  5AVY B;  2XZR A;  4HYT B;  5AW4 B;  1H89 A;  4C7N B;  4AUW A;  2R3C A;  1T2K D;  1A02 J;  1MUU A;  5APW A;  5AW0 B;  1GZL A;  3VMZ A;  1MFZ A;  3B8E B;  1HBW A;  2JJL A;  5AW8 B;  2KP8 A;  2R5D A;  3KQG A;  4LC1 A;  3M0D A;  5AVW B;  2C9L Y;  1S9K E;  3VTP C;  1IO4 A;  2XV5 A;  3HE5 A;  3MD0 A;  3HE5 B;  4I2L C;  1SP4 A;  4AQR D;  2P7J A;  5AVR B;  2ZFC A;  2VRS A;  1KQL A;  2Q3I A;  5AVX B;  5AW2 B;  4B86 A;  4KHX A;  5AW5 B;  1GK6 A;  5APT A;  5AVT B;  1GTW A;  1GK4 A;  1FOS F;  4GKG A;  4GT1 A;  5AVZ B;  3HTK A;  1DH3 A;  5APU A; 
#chains in the Genus database with same CATH topology
 2QJP C;  5TIS E;  4WY4 C;  1NTM K;  1GW3 A;  3R4Y A;  4HH2 A;  2JEE A;  4L76 A;  3RL0 D;  3V4W A;  4DOJ A;  4GDO A;  3GHG C;  2YKQ A;  1IC2 A;  1SQB G;  1NTK G;  3GW6 A;  3IN6 A;  3MHV A;  1NTM G;  2XU6 A;  3SWY A;  1YIJ P;  1W5C E;  2B87 A;  3L75 G;  1PIX A;  5CJ0 A;  3V2N A;  1SQB J;  1QVF O;  1LNQ A;  1HTL C;  2XNX A;  2KYV A;  2WPV B;  1N8R Q;  2E75 C;  3FGA D;  1NTZ E;  1M1J B;  2FKW B;  3B5N A;  3H32 B;  3IF4 A;  1QEX A;  3JCU E;  3KPE A;  3NFQ A;  1W2E A;  4WB4 A;  5APS A;  1GL2 D;  2OYI A;  2WSC J;  1URQ D;  1KIL D;  1YBK A;  1LTT C;  5AW6 B;  2JWD A;  3RBZ A;  2ZYG A;  4IFD K;  4U3F J;  3H1H G;  5CCG C;  2LKM A;  1DEB A;  3KHU A;  1ZRT D;  2E75 D;  2I1K A;  2XKM A;  1NAF A;  1N7S D;  3P8M C;  1S4X A;  3CXH D;  4PD4 H;  3W67 A;  1EXI A;  4U3F D;  1KMI Z;  2OTL P;  1FS0 E;  1SQQ K;  3H25 A;  5E79 H;  5APY A;  1AA0 A;  5AW3 B;  3E7K A;  1BGY D;  1L4A D;  2WPR A;  3R2P A;  3C1L A;  3TGU J;  4W80 A;  3CCM P;  1GD2 E;  2L91 A;  1S5L X;  2O01 N;  3HE4 B;  2N1T D;  2WSS H;  1GW4 A;  3A3Y B;  1JEK A;  1LTJ A;  2ZXX A;  3L72 G;  1NO4 A;  4ZMD A;  3C9I A;  2KS1 B;  1KB9 I;  3FXD A;  3HRN A;  1KYO E;  1EDI A;  2M0B A;  3LID A;  3BVH A;  4NPD A;  1L0N K;  1M8O B;  3AEA C;  3L35 A;  3V5B A;  1FZC A;  1VQ9 P;  5KLI B;  2Y0E A;  2JP3 A;  5KLV J;  4K3A A;  1DD3 A;  1IJD B;  2N1T C;  2BEZ F;  1IZN B;  2ZXE B;  3CLQ A;  3H1K D;  3L4F A;  3AE4 C;  2WSC H;  2Y0C A;  2ZVO B;  1FC2 C;  2KUB A;  3I5C A;  2YMK A;  2Q5U A;  2ITA A;  1ZP0 C;  2OYI B;  4Y99 C;  4PV1 D;  5KJ7 C;  1RF0 C;  2D2C D;  1ZRT E;  3HE4 A;  3P32 A;  1EQ7 A;  2A45 G;  2IX7 C;  2P1J A;  1M1J A;  3AE7 C;  3B5N B;  