2N9GA

Solution structure of the bromodomain of trypanosoma brucei bromodomain factor 2(bdf2)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
111
structure length
111
Chain Sequence
MSKNERDTSFNKNGCLVFVSRLWDLDKLGMFHHPVSAEELPDYHTVIKRPVDLSSIRDGIEKGTYATDVDVQNDVARMITNALEYNAKGSTWYQEAMSFRKTYLDLARQSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Putative uncharacterized protein
publication title Solution structure of the bromodomain of Trypanosoma brucei Bromodomain Factor 2(BDF2)
rcsb
source organism Trypanosoma brucei brucei treu927
total genus 26
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2015-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2n9gA00
3DWYA 5CU8A 4HXMA 5FFWA 5LVQA 5E9IA 4HBVA 4YH3A 4IOOA 4LRGA 3U5KA 3IU6A 5EK9A 5E3GA 5A81A 5AD2A 2L5EA 5FBXA 2G4AA 4HXNA 4HBXA 4QR4A 4MR5A 4NUEA 4TT2A 5E73A 2YYNA 5D3PA 4AKNA 5L99A 4WIVA 2DVVA 5CUBA 5COIA 2YDWA 5FE8A 2WP2A 4O7FA 5EISA 4CUUA 3U5PA 5JWMA 5FE1A 5CRZA 5KTXA 4QSUA 4N4FA 4FLPA 5IIDA 4CUSA 5DFDA 4TT6A 5IGKA 3O37A 4Z93A 4HXKA 4KCXA 4CUTA 3NXBA 2I8NA 4QZSA 4QSPA 4QC1A 4NUDA 5D3LA 5FE0A 5CGPA 3Q2EA 4QNSA 4QB3A 5F25A 1JM4B 4O77A 4PCEA 4MR3A 3FKMX 4YY4A 4NR7A 4Z1SA 5F63A 4TU4A 4OUFA 3UVWA 5A83A 2F6JA 5G4SA 4BW3A 4CL9A 5L98A 4YATA 4MENA 3JVKA 5C7NA 5EI4A 4IR6A 4YH4A 5A85A 4NR8A 4KV4A 4YY6A 5I29A 5JI8A 4QY4A 4YK0A 4BJXA 5HQ6A 4MEPA 4UYHA 4HXLA 4YYKA 5HCLA 2DWWA 4ZC9A 3AQAA 5J0DA 5I80A 4TTEA 5E9KA 4TS8A 5FH6A 3MXFA 5CPEA 4QSRA 4LYSA 4QUUA 5C8GA 5ENIA 3LQIA 5ENHA 4NR4A 5EWVA 5D3JA 4J1PA 5I7YA 5ACYA 4A9MA 2RFJA 2YQDA 5HFQA 4QSTA 5EPBA 5CUAA 4UYFA 4BW1A 4IR4A 5KTUA 3GG3A 4YBTA 4QC3A 4NUCA 4UIVA 5HENA 5C87A 2RNYA 5FE5A 4IR5A 2NXBA 2E7OA 4NQMA 4O7EA 4ALGA 4E96A 5DFCA 3JVJA 4A9EA 3P1EA 5CTLA 4QEVA 5EGUA 5FFYA 3JVMA 4XYAA 2RI7A 5HJCA 5I86A 5E9MA 4YBMA 5IG6A 1WUMA 5ETDA 4WHUA 1F68A 5ENCA 5ENGA 5ENBA 4PKLA 4PCIA 2RNWA 5F5ZA 4C67A 4A9IA 4J0SA 2DVRA 5D25A 5EICA 2D9EA 2E7NA 5FG4A 5LUUA 3HMFA 5LJ2A 3P1DA 5I1QA 5DX4A 5A5NA 5LKZA 2L85A 5EVAA 4ZW1A 4UIXA 5CUEA 5L96A 5DKDA 4QSSA 3D7CA 5EQ1A 4KV1A 5H1TA 3IU5A 5EV9A 3JVLA 4LYIA 1WUGA 2OSSA 4TQNA 4IORA 5CQTA 5C4QA 5C85A 5F2PA 5CQ4A 4LZSA 2YEKA 2MJVB 4NXJA 3SVGA 3LXJA 5EA1A 2LSPB 4DONA 3P1CA 4WHWA 5FE3A 4YYDA 5DYUA 4LR6A 4UIWA 4A9HA 5EM3A 5L97A 4UYFB 3U5LA 4ALHA 4LZ2A 4QYDA 4TZ2A 5EPRA 5HRWA 4O7AA 3MQMA 4QEUA 3AADA 5FE9A 5IGMA 5KO4A 4YYJA 5EP7A 2WP1A 1ZS5A 5A7CA 5CY9A 5D0CA 2FSAA 5EPSA 5D24A 5E3DA 3UW9A 3S91A 2OUOA 4N4HA 3O35A 4F3IA 4HBYA 3TLPA 5TB6A 3U5NA 2N9GA 1JSPB 5DLZA 4Q0NA 4N3WA 5HELA 5I40A 5F1LA 5FE2A 5II1A 4NS5A 4YAXA 5LJ0A 3UVYA 4Y03A 4N4IA 4A9LA 2YELA 4NYWA 4TU6A 3U5JA 4YBSA 5H1VA 3DAIA 5CP5A 4NYXA 4O70A 3QZSA 4J3IA 4QSVA 5DW1A 5D26A 4Z6IA 4LYWA 4NRAA 2R0VA 1E6IA 4UIUA 1N72A 5HM0A 4YYMA 2GRCA 4O76A 5DW2A 5CUGA 5DYAA 2DVSA 5H1UA 3UVDA 5FH8A 3G0LA 4YYIA 5L8UA 4UIZA 1EQFA 4CFLA 5A5OA 4O78A 5KHMA 4Z1QA 4YADA 4QR3A 4UITA 5CS8A 5I88A 4HXPA 2F6NA 4O75A 3MUKA 5CRMA 4N4GA 3UVXA 5E9YA 4BW2A 5F36A 4LDFA 4UYDA 5ENEA 5F61A 3ONIA 5ENJA 4NR5A 4XUAA 5A82A 3MB3A 2RNXA 5A5PA 3SVFA 5CQ8A 5CFWA 5BT3A 4BHWA 2DATA 5FB1A 4QUTA 5F60A 5FDZA 3UV2A 4A9OA 2E3KA 4QSQA 5L8TA 5FH7A 4O71A 3G0JA 4A9JA 4YABA 2R0YA 2RS9B 4OGJA 5F3AA 4ZQLA 2YEMA 4YYGA 5CUDA 5CQ7A 5DYXA 5HEMA 5E7DA 5HQ5A 5DLXA 2R10A 5FFVA 5F62A 4PY6A 3UV4A 4MEQA 4C66A 5AD3A 5CQ6A 5TCMA 4CUPA 4NRBA 5K29A 4LC2A 4LZRA 4TZ8A 4YC9A 5E9VA 5G4RA 5CUCA 4RVRA 3O34A 5BT4A 5DKCA 5E9LA 5KU3A 4Z6HA 5LJ1A 5FE6A 4MEOA 5LKXA 4XUBA 5FG5A 5ETBA 5LKTA 4O72A 4MR4A 5I83A 4CUQA 3QZVA 5DBMA 5II2A 3S92A 4CLBA 