2N9BA

Solution nmr structure of antiparallel myosin-10:gcn4 tandem coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
GSHENKQVEEILRLEKEIEDLQRMKERQELSLTEASLQKLQLEDKVEELLSKNYHLENEVARLKKLVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Unconventional myosin-X, General control protein GCN4 fusion
publication title Competition between Coiled-Coil Structures and the Impact on Myosin-10 Bundle Selection
pubmed doi rcsb
source organism Bos taurus
molecule tags Motor protein/transcription
total genus 31
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n9bA00
3VN0A 2QM7A 2R5BA 3MGNA 5AVRB 3TYYA 1GK6A 2IPPA 4RESB 5APVA 2WPSA 1KQLA 3IR9A 2Q3IA 3NXSA 2XZRA 2YNYA 5AW7B 3L35A 3VMYA 1FOSE 5AVQB 2Q5UA 2C9NY 2P2UA 1MFZA 5AVYB 3P8MC 3HE5A 3NTNA 3UIAA 1T2KC 5APWA 5AW2B 2N9BA 2VRSA 2W27A 3NFQA 2WT7A 5AW0B 4GKGA 5AVTB 2H7HA 2R3CA 4GT1A 1J2JB 3HE4A 3SWFA 1SP4A 5AVZB 3B8EB 2WPRA 3OAKA 5AW1B 1HWTC 2WTYA 3KDPB 3A5TA 3TK1A 2E43A 1H89A 3TNUB 2Z5HA 5AW3B 1A02F 1NAFA 2BASA 3A2AA 3M0AA 4LC1A 3TNUA 4DZOA 2JJLA 2ZFCA 1CI6B 1S9KD 1G2CB 1NWQA 1GU4A 2YO3A 1CI6A 3LIDA 1GU5A 1H8AA 3M9BA 3HTKA 4C46A 1JUNA 1GZLA 5AW8B 2Q7CA 2C9LY 3P32A 2XU6A 1X8YA 5APXA 1HUCA 1GD2E 2Z5IA 1HJBA 3L36A 3V4WA 5APUA 4I2LC 3M0DA 4C7NB 1JNMA 1DH3A 2P7JA 2P67A 3VMZA 2R32A 5AW5B 3A3YB 3VYIA 4C7NA 3VMXA 3KQGA 1A02J 2W6AA 3M9HA 3NMDA 1IO4A 5AW4B 2XV5A 5APTA 4AQRD 5AVXB 3V4QA 4AYCA 4XE5B 5AVUB 4AUWA 4EOTA 3LIEA 1GTWA 3A7OA 3MD0A 3P7KA 1SLQA 5APSA 1FOSF 5CMZA 5AVVB 1GK4A 3M91A 5APQA 5AW9B 3M06A 3V5BA 5AVWB 4JYBA 3VTPC 1CSBA 3L37A 5AW6B 3T97A 5AVSB 2QM8A 5APYA 1YYCA 3HE5B 4M3LA 1FAVA 4HYTB 1T2KD 2R5DA 2WPQA 4B86A 2WT7B 1MV8A 4JYCA 1CZQA 4I6MC 1OWAA 1S9KE 3HE4B 2YO2A 2E42A 1OXZA 2KP8A 1H88A 3I5CA 4KHXA 2WWWA 1HBWA 3O8ZA 1MUUA 2ZXEB
chains in the Genus database with same CATH superfamily
1OVUA 3B5NB 1KQLA 1NTKD 5TISE 1L0LJ 3HTKB 2P58A 1L0ND 4H0LB 1OW6A 5AVTB 2Y0EA 3B4SA 2WPRA 1KB9E 2YKQA 5K5GB 3G4SP 1AJYA 3CC2P 2YIUB 1GU4A 5H2FH 1VQ5P 3TGUE 2JP3A 1X79B 1M1KQ 1SQQJ 2ZT9D 3R2PA 3RL0C 1IO4A 1T6AA 1JY3P 5GTIE 2QJYB 2B87A 3L73J 3Q3DA 2KZJA 1FZCA 4EDFA 5APSA 2NPSB 2QVAA 3H1KE 1SVFA 2Q1KA 1YYCA 2E76D 1SQPG 1YIJP 2WSFH 1T3JA 1SQPK 4JF7A 3CCMP 3G3ZA 2FYUJ 1H88A 1ZLLA 3C1LA 1BCCD 2IZ1A 5CHXA 1Y8AA 3HD7A 1KQSO 3VN0A 2IBZD 3I56P 1P84I 3S9OA 1KQFB 1YTZT 1UIIA 3E1RA 5AVQB 2C0XA 3HE5A 2FYZA 3KZIE 1YTZI 3II6A 3WUTA 2BCCE 5AW3B 3TF5A 2Q6QA 2Y9YA 1M1JB 1L0LD 3R4YA 3GLMA 3I55P 3LIDA 1SQXD 2BCCG 1H8AA 3CC4P 1JUNA 2CPSA 2IBZG 1KORA 3GG2A 3GHGC 4PD4D 2D2CB 2BEQD 4YPCA 2HFED 2WSSH 3VMZA 2KS1B 2BEZF 1QLED 2WVRA 3S4RA 4H44B 1IFDA 3V2NA 2XV5A 2QG4A 2FXOA 4XE5B 5AVUB 1LTGC 1KILB 3P8CE 1NU1G 1LTJC 1MKMA 2W6BA 1KV4A 2NZ2A 1SQQD 1L2PA 3L37A 3WU2E 3HE5B 3EFGA 1VQ9P 2CPBA 1CZQA 3AE4C 2W83C 1U7MA 5KLVE 3FWLA 3I5CA 3CX5E 1YQ4C 2WWWA 3MZWB 4L75A 3O6QA 2IPPA 5GTHE 2J58A 1FJPA 1IC2A 1BSHA 1YBKA 1GK6A 5KLVG 3NXSA 2AEMA 3L35A 5KLVK 3CCLP 1N73B 2OTJP 3H1HD 2Y9ZA 1ZMEC 1YJ9P 3CPWO 1X9VA 3CWBJ 3E1IA 2FYUE 1G1JA 4XFJA 1X22A 2BASA 2Z4EA 1W5CE 1S3JA 1GU5A 4OGQC 1RQVA 2G8YA 1J1EB 2Q7CA 4R4MA 2OARA 3MUDC 2WMMA 3RK2D 1KZUB 2P67A 1EZVG 2I8DA 2W6AA 3NMDA 2JO1A 3JCUH 3P7KA 3O6QB 4Y99B 3GHGA 4H0LD 3L72G 3G6EP 1JMBA 2QJPB 3M06A 2E5YA 1N7SC 1RHZB 1BDDA 3KPEA 2PAJA 2QM8A 2ZYGA 1NTZG 2PRRA 1LTJA 1SQBG 1LP1B 2E75C 1OXZA 4O9BA 1SS1A 4ASVA 1KN7A 5KAFH 1FBMA 2QJKB 2RKLA 5B66H 2L5GB 5KJ7C 2IDBA 5BU8B 1NGMB 2AEJA 2HPCA 2WQYC 2HR3A 2J5UA 1NTMJ 4WB4A 3M9QA 5H2FE 3CD6P 1NOHA 2NPSD 2QA4P 1CW5A 2ZAEB 1LTBC 2PP6A 4HKZH 2H89C 1KYOI 3CMAP 2IFMA 3H32A 4KT0J 3OW2O 1Q81Q 1KYOH 1SQVG 1S5LH 1DX7A 2V4HA 4W7ZA 3L74E 3AEDC 5KLIB 1JY3N 4BXLA 4C7NB 4I7ZC 1JNMA 2K37A 4HJGH 2KUBA 3H1LG 1L4AC 1KFNA 3L70E 4IFFA 3L74G 2O1JA 3M9HA 2QE7H 1HGZA 4H13C 4L73A 2KB7P 2GM4A 2B89A 1PPJE 3SFEC 2NRGA 3IFMA 3MUDA 2W8ZA 4DCKA 2IX7C 2O01H 1U57A 3V2PA 1HF9A 3C8VA 4D6TJ 3K5BA 2AEFA 3H1IE 1OVRA 3A0HH 2E42A 5TJHA 3H1IG 2YMKA 1FDMA 2WITA 3CLQA 1N7SA 3QH9A 2HLOA 2QM7A 4U3FD 2D2CD 3VMYA 2N1TB 3BCCG 4H44D 2C9NY 3AEEC 1HVVA 5AW2B 1AFOA 1NYHA 1YJWP 2I1KA 1KILD 1LGHB 4PD4H 4GT1A 2Q3EA 1SP4A 5AVZB 2V7QH 1NKNA 4YXWH 5KJ7A 1EC5A 3AE8C 1EQ7A 1S72P 2FKWB 3TGUJ 2WSCJ 