2QE7 H;  3H32 A;  3MTU E;  1NTZ K;  3NTN A;  4W7Z A;  5C39 A;  3AEG C;  1OFC X;  1MV8 A;  4H44 B;  1IFD A;  4DZO A;  1KIL E;  1GMJ A;  1ZXG A;  4RKU J;  3VMX A;  1PGO A;  2J59 M;  5TJH A;  5K5G B;  3BCC J;  3H1H E;  1OW6 A;  2IZ1 A;  2OGU A;  3SFD C;  1VQN P;  2R5B A;  4PV1 C;  4H0L D;  2Z5H A;  3VYI A;  5GTI E;  2QM7 A;  3H1K J;  1YYC A;  2IZ0 A;  5AW7 B;  5GTI H;  1VQ8 P;  3I56 P;  2WSE J;  5E79 E;  4H44 D;  1EXJ A;  2RH0 A;  1VDF A;  1P84 I;  3RBX A;  2OTK E;  1YTZ T;  4JYC A;  1EDL A;  1SFC D;  2O1J A;  2W6A A;  1T3U A;  1FBM A;  1OXZ A;  2Y9Y A;  3SWF A;  1P84 H;  1G1I A;  1SQP J;  4NPF X;  1FDI A;  1USD A;  3CCR P;  3CX5 I;  4ASV A;  1BGY J;  3TGU D;  2WQY C;  3EWK A;  3D71 A;  3RL0 C;  2KLV A;  1X0T A;  2NZ2 A;  5H2F H;  4PV1 B;  2KI7 B;  2R3C A;  5M1B A;  2A45 I;  2QJY C;  1FU1 A;  2A06 D;  2WSF J;  2BCC J;  3L74 D;  5AW0 B;  1YHQ P;  5CCH D;  1OX3 A;  3Q5P A;  1GDT A;  1BCC J;  1ZOY C;  1SFC B;  1K9M Q;  1NTZ J;  1NTM D;  1LT9 B;  3HUS B;  3ITK A;  3O6Q B;  5KAF H;  1L0L J;  2Q3E A;  1U7M A;  5AW8 B;  3VMA A;  1L0N D;  2K37 A;  2KP8 A;  1N2D C;  2R5D A;  3H1L J;  3II6 A;  1AQT A;  2CK3 H;  3KQG A;  5CCG A;  3KYQ A;  2WIT A;  3M0D A;  3H1I D;  1G1J A;  1EZV D;  1S9K E;  3RK3 E;  1SQX G;  2JR8 A;  2WSE H;  5KKZ C;  1IO4 A;  2UWJ E;  4QMA A;  5DJT B;  4I2L C;  1SP4 A;  1FZE A;  2NPS A;  2P7J A;  2GUS A;  4RO0 A;  2QJK C;  2WZ7 A;  4D6T G;  5KLV K;  1L0N G;  5KLI C;  2E76 D;  2QIW A;  3F89 A;  1NTZ D;  1JMB A;  4N78 E;  5APT A;  5AVT B;  2QG4 A;  2Z4E A;  1L2P A;  1OWA A;  3HTK A;  2Y0D A;  2ZT9 D;  3CWB J;  4OGQ B;  3SFE C;  3USS A;  4I7Z C;  2OTJ P;  1LWU B;  1GL2 B;  2YIU C;  1IFJ A;  1VQO P;  1VQK P;  1H0T B;  3CI9 A;  3NXS A;  1GU5 A;  1KIL C;  4C7N A;  4EDF A;  1KD1 Q;  4XA4 A;  1JCC A;  1NU1 D;  1LTG C;  2ZYA A;  5CCH C;  1T8Z A;  1JTH A;  1NTZ G;  1BE3 E;  3CXH E;  1EC5 A;  2WSF H;  1L0L G;  1OIP A;  1RQV A;  3S1K A;  3A2A A;  2G3A A;  1JY3 P;  2YXQ B;  5CBO A;  3G3Z A;  3E1R A;  3A5T A;  3U1A A;  3M9B A;  1BE3 D;  1IFP A;  2JO1 A;  1SQX D;  2PGD A;  2WWW A;  3G6E P;  4GOF A;  3OW2 O;  1AJY A;  1IFI A;  3AEE C;  1NTK D;  3TYY A;  1IK7 A;  2V7Q H;  4OVN F;  1OMI A;  2Q6Q A;  5EFW B;  1MKM A;  3RK2 B;  2E76 B;  1KZU B;  3WUV A;  3G9R A;  