3I3JA 5LVRA 5IBNA 5DY7A 3P1FA 4TT4A 5EWCA 1X0JA 2YW5A 4O74A 5I7XA 5F1HA 4XY9A 4QR5A 5D3HA 4PTBA 5D3TA 5FE4A 2R0SA 2I7KA 5A5RA 4O7CA 5AMFA 3O36A 3LQHA 3LQJA 5I89A 4A9FA 3MB4A 5KTWA 3SVHA 3K2JA 4Q0OA 4MR6A 3Q2FA 4QYLA 5CQ3A 3ZYUA 4HXRA 2RO1A 5EWHA 5HRXA 4BW4A 4O7BA 4UIYA 4NYVA 5C89A 5D3SA 5E0RA 4YYHA 4PS5A 2OO1A 3HMEA 5E74A 5DYCA 5EWDA 5AMEA 4OGIA 5ENFA 5CQAA 4QSXA 5HLSA 4HXSA 3RCWA 5EWWA 4NR6A 5CZGA 5D7XA 5IGLA 5FB0A 2L84A 5D3RA 5EU1A 5IGNA 5DFBA 4QBMA 4NQNA 4GPJA 4TYLA 4QEWA 5CQ5A 5FG6A 3O33A 3QZTA 5BT5A 4XY8A 3LJWA 5A5SA 4IOQA 3UV5A 4NR9A 2H60A 3MULA 4NRCA 4CURA 2KTBB 4HBWA 4IR3A 4QSWA 3HMHA 3U5OA 3U5MA 5DKHA 4YYNA 4J0RA 4UYEA 2DKWA 4A9NA 4A9KA 5D3NA 5H85A 5A5QA 5HRVA 4HXOA 5HQ7A 4CFKA 2DVQA 4X2IA 5LKUA 3P5OA 5HFRA 4UYGA 2D82A 5FE7A
chains in the Genus database with same CATH superfamily
3DWYA 5CU8A 4HXMA 5FFWA 5LVQA 5E9IA 4HBVA 4YH3A 4IOOA 4LRGA 3U5KA 3IU6A 5EK9A 5E3GA 5A81A 5AD2A 2L5EA 5FBXA 2G4AA 4HXNA 4HBXA 4QR4A 4MR5A 4NUEA 4TT2A 5E73A 2YYNA 5D3PA 4AKNA 5L99A 4WIVA 2DVVA 5CUBA 5COIA 2YDWA 5FE8A 2WP2A 4O7FA 5EISA 4CUUA 3U5PA 5JWMA 5FE1A 5CRZA 5KTXA 4QSUA 4N4FA 4FLPA 5IIDA 4CUSA 5DFDA 4TT6A 5IGKA 4AKGA 3O37A 4Z93A 4HXKA 4KCXA 4CUTA 3NXBA 2I8NA 4QZSA 4QSPA 4QC1A 4NUDA 5D3LA 5FE0A 5CGPA 3Q2EA 4QNSA 4QB3A 5F25A 1JM4B 4O77A 4PCEA 4MR3A 3FKMX 4YY4A 4NR7A 4Z1SA 5F63A 4TU4A 4OUFA 3UVWA 5A83A 2F6JA 5G4SA 4BW3A 4CL9A 5L98A 4YATA 4MENA 3JVKA 5C7NA 5EI4A 4IR6A 4YH4A 5A85A 4NR8A 4KV4A 4YY6A 4AKIA 5I29A 5JI8A 4QY4A 4YK0A 4BJXA 5HQ6A 4MEPA 4UYHA 4HXLA 4YYKA 5HCLA 2DWWA 4ZC9A 3AQAA 5J0DA 5I80A 4TTEA 5E9KA 4TS8A 5FH6A 3MXFA 5CPEA 4QSRA 4LYSA 4QUUA 5C8GA 5ENIA 3LQIA 5ENHA 4NR4A 5EWVA 5D3JA 4J1PA 5I7YA 5ACYA 4A9MA 2EJNA 2RFJA 2YQDA 5HFQA 4QSTA 5EPBA 5CUAA 4UYFA 4BW1A 4IR4A 5KTUA 3GG3A 4YBTA 4QC3A 4NUCA 4UIVA 5HENA 5C87A 2RNYA 5FE5A 4IR5A 2NXBA 2E7OA 4NQMA 4O7EA 4ALGA 4E96A 5DFCA 3JVJA 4A9EA 3P1EA 5CTLA 4QEVA 5EGUA 5FFYA 3D1DA 3JVMA 4XYAA 2RI7A 5HJCA 5I86A 5E9MA 4YBMA 5IG6A 1WUMA 5ETDA 4WHUA 1F68A 5ENCA 5ENGA 5ENBA 4PKLA 4PCIA 2RNWA 5F5ZA 4C67A 4A9IA 4J0SA 2DVRA 5D25A 5EICA 2D9EA 2E7NA 5FG4A 5LUUA 3HMFA 5LJ2A 3P1DA 5I1QA 5DX4A 5A5NA 5LKZA 2L85A 5EVAA 4ZW1A 4UIXA 5CUEA 5L96A 5DKDA 4QSSA 3D7CA 5EQ1A 4KV1A 5H1TA 3IU5A 5EV9A 3JVLA 4LYIA 1WUGA 2OSSA 4TQNA 4IORA 5CQTA 5C4QA 3ERRA 5C85A 5F2PA 5CQ4A 4LZSA 2YEKA 2MJVB 4NXJA 1ZKRA 3SVGA 3LXJA 5EA1A 4AKHA 2LSPB 4DONA 3P1CA 4WHWA 5FE3A 4YYDA 5DYUA 4LR6A 4UIWA 4A9HA 5EM3A 5L97A 4UYFB 3U5LA 4ALHA 4LZ2A 4QYDA 4TZ2A 5EPRA 5HRWA 4O7AA 3MQMA 4QEUA 3AADA 5FE9A 5IGMA 5KO4A 4YYJA 5EP7A 2WP1A 1ZS5A 5A7CA 5CY9A 5D0CA 2FSAA 5EPSA 5D24A 5E3DA 3UW9A 3S91A 2OUOA 4N4HA 3O35A 4F3IA 4HBYA 3TLPA 5TB6A 3U5NA 2N9GA 1JSPB 5DLZA 4Q0NA 4N3WA 5HELA 5I40A 5F1LA 5FE2A 5II1A 4NS5A 4YAXA 5LJ0A 3UVYA 4Y03A 4N4IA 4A9LA 2YELA 4NYWA 4TU6A 3U5JA 4YBSA 5H1VA 3DAIA 5CP5A 4NYXA 4O70A 3QZSA 4J3IA 4QSVA 5DW1A 5D26A 4Z6IA 4LYWA 4NRAA 2R0VA 1E6IA 4UIUA 1N72A 5HM0A 4YYMA 2GRCA 4O76A 5DW2A 5CUGA 5DYAA 2DVSA 5H1UA 3UVDA 5FH8A 3G0LA 4YYIA 5L8UA 4UIZA 1EQFA 4CFLA 5A5OA 4O78A 5KHMA 4Z1QA 4YADA 4QR3A 4UITA 5CS8A 5I88A 4HXPA 2F6NA 4O75A 3MUKA 5CRMA 4N4GA 3UVXA 5E9YA 4BW2A 5F36A 4LDFA 4UYDA 5ENEA 5F61A 3ONIA 5ENJA 4NR5A 4XUAA 5A82A 3MB3A 2RNXA 5A5PA 3SVFA 5CQ8A 5CFWA 5BT3A 4BHWA 2DATA 5FB1A 4QUTA 5F60A 5FDZA 3UV2A 4A9OA 2E3KA 4QSQA 5L8TA 5FH7A 3D1BA 4O71A 3G0JA 4A9JA 4YABA 2R0YA 2RS9B 4OGJA 5F3AA 4ZQLA 2YEMA 4YYGA 5CUDA 5CQ7A 5DYXA 5HEMA 5E7DA 5HQ5A 5DLXA 2R10A 5FFVA 5F62A 4PY6A 3UV4A 1PUOA 4MEQA 4C66A 5AD3A 5CQ6A 5TCMA 4CUPA 4NRBA 5K29A 4LC2A 