1GD2E 4GOFA 3AE3C 2Z5IA 5KAIH 1JM0A 1RF0C 1PGQA 1SQPJ 4IL6H 3Q2YA 4EOTA 1DEEG 1RF1B 1Y47A 3USSA 3W68A 3H1KJ 3L75E 1PP9E 1SFCC 3L71E 1EZVI 1L4AA 5AVWB 4W7YA 3JSVC 4HB1A 1S5LX 1FAVA 1IFMA 3L75G 1T2KD 1MV8A 3U1AA 1NHLA 1OWAA 1S9KE 1IFNA 1JY3O 1JB0J 2WSEH 1YJNP 1AV1A 2QIWA 1JTHA 3TYYA 3TSIA 2WPSA 4D6TD 2YNYA 4GODA 4WVZA 2LXBA 1EDJA 2W27A 2BCCJ 1BE3D 3HE4A 3SWFA 2KYVA 3TNUB 3A2AA 1Q90D 3AE5C 5KKZB 1CI6A 3H1JD 1JY2O 3CCEP 1KB9D 2OYIC 2FYNB 1UIXA 2HODB 3JCUE 4H13B 5KTBA 1Y9BA 2W90A 1FDIA 1TU3F 3VMXA 1BDCA 1LT9B 3LW5J 1GL2C 3V4QA 1EDLA 4N6JA 1NTKE 3D71A 3VMAA 1BGYD 1L0NE 1QGKB 3MHVA 1LTTC 1VPCA 4N3YB 1NTKG 1NTKK 1RF0A 2XDJA 3H1JG 1L0NG 4QMAA 1LTIC 5KLVJ 3V2QA 1L0NK 1FE6A 3HE4B 4PV1C 5CCGD 2KNCA 1SFCA 5B66E 3BATA 1SQPE 2K9JA 3O8ZA 1T8ZA 1JCDA 1D7MA 2MJZA 4IL6X 4UB6H 5DJUB 2Q3IA 1USEA 2SPZA 3KXDA 2Q5UA 2P2UA 2O3JA 1G1IA 5APWA 3NFQA 1WMKA 2WTYA 1URQC 4RO0A 1GW4A 1KYOE 1S5LE 1M8OB 2A45G 3AEGC 1JY2P 3N7NA 4Y28J 3L4FA 1W2EA 3CXHI 3OA7A 3CXHH 2YKOA 2ZVNB 3ZDMA 2IBZE 3BRTB 2B87B 2N1TD 4R4LA 1BCCG 1FZCB 2KSJA 2OYIA 2LR2A 2K9JB 3HUSC 2JDIH 3E7KA 1RY3A 1LTAC 1E5WA 3A0HE 2PGDA 5AVSB 4RJTA 1NU1E 1GL2A 2KXPB 2YXQB 1XTGB 3A0BH 3GMAA 3FXEA 1SQXE 3HD7B 4N78E 1NU1K 4ZMDA 2KLUA 3AECC 1GMJA 1L0LG 1SQXG 4PD4E 1J1DB 1OMIA 1SQXK 2E76C 3CX5D 4K35A 1LWUC 3BVHA 3L73D 3G9RA 2H7HA 3AE9C 1K8AQ 4ZKPA 3ABVC 5AW1B 3A5TA 4BWNA 5CCHD 3L74J 1GZLA 2C9LY 4UB8E 2KZIA 2FYUD 1VQMP 2XKMA 1X8YA 2O01N 1SQQG 3L70J 1QL1A 1URQA 3CCRP 3WUUA 4IL6E 1GDTA 1GL2B 1Z56A 1Q2NA 1DD3A 1KD1Q 3U59A 4K3AA 2WSFJ 1G2CA 4AYCA 3VP8A 2FXPA 3BRVB 1EZVE 2KIKA 2QSIA 2OTKE 3H1HE 5BU5A 3H1IJ 5APQA 3RL0B 1FZFA 2GUSA 1CSBA 3CCUP 1ZRTD 2JEEA 3H1HG 2A06D 4IFDK 3L72E 1JOCA 3BCCJ 3HUSA 2B88A 1NAYA 1XTCC 2KP8A 5TISH 2W6JH 1EDKA 1NTZE 4HH2A 2FXMA 4RESB 1SQBE 4H13D 1E79H 1VQ7P 4OH8B 1KB9H 1NTZK 2FBWC 1X0TA 1SQBK 1AA0A 4LC1A 1K04A 4W80A 1G2CB 1BSNA 1FS0E 1LWUA 3BASA 2XU6A 4ZNCA 2E74C 1VF5C 2M8RA 3QWOC 3VYIA 1SQVE 2A45H 3L75J 1PP9J 3L71J 2PFXA 3GHGB 3H1LE 3RGUA 1SQVK 1NH4A 1OVVA 3L70D 3CWBD 1MZ9A 3RK2C 1LJ2A 1S4XA 3T97A 3IF4A 4YXDC 3KHUA 1PPJD 1LTJB 3B71A 3B5NC 2IBZI 1S2EA 2WPVB 4RKUJ 1VQPP 3G71P 1DD4A 1USDA 4H0LC 2M5AA 3SFDC 2KI7B 1QX8A 1FOSE 2HPCB 4DOJA 1OIPA 3W67A 1P84D 3S1KA 2YIUC 2VRSA 4WY4C 4DT0A 1JY2N 1RQUA 3OAKA 5EFWB 3BCCE 1NAFA 2RH0A 2OYHC 3M0DC 2ZFCA 3H32B 3VP9A 4PD4I 3CXHE 1OFCX 1AVOA 2QJYC 2GUVA 4NPFX 1HJBA 3L36A 1RH5B 2R44A 2L91A 3HD7D 1HH0A 2IYOA 1AQTA 2Y0CA 1HGVA 3MP7B 1M7LA 1DIPA 5CJ4A 1NTKJ 2R32A 4OGQB 2NPSC 2YKPA 4U3FE 5AW4B 1L0NJ 2ZYDA 4C7RA 4AUWA 3RK3E 2POHA 1PZQA 3WU2H 2YMYA 1SLQA 2JWAA 5CMZA 4U3FG 2LXCB 1PFIA 2DW3A 2KK7A 1KILE 1NTMD 1T3UA 4TT3H 3CCVP 2K1AA 3A0BE 4GOEA 1EDIA 3CX5H 4IFMA 1KFMA 4NPEA 4JYCA 3L71D 2YO2A 3EFFK 1N7SB 1IK7A 1ZR4A 3V2RA 2XNDH 1GL2D 2E75B 2P1JA 3B5NA 2H43A 1M1JC 1Q86Q 3EWKA 3B8EB 1HWTC 1LT1A 3JC22 1ZV8A 3RL0D 3H25A 3C9IA 1IZNB 2D2CC 2RN0A 3CI9A 2OTLP 3RK3C 1WRGA 4WY4A 4H44C 3AEBC 2E74B 1VF5B 5AW8B 5APXA 2AXTH 3HRNA 1KILC 4PJ0H 2OYHA 4I2LC 3M0DA 3MIWA 1QL2A 3KQGA 5B5EH 1VDFA 5APTA 1LNQA 1PV3A 1ZOYC 4I7ZB 2H8PD 1Q82Q 1L4AB 1NU1J 4D6TG 1BE3E 4JYBA 2NPSA 5AW6B 2ZYAA 5APYA 4BRYA 1SQXJ 1BE3G 3TGUD 1IFIA 1ZR2A 4WBAA 1N73C 4I1LA 3H1JE 1JTHB 2QEXP 1M57D 2YXRB 2V7QJ 5AW7B 4WY4B 1MFZA 5AVYB 4JPZB 3UIAA 1T2KC 1SQPD 5KAFE 2N9BA 2R3CA 2OYHB 3H1KD 1J1EC 1FU1A 1BGYE 1OX3A 3FWNA 5L8RJ 2JWDA 3TK1A 1H89A 2E43A 3TGUG 4DZOA 1CI6B 3PLNA 1VQ4P 1BGYG 2R3SA 1RE4C 1M1JA 1FDOA 1IFPA 3P32A 1AQ5A 1KYOD 4JBZA 4Y99C 5CBNA 2QJPC 5AW5B 4BRYB 2KS1A 2I1JA 3GF7A 4Z1MH 3MTUE 4AQRD 3PTZA 2H88C 3H1HJ 2IFNA 2JKVA 3AE2C 3H1KG 4EIJA 1ZP0C 1KILA 2BCCD 2Q9IA 1YI2P 4OWFA 1JCCA 4L74A 2WSEJ 1GK4A 3L72J 1K05A 1KMIZ 1BCCE 3VTPC 2OGUA 4M3LA 1P84H 3AEAC 2QJKC 3PP5A 2ITAA 1PGJA 2KNCB 1NTZJ 1SFCB 1EXIA 2KSEA 4KHXA 1SQBJ 1NU1D 5E79H 1LTSC 2ZT9C 3FXDA 4OGQD 3P8CD 3NTNA 4N78D 1M56D 5CJ0A 1N73A 5AW0B 1L0LE 3IAOA 5CCGC 3KDPB 3RK3B 5KLIC 3M0AA 4IOIH 2ZVOB 1L0LK 5KLVD 2IZ0A 1YQ3C 1KTMA 1JO5A 3RL0g 1SQVJ 1N7SD 1VQ6P 1DH3A 1N7LA 1IK9A 1DEBA 1JMMA 1RE4A 1ZN5A 1SQQE 3H1LJ 2OYIB 5AVXB 2E75D 2K3RA 1GTWA 5KAIE 1NVOA 3Q5SA 1FOSF 1N2DC 2HYNA 4CPGA 1SQQK 3L73E 1VQ8P 3VOPA 4EI2A 5KJ7D 2KOGA 2J59M 1N86A 