4RJT A;  4BRY A;  5KLV D;  5BVZ A;  2W6J H;  4UB6 H;  1VF5 B;  2ZAE B;  3H1L D;  4W7Y A;  3T97 A;  2M5A B;  4PD4 D;  3JC2 2;  1RF1 B;  1MFT A;  3CWB G;  3GHG B;  5CCG D;  3VP9 A;  5APQ A;  1BSH A;  3H1L E;  3H1K G;  2QRX A;  2QJK B;  3P8C E;  3GHG A;  3CX5 E;  3TDK A;  2BAS A;  2K3R A;  3RK2 C;  2JDI H;  1SS1 A;  1CI6 B;  2OYH A;  2BCC E;  3M9H A;  3L70 J;  3V6I A;  3H1L G;  4GOE A;  2CPS A;  2WT7 A;  1EZV I;  1RE3 C;  1KN7 A;  1EDK A;  1M56 D;  1NKZ B;  3CWB D;  4OH8 B;  1BGY E;  2KIK A;  2G8Y A;  2P58 A;  2N9B A;  1SQB E;  1WRG A;  1P84 E;  2YXR B;  4UB6 E;  2WT7 B;  1NTM E;  2H7H A;  2A45 H;  1CW5 A;  1FDO A;  4IL6 E;  3A0B H;  4D6T D;  3CME P;  1HGV A;  3RK3 B;  3TGU E;  2K9J B;  3AE9 C;  3CWB E;  3W68 A;  4C46 A;  1KFM A;  1IK9 A;  3P7K A;  1JOC A;  3Q2Y A;  3LW5 H;  3D6Z A;  1URQ A;  3L71 J;  3VN0 A;  3CCL P;  3KXD A;  1LWU C;  2M5A A;  1JTH B;  1K05 A;  3T97 B;  1Q90 D;  1LTA C;  4BWN A;  2KLU A;  3MUD A;  1JY2 O;  1ZN5 A;  3FX0 A;  4OGQ C;  2YO3 A;  5BU8 B;  2QEX P;  2BEQ D;  2Q1K A;  3CCJ P;  1GL2 A;  4Y28 J;  2D2C C;  1L0L D;  3MGN A;  3NMD A;  3A0H E;  1LJ2 A;  4N78 D;  2XDJ A;  3KDP B;  1A02 F;  5KAI E;  4I6M C;  1W2B O;  4JQ0 D;  1NYH A;  1BE3 G;  3UIA A;  1ZR4 A;  3HD7 D;  1L0L E;  3CC2 P;  3U59 A;  4L75 A;  5B66 H;  3H1J D;  3JCU H;  4WWI A;  4K35 A;  3RL0 g;  3TNU B;  2PAJ A;  1PGJ A;  4KJM A;  3H1H D;  1S9K D;  1OVR A;  2ZJS E;  3M9Q A;  1DH3 A;  4H13 D;  1USE A;  1QVG O;  3AEF C;  2B9B A;  4H44 C;  2XZR A;  4HYT B;  3HD7 B;  2FYU G;  3PH0 A;  2FY8 A;  2OYO A;  1H89 A;  4C7N B;  4N3Y B;  1KB9 D;  1SQP E;  2N1T A;  3HUS C;  1A02 J;  1LWU A;  1BGY G;  3B5N D;  5APW A;  3G4S P;  1L0N E;  2AEM A;  2OYI C;  3AE8 C;  1Q2N A;  3H6P A;  3MZW B;  4LGD E;  3VMZ A;  1LTJ C;  3WUU A;  1KIL B;  2KNC A;  2BCC G;  1MFZ A;  1HBW A;  1Z56 A;  1N7L A;  2AXC A;  3L70 G;  1NTK J;  1LP1 A;  3L73 D;  4I7Z B;  2E75 B;  4LC1 A;  4EI2 A;  1FDM A;  2O01 J;  2OAR A;  2P10 A;  2NPS B;  3FXE A;  5GTH E;  2D2C B;  2GUV A;  3HE5 A;  1RF1 C;  1K04 A;  1RH5 B;  2QVA A;  3PHL A;  1VF5 D;  3RK3 D;  2ZFC A;  3H1I E;  4BXL A;  2Q3I A;  1Q81 Q;  1KV4 A;  1XTG B;  2PFX A;  3EFG A;  5AW2 B;  4HKZ H;  5DJU B;  2JWA A;  3BRT B;  3L75 D;  3AEB C;  1EZV E;  1JO5 A;  3CCE P;  