4LZRA 4TZ8A 4YC9A 5E9VA 5G4RA 5CUCA 4RVRA 3O34A 5BT4A 5DKCA 5E9LA 5KU3A 4Z6HA 5LJ1A 5FE6A 4MEOA 5LKXA 4XUBA 5FG5A 5ETBA 5LKTA 4O72A 4MR4A 5I83A 4AI6A 4CUQA 3QZVA 5DBMA 5II2A 3S92A 4CLBA 3I3JA 5LVRA 5IBNA 5DY7A 3P1FA 4TT4A 5EWCA 1X0JA 2YW5A 4O74A 5I7XA 3VKGA 5F1HA 4XY9A 4QR5A 5D3HA 4PTBA 5D3TA 5FE4A 2R0SA 2I7KA 5A5RA 4O7CA 5AMFA 3O36A 3LQHA 3LQJA 5I89A 4A9FA 3MB4A 5KTWA 3SVHA 3K2JA 4Q0OA 4MR6A 3Q2FA 4QYLA 5CQ3A 3ZYUA 4HXRA 2RO1A 5EWHA 5HRXA 4BW4A 4O7BA 4UIYA 4NYVA 5C89A 5D3SA 5E0RA 4YYHA 4PS5A 2OO1A 3HMEA 5E74A 5DYCA 5EWDA 5AMEA 4OGIA 5ENFA 5CQAA 4QSXA 5HLSA 4HXSA 3RCWA 5EWWA 4NR6A 5CZGA 5D7XA 5IGLA 5FB0A 2L84A 5D3RA 5EU1A 5IGNA 5DFBA 4QBMA 4NQNA 4GPJA 4TYLA 4QEWA 5CQ5A 5FG6A 3O33A 3QZTA 3VKHA 5BT5A 4XY8A 3LJWA 5A5SA 4IOQA 3UV5A 4NR9A 2H60A 3MULA 4NRCA 4CURA 2KTBB 4HBWA 4IR3A 4QSWA 3HMHA 3U5OA 3U5MA 5DKHA 4YYNA 4J0RA 4UYEA 2DKWA 4A9NA 4A9KA 5D3NA 5H85A 5A5QA 5HRVA 4HXOA 5HQ7A 4CFKA 2DVQA 4X2IA 5LKUA 3P5OA 5HFRA 4UYGA 2D82A 5FE7A
chains in the Genus database with same CATH topology
3DWYA 5CU8A 4HXMA 5FFWA 5LVQA 5E9IA 4HBVA 4YH3A 4IOOA 4LRGA 3U5KA 3IU6A 5EK9A 5E3GA 5A81A 5AD2A 2L5EA 5FBXA 2G4AA 4HXNA 4HBXA 4QR4A 4MR5A 4NUEA 4TT2A 5E73A 2YYNA 5D3PA 4AKNA 5L99A 4WIVA 2DVVA 5CUBA 5COIA 2YDWA 5FE8A 2WP2A 4O7FA 5EISA 4CUUA 3U5PA 5JWMA 5FE1A 5CRZA 5KTXA 4QSUA 4N4FA 4FLPA 5IIDA 4CUSA 5DFDA 4TT6A 5IGKA 3O37A 4Z93A 4HXKA 4KCXA 4CUTA 3NXBA 2I8NA 4QZSA 4QSPA 4QC1A 4NUDA 5D3LA 5FE0A 5CGPA 3Q2EA 4QNSA 4QB3A 5F25A 1JM4B 4O77A 4PCEA 4MR3A 3FKMX 4YY4A 4NR7A 4Z1SA 5F63A 4TU4A 4OUFA 3UVWA 5A83A 2F6JA 5G4SA 4BW3A 4CL9A 5L98A 4YATA 4MENA 3JVKA 5C7NA 5EI4A 4IR6A 4YH4A 5A85A 4NR8A 4KV4A 4YY6A 5I29A 5JI8A 4QY4A 4YK0A 4BJXA 5HQ6A 4MEPA 4UYHA 4HXLA 4YYKA 5HCLA 2DWWA 4ZC9A 3AQAA 5J0DA 5I80A 4TTEA 5E9KA 4TS8A 5FH6A 3MXFA 5CPEA 4QSRA 4LYSA 4QUUA 5C8GA 5ENIA 3LQIA 5ENHA 4NR4A 5EWVA 5D3JA 4J1PA 5I7YA 5ACYA 4A9MA 2RFJA 2YQDA 5HFQA 4QSTA 5EPBA 5CUAA 4UYFA 4BW1A 4IR4A 5KTUA 3GG3A 4YBTA 4QC3A 4NUCA 4UIVA 5HENA 5C87A 2RNYA 5FE5A 4IR5A 2NXBA 2E7OA 4NQMA 4O7EA 4ALGA 4E96A 5DFCA 3JVJA 4A9EA 3P1EA 5CTLA 4QEVA 5EGUA 5FFYA 3JVMA 4XYAA 2RI7A 5HJCA 5I86A 5E9MA 4YBMA 5IG6A 1WUMA 5ETDA 4WHUA 1F68A 5ENCA 5ENGA 5ENBA 4PKLA 4PCIA 2RNWA 5F5ZA 4C67A 4A9IA 4J0SA 2DVRA 5D25A 5EICA 2D9EA 2E7NA 5FG4A 5LUUA 3HMFA 5LJ2A 3P1DA 5I1QA 5DX4A 5A5NA 5LKZA 2L85A 5EVAA 4ZW1A 4UIXA 5CUEA 5L96A 5DKDA 4QSSA 3D7CA 5EQ1A 4KV1A 5H1TA 3IU5A 5EV9A 3JVLA 4LYIA 1WUGA 2OSSA 4TQNA 4IORA 5CQTA 5C4QA 5C85A 5F2PA 5CQ4A 4LZSA 2YEKA 2MJVB 4NXJA 3SVGA 3LXJA 5EA1A 2LSPB 4DONA 3P1CA 4WHWA 5FE3A 4YYDA 5DYUA 4LR6A 4UIWA 4A9HA 5EM3A 5L97A 4UYFB 3U5LA 4ALHA 4LZ2A 4QYDA 4TZ2A 5EPRA 5HRWA 4O7AA 3MQMA 4QEUA 3AADA 5FE9A 5IGMA 5KO4A 4YYJA 5EP7A 2WP1A 1ZS5A 5A7CA 5CY9A 5D0CA 2FSAA 5EPSA 5D24A 5E3DA 3UW9A 3S91A 2OUOA 4N4HA 3O35A 4F3IA 4HBYA 3TLPA 5TB6A 3U5NA 2N9GA 1JSPB 5DLZA 4Q0NA 4N3WA 5HELA 5I40A 5F1LA 5FE2A 5II1A 4NS5A 4YAXA 5LJ0A 3UVYA 4Y03A 4N4IA 4A9LA 2YELA 4NYWA 4TU6A 3U5JA 4YBSA 5H1VA 3DAIA 5CP5A 4NYXA 4O70A 3QZSA 4J3IA 4QSVA 5DW1A 5D26A 4Z6IA 4LYWA 4NRAA 2R0VA 1E6IA 4UIUA 1N72A 5HM0A 4YYMA 2GRCA 4O76A 5DW2A 5CUGA 5DYAA 2DVSA 5H1UA 3UVDA 5FH8A 3G0LA 4YYIA 5L8UA 4UIZA 1EQFA 4CFLA 5A5OA 4O78A 5KHMA 4Z1QA 4YADA 4QR3A 4UITA 5CS8A 5I88A 4HXPA 2F6NA 4O75A 3MUKA 5CRMA 4N4GA 3UVXA 5E9YA 4BW2A 5F36A 4LDFA 4UYDA 5ENEA 5F61A 3ONIA 5ENJA 4NR5A 4XUAA 5A82A 3MB3A 2RNXA 5A5PA 3SVFA 5CQ8A 5CFWA 5BT3A 4BHWA 2DATA 5FB1A 4QUTA 5F60A 5FDZA 3UV2A 4A9OA 2E3KA 4QSQA 5L8TA 5FH7A 4O71A 3G0JA 4A9JA 4YABA 2R0YA 2RS9B 4OGJA 5F3AA 4ZQLA 