5DJTB 4HYTB 3WUVA 1EZVD 1N8RQ 3L73G 2Y0DA 3CCQP 1S1CX 2N1TC 2P10A 2E74D 1LP1A 1VF5D 1HBWA 2WZ7A 2ZXEB 3Q5RA 2UWJE 1PIXA 3L72D 1JEKA 1ZW0A 5CBOA 2OYOA 1VQKP 2HG5D 2M3EA 4PV1B 2FYUG 2FYUK 2WT7A 1NTZD 3Q5PA 1NKZB 3D70A 1SQBD 4A7PA 2GA1A 1L4AD 1PL5A 2Z5HA 1IJDB 1KB9I 2QRXA 2AXTE 3B5ND 2YO3A 2ZXXA 4LLHA 3D6YA 3CMEP 4PJ0E 1ZRTE 2A06E 2XNXA 3TDKA 5CCGA 1URQB 5B5EE 2E5TA 1RF1C 1ZXGA 5APUA 2A06G 4U3FJ 4C7NA 4JQ0D 1M90Q 4WY4D 4OVNF 5CCHC 2WSCH 2RMZA 2FFDC 3A7OA 3PHLA 5AVVB 1FZAA 4U7JA 1SQVD 3PRJA 5GTIH 3M91A 1HJ0A 1MFTA 2A45I 4NPDA 4MN4C 2WPQA 3CL3D 3H1LD 3HUSB 4B86A 2MKVA 2WT7B 3L74D 2OQQA 1FZEA 2ZT9B 2R5BA 3MGNA 1YITP 1FC2C 1H0TA 4GIFA 4ASWA 3CCJP 2IYPA 2N1TA 2K88A 5KKZC 3CCSP 4UB6E 1U7JA 3KYQA 1OW7A 3CC7P 1R8EA 3H1ID 3KZIH 1RE3C 2FYNC 1A02F 2E76B 4YTPC 1R5SA 1LWUB 3CWBE 3U1CA 1FJKA 3M9BA 1QVGO 3L70G 3BCCD 1VQLP 1LT9C 2N9YB 1SFCD 3F89A 3CWBG 2LKMA 3AE1C 1R5LA 2O1KA 3SSUA 1PPJG 2P7JA 5C39A 1VQNP 1NO4A 3A3YB 3RBXA 3CXHD 1A02J 1IFJA 3F5HA 1VL2A 1BE3J 3LIEA 2AXCA 1GW3A 2M0BA 1P84E 1RF1A 2G3AA 5AW9B 3T97B 1H0TB 3SWKA 3RBZA 3RK3D 4ZKUA 3LW5H 5CCHA 2R5DA 3H1JJ 2FFDA 3Q1MA 4I6MC 3AE6C 1FZBA 5E79E 4XA4A 2B9BA 4WWIA 3IN6A 1MUUA 2M5AB 1PGOA 3CX5I 5AVRB 5APVA 3H6PA 3IR9A 2XZRA 1OW8A 3V6IA 3P8MC 5GTHH 4DJGA 3L75D 1PP9D 1BGYJ 4GKGA 1J2JB 1EXJA 1QEXA 3AEFC 4UB8H 3D6ZA 5BVZA 3TNUA 2JJLA 1S9KD 1NTME 1NWQA 1W2BO 3WMM0 1OZHA 1KQGB 3HTKA 1YHQP 4C46A 3FGAD 2K9YA 1NTMG 1HUCA 1FZCC 1NTMK 1RE3A 1PGPA 3N4XA 3OJAB 3V4WA 2HODA 1Q7YQ 1K73Q 1NJIQ 5M1BA 1K9MQ 3SWYA 2FFDB 3GW6A 1PP9G 4L76A 3L71G 4LGDE 3EQ2A 2FY8A 3AE7C 2C0WA 1FZGA 2M3BA 1LT9A 4PV1D 2CK3H 3MD0A 1WT6A 1BCCJ 2KLVA 3GF3A 3ITKA 1AVYA 3V5BA 4KJMA 4GDOA 2O01J 3HD7C 3PH0A 4TLFA 2JR8A 1QVFO 4EYYQ 1VQOP 4D6TE 1KC8Q 1J1DC 1HTLC 3PJSK 2ZJSE 3RK2B 1URQD 3FX0A
chains in the Genus database with same CATH topology
2QM7A 4HH2A 2FXMA 4RESB 3B5NB 1LTSC 1KQLA 3VMYA 4OH8B 2N1TB 3HTKB 3P8CD 2C9NY 1HVVA 3NTNA 4N78D 1N73A 5CJ0A 5AW2B 1AFOA 1NTZK 5AW0B 2I1KA 5AVTB 1KILD 1LGHB 1SQBK 4GT1A 1SP4A 5CCGC 5AVZB 2WPRA 2YKQA 1NKNA 3KDPB 3RK3B 3M0AA 5KJ7A 4LC1A 4W80A 1G2CB 1L0LK 1EQ7A 1GU4A 2FKWB 1LWUA 3BASA 1JO5A 2XU6A 1GD2E 2Z5IA 1N7SD 1X79B 2M8RA 3R2PA 1DH3A 1N7LA 1IK9A 3VYIA 1RF0C 3RL0C 1IO4A 1DEBA 1JMMA 1RE4A 1ZN5A 2A45H 1JY3P 2OYIB 5AVXB 4EOTA 1GTWA 3GHGB 1RF1B 1FZCA 5APSA 1FOSF 1SQVK 1NH4A 1N2DC 2HYNA 2NPSB 1SFCC 1SQQK 1L4AA 5AVWB 3VOPA 4W7YA 1MZ9A 3RK2C 3T97A 5KJ7D 1SVFA 2KOGA 1YYCA 1FAVA 2J59M 1N86A 1IFMA 4HYTB 2WSFH 1T3JA 1T2KD 1LTJB 1SQPK 4JF7A 1MV8A 3U1AA 1NHLA 3B5NC 1OWAA 1S9KE 3G3ZA 2N1TC 1IFNA 1JY3O 1H88A 1ZLLA 2WSEH 1HBWA 5CHXA 2WZ7A 3HD7A 2ZXEB 3VN0A 1JTHA 3TYYA 3TSIA 2WPSA 1YTZT 2YNYA 1FOSE 5AVQB 2C0XA 2HG5D 2HPCB 4DOJA 3HE5A 2FYZA 2FYUK 1YTZI 2VRSA 2W27A 2WT7A 4WY4C 3II6A 1JY2N 1NKZB 3HE4A 3SWFA 2KYVA 3OAKA 1L4AD 3TNUB 2Z5HA 5AW3B 1NAFA 2OYHC 1IJDB 3A2AA 3M0DC 2ZFCA 3B5ND 3H32B 2YO3A 4LLHA 1M1JB 1CI6A 3LIDA 3VP9A 1H8AA 2XNXA 1JY2O 1JUNA 2CPSA 5CCGA 2OYIC 1URQB 2GUVA 1HJBA 2HODB 3L36A 3GHGC 3HD7D 1HH0A 1RF1C 5APUA 5KTBA 2HFED 1HGVA 3VMZA 1M7LA 5CJ4A 2R32A 4C7NA 2NPSC 3VMXA 2YKPA 1IFDA 3V2NA 1LT9B 5AW4B 2XV5A 1GL2C 4WY4D 3V4QA 4C7RA 5CCHC 4N6JA 4XE5B 5AVUB 4AUWA 1LTGC 1KILB 2POHA 2WSCH 2FFDC 3A7OA 3P8CE 1LTJC 2YMYA 1SLQA 2W6BA 5CMZA 5AVVB 1FZAA 1LTTC 3M91A 1VPCA 1PFIA 4N3YB 1T3UA 2A45I 1NTKK 1RF0A 2XDJA 3L37A 3HE5B 4IFMA 1LTIC 3EFGA 3V2QA 1L0NK 1KFMA 2WPQA 3CL3D 3HUSB 4B86A 2WT7B 4JYCA 2CPBA 1CZQA 3HE4B 2YO2A 5CCGD 3I5CA 1N7SB 1SFCA 2WWWA 3BATA 1FZEA 3O8ZA 2IPPA 1T8ZA 1JCDA 2J58A 1FJPA 1IC2A 2R5BA 3V2RA 3MGNA 1ZR4A 1GK6A 2MJZA 3NXSA 2Q3IA 1GL2D 3L35A 5KLVK 4GIFA 3B5NA 2P1JA 2Q5UA 2H43A 1N73B 2P2UA 2N1TA 1G1IA 5APWA 3NFQA 1M1JC 3KYQA 3B8EB 1X9VA 1HWTC 2WTYA 3E1IA 1URQC 1G1JA 1RE3C 1GW4A 1A02F 1ZV8A 3RL0D 2BASA 3C9IA 2A45G 1LWUB 2Z4EA 1JY2P 3CI9A 3U1CA 1FJKA 3RK3C 1GU5A 3N7NA 1WRGA 4WY4A 3M9BA 1J1EB 3L4FA 5AW8B 2Q7CA 1LT9C 1W2EA 2OARA 5APXA 1SFCD 3HRNA 2LKMA 1KILC 3RK2D 2OYHA 4I2LC 2O1KA 3M0DA 2P7JA 1KZUB 3OA7A 3MIWA 2P67A 1NO4A 2YKOA 1QL2A 3A3YB 3KQGA 1A02J 3BRTB 2W6AA 1VDFA 3NMDA 1IFJA 5APTA 2N1TD 1FZCB 2KSJA 2OYIA 3LIEA 3P7KA 3HUSC 1GW3A 4Y99B 3GHGA 2H8PD 1RF1A 1L4AB 1RY3A 1LTAC 