2KSE A;  3GG2 A;  3H1I J;  4GT1 A;  1FZB A;  1NOH A;  3FWL A;  1SFC A;  4MN4 C;  5AVZ B;  3BCC D;  2K1A A;  3TGU G;  3BAS A;  4ASW A;  5APU A;  1R8E A;  3RK3 C;  2KZJ A;  3QWO C;  2C9N Y;  3L71 G;  1QLE D;  1PGQ A;  2OQQ A;  5AW9 B;  4WBA A;  1L0L K;  2LR2 A;  5AVV B;  3B5N C;  1AVO A;  2IBZ I;  4JPZ B;  4R4L A;  1DIP A;  3AEC C;  2YMY A;  3N7N A;  2KB7 P;  4TLF A;  4YPC A;  1E79 H;  1NU1 E;  1AQ5 A;  1SLQ A;  2IYO A;  5AVU B;  1U7J A;  5KLV G;  4PJ0 H;  1KQG B;  1HUC A;  1X22 A;  3H1K E;  3PTZ A;  1EDJ A;  2HOD A;  2PRR A;  1RE4 A;  3GMA A;  1SQP K;  3L71 D;  2NRG A;  5AVS B;  1BDC A;  3RGU A;  2WPQ A;  2WVR A;  1FE6 A;  2Z5I A;  1H8A A;  2H43 A;  1AFO A;  1AVY A;  1YI2 P;  3L71 E;  2E5T A;  2NPS C;  2O01 H;  4JF7 A;  4EIJ A;  4D6T J;  1JB0 J;  2JKV A;  4IFF A;  5CCH A;  1KB9 H;  1VQL P;  2E76 C;  1RHZ B;  5B5E E;  2B88 A;  2POH A;  4I1L A;  2I1J A;  4NPE A;  1DX7 A;  2DW3 A;  3L73 J;  2KS1 A;  4OGQ D;  3BCC G;  3EQ2 A;  1PL5 A;  2IPP A;  1PFI A;  1LTJ B;  2M8R A;  4Z1M H;  5B66 E;  1FZC B;  1YQ4 C;  1JY3 N;  2W27 A;  3AE6 C;  3M91 A;  2FYU K;  4WY4 D;  1M57 D;  2L5G B;  1YJN P;  1SQB D;  2HLO A;  4CPG A;  1JUN A;  4R4M A;  3LIE A;  2FFD A;  5KAI H;  1HWT C;  3HD7 C;  1Y47 A;  3AE5 C;  1KQF B;  2ZVN B;  3B71 A;  1LT9 C;  4LLH A;  4PD4 I;  1SFC C;  3U1C A;  1FZF A;  3OA7 A;  2H89 C;  1J2J B;  3IR9 A;  4M3L A;  3JSV C;  1LTB C;  1ZW0 A;  5AVQ B;  3ZDM A;  2P2U A;  3RL0 B;  1X9V A;  1WT6 A;  1NWQ A;  1JNM A;  3QH9 A;  3CCS P;  1KYO D;  1OZH A;  3CPW O;  3O8Z A;  1SQV D;  2IBZ D;  4PD4 E;  2HOD B;  2FBW C;  2N9Y B;  3AE2 C;  1BCC E;  1U57 A;  2Q9I A;  3L73 G;  4KT0 J;  2K9Y A;  3TK1 A;  1SQP G;  3CXH I;  1N7S C;  2A06 G;  3L74 G;  4RES B;  4EOT A;  1PP9 E;  3A0B E;  1PV3 A;  3L74 J;  3M0A A;  3CCV P;  1PP9 D;  3L72 J;  1HF9 A;  5APV A;  2Q7C A;  3CC4 P;  4H0L B;  4L73 A;  1KOR A;  1NU1 G;  3OAK A;  3Q5R A;  1FOS E;  4AUW A;  1S5L E;  4HJG H;  4A7P A;  1JY3 O;  3SWK A;  2WPS A;  1SQP D;  4IL6 X;  4L74 A;  1SQX J;  1HVV A;  1QGK B;  2AXT H;  4ZNC A;  1L4A A;  3CX5 H;  3E1I A;  1JCD A;  3M0D C;  1X79 B;  1SQQ J;  2QA4 P;  1VQP P;  5TIS H;  1HJ0 A;  1YQ3 C;  1NVO A;  1RE3 A;  1J1E B;  4YXW H;  3PJS K;  1M1K Q;  4JBZ A;  1VQM P;  3N4X A;  1PP9 G;  2O1K A;  