2YEMA 4YYGA 5CUDA 5CQ7A 5DYXA 5HEMA 5E7DA 5HQ5A 5DLXA 2R10A 5FFVA 5F62A 4PY6A 3UV4A 4MEQA 4C66A 5AD3A 5CQ6A 5TCMA 4CUPA 4NRBA 5K29A 4LC2A 4LZRA 4TZ8A 4YC9A 5E9VA 5G4RA 5CUCA 4RVRA 3O34A 5BT4A 5DKCA 5E9LA 5KU3A 4Z6HA 5LJ1A 5FE6A 4MEOA 5LKXA 4XUBA 5FG5A 5ETBA 5LKTA 4O72A 4MR4A 5I83A 4CUQA 3QZVA 5DBMA 5II2A 3S92A 4CLBA 3I3JA 5LVRA 5IBNA 5DY7A 3P1FA 4TT4A 5EWCA 1X0JA 2YW5A 4O74A 5I7XA 5F1HA 4XY9A 4QR5A 5D3HA 4PTBA 5D3TA 5FE4A 2R0SA 2I7KA 5A5RA 4O7CA 5AMFA 3O36A 3LQHA 3LQJA 5I89A 4A9FA 3MB4A 5KTWA 3SVHA 3K2JA 4Q0OA 4MR6A 3Q2FA 4QYLA 5CQ3A 3ZYUA 4HXRA 2RO1A 5EWHA 5HRXA 4BW4A 4O7BA 4UIYA 4NYVA 5C89A 5D3SA 5E0RA 4YYHA 4PS5A 2OO1A 3HMEA 5E74A 5DYCA 5EWDA 5AMEA 4OGIA 5ENFA 5CQAA 4QSXA 5HLSA 4HXSA 3RCWA 5EWWA 4NR6A 5CZGA 5D7XA 5IGLA 5FB0A 2L84A 5D3RA 5EU1A 5IGNA 5DFBA 4QBMA 4NQNA 4GPJA 4TYLA 4QEWA 5CQ5A 5FG6A 3O33A 3QZTA 5BT5A 4XY8A 3LJWA 5A5SA 4IOQA 3UV5A 4NR9A 2H60A 3MULA 4NRCA 4CURA 2KTBB 4HBWA 4IR3A 4QSWA 3HMHA 3U5OA 3U5MA 5DKHA 4YYNA 4J0RA 4UYEA 2DKWA 4A9NA 4A9KA 5D3NA 5H85A 5A5QA 5HRVA 4HXOA 5HQ7A 4CFKA 2DVQA 4X2IA 5LKUA 3P5OA 5HFRA 4UYGA 2D82A 5FE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWY A;  5CU8 A;  4HXM A;  5FFW A;  5LVQ A;  5E9I A;  4HBV A;  4YH3 A;  4IOO A;  4LRG A;  3U5K A;  3IU6 A;  5EK9 A;  5E3G A;  5A81 A;  5AD2 A;  2L5E A;  5FBX A;  2G4A A;  4HXN A;  4HBX A;  4QR4 A;  4MR5 A;  4NUE A;  4TT2 A;  5E73 A;  2YYN A;  5D3P A;  4AKN A;  5L99 A;  4WIV A;  2DVV A;  5CUB A;  5COI A;  2YDW A;  5FE8 A;  2WP2 A;  4O7F A;  5EIS A;  4CUU A;  3U5P A;  5JWM A;  5FE1 A;  5CRZ A;  5KTX A;  4QSU A;  4N4F A;  4FLP A;  5IID A;  4CUS A;  5DFD A;  4TT6 A;  5IGK A;  3O37 A;  4Z93 A;  4HXK A;  4KCX A;  4CUT A;  3NXB A;  2I8N A;  4QZS A;  4QSP A;  4QC1 A;  4NUD A;  5D3L A;  5FE0 A;  5CGP A;  3Q2E A;  4QNS A;  4QB3 A;  5F25 A;  1JM4 B;  4O77 A;  4PCE A;  4MR3 A;  3FKM X;  4YY4 A;  4NR7 A;  4Z1S A;  5F63 A;  4TU4 A;  4OUF A;  3UVW A;  5A83 A;  2F6J A;  5G4S A;  4BW3 A;  4CL9 A;  5L98 A;  4YAT A;  4MEN A;  3JVK A;  5C7N A;  5EI4 A;  4IR6 A;  4YH4 A;  5A85 A;  4NR8 A;  4KV4 A;  4YY6 A;  5I29 A;  5JI8 A;  4QY4 A;  4YK0 A;  4BJX A;  5HQ6 A;  4MEP A;  4UYH A;  4HXL A;  4YYK A;  5HCL A;  2DWW A;  4ZC9 A;  3AQA A;  5J0D A;  5I80 A;  4TTE A;  5E9K A;  4TS8 A;  5FH6 A;  3MXF A;  5CPE A;  4QSR A;  4LYS A;  4QUU A;  5C8G A;  5ENI A;  3LQI A;  5ENH A;  4NR4 A;  5EWV A;  5D3J A;  4J1P A;  5I7Y A;  5ACY A;  4A9M A;  2RFJ A;  2YQD A;  5HFQ A;  4QST A;  5EPB A;  5CUA A;  4UYF A;  4BW1 A;  4IR4 A;  5KTU A;  3GG3 A;  4YBT A;  4QC3 A;  4NUC A;  4UIV A;  5HEN A;  5C87 A;  2RNY A;  5FE5 A;  4IR5 A;  2NXB A;  2E7O A;  4NQM A;  4O7E A;  4ALG A;  4E96 A;  5DFC A;  3JVJ A;  4A9E A;  3P1E A;  5CTL A;  4QEV A;  5EGU A;  5FFY A;  3JVM A;  4XYA A;  2RI7 A;  5HJC A;  5I86 A;  5E9M A;  4YBM A;  5IG6 A;  1WUM A;  5ETD A;  4WHU A;  1F68 A;  5ENC A;  5ENG A;  5ENB A;  4PKL A;  4PCI A;  2RNW A;  5F5Z A;  4C67 A;  4A9I A;  4J0S A;  2DVR A;  5D25 A;  5EIC A;  2D9E A;  2E7N A;  5FG4 A;  5LUU A;  3HMF A;  5LJ2 A;  3P1D A;  5I1Q A;  5DX4 A;  5A5N A;  5LKZ A;  2L85 A;  5EVA A;  4ZW1 A;  4UIX A;  5CUE A;  5L96 A;  5DKD A;  4QSS A;  3D7C A;  5EQ1 A;  4KV1 A;  5H1T A;  3IU5 A;  5EV9 A;  3JVL A;  4LYI A;  1WUG A;  2OSS A;  4TQN A;  4IOR A;  5CQT A;  5C4Q A;  5C85 A;  5F2P A;  5CQ4 A;  4LZS A;  2YEK A;  2MJV B;  4NXJ A;  3SVG A;  3LXJ A;  5EA1 A;  2LSP B;  4DON A;  3P1C A;  4WHW A;  5FE3 A;  4YYD A;  5DYU A;  4LR6 A;  4UIW A;  4A9H A;  5EM3 A;  5L97 A;  4UYF B;  3U5L A;  