5AW9B 3M06A 4JYBA 1N7SC 2NPSA 1E5WA 3KPEA 5AW6B 5AVSB 2PAJA 2QM8A 5APYA 3RK3D 4ZKUA 3LW5H 1GL2A 5CCHA 2R5DA 2FFDA 1IFIA 4I6MC 1LTJA 1ZR2A 1FZBA 4WBAA 1XTGB 1N73C 1OXZA 4XA4A 4I1LA 4O9BA 3HD7B 4N78E 1NU1K 1JTHB 1MUUA 5AVRB 5APVA 1FBMA 3H6PA 3IR9A 5AW7B 2XZRA 4WY4B 2L5GB 1J1DB 1SQXK 5KJ7C 1MFZA 5AVYB 3P8MC 3UIAA 1T2KC 1LWUC 5BU8B 2HPCA 2N9BA 3BVHA 4GKGA 2H7HA 2R3CA 2OYHB 1J2JB 1J1EC 4ZKPA 1FU1A 4WB4A 3M9QA 5AW1B 3A5TA 3TK1A 1NOHA 2NPSD 1H89A 2E43A 1CW5A 1LTBC 5BVZA 2PP6A 3TNUA 4DZOA 2JJLA 1CI6B 1S9KD 1NWQA 5CCHD 3WMM0 2IFMA 3H32A 1RE4C 1M1JA 3HTKA 4C46A 1GZLA 2C9LY 3P32A 1DX7A 2XKMA 1X8YA 1AQ5A 1HUCA 4W7ZA 1FZCC 1NTMK 1QL1A 1JY3N 1URQA 1RE3A 3N4XA 3OJAB 3V4WA 2HODA 4Y99C 4C7NB 1JNMA 1GDTA 1GL2B 1L4AC 5AW5B 1KFNA 1Z56A 4IFFA 3SWYA 2FFDB 2I1JA 2O1JA 3M9HA 3MTUE 1HGZA 4LGDE 3EQ2A 3U59A 4AQRD 2C0WA 1FZGA 1G2CA 4AYCA 2M3BA 3VP8A 1LT9A 2IFNA 2KB7P 2GM4A 4EIJA 3BRVB 3MD0A 1WT6A 3IFMA 3MUDA 1KILA 2Q9IA 2KLVA 1JCCA 2IX7C 2O01H 5BU5A 1GK4A 5APQA 3V5BA 3RL0B 3V2PA 1FZFA 3HD7C 2GUSA 1CSBA 3VTPC 2JEEA 4M3LA 4IFDK 1JOCA 3PP5A 3HUSA 1J1DC 1SFCB 1XTCC 2E42A 2KP8A 4KHXA 1HTLC 3RK2B 1FDMA 2WITA 3CLQA 1URQD 1N7SA 2HLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VN0 A;  2QM7 A;  2R5B A;  3MGN A;  5AVR B;  3TYY A;  1GK6 A;  2IPP A;  4RES B;  5APV A;  2WPS A;  1KQL A;  3IR9 A;  2Q3I A;  3NXS A;  2XZR A;  2YNY A;  5AW7 B;  3L35 A;  3VMY A;  1FOS E;  5AVQ B;  2Q5U A;  2C9N Y;  2P2U A;  1MFZ A;  5AVY B;  3P8M C;  3HE5 A;  3NTN A;  3UIA A;  1T2K C;  5APW A;  5AW2 B;  2N9B A;  2VRS A;  2W27 A;  3NFQ A;  2WT7 A;  5AW0 B;  4GKG A;  5AVT B;  2H7H A;  2R3C A;  4GT1 A;  1J2J B;  3HE4 A;  3SWF A;  1SP4 A;  5AVZ B;  3B8E B;  2WPR A;  3OAK A;  5AW1 B;  1HWT C;  2WTY A;  3KDP B;  3A5T A;  3TK1 A;  2E43 A;  1H89 A;  3TNU B;  2Z5H A;  5AW3 B;  1A02 F;  1NAF A;  2BAS A;  3A2A A;  3M0A A;  4LC1 A;  3TNU A;  4DZO A;  2JJL A;  2ZFC A;  1CI6 B;  1S9K D;  1G2C B;  1NWQ A;  1GU4 A;  2YO3 A;  1CI6 A;  3LID A;  1GU5 A;  1H8A A;  3M9B A;  3HTK A;  4C46 A;  1JUN A;  1GZL A;  5AW8 B;  2Q7C A;  2C9L Y;  3P32 A;  2XU6 A;  1X8Y A;  5APX A;  1HUC A;  1GD2 E;  2Z5I A;  1HJB A;  3L36 A;  3V4W A;  5APU A;  4I2L C;  3M0D A;  4C7N B;  1JNM A;  1DH3 A;  2P7J A;  2P67 A;  3VMZ A;  2R32 A;  5AW5 B;  3A3Y B;  3VYI A;  4C7N A;  3VMX A;  3KQG A;  1A02 J;  2W6A A;  3M9H A;  3NMD A;  1IO4 A;  5AW4 B;  2XV5 A;  5APT A;  4AQR D;  5AVX B;  3V4Q A;  4AYC A;  4XE5 B;  5AVU B;  4AUW A;  4EOT A;  3LIE A;  1GTW A;  3A7O A;  3MD0 A;  3P7K A;  1SLQ A;  5APS A;  1FOS F;  5CMZ A;  5AVV B;  1GK4 A;  3M91 A;  5APQ A;  5AW9 B;  3M06 A;  3V5B A;  5AVW B;  4JYB A;  3VTP C;  1CSB A;  3L37 A;  5AW6 B;  3T97 A;  5AVS B;  2QM8 A;  5APY A;  1YYC A;  3HE5 B;  4M3L A;  1FAV A;  4HYT B;  1T2K D;  2R5D A;  2WPQ A;  4B86 A;  2WT7 B;  1MV8 A;  4JYC A;  1CZQ A;  4I6M C;  1OWA A;  1S9K E;  3HE4 B;  2YO2 A;  2E42 A;  1OXZ A;  2KP8 A;  1H88 A;  3I5C A;  4KHX A;  2WWW A;  1HBW A;  3O8Z A;  1MUU A;  2ZXE B; 
#chains in the Genus database with same CATH topology
 1OVU A;  3B5N B;  1KQL A;  1NTK D;  5TIS E;  1L0L J;  3HTK B;  2P58 A;  1L0N D;  4H0L B;  1OW6 A;  5AVT B;  2Y0E A;  3B4S A;  2WPR A;  1KB9 E;  2YKQ A;  5K5G B;  3G4S P;  1AJY A;  3CC2 P;  2YIU B;  1GU4 A;  5H2F H;  1VQ5 P;  3TGU E;  2JP3 A;  1X79 B;  1M1K Q;  1SQQ J;  2ZT9 D;  3R2P A;  3RL0 C;  1IO4 A;  1T6A A;  1JY3 P;  5GTI E;  2QJY B;  2B87 A;  3L73 J;  3Q3D A;  2KZJ A;  1FZC A;  4EDF A;  5APS A;  2NPS B;  2QVA A;  3H1K E;  1SVF A;  2Q1K A;  1YYC A;  2E76 D;  1SQP G;  1YIJ P;  2WSF H;  1T3J A;  1SQP K;  4JF7 A;  3CCM P;  3G3Z A;  2FYU J;  1H88 A;  1ZLL A;  3C1L A;  1BCC D;  2IZ1 A;  5CHX A;  1Y8A A;  3HD7 A;  1KQS O;  3VN0 A;  2IBZ D;  3I56 P;  1P84 I;  3S9O A;  1KQF B;  1YTZ T;  1UII A;  3E1R A;  5AVQ B;  2C0X A;  3HE5 A;  2FYZ A;  3KZI E;  1YTZ I;  3II6 A;  3WUT A;  2BCC E;  5AW3 B;  3TF5 A;  2Q6Q A;  2Y9Y A;  1M1J B;  1L0L D;  3R4Y A;  3GLM A;  3I55 P;  3LID A;  1SQX D;  2BCC G;  1H8A A;  3CC4 P;  1JUN A;  2CPS A;  2IBZ G;  1KOR A;  3GG2 A;  3GHG C;  4PD4 D;  2D2C B;  2BEQ D;  4YPC A;  2HFE D;  2WSS H;  3VMZ A;  2KS1 B;  