1KFN A;  3F5H A;  1Q86 Q;  3H1J E;  3GLM A;  2QJY B;  2E5Y A;  5AVY B;  2ZT9 C;  3BCC E;  2MKV A;  3H1H J;  2B87 B;  5AW4 B;  4DJG A;  2O3J A;  2HR3 A;  1M1J C;  1BDD A;  1N73 C;  2R44 A;  1LTS C;  1RY3 A;  3CD6 P;  3H1I G;  1LP1 B;  2B89 A;  1OVV A;  3AED C;  1YJW P;  1N73 A;  3S9O A;  4IL6 H;  2E74 C;  2KNC B;  3B8E B;  3D6Y A;  1KIL A;  1VF5 C;  2JJL A;  5KAF E;  3S4R A;  3AE3 C;  4HB1 A;  2QJP B;  1SQV E;  2IBZ E;  1NTM J;  1XTC C;  1QL2 A;  3V2P A;  3TF5 A;  3MP7 B;  1FJP A;  2AXT E;  2K88 A;  1S5L H;  1LT1 A;  1N7S A;  1OVU A;  5AVW B;  5KLV E;  2IYP A;  1PPJ E;  1QL1 A;  2LXC B;  3VTP C;  2XV5 A;  1ZME C;  1OW7 A;  2FYN B;  3L70 E;  3HE5 B;  3BAT A;  2Y9Z A;  2HPC B;  1R5S A;  5AVR B;  3OJA B;  1NKN A;  1KQL A;  4IFM A;  5CJ4 A;  2FFD B;  1KB9 E;  1M90 Q;  2FXP A;  2RN0 A;  4XFJ A;  2A06 E;  3L74 E;  4KHX A;  5AW5 B;  1Q82 Q;  4ZKU A;  1GTW A;  4GKG A;  2IDB A;  3G71 P;  1RF0 A;  1BCC G;  2FYU J;  1SQQ D;  1VQ6 P;  3L37 A;  1CSB A;  1NU1 J;  3C8V A;  1VL2 A;  2H88 C;  1FAV A;  1GL2 C;  2YIU B;  2N1T B;  2C0W A;  2YNY A;  3L75 J;  3PRJ A;  4PJ0 E;  3TSI A;  1YJ9 P;  1T2K C;  1CZQ A;  3HD7 A;  1KQS O;  1Q7Y Q;  1RQU A;  1JY2 P;  3GF3 A;  2FYU D;  1YTZ I;  3L75 E;  2GM4 A;  1IFM A;  1TU3 F;  3PP5 A;  1G2C B;  2HG5 D;  3TNU A;  3Q3D A;  3V2Q A;  3KZI H;  1T6A A;  4WY4 B;  2I8D A;  2WTY A;  1FZA A;  4GOD A;  2LXB A;  4YXD C;  1L4A C;  1T3J A;  1ZLL A;  5KKZ B;  1K8A Q;  3M06 A;  1D7M A;  2SPZ A;  2AEF A;  1HGZ A;  1JMM A;  1PP9 J;  3L72 D;  5H2F E;  4DT0 A;  3A7O A;  2ZT9 B;  5B5E H;  3CMA P;  3BRV B;  1VQ5 P;  3RK2 D;  3CCU P;  2W83 C;  1SQV K;  1URQ C;  1HJB A;  2OYH B;  1CI6 A;  4TT3 H;  3IAO A;  1P84 D;  4AYC A;  1VQ4 P;  2E43 A;  1J1D B;  1J1E C;  1J1D C;  2KZI A;  4D6T E;  5CMZ A;  3K5B A;  1SQV J;  2M3E A;  1S72 P;  1URQ B;  2OYH C;  2MJZ A;  3CC7 P;  1KYO I;  2R3S A;  2BCC D;  1JM0 A;  2YO2 A;  1WMK A;  2K9J A;  1DEE G;  4JYB A;  3Q1M A;  3EFF K;  4GIF A;  1KTM A;  1X8Y A;  3CX5 D;  3WMM 0;  2P67 A;  5KJ7 A;  1H88 A;  2H8P D;  2RMZ A;  1KC8 Q;  1NAY A;  3GF7 A;  2PP6 A;  1BE3 J;  2YKO A;  3AE1 C;  2ZYD A;  2J58 A;  3P8C D;  3VMY A;  4O9B A;  3PLN A;  2IFN A;  3I55 P;  2E42 A;  1ZV8 A;  2QM8 A;  3L73 E;  1S1C X;  3CXH H;  3SSU A;  2FYZ A;  4H13 