4ALH A;  4LZ2 A;  4QYD A;  4TZ2 A;  5EPR A;  5HRW A;  4O7A A;  3MQM A;  4QEU A;  3AAD A;  5FE9 A;  5IGM A;  5KO4 A;  4YYJ A;  5EP7 A;  2WP1 A;  1ZS5 A;  5A7C A;  5CY9 A;  5D0C A;  2FSA A;  5EPS A;  5D24 A;  5E3D A;  3UW9 A;  3S91 A;  2OUO A;  4N4H A;  3O35 A;  4F3I A;  4HBY A;  3TLP A;  5TB6 A;  3U5N A;  2N9G A;  1JSP B;  5DLZ A;  4Q0N A;  4N3W A;  5HEL A;  5I40 A;  5F1L A;  5FE2 A;  5II1 A;  4NS5 A;  4YAX A;  5LJ0 A;  3UVY A;  4Y03 A;  4N4I A;  4A9L A;  2YEL A;  4NYW A;  4TU6 A;  3U5J A;  4YBS A;  5H1V A;  3DAI A;  5CP5 A;  4NYX A;  4O70 A;  3QZS A;  4J3I A;  4QSV A;  5DW1 A;  5D26 A;  4Z6I A;  4LYW A;  4NRA A;  2R0V A;  1E6I A;  4UIU A;  1N72 A;  5HM0 A;  4YYM A;  2GRC A;  4O76 A;  5DW2 A;  5CUG A;  5DYA A;  2DVS A;  5H1U A;  3UVD A;  5FH8 A;  3G0L A;  4YYI A;  5L8U A;  4UIZ A;  1EQF A;  4CFL A;  5A5O A;  4O78 A;  5KHM A;  4Z1Q A;  4YAD A;  4QR3 A;  4UIT A;  5CS8 A;  5I88 A;  4HXP A;  2F6N A;  4O75 A;  3MUK A;  5CRM A;  4N4G A;  3UVX A;  5E9Y A;  4BW2 A;  5F36 A;  4LDF A;  4UYD A;  5ENE A;  5F61 A;  3ONI A;  5ENJ A;  4NR5 A;  4XUA A;  5A82 A;  3MB3 A;  2RNX A;  5A5P A;  3SVF A;  5CQ8 A;  5CFW A;  5BT3 A;  4BHW A;  2DAT A;  5FB1 A;  4QUT A;  5F60 A;  5FDZ A;  3UV2 A;  4A9O A;  2E3K A;  4QSQ A;  5L8T A;  5FH7 A;  4O71 A;  3G0J A;  4A9J A;  4YAB A;  2R0Y A;  2RS9 B;  4OGJ A;  5F3A A;  4ZQL A;  2YEM A;  4YYG A;  5CUD A;  5CQ7 A;  5DYX A;  5HEM A;  5E7D A;  5HQ5 A;  5DLX A;  2R10 A;  5FFV A;  5F62 A;  4PY6 A;  3UV4 A;  4MEQ A;  4C66 A;  5AD3 A;  5CQ6 A;  5TCM A;  4CUP A;  4NRB A;  5K29 A;  4LC2 A;  4LZR A;  4TZ8 A;  4YC9 A;  5E9V A;  5G4R A;  5CUC A;  4RVR A;  3O34 A;  5BT4 A;  5DKC A;  5E9L A;  5KU3 A;  4Z6H A;  5LJ1 A;  5FE6 A;  4MEO A;  5LKX A;  4XUB A;  5FG5 A;  5ETB A;  5LKT A;  4O72 A;  4MR4 A;  5I83 A;  4CUQ A;  3QZV A;  5DBM A;  5II2 A;  3S92 A;  4CLB A;  3I3J A;  5LVR A;  5IBN A;  5DY7 A;  3P1F A;  4TT4 A;  5EWC A;  1X0J A;  2YW5 A;  4O74 A;  5I7X A;  5F1H A;  4XY9 A;  4QR5 A;  5D3H A;  4PTB A;  5D3T A;  5FE4 A;  2R0S A;  2I7K A;  5A5R A;  4O7C A;  5AMF A;  3O36 A;  3LQH A;  3LQJ A;  5I89 A;  4A9F A;  3MB4 A;  5KTW A;  3SVH A;  3K2J A;  4Q0O A;  4MR6 A;  3Q2F A;  4QYL A;  5CQ3 A;  3ZYU A;  4HXR A;  2RO1 A;  5EWH A;  5HRX A;  4BW4 A;  4O7B A;  4UIY A;  4NYV A;  5C89 A;  5D3S A;  5E0R A;  4YYH A;  4PS5 A;  2OO1 A;  3HME A;  5E74 A;  5DYC A;  5EWD A;  5AME A;  4OGI A;  5ENF A;  5CQA A;  4QSX A;  5HLS A;  4HXS A;  3RCW A;  5EWW A;  4NR6 A;  5CZG A;  5D7X A;  5IGL A;  5FB0 A;  2L84 A;  5D3R A;  5EU1 A;  5IGN A;  5DFB A;  4QBM A;  4NQN A;  4GPJ A;  4TYL A;  4QEW A;  5CQ5 A;  5FG6 A;  3O33 A;  3QZT A;  5BT5 A;  4XY8 A;  3LJW A;  5A5S A;  4IOQ A;  3UV5 A;  4NR9 A;  2H60 A;  3MUL A;  4NRC A;  4CUR A;  2KTB B;  4HBW A;  4IR3 A;  4QSW A;  3HMH A;  3U5O A;  3U5M A;  5DKH A;  4YYN A;  4J0R A;  4UYE A;  2DKW A;  4A9N A;  4A9K A;  5D3N A;  5H85 A;  5A5Q A;  5HRV A;  4HXO A;  5HQ7 A;  4CFK A;  2DVQ A;  4X2I A;  5LKU A;  3P5O A;  5HFR A;  4UYG A;  2D82 A;  5FE7 A; 
#chains in the Genus database with same CATH topology