2BEZ F;  1QLE D;  2WVR A;  3S4R A;  4H44 B;  1IFD A;  3V2N A;  2XV5 A;  2QG4 A;  2FXO A;  4XE5 B;  5AVU B;  1LTG C;  1KIL B;  3P8C E;  1NU1 G;  1LTJ C;  1MKM A;  2W6B A;  1KV4 A;  2NZ2 A;  1SQQ D;  1L2P A;  3L37 A;  3WU2 E;  3HE5 B;  3EFG A;  1VQ9 P;  2CPB A;  1CZQ A;  3AE4 C;  2W83 C;  1U7M A;  5KLV E;  3FWL A;  3I5C A;  3CX5 E;  1YQ4 C;  2WWW A;  3MZW B;  4L75 A;  3O6Q A;  2IPP A;  5GTH E;  2J58 A;  1FJP A;  1IC2 A;  1BSH A;  1YBK A;  1GK6 A;  5KLV G;  3NXS A;  2AEM A;  3L35 A;  5KLV K;  3CCL P;  1N73 B;  2OTJ P;  3H1H D;  2Y9Z A;  1ZME C;  1YJ9 P;  3CPW O;  1X9V A;  3CWB J;  3E1I A;  2FYU E;  1G1J A;  4XFJ A;  1X22 A;  2BAS A;  2Z4E A;  1W5C E;  1S3J A;  1GU5 A;  4OGQ C;  1RQV A;  2G8Y A;  1J1E B;  2Q7C A;  4R4M A;  2OAR A;  3MUD C;  2WMM A;  3RK2 D;  1KZU B;  2P67 A;  1EZV G;  2I8D A;  2W6A A;  3NMD A;  2JO1 A;  3JCU H;  3P7K A;  3O6Q B;  4Y99 B;  3GHG A;  4H0L D;  3L72 G;  3G6E P;  1JMB A;  2QJP B;  3M06 A;  2E5Y A;  1N7S C;  1RHZ B;  1BDD A;  3KPE A;  2PAJ A;  2QM8 A;  2ZYG A;  1NTZ G;  2PRR A;  1LTJ A;  1SQB G;  1LP1 B;  2E75 C;  1OXZ A;  4O9B A;  1SS1 A;  4ASV A;  1KN7 A;  5KAF H;  1FBM A;  2QJK B;  2RKL A;  5B66 H;  2L5G B;  5KJ7 C;  2IDB A;  5BU8 B;  1NGM B;  2AEJ A;  2HPC A;  2WQY C;  2HR3 A;  2J5U A;  1NTM J;  4WB4 A;  3M9Q A;  5H2F E;  3CD6 P;  1NOH A;  2NPS D;  2QA4 P;  1CW5 A;  2ZAE B;  1LTB C;  2PP6 A;  4HKZ H;  2H89 C;  1KYO I;  3CMA P;  2IFM A;  3H32 A;  4KT0 J;  3OW2 O;  1Q81 Q;  1KYO H;  1SQV G;  1S5L H;  1DX7 A;  2V4H A;  4W7Z A;  3L74 E;  3AED C;  5KLI B;  1JY3 N;  4BXL A;  4C7N B;  4I7Z C;  1JNM A;  2K37 A;  4HJG H;  2KUB A;  3H1L G;  1L4A C;  1KFN A;  3L70 E;  4IFF A;  3L74 G;  2O1J A;  3M9H A;  2QE7 H;  1HGZ A;  4H13 C;  4L73 A;  2KB7 P;  2GM4 A;  2B89 A;  1PPJ E;  3SFE C;  2NRG A;  3IFM A;  3MUD A;  2W8Z A;  4DCK A;  2IX7 C;  2O01 H;  1U57 A;  3V2P A;  1HF9 A;  3C8V A;  4D6T J;  3K5B A;  2AEF A;  3H1I E;  1OVR A;  3A0H H;  2E42 A;  5TJH A;  3H1I G;  2YMK A;  1FDM A;  2WIT A;  3CLQ A;  1N7S A;  3QH9 A;  2HLO A;  2QM7 A;  4U3F D;  2D2C D;  3VMY A;  2N1T B;  3BCC G;  4H44 D;  2C9N Y;  3AEE C;  1HVV A;  5AW2 B;  1AFO A;  1NYH A;  1YJW P;  2I1K A;  1KIL D;  1LGH B;  4PD4 H;  4GT1 A;  2Q3E A;  1SP4 A;  5AVZ B;  2V7Q H;  1NKN A;  4YXW H;  5KJ7 A;  1EC5 A;  3AE8 C;  1EQ7 A;  1S72 P;  2FKW B;  3TGU J;  2WSC J;  1GD2 E;  4GOF A;  3AE3 C;  2Z5I A;  5KAI H;  1JM0 A;  1RF0 C;  1PGQ A;  1SQP J;  4IL6 H;  3Q2Y A;  4EOT A;  1DEE G;  1RF1 B;  1Y47 A;  3USS A;  3W68 A;  3H1K J;  3L75 E;  1PP9 E;  1SFC C;  3L71 E;  1EZV I;  1L4A A;  5AVW B;  4W7Y A;  3JSV C;  4HB1 A;  1S5L X;  1FAV A;  1IFM A;  3L75 G;  1T2K D;  1MV8 A;  3U1A A;  1NHL A;  1OWA A;  1S9K E;  1IFN A;  1JY3 O;  1JB0 J;  2WSE H;  1YJN P;  1AV1 A;  2QIW A;  1JTH A;  3TYY A;  3TSI A;  2WPS A;  4D6T D;  2YNY A;  4GOD A;  4WVZ A;  2LXB A;  1EDJ A;  2W27 A;  2BCC J;  1BE3 D;  3HE4 A;  3SWF A;  2KYV A;  3TNU B;  3A2A A;  1Q90 D;  3AE5 C;  5KKZ B;  1CI6 A;  3H1J D;  1JY2 O;  3CCE P;  1KB9 D;  2OYI C;  2FYN B;  1UIX A;  2HOD B;  3JCU E;  4H13 B;  5KTB A;  1Y9B A;  2W90 A;  1FDI A;  1TU3 F;  3VMX A;  1BDC A;  1LT9 B;  3LW5 J;  1GL2 C;  3V4Q A;  1EDL A;  4N6J A;  1NTK E;  3D71 A;  3VMA A;  1BGY D;  1L0N E;  1QGK B;  3MHV A;  1LTT C;  1VPC A;  4N3Y B;  1NTK G;  1NTK K;  1RF0 A;  2XDJ A;  3H1J G;  1L0N G;  4QMA A;  1LTI C;  5KLV J;  3V2Q A;  1L0N K;  1FE6 A;  3HE4 B;  4PV1 C;  5CCG D;  2KNC A;  1SFC A;  5B66 E;  3BAT A;  1SQP E;  2K9J A;  3O8Z A;  1T8Z A;  1JCD A;  1D7M A;  2MJZ A;  4IL6 X;  4UB6 H;  5DJU B;  2Q3I A;  1USE A;  2SPZ A;  3KXD A;  2Q5U A;  2P2U A;  2O3J A;  1G1I A;  5APW A;  3NFQ A;  1WMK A;  2WTY A;  1URQ C;  4RO0 A;  1GW4 A;  1KYO E;  1S5L E;  1M8O B;  2A45 G;  3AEG C;  1JY2 P;  3N7N A;  4Y28 J;  3L4F A;  1W2E A;  3CXH I;  3OA7 A;  3CXH H;  2YKO A;  2ZVN B;  3ZDM A;  2IBZ E;  3BRT B;  2B87 B;  2N1T D;  4R4L A;  1BCC G;  1FZC B;  2KSJ A;  2OYI A;  2LR2 A;  2K9J B;  3HUS C;  2JDI H;  3E7K A;  1RY3 A;  1LTA C;  1E5W A;  3A0H E;  2PGD A;  5AVS B;  4RJT A;  1NU1 E;  1GL2 A;  2KXP B;  2YXQ B;  1XTG B;  3A0B H;  3GMA A;  3FXE