B;  1NTK K;  1G2C A;  2NPS D;  2QSI A;  2W8Z A;  3MUD C;  2YKP A;  5APX A;  4U3F E;  1NU1 K;  3KZI E;  2E74 D;  1AV1 A;  1RF1 A;  3H1J G;  3CCQ P;  1OW8 A;  1SQX E;  4WVZ A;  1SVF A;  3CL3 D;  4OWF A;  3B4S A;  2HFE D;  3V2R A;  1UIX A;  4BRY B;  1S3J A;  1VPC A;  1GU4 A;  1Y8A A;  5KTB A;  1HH0 A;  1E5W A;  1NHL A;  1DD4 A;  1SQV G;  2IBZ G;  1R5L A;  1RE4 C;  3A0H H;  3L72 E;  4XE5 B;  5GTH H;  1NJI Q;  4Y99 B;  3MIW A;  4IOI H;  1LGH B;  1S2E A;  2FXM A;  5AW1 B;  2J5U A;  3ABV C;  1NH4 A;  2KXP B;  3L36 A;  2WMM A;  3LW5 J;  4WY4 A;  3VP8 A;  1UII A;  2HYN A;  2FYN C;  2KSJ A;  1SQQ G;  1LTI C;  1FZC C;  3WU2 H;  2GA1 A;  1ZR2 A;  4H0L C;  3IFM A;  2R32 A;  2CPB A;  3V4Q A;  2KOG A;  2FYU E;  2XND H;  1JY2 N;  1L0N J;  1N86 A;  1PPJ D;  1N7S B;  1NGM B;  3D70 A;  2AEJ A;  1QX8 A;  2E74 B;  5CBN A;  1BCC D;  1T2K D;  1H0T A;  5CHX A;  1MUU A;  3FWN A;  2M3B A;  1GZL A;  1Y9B A;  4ZKP A;  5BU5 A;  2FFD C;  2FXO A;  2W90 A;  3HTK B;  1IFN A;  1LT9 A;  3O6Q A;  4U7J A;  3Q5S A;  1VQ7 P;  1N73 B;  2IFM A;  5KJ7 D;  1SQQ E;  1FJK A;  5L8R J;  4YTP C;  1PZQ A;  1PPJ G;  2W6B A;  2C9L Y;  1FZG A;  1PGP A;  1BSN A;  2HPC A;  1NTK E;  1KYO H;  1K73 Q;  2V4H A;  3MD0 A;  4C7R A;  2C0X A;  2V7Q J;  3VOP A;  4AQR D;  1M7L A;  2VRS A;  4N6J A;  4UB8 E;  4EYY Q;  5AVX B;  1SQX K;  3L70 D;  4B86 A;  4U3F G;  3WU2 E;  1YIT P;  4DCK A;  2RKL A;  1GK6 A;  1FOS F;  1GK4 A;  4H13 C;  3WUT A;  1MZ9 A;  1EZV G;  1L4A B;  3H1J J;  2KK7 A;  3HUS A;  1SQB K;  4UB8 H; 
#chains in the Genus database with same CATH homology
 4WY4 C;  1NTM K;  1GW3 A;  3V4W A;  4HH2 A;  2JEE A;  4DOJ A;  3RL0 D;  3GHG C;  2YKQ A;  1IC2 A;  3SWY A;  2XU6 A;  5CJ0 A;  3V2N A;  1HTL C;  2XNX A;  2KYV A;  5KJ7 C;  1M1J B;  2FKW B;  3B5N A;  3H32 B;  3NFQ A;  3KPE A;  5APS A;  4WB4 A;  1W2E A;  1GL2 D;  2OYI A;  1URQ D;  1KIL D;  5AW6 B;  1LTT C;  5CCG C;  2LKM A;  1DEB A;  2I1K A;  2XKM A;  1NAF A;  1N7S D;  3P8M C;  1SQQ K;  5APY A;  5AW3 B;  2WPR A;  1L4A D;  3R2P A;  4W80 A;  1GD2 E;  3HE4 B;  2N1T D;  3A3Y B;  1GW4 A;  1LTJ A;  1NO4 A;  3C9I A;  3HRN A;  3BVH A;  3LID A;  1L0N K;  3L35 A;  3V5B A;  1FZC A;  3CLQ A;  1IJD B;  2N1T C;  2ZXE B;  3L4F A;  1FZC B;  2WSC H;  3I5C A;  2Q5U A;  2OYI