 3DWY A;  5CU8 A;  4HXM A;  5FFW A;  5LVQ A;  5E9I A;  4HBV A;  4YH3 A;  4IOO A;  4LRG A;  3U5K A;  3IU6 A;  5EK9 A;  5E3G A;  5A81 A;  5AD2 A;  2L5E A;  5FBX A;  2G4A A;  4HXN A;  4HBX A;  4QR4 A;  4MR5 A;  4NUE A;  4TT2 A;  5E73 A;  2YYN A;  5D3P A;  4AKN A;  5L99 A;  4WIV A;  2DVV A;  5CUB A;  5COI A;  2YDW A;  5FE8 A;  2WP2 A;  4O7F A;  5EIS A;  4CUU A;  3U5P A;  5JWM A;  5FE1 A;  5CRZ A;  5KTX A;  4QSU A;  4N4F A;  4FLP A;  5IID A;  4CUS A;  5DFD A;  4TT6 A;  5IGK A;  4AKG A;  3O37 A;  4Z93 A;  4HXK A;  4KCX A;  4CUT A;  3NXB A;  2I8N A;  4QZS A;  4QSP A;  4QC1 A;  4NUD A;  5D3L A;  5FE0 A;  5CGP A;  3Q2E A;  4QNS A;  4QB3 A;  5F25 A;  1JM4 B;  4O77 A;  4PCE A;  4MR3 A;  3FKM X;  4YY4 A;  4NR7 A;  4Z1S A;  5F63 A;  4TU4 A;  4OUF A;  3UVW A;  5A83 A;  2F6J A;  5G4S A;  4BW3 A;  4CL9 A;  5L98 A;  4YAT A;  4MEN A;  3JVK A;  5C7N A;  5EI4 A;  4IR6 A;  4YH4 A;  5A85 A;  4NR8 A;  4KV4 A;  4YY6 A;  4AKI A;  5I29 A;  5JI8 A;  4QY4 A;  4YK0 A;  4BJX A;  5HQ6 A;  4MEP A;  4UYH A;  4HXL A;  4YYK A;  5HCL A;  2DWW A;  4ZC9 A;  3AQA A;  5J0D A;  5I80 A;  4TTE A;  5E9K A;  4TS8 A;  5FH6 A;  3MXF A;  5CPE A;  4QSR A;  4LYS A;  4QUU A;  5C8G A;  5ENI A;  3LQI A;  5ENH A;  4NR4 A;  5EWV A;  5D3J A;  4J1P A;  5I7Y A;  5ACY A;  4A9M A;  2EJN A;  2RFJ A;  2YQD A;  5HFQ A;  4QST A;  5EPB A;  5CUA A;  4UYF A;  4BW1 A;  4IR4 A;  5KTU A;  3GG3 A;  4YBT A;  4QC3 A;  4NUC A;  4UIV A;  5HEN A;  5C87 A;  2RNY A;  5FE5 A;  4IR5 A;  2NXB A;  2E7O A;  4NQM A;  4O7E A;  4ALG A;  4E96 A;  5DFC A;  3JVJ A;  4A9E A;  3P1E A;  5CTL A;  4QEV A;  5EGU A;  5FFY A;  3D1D A;  3JVM A;  4XYA A;  2RI7 A;  5HJC A;  5I86 A;  5E9M A;  4YBM A;  5IG6 A;  1WUM A;  5ETD A;  4WHU A;  1F68 A;  5ENC A;  5ENG A;  5ENB A;  4PKL A;  4PCI A;  2RNW A;  5F5Z A;  4C67 A;  4A9I A;  4J0S A;  2DVR A;  5D25 A;  5EIC A;  2D9E A;  2E7N A;  5FG4 A;  5LUU A;  3HMF A;  5LJ2 A;  3P1D A;  5I1Q A;  5DX4 A;  5A5N A;  5LKZ A;  2L85 A;  5EVA A;  4ZW1 A;  4UIX A;  5CUE A;  5L96 A;  5DKD A;  4QSS A;  3D7C A;  5EQ1 A;  4KV1 A;  5H1T A;  3IU5 A;  5EV9 A;  3JVL A;  4LYI A;  1WUG A;  2OSS A;  4TQN A;  4IOR A;  5CQT A;  5C4Q A;  3ERR A;  5C85 A;  5F2P A;  5CQ4 A;  4LZS A;  2YEK A;  2MJV B;  4NXJ A;  1ZKR A;  3SVG A;  3LXJ A;  5EA1 A;  4AKH A;  2LSP B;  4DON A;  3P1C A;  4WHW A;  5FE3 A;  4YYD A;  5DYU A;  4LR6 A;  4UIW A;  4A9H A;  5EM3 A;  5L97 A;  4UYF B;  3U5L A;  4ALH A;  4LZ2 A;  4QYD A;  4TZ2 A;  5EPR A;  5HRW A;  4O7A A;  3MQM A;  4QEU A;  3AAD A;  5FE9 A;  5IGM A;  5KO4 A;  4YYJ A;  5EP7 A;  2WP1 A;  1ZS5 A;  5A7C A;  5CY9 A;  5D0C A;  2FSA A;  5EPS A;  5D24 A;  5E3D A;  3UW9 A;  3S91 A;  2OUO A;  4N4H A;  3O35 A;  4F3I A;  4HBY A;  3TLP A;  5TB6 A;  3U5N A;  2N9G A;  1JSP B;  5DLZ A;  4Q0N A;  4N3W A;  5HEL A;  5I40 A;  5F1L A;  5FE2 A;  5II1 A;  4NS5 A;  4YAX A;  5LJ0 A;  3UVY A;  4Y03 A;  4N4I A;  4A9L A;  2YEL A;  4NYW A;  4TU6 A;  3U5J A;  4YBS A;  5H1V A;  3DAI A;  5CP5 A;  4NYX A;  4O70 A;  3QZS A;  4J3I A;  4QSV A;  5DW1 A;  5D26 A;  4Z6I A;  4LYW A;  4NRA A;  2R0V A;  1E6I A;  4UIU A;  1N72 A;  5HM0 A;  4YYM A;  2GRC A;  4O76 A;  5DW2 A;  5CUG A;  5DYA A;  2DVS A;  5H1U A;  3UVD A;  5FH8 A;  3G0L A;  4YYI A;  5L8U A;  4UIZ A;  1EQF A;  4CFL A;  5A5O A;  4O78 A;  5KHM A;  4Z1Q A;  4YAD A;  4QR3 A;  4UIT A;  5CS8 A;  5I88 A;  4HXP A;  2F6N A;  4O75 A;  3MUK A;  5CRM A;  4N4G A;  3UVX A;  5E9Y A;  4BW2 A;  5F36 A;  4LDF A;  4UYD A;  5ENE A;  5F61 A;  3ONI A;  5ENJ A;  4NR5 A;  4XUA A;  5A82 A;  3MB3 A;  2RNX A;  5A5P A;  3SVF A;  5CQ8 A;  5CFW A;  5BT3 A;  4BHW A;  2DAT A;  5FB1 A;  4QUT A;  5F60 A;  5FDZ A;  3UV2 A;  4A9O A;  2E3K A;  4QSQ A;  5L8T A;  5FH7 A;  3D1B A;  4O71 A;  3G0J A;  4A9J A;  4YAB A;  2R0Y A;  2RS9 B;  4OGJ A;  5F3A A;  4ZQL A;  2YEM A;  4YYG A;  5CUD A;  5CQ7 A;  5DYX A;  5HEM A;  5E7D A;  5HQ5 A;  5DLX A;  2R10 A;  5FFV A;  5F62 A;  4PY6 A;  3UV4 A;  1PUO A;  4MEQ A;  4C66 