A;  1SQX E;  3HD7 B;  4N78 E;  1NU1 K;  4ZMD A;  2KLU A;  3AEC C;  1GMJ A;  1L0L G;  1SQX G;  4PD4 E;  1J1D B;  1OMI A;  1SQX K;  2E76 C;  3CX5 D;  4K35 A;  1LWU C;  3BVH A;  3L73 D;  3G9R A;  2H7H A;  3AE9 C;  1K8A Q;  4ZKP A;  3ABV C;  5AW1 B;  3A5T A;  4BWN A;  5CCH D;  3L74 J;  1GZL A;  2C9L Y;  4UB8 E;  2KZI A;  2FYU D;  1VQM P;  2XKM A;  1X8Y A;  2O01 N;  1SQQ G;  3L70 J;  1QL1 A;  1URQ A;  3CCR P;  3WUU A;  4IL6 E;  1GDT A;  1GL2 B;  1Z56 A;  1Q2N A;  1DD3 A;  1KD1 Q;  3U59 A;  4K3A A;  2WSF J;  1G2C A;  4AYC A;  3VP8 A;  2FXP A;  3BRV B;  1EZV E;  2KIK A;  2QSI A;  2OTK E;  3H1H E;  5BU5 A;  3H1I J;  5APQ A;  3RL0 B;  1FZF A;  2GUS A;  1CSB A;  3CCU P;  1ZRT D;  2JEE A;  3H1H G;  2A06 D;  4IFD K;  3L72 E;  1JOC A;  3BCC J;  3HUS A;  2B88 A;  1NAY A;  1XTC C;  2KP8 A;  5TIS H;  2W6J H;  1EDK A;  1NTZ E;  4HH2 A;  2FXM A;  4RES B;  1SQB E;  4H13 D;  1E79 H;  1VQ7 P;  4OH8 B;  1KB9 H;  1NTZ K;  2FBW C;  1X0T A;  1SQB K;  1AA0 A;  4LC1 A;  1K04 A;  4W80 A;  1G2C B;  1BSN A;  1FS0 E;  1LWU A;  3BAS A;  2XU6 A;  4ZNC A;  2E74 C;  1VF5 C;  2M8R A;  3QWO C;  3VYI A;  1SQV E;  2A45 H;  3L75 J;  1PP9 J;  3L71 J;  2PFX A;  3GHG B;  3H1L E;  3RGU A;  1SQV K;  1NH4 A;  1OVV A;  3L70 D;  3CWB D;  1MZ9 A;  3RK2 C;  1LJ2 A;  1S4X A;  3T97 A;  3IF4 A;  4YXD C;  3KHU A;  1PPJ D;  1LTJ B;  3B71 A;  3B5N C;  2IBZ I;  1S2E A;  2WPV B;  4RKU J;  1VQP P;  3G71 P;  1DD4 A;  1USD A;  4H0L C;  2M5A A;  3SFD C;  2KI7 B;  1QX8 A;  1FOS E;  2HPC B;  4DOJ A;  1OIP A;  3W67 A;  1P84 D;  3S1K A;  2YIU C;  2VRS A;  4WY4 C;  4DT0 A;  1JY2 N;  1RQU A;  3OAK A;  5EFW B;  3BCC E;  1NAF A;  2RH0 A;  2OYH C;  3M0D C;  2ZFC A;  3H32 B;  3VP9 A;  4PD4 I;  3CXH E;  1OFC X;  1AVO A;  2QJY C;  2GUV A;  4NPF X;  1HJB A;  3L36 A;  1RH5 B;  2R44 A;  2L91 A;  3HD7 D;  1HH0 A;  2IYO A;  1AQT A;  2Y0C A;  1HGV A;  3MP7 B;  1M7L A;  1DIP A;  5CJ4 A;  1NTK J;  2R32 A;  4OGQ B;  2NPS C;  2YKP A;  4U3F E;  5AW4 B;  1L0N J;  2ZYD A;  4C7R A;  4AUW A;  3RK3 E;  2POH A;  1PZQ A;  3WU2 H;  2YMY A;  1SLQ A;  2JWA A;  5CMZ A;  4U3F G;  2LXC B;  1PFI A;  2DW3 A;  2KK7 A;  1KIL E;  1NTM D;  1T3U A;  4TT3 H;  3CCV P;  2K1A A;  3A0B E;  4GOE A;  1EDI A;  3CX5 H;  4IFM A;  1KFM A;  4NPE A;  4JYC A;  3L71 D;  2YO2 A;  3EFF K;  1N7S B;  1IK7 A;  1ZR4 A;  3V2R A;  2XND H;  1GL2 D;  2E75 B;  2P1J A;  3B5N A;  2H43 A;  1M1J C;  1Q86 Q;  3EWK A;  3B8E B;  1HWT C;  1LT1 A;  3JC2 2;  1ZV8 A;  3RL0 D;  3H25 A;  3C9I A;  1IZN B;  2D2C C;  2RN0 A;  3CI9 A;  2OTL P;  3RK3 C;  1WRG A;  4WY4 A;  4H44 C;  3AEB C;  2E74 B;  1VF5 B;  5AW8 B;  5APX A;  2AXT H;  3HRN A;  1KIL C;  4PJ0 H;  2OYH A;  4I2L C;  3M0D A;  3MIW A;  1QL2 A;  3KQG A;  5B5E H;  1VDF A;  5APT A;  1LNQ A;  1PV3 A;  1ZOY C;  4I7Z B;  2H8P D;  1Q82 Q;  1L4A B;  1NU1 J;  4D6T G;  1BE3 E;  4JYB A;  2NPS A;  5AW6 B;  2ZYA A;  5APY A;  4BRY A;  1SQX J;  1BE3 G;  3TGU D;  1IFI A;  1ZR2 A;  4WBA A;  1N73 C;  4I1L A;  3H1J E;  1JTH B;  2QEX P;  1M57 D;  2YXR B;  2V7Q J;  5AW7 B;  4WY4 B;  1MFZ A;  5AVY B;  4JPZ B;  3UIA A;  1T2K C;  1SQP D;  5KAF E;  2N9B A;  2R3C A;  2OYH B;  3H1K D;  1J1E C;  1FU1 A;  1BGY E;  1OX3 A;  3FWN A;  5L8R J;  2JWD A;  3TK1 A;  1H89 A;  2E43 A;  3TGU G;  4DZO A;  1CI6 B;  3PLN A;  1VQ4 P;  1BGY G;  2R3S A;  1RE4 C;  1M1J A;  1FDO A;  1IFP A;  3P32 A;  1AQ5 A;  1KYO D;  4JBZ A;  4Y99 C;  5CBN A;  2QJP C;  5AW5 B;  4BRY B;  2KS1 A;  2I1J A;  3GF7 A;  4Z1M H;  3MTU E;  4AQR D;  3PTZ A;  2H88 C;  3H1H J;  2IFN A;  2JKV A;  3AE2 C;  3H1K G;  4EIJ A;  1ZP0 C;  1KIL A;  2BCC D;  2Q9I A;  1YI2 P;  4OWF A;  1JCC A;  4L74 A;  2WSE J;  1GK4 A;  3L72 J;  1K05 A;  1KMI Z;  1BCC E;  3VTP C;  2OGU A;  4M3L A;  1P84 H;  3AEA C;  2QJK C;  3PP5 A;  2ITA A;  1PGJ A;  2KNC B;  1NTZ J;  1SFC B;  1EXI A;  2KSE A;  4KHX A;  1SQB J;  1NU1 D;  5E79 H;  1LTS C;  2ZT9 C;  3FXD A;  4OGQ D;  3P8C D;  3NTN A;  4N78 D;  1M56 D;  5CJ0 A;  1N73 A;  5AW0 B;  1L0L E;  3IAO A;  5CCG C;  3KDP B;  3RK3 B;  5KLI C;  3M0A A;  4IOI H;  2ZVO B;  1L0L K;  5KLV D;  2IZ0 A;  1YQ3 C;  1KTM A;  1JO5 A;  3RL0 g;  1SQV J;  1N7S