B;  4Y99 C;  1RF0 C;  3HE4 A;  3P32 A;  1EQ7 A;  2A45 G;  2IX7 C;  2P1J A;  1M1J A;  3B5N B;  3H32 A;  3MTU E;  3NTN A;  2GM4 A;  1NTZ K;  4W7Z A;  4DZO A;  4IFD K;  1MV8 A;  1IFD A;  3VMX A;  2J59 M;  2R5B A;  2Z5H A;  3VYI A;  2QM7 A;  1YYC A;  5AW7 B;  1VDF A;  1YTZ T;  4JYC A;  1SFC D;  2O1J A;  2W6A A;  1T3U A;  1FBM A;  1OXZ A;  3SWF A;  1G1I A;  4AUW A;  3RL0 C;  2KLV A;  2R3C A;  2A45 I;  1FU1 A;  5AW0 B;  5CCH D;  1GDT A;  1SFC B;  3HUS B;  1LT9 B;  5AW8 B;  2KP8 A;  2R5D A;  1N2D C;  3II6 A;  3KQG A;  5CCG A;  3KYQ A;  2WIT A;  3M0D A;  1G1J A;  1S9K E;  2WSE H;  1IO4 A;  4I2L C;  1SP4 A;  1FZE A;  2NPS A;  2P7J A;  2GUS A;  2WZ7 A;  4N78 E;  5APT A;  5AVT B;  2Z4E A;  3HTK A;  1OWA A;  1LWU B;  1GL2 B;  1IFJ A;  3CI9 A;  3NXS A;  1GU5 A;  1KIL C;  4C7N A;  4XA4 A;  1JCC A;  5CCH C;  1LTG C;  1T8Z A;  1JTH A;  2WSF H;  3A2A A;  1JY3 P;  3G3Z A;  3A5T A;  3U1A A;  3M9B A;  2WWW A;  1IFI A;  3TYY A;  3RK2 B;  1KZU B;  5BVZ A;  4W7Y A;  3T97 A;  1RF1 B;  3GHG B;  5CCG D;  3VP9 A;  5APQ A;  3P8C E;  3GHG A;  2BAS A;  3RK2 C;  1CI6 B;  2OYH A;  3M9H A;  2WT7 A;  2CPS A;  1RE3 C;  1NKZ B;  4OH8 B;  2N9B A;  1WRG A;  1CW5 A;  2H7H A;  2WT7 B;  2A45 H;  1HGV A;  3RK3 B;  4C46 A;  1KFM A;  1IK9 A;  3P7K A;  1JOC A;  3LW5 H;  1URQ A;  3VN0 A;  1LWU C;  1JTH B;  1LTA C;  3MUD A;  1JY2 O;  1ZN5 A;  2YO3 A;  1GL2 A;  3NMD A;  3MGN A;  1A02 F;  4N78 D;  2XDJ A;  3KDP B;  4I6M C;  3UIA A;  1ZR4 A;  3HD7 D;  3U59 A;  3TNU B;  2PAJ A;  1S9K D;  3M9Q A;  2XZR A;  4HYT B;  3HD7 B;  1H89 A;  4C7N B;  4N3Y B;  2N1T A;  3HUS C;  1A02 J;  1LWU A;  3B5N D;  5APW A;  2OYI C;  3H6P A;  4LGD E;  3VMZ A;  1LTJ C;  1KIL B;  1MFZ A;  1HBW A;  1Z56 A;  1N7L A;  4LC1 A;  1FDM A;  2OAR A;  2NPS B;  2GUV A;  3HE5 A;  1RF1 C;  3RK3 D;  2ZFC A;  2Q3I A;  1XTG B;  3EFG A;  5AW2 B;  3BRT B;  1JO5 A;  4GT1 A;  1FZB A;  1NOH A;  5AVZ B;  1SFC A;  1AQ5 A;  3BAS A;  5APU A;  2C9N Y;  3RK3 C;  5AW9 B;  4WBA A;  1L0L K;  5AVV B;  3B5N C;  2YMY A;  3N7N A;  2KB7 P;  1SLQ A;  5AVU B;  1HUC A;  2HOD A;  1RE4 A;  5AVS B;  1SQP K;  1H8A A;  2WPQ A;  1AFO A;  2Z5I A;  2H43 A;  2NPS C;  2O01 H;  4JF7 A;  4EIJ A;  4IFF A;  5CCH A;  2POH A;  4I1L A;  2I1J A;  1DX7 A;  3EQ2 A;  2IPP A;  1PFI