A;  5AD3 A;  5CQ6 A;  5TCM A;  4CUP A;  4NRB A;  5K29 A;  4LC2 A;  4LZR A;  4TZ8 A;  4YC9 A;  5E9V A;  5G4R A;  5CUC A;  4RVR A;  3O34 A;  5BT4 A;  5DKC A;  5E9L A;  5KU3 A;  4Z6H A;  5LJ1 A;  5FE6 A;  4MEO A;  5LKX A;  4XUB A;  5FG5 A;  5ETB A;  5LKT A;  4O72 A;  4MR4 A;  5I83 A;  4AI6 A;  4CUQ A;  3QZV A;  5DBM A;  5II2 A;  3S92 A;  4CLB A;  3I3J A;  5LVR A;  5IBN A;  5DY7 A;  3P1F A;  4TT4 A;  5EWC A;  1X0J A;  2YW5 A;  4O74 A;  5I7X A;  3VKG A;  5F1H A;  4XY9 A;  4QR5 A;  5D3H A;  4PTB A;  5D3T A;  5FE4 A;  2R0S A;  2I7K A;  5A5R A;  4O7C A;  5AMF A;  3O36 A;  3LQH A;  3LQJ A;  5I89 A;  4A9F A;  3MB4 A;  5KTW A;  3SVH A;  3K2J A;  4Q0O A;  4MR6 A;  3Q2F A;  4QYL A;  5CQ3 A;  3ZYU A;  4HXR A;  2RO1 A;  5EWH A;  5HRX A;  4BW4 A;  4O7B A;  4UIY A;  4NYV A;  5C89 A;  5D3S A;  5E0R A;  4YYH A;  4PS5 A;  2OO1 A;  3HME A;  5E74 A;  5DYC A;  5EWD A;  5AME A;  4OGI A;  5ENF A;  5CQA A;  4QSX A;  5HLS A;  4HXS A;  3RCW A;  5EWW A;  4NR6 A;  5CZG A;  5D7X A;  5IGL A;  5FB0 A;  2L84 A;  5D3R A;  5EU1 A;  5IGN A;  5DFB A;  4QBM A;  4NQN A;  4GPJ A;  4TYL A;  4QEW A;  5CQ5 A;  5FG6 A;  3O33 A;  3QZT A;  3VKH A;  5BT5 A;  4XY8 A;  3LJW A;  5A5S A;  4IOQ A;  3UV5 A;  4NR9 A;  2H60 A;  3MUL A;  4NRC A;  4CUR A;  2KTB B;  4HBW A;  4IR3 A;  4QSW A;  3HMH A;  3U5O A;  3U5M A;  5DKH A;  4YYN A;  4J0R A;  4UYE A;  2DKW A;  4A9N A;  4A9K A;  5D3N A;  5H85 A;  5A5Q A;  5HRV A;  4HXO A;  5HQ7 A;  4CFK A;  2DVQ A;  4X2I A;  5LKU A;  3P5O A;  5HFR A;  4UYG A;  2D82 A;  5FE7 A; 
#chains in the Genus database with same CATH homology
 3DWY A;  5CU8 A;  4HXM A;  5FFW A;  5LVQ A;  5E9I A;  4HBV A;  4YH3 A;  4IOO A;  4LRG A;  3U5K A;  3IU6 A;  5EK9 A;  5E3G A;  5A81 A;  5AD2 A;  2L5E A;  5FBX A;  2G4A A;  4HXN A;  4HBX A;  4QR4 A;  4MR5 A;  4NUE A;  4TT2 A;  5E73 A;  2YYN A;  5D3P A;  4AKN A;  5L99 A;  4WIV A;  2DVV A;  5CUB A;  5COI A;  2YDW A;  5FE8 A;  2WP2 A;  4O7F A;  5EIS A;  4CUU A;  3U5P A;  5JWM A;  5FE1 A;  5CRZ A;  5KTX A;  4QSU A;  4N4F A;  4FLP A;  5IID A;  4CUS A;  5DFD A;  4TT6 A;  5IGK A;  3O37 A;  4Z93 A;  4HXK A;  4KCX A;  4CUT A;  3NXB A;  2I8N A;  4QZS A;  4QSP A;  4QC1 A;  4NUD A;  5D3L A;  5FE0 A;  5CGP A;  3Q2E A;  4QNS A;  4QB3 A;  5F25 A;  1JM4 B;  4O77 A;  4PCE A;  4MR3 A;  3FKM X;  4YY4 A;  4NR7 A;  4Z1S A;  5F63 A;  4TU4 A;  4OUF A;  3UVW A;  5A83 A;  2F6J A;  5G4S A;  4BW3 A;  4CL9 A;  5L98 A;  4YAT A;  4MEN A;  3JVK A;  5C7N A;  5EI4 A;  4IR6 A;  4YH4 A;  5A85 A;  4NR8 A;  4KV4 A;  4YY6 A;  5I29 A;  5JI8 A;  4QY4 A;  4YK0 A;  4BJX A;  5HQ6 A;  4MEP A;  4UYH A;  4HXL A;  4YYK A;  5HCL A;  2DWW A;  4ZC9 A;  3AQA A;  5J0D A;  5I80 A;  4TTE A;  5E9K A;  4TS8 A;  5FH6 A;  3MXF A;  5CPE A;  4QSR A;  4LYS A;  4QUU A;  5C8G A;  5ENI A;  3LQI A;  5ENH A;  4NR4 A;  5EWV A;  5D3J A;  4J1P A;  5I7Y A;  5ACY A;  4A9M A;  2RFJ A;  2YQD A;  5HFQ A;  4QST A;  5EPB A;  5CUA A;  4UYF A;  4BW1 A;  4IR4 A;  5KTU A;  3GG3 A;  4YBT A;  4QC3 A;  4NUC A;  4UIV A;  5HEN A;  5C87 A;  2RNY A;  5FE5 A;  4IR5 A;  2NXB A;  2E7O A;  4NQM A;  4O7E A;  4ALG A;  4E96 A;  5DFC A;  3JVJ A;  4A9E A;  3P1E A;  5CTL A;  4QEV A;  5EGU A;  5FFY A;  3JVM A;  4XYA A;  2RI7 A;  5HJC A;  5I86 A;  5E9M A;  4YBM A;  5IG6 A;  1WUM A;  5ETD A;  4WHU A;  1F68 A;  5ENC A;  5ENG A;  5ENB A;  4PKL A;  4PCI A;  2RNW A;  5F5Z A;  4C67 A;  4A9I A;  4J0S A;  2DVR A;  5D25 A;  5EIC A;  2D9E A;  2E7N A;  5FG4 A;  5LUU A;  3HMF A;  5LJ2 A;  3P1D A;  5I1Q A;  5DX4 A;  5A5N A;  