D;  1VQ6 P;  1DH3 A;  1N7L A;  1IK9 A;  1DEB A;  1JMM A;  1RE4 A;  1ZN5 A;  1SQQ E;  3H1L J;  2OYI B;  5AVX B;  2E75 D;  2K3R A;  1GTW A;  5KAI E;  1NVO A;  3Q5S A;  1FOS F;  1N2D C;  2HYN A;  4CPG A;  1SQQ K;  3L73 E;  1VQ8 P;  3VOP A;  4EI2 A;  5KJ7 D;  2KOG A;  2J59 M;  1N86 A;  5DJT B;  4HYT B;  3WUV A;  1EZV D;  1N8R Q;  3L73 G;  2Y0D A;  3CCQ P;  1S1C X;  2N1T C;  2P10 A;  2E74 D;  1LP1 A;  1VF5 D;  1HBW A;  2WZ7 A;  2ZXE B;  3Q5R A;  2UWJ E;  1PIX A;  3L72 D;  1JEK A;  1ZW0 A;  5CBO A;  2OYO A;  1VQK P;  2HG5 D;  2M3E A;  4PV1 B;  2FYU G;  2FYU K;  2WT7 A;  1NTZ D;  3Q5P A;  1NKZ B;  3D70 A;  1SQB D;  4A7P A;  2GA1 A;  1L4A D;  1PL5 A;  2Z5H A;  1IJD B;  1KB9 I;  2QRX A;  2AXT E;  3B5N D;  2YO3 A;  2ZXX A;  4LLH A;  3D6Y A;  3CME P;  4PJ0 E;  1ZRT E;  2A06 E;  2XNX A;  3TDK A;  5CCG A;  1URQ B;  5B5E E;  2E5T A;  1RF1 C;  1ZXG A;  5APU A;  2A06 G;  4U3F J;  4C7N A;  4JQ0 D;  1M90 Q;  4WY4 D;  4OVN F;  5CCH C;  2WSC H;  2RMZ A;  2FFD C;  3A7O A;  3PHL A;  5AVV B;  1FZA A;  4U7J A;  1SQV D;  3PRJ A;  5GTI H;  3M91 A;  1HJ0 A;  1MFT A;  2A45 I;  4NPD A;  4MN4 C;  2WPQ A;  3CL3 D;  3H1L D;  3HUS B;  4B86 A;  2MKV A;  2WT7 B;  3L74 D;  2OQQ A;  1FZE A;  2ZT9 B;  2R5B A;  3MGN A;  1YIT P;  1FC2 C;  1H0T A;  4GIF A;  4ASW A;  3CCJ P;  2IYP A;  2N1T A;  2K88 A;  5KKZ C;  3CCS P;  4UB6 E;  1U7J A;  3KYQ A;  1OW7 A;  3CC7 P;  1R8E A;  3H1I D;  3KZI H;  1RE3 C;  2FYN C;  1A02 F;  2E76 B;  4YTP C;  1R5S A;  1LWU B;  3CWB E;  3U1C A;  1FJK A;  3M9B A;  1QVG O;  3L70 G;  3BCC D;  1VQL P;  1LT9 C;  2N9Y B;  1SFC D;  3F89 A;  3CWB G;  2LKM A;  3AE1 C;  1R5L A;  2O1K A;  3SSU A;  1PPJ G;  2P7J A;  5C39 A;  1VQN P;  1NO4 A;  3A3Y B;  3RBX A;  3CXH D;  1A02 J;  1IFJ A;  3F5H A;  1VL2 A;  1BE3 J;  3LIE A;  2AXC A;  1GW3 A;  2M0B A;  1P84 E;  1RF1 A;  2G3A A;  5AW9 B;  3T97 B;  1H0T B;  3SWK A;  3RBZ A;  3RK3 D;  4ZKU A;  3LW5 H;  5CCH A;  2R5D A;  3H1J J;  2FFD A;  3Q1M A;  4I6M C;  3AE6 C;  1FZB A;  5E79 E;  4XA4 A;  2B9B A;  4WWI A;  3IN6 A;  1MUU A;  2M5A B;  1PGO A;  3CX5 I;  5AVR B;  5APV A;  3H6P A;  3IR9 A;  2XZR A;  1OW8 A;  3V6I A;  3P8M C;  5GTH H;  4DJG A;  3L75 D;  1PP9 D;  1BGY J;  4GKG A;  1J2J B;  1EXJ A;  1QEX A;  3AEF C;  4UB8 H;  3D6Z A;  5BVZ A;  3TNU A;  2JJL A;  1S9K D;  1NTM E;  1NWQ A;  1W2B O;  3WMM 0;  1OZH A;  1KQG B;  3HTK A;  1YHQ P;  4C46 A;  3FGA D;  2K9Y A;  1NTM G;  1HUC A;  1FZC C;  1NTM K;  1RE3 A;  1PGP A;  3N4X A;  3OJA B;  3V4W A;  2HOD A;  1Q7Y Q;  1K73 Q;  1NJI Q;  5M1B A;  1K9M Q;  3SWY A;  2FFD B;  3GW6 A;  1PP9 G;  4L76 A;  3L71 G;  4LGD E;  3EQ2 A;  2FY8 A;  3AE7 C;  2C0W A;  1FZG A;  2M3B A;  1LT9 A;  4PV1 D;  2CK3 H;  3MD0 A;  1WT6 A;  1BCC J;  2KLV A;  3GF3 A;  3ITK A;  1AVY A;  3V5B A;  4KJM A;  4GDO A;  2O01 J;  3HD7 C;  3PH0 A;  4TLF A;  2JR8 A;  1QVF O;  4EYY Q;  1VQO P;  4D6T E;  1KC8 Q;  1J1D C;  1HTL C;  3PJS K;  2ZJS E;  3RK2 B;  1URQ D;  3FX0 A; 
#chains in the Genus database with same CATH homology
 2QM7 A;  4HH2 A;  2FXM A;  4RES B;  3B5N B;  1LTS C;  1KQL A;  3VMY A;  4OH8 B;  2N1T B;  3HTK B;  3P8C D;  2C9N Y;  1HVV A;  3NTN A;  4N78 D;  1N73 A;  5CJ0 A;  5AW2 B;  1AFO A;  1NTZ K;  5AW0 B;  2I1K A;  5AVT B;  1KIL D;  1LGH B;  1SQB K;  4GT1 A;  1SP4 A;  5CCG C;  5AVZ B;  2WPR A;  2YKQ A;  1NKN A;  3KDP B;  3RK3 B;  3M0A A;  5KJ7 A;  4LC1 A;  4W80 A;  1G2C B;  1L0L K;  1EQ7 A;  1GU4 A;  2FKW B;  1LWU A;  3BAS A;  1JO5 A;  2XU6 A;  1GD2 E;  2Z5I A;  1N7S D;  1X79 B;  2M8R A;  3R2P A;  1DH3 A;  1N7L A;  1IK9 A;  3VYI A;  1RF0 C;  3RL0 C;  1IO4 A;  1DEB A;  1JMM A;  1RE4 A;  1ZN5 A;  2A45 H;  1JY3 P;  2OYI B;  5AVX B;  4EOT A;  1GTW A;  3GHG B;  1RF1 B;  1FZC A;  5APS A;  1FOS F;  1SQV K;  1NH4 A;  1N2D C;  2HYN A;  2NPS B;  1SFC C;  1SQQ K;  1L4A A;  5AVW B;  3VOP A;  4W7Y A;  1MZ9 A;  3RK2 C;  3T97 A;  5KJ7 D;  1SVF A;  2KOG A;  1YYC A;  1FAV A;  2J59 M;  1N86 A;  1IFM A;  4HYT B;  2WSF H;  1T3J A;  1T2K D;  1LTJ B;  1SQP K;  4JF7 A;  1MV8 A;  3U1A A;  1NHL A;  3B5N C;  1OWA A;  1S9K E;  3G3Z A;  2N1T C;  1IFN A;  1JY3 O;  1H88 A;  1ZLL A;  2WSE H;  