A;  1LTJ B;  2M8R A;  2W27 A;  1JY3 N;  3M91 A;  2FYU K;  4WY4 D;  2L5G B;  2HLO A;  1JUN A;  3LIE A;  2FFD A;  1HWT C;  3HD7 C;  1LT9 C;  4LLH A;  3U1C A;  1SFC C;  1FZF A;  3OA7 A;  1J2J B;  3IR9 A;  4M3L A;  1LTB C;  5AVQ B;  2P2U A;  3RL0 B;  1X9V A;  1WT6 A;  1NWQ A;  1JNM A;  3O8Z A;  5KLV K;  2FFD B;  2HOD B;  2Q9I A;  3TK1 A;  1N7S C;  4RES B;  4EOT A;  3M0A A;  5APV A;  2Q7C A;  1FOS E;  3OAK A;  1JY3 O;  2WPS A;  1HVV A;  1L4A A;  3E1I A;  1JCD A;  3M0D C;  1X79 B;  1RE3 A;  1J1E B;  3N4X A;  2O1K A;  1KFN A;  5AVY B;  5AW4 B;  1M1J C;  1N73 C;  1LTS C;  1RY3 A;  1N73 A;  3B8E B;  1KIL A;  2JJL A;  1XTC C;  1QL2 A;  3V2P A;  1FJP A;  5AVW B;  1N7S A;  3VTP C;  1QL1 A;  2XV5 A;  3HE5 B;  3BAT A;  2HPC B;  5AVR B;  3OJA B;  1NKN A;  1KQL A;  4IFM A;  5CJ4 A;  4KHX A;  5AW5 B;  4ZKU A;  1GTW A;  4GKG A;  1RF0 A;  3L37 A;  1CSB A;  1FAV A;  1GL2 C;  2YNY A;  2N1T B;  2C0W A;  1T2K C;  3TSI A;  1CZQ A;  3HD7 A;  1JY2 P;  1YTZ I;  1IFM A;  3PP5 A;  1G2C B;  2HG5 D;  3TNU A;  3V2Q A;  2WTY A;  4WY4 B;  1FZA A;  1L4A C;  1T3J A;  1ZLL A;  3M06 A;  1HGZ A;  1JMM A;  3A7O A;  3BRV B;  3RK2 D;  1SQV K;  1URQ C;  1HJB A;  2OYH B;  1CI6 A;  4AYC A;  2E43 A;  1J1D B;  1J1E C;  1J1D C;  5CMZ A;  1URQ B;  2OYH C;  2MJZ A;  2YO2 A;  4JYB A;  4GIF A;  1X8Y A;  3WMM 0;  2P67 A;  5KJ7 A;  1H88 A;  2H8P D;  2PP6 A;  2YKO A;  3P8C D;  2J58 A;  3VMY A;  4O9B A;  2IFN A;  2E42 A;  1ZV8 A;  2QM8 A;  2FYZ A;  1NTK K;  1G2C A;  2NPS D;  2YKP A;  5APX A;  1NU1 K;  1RF1 A;  1SVF A;  3CL3 D;  2HFE D;  3V2R A;  1VPC A;  1GU4 A;  5KTB A;  1HH0 A;  1E5W A;  1NHL A;  4XE5 B;  4B86 A;  1RE4 C;  4Y99 B;  3MIW A;  1LGH B;  2FXM A;  5AW1 B;  1NH4 A;  3L36 A;  4WY4 A;  3VP8 A;  2HYN A;  2KSJ A;  1FZC C;  1LTI C;  1ZR2 A;  3IFM A;  2R32 A;  2CPB A;  3V4Q A;  2KOG A;  1JY2 N;  1N86 A;  1N7S B;  1T2K D;  5CHX A;  1MUU A;  4ZKP A;  2M3B A;  1GZL A;  5BU5 A;  2FFD C;  3HTK B;  1IFN A;  1LT9 A;  1N73 B;  2IFM A;  5KJ7 D;  1FJK A;  2W6B A;  2C9L Y;  1FZG A;  2HPC A;  3MD0 A;  4C7R A;  2C0X A;  4AQR D;  3VOP A;  1M7L A;  2VRS A;  4N6J A;  5AVX B;  1SQX K;  1GK6 A;  1FOS F;  1GK4 A;  1MZ9 A;  3HUS A;  1L4A B;  5BU8 B;  1DH3 A;  1SQB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...