5LKZ A;  2L85 A;  5EVA A;  4ZW1 A;  4UIX A;  5CUE A;  5L96 A;  5DKD A;  4QSS A;  3D7C A;  5EQ1 A;  4KV1 A;  5H1T A;  3IU5 A;  5EV9 A;  3JVL A;  4LYI A;  1WUG A;  2OSS A;  4TQN A;  4IOR A;  5CQT A;  5C4Q A;  5C85 A;  5F2P A;  5CQ4 A;  4LZS A;  2YEK A;  2MJV B;  4NXJ A;  3SVG A;  3LXJ A;  5EA1 A;  2LSP B;  4DON A;  3P1C A;  4WHW A;  5FE3 A;  4YYD A;  5DYU A;  4LR6 A;  4UIW A;  4A9H A;  5EM3 A;  5L97 A;  4UYF B;  3U5L A;  4ALH A;  4LZ2 A;  4QYD A;  4TZ2 A;  5EPR A;  5HRW A;  4O7A A;  3MQM A;  4QEU A;  3AAD A;  5FE9 A;  5IGM A;  5KO4 A;  4YYJ A;  5EP7 A;  2WP1 A;  1ZS5 A;  5A7C A;  5CY9 A;  5D0C A;  2FSA A;  5EPS A;  5D24 A;  5E3D A;  3UW9 A;  3S91 A;  2OUO A;  4N4H A;  3O35 A;  4F3I A;  4HBY A;  3TLP A;  5TB6 A;  3U5N A;  2N9G A;  1JSP B;  5DLZ A;  4Q0N A;  4N3W A;  5HEL A;  5I40 A;  5F1L A;  5FE2 A;  5II1 A;  4NS5 A;  4YAX A;  5LJ0 A;  3UVY A;  4Y03 A;  4N4I A;  4A9L A;  2YEL A;  4NYW A;  4TU6 A;  3U5J A;  4YBS A;  5H1V A;  3DAI A;  5CP5 A;  4NYX A;  4O70 A;  3QZS A;  4J3I A;  4QSV A;  5DW1 A;  5D26 A;  4Z6I A;  4LYW A;  4NRA A;  2R0V A;  1E6I A;  4UIU A;  1N72 A;  5HM0 A;  4YYM A;  2GRC A;  4O76 A;  5DW2 A;  5CUG A;  5DYA A;  2DVS A;  5H1U A;  3UVD A;  5FH8 A;  3G0L A;  4YYI A;  5L8U A;  4UIZ A;  1EQF A;  4CFL A;  5A5O A;  4O78 A;  5KHM A;  4Z1Q A;  4YAD A;  4QR3 A;  4UIT A;  5CS8 A;  5I88 A;  4HXP A;  2F6N A;  4O75 A;  3MUK A;  5CRM A;  4N4G A;  3UVX A;  5E9Y A;  4BW2 A;  5F36 A;  4LDF A;  4UYD A;  5ENE A;  5F61 A;  3ONI A;  5ENJ A;  4NR5 A;  4XUA A;  5A82 A;  3MB3 A;  2RNX A;  5A5P A;  3SVF A;  5CQ8 A;  5CFW A;  5BT3 A;  4BHW A;  2DAT A;  5FB1 A;  4QUT A;  5F60 A;  5FDZ A;  3UV2 A;  4A9O A;  2E3K A;  4QSQ A;  5L8T A;  5FH7 A;  4O71 A;  3G0J A;  4A9J A;  4YAB A;  2R0Y A;  2RS9 B;  4OGJ A;  5F3A A;  4ZQL A;  2YEM A;  4YYG A;  5CUD A;  5CQ7 A;  5DYX A;  5HEM A;  5E7D A;  5HQ5 A;  5DLX A;  2R10 A;  5FFV A;  5F62 A;  4PY6 A;  3UV4 A;  4MEQ A;  4C66 A;  5AD3 A;  5CQ6 A;  5TCM A;  4CUP A;  4NRB A;  5K29 A;  4LC2 A;  4LZR A;  4TZ8 A;  4YC9 A;  5E9V A;  5G4R A;  5CUC A;  4RVR A;  3O34 A;  5BT4 A;  5DKC A;  5E9L A;  5KU3 A;  4Z6H A;  5LJ1 A;  5FE6 A;  4MEO A;  5LKX A;  4XUB A;  5FG5 A;  5ETB A;  5LKT A;  4O72 A;  4MR4 A;  5I83 A;  4CUQ A;  3QZV A;  5DBM A;  5II2 A;  3S92 A;  4CLB A;  3I3J A;  5LVR A;  5IBN A;  5DY7 A;  3P1F A;  4TT4 A;  5EWC A;  1X0J A;  2YW5 A;  4O74 A;  5I7X A;  5F1H A;  4XY9 A;  4QR5 A;  5D3H A;  4PTB A;  5D3T A;  5FE4 A;  2R0S A;  2I7K A;  5A5R A;  4O7C A;  5AMF A;  3O36 A;  3LQH A;  3LQJ A;  5I89 A;  4A9F A;  3MB4 A;  5KTW A;  3SVH A;  3K2J A;  4Q0O A;  4MR6 A;  3Q2F A;  4QYL A;  5CQ3 A;  3ZYU A;  4HXR A;  2RO1 A;  5EWH A;  5HRX A;  4BW4 A;  4O7B A;  4UIY A;  4NYV A;  5C89 A;  5D3S A;  5E0R A;  4YYH A;  4PS5 A;  2OO1 A;  3HME A;  5E74 A;  5DYC A;  5EWD A;  5AME A;  4OGI A;  5ENF A;  5CQA A;  4QSX A;  5HLS A;  4HXS A;  3RCW A;  5EWW A;  4NR6 A;  5CZG A;  5D7X A;  5IGL A;  5FB0 A;  2L84 A;  5D3R A;  5EU1 A;  5IGN A;  5DFB A;  4QBM A;  4NQN A;  4GPJ A;  4TYL A;  4QEW A;  5CQ5 A;  5FG6 A;  3O33 A;  3QZT A;  5BT5 A;  4XY8 A;  3LJW A;  5A5S A;  4IOQ A;  3UV5 A;  4NR9 A;  2H60 A;  3MUL A;  4NRC A;  4CUR A;  2KTB B;  4HBW A;  4IR3 A;  4QSW A;  3HMH A;  3U5O A;  3U5M A;  5DKH A;  4YYN A;  4J0R A;  4UYE A;  2DKW A;  4A9N A;  4A9K A;  5D3N A;  5H85 A;  5A5Q A;  5HRV A;  4HXO A;  5HQ7 A;  4CFK A;  2DVQ A;  4X2I A;  5LKU A;  3P5O A;  5HFR A;  4UYG A;  2D82 A;  5FE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...