1HBW A;  5CHX A;  2WZ7 A;  3HD7 A;  2ZXE B;  3VN0 A;  1JTH A;  3TYY A;  3TSI A;  2WPS A;  1YTZ T;  2YNY A;  1FOS E;  5AVQ B;  2C0X A;  2HG5 D;  2HPC B;  4DOJ A;  3HE5 A;  2FYZ A;  2FYU K;  1YTZ I;  2VRS A;  2W27 A;  2WT7 A;  4WY4 C;  3II6 A;  1JY2 N;  1NKZ B;  3HE4 A;  3SWF A;  2KYV A;  3OAK A;  1L4A D;  3TNU B;  2Z5H A;  5AW3 B;  1NAF A;  2OYH C;  1IJD B;  3A2A A;  3M0D C;  2ZFC A;  3B5N D;  3H32 B;  2YO3 A;  4LLH A;  1M1J B;  1CI6 A;  3LID A;  3VP9 A;  1H8A A;  2XNX A;  1JY2 O;  1JUN A;  2CPS A;  5CCG A;  2OYI C;  1URQ B;  2GUV A;  1HJB A;  2HOD B;  3L36 A;  3GHG C;  3HD7 D;  1HH0 A;  1RF1 C;  5APU A;  5KTB A;  2HFE D;  1HGV A;  3VMZ A;  1M7L A;  5CJ4 A;  2R32 A;  4C7N A;  2NPS C;  3VMX A;  2YKP A;  1IFD A;  3V2N A;  1LT9 B;  5AW4 B;  2XV5 A;  1GL2 C;  4WY4 D;  3V4Q A;  4C7R A;  5CCH C;  4N6J A;  4XE5 B;  5AVU B;  4AUW A;  1LTG C;  1KIL B;  2POH A;  2WSC H;  2FFD C;  3A7O A;  3P8C E;  1LTJ C;  2YMY A;  1SLQ A;  2W6B A;  5CMZ A;  5AVV B;  1FZA A;  1LTT C;  3M91 A;  1VPC A;  1PFI A;  4N3Y B;  1T3U A;  2A45 I;  1NTK K;  1RF0 A;  2XDJ A;  3L37 A;  3HE5 B;  4IFM A;  1LTI C;  3EFG A;  3V2Q A;  1L0N K;  1KFM A;  2WPQ A;  3CL3 D;  3HUS B;  4B86 A;  2WT7 B;  4JYC A;  2CPB A;  1CZQ A;  3HE4 B;  2YO2 A;  5CCG D;  3I5C A;  1N7S B;  1SFC A;  2WWW A;  3BAT A;  1FZE A;  3O8Z A;  2IPP A;  1T8Z A;  1JCD A;  2J58 A;  1FJP A;  1IC2 A;  2R5B A;  3V2R A;  3MGN A;  1ZR4 A;  1GK6 A;  2MJZ A;  3NXS A;  2Q3I A;  1GL2 D;  3L35 A;  5KLV K;  4GIF A;  3B5N A;  2P1J A;  2Q5U A;  2H43 A;  1N73 B;  2P2U A;  2N1T A;  1G1I A;  5APW A;  3NFQ A;  1M1J C;  3KYQ A;  3B8E B;  1X9V A;  1HWT C;  2WTY A;  3E1I A;  1URQ C;  1G1J A;  1RE3 C;  1GW4 A;  1A02 F;  1ZV8 A;  3RL0 D;  2BAS A;  3C9I A;  2A45 G;  1LWU B;  2Z4E A;  1JY2 P;  3CI9 A;  3U1C A;  1FJK A;  3RK3 C;  1GU5 A;  3N7N A;  1WRG A;  4WY4 A;  3M9B A;  1J1E B;  3L4F A;  5AW8 B;  2Q7C A;  1LT9 C;  1W2E A;  2OAR A;  5APX A;  1SFC D;  3HRN A;  2LKM A;  1KIL C;  3RK2 D;  2OYH A;  4I2L C;  2O1K A;  3M0D A;  2P7J A;  1KZU B;  3OA7 A;  3MIW A;  2P67 A;  1NO4 A;  2YKO A;  1QL2 A;  3A3Y B;  3KQG A;  1A02 J;  3BRT B;  2W6A A;  1VDF A;  3NMD A;  1IFJ A;  5APT A;  2N1T D;  1FZC B;  2KSJ A;  2OYI A;  3LIE A;  3P7K A;  3HUS C;  1GW3 A;  4Y99 B;  3GHG A;  2H8P D;  1RF1 A;  1L4A B;  1RY3 A;  1LTA C;  5AW9 B;  3M06 A;  4JYB A;  1N7S C;  2NPS A;  1E5W A;  3KPE A;  5AW6 B;  5AVS B;  2PAJ A;  2QM8 A;  5APY A;  3RK3 D;  4ZKU A;  3LW5 H;  1GL2 A;  5CCH A;  2R5D A;  2FFD A;  1IFI A;  4I6M C;  1LTJ A;  1ZR2 A;  1FZB A;  4WBA A;  1XTG B;  1N73 C;  1OXZ A;  4XA4 A;  4I1L A;  4O9B A;  3HD7 B;  4N78 E;  1NU1 K;  1JTH B;  1MUU A;  5AVR B;  5APV A;  1FBM A;  3H6P A;  3IR9 A;  5AW7 B;  2XZR A;  4WY4 B;  2L5G B;  1J1D B;  1SQX K;  5KJ7 C;  1MFZ A;  5AVY B;  3P8M C;  3UIA A;  1T2K C;  1LWU C;  5BU8 B;  2HPC A;  2N9B A;  3BVH A;  4GKG A;  2H7H A;  2R3C A;  2OYH B;  1J2J B;  1J1E C;  4ZKP A;  1FU1 A;  4WB4 A;  3M9Q A;  5AW1 B;  3A5T A;  3TK1 A;  1NOH A;  2NPS D;  1H89 A;  2E43 A;  1CW5 A;  1LTB C;  5BVZ A;  2PP6 A;  3TNU A;  4DZO A;  2JJL A;  1CI6 B;  1S9K D;  1NWQ A;  5CCH D;  3WMM 0;  2IFM A;  3H32 A;  1RE4 C;  1M1J A;  3HTK A;  4C46 A;  1GZL A;  2C9L Y;  3P32 A;  1DX7 A;  2XKM A;  1X8Y A;  1AQ5 A;  1HUC A;  4W7Z A;  1FZC C;  1NTM K;  1QL1 A;  1JY3 N;  1URQ A;  1RE3 A;  3N4X A;  3OJA B;  3V4W A;  2HOD A;  4Y99 C;  4C7N B;  1JNM A;  1GDT A;  1GL2 B;  1L4A C;  5AW5 B;  1KFN A;  1Z56 A;  4IFF A;  3SWY A;  2FFD B;  2I1J A;  2O1J A;  3M9H A;  3MTU E;  1HGZ A;  4LGD E;  3EQ2 A;  3U59 A;  4AQR D;  2C0W A;  1FZG A;  1G2C A;  4AYC A;  2M3B A;  3VP8 A;  1LT9 A;  2IFN A;  2KB7 P;  2GM4 A;  4EIJ A;  3BRV B;  3MD0 A;  1WT6 A;  3IFM A;  3MUD A;  1KIL A;  2Q9I A;  2KLV A;  1JCC A;  2IX7 C;  2O01 H;  5BU5 A;  1GK4 A;  5APQ A;  3V5B A;  3RL0 B;  3V2P A;  1FZF A;  3HD7 C;  2GUS A;  1CSB A;  3VTP C;  2JEE A;  4M3L A;  4IFD K;  1JOC A;  3PP5 A;  3HUS A;  1J1D C;  1SFC B;  1XTC C;  2E42 A;  2KP8 A;  4KHX A;  1HTL C;  3RK2 B;  1FDM A;  2WIT A;  3CLQ A;  1URQ D;  1N7S A;  2HLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...