2N9PC

Solution structure of rnf126 n-terminal zinc finger domain in complex with bag6 ubiquitin-like domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
100
Chain Sequence
MAHHHHHHVDDDDKMLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into the E3 ligase, RNF126.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF126
total genus 11
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n9pC00
3T9LA 2LRWA 1OEYA 3X0WA 4AUQC 4F1SA 3UQAA 1NDDA 3EFUA 4IWQA 4LJPB 4MSQB 2BGFA 4PYZA 2MBBB 3R3MA 2EMTA 4II3B 3NZSA 4KZ0A 1P0RA 1WMHB 2WX1A 1P3QU 3ZUNA 1L7YA 4WJNA 5JZEB 1Z2MA 3GOEA 1NI2A 1WXSA 3NS8A 3VTUA 3PRMB 4MGZE 4BKTA 1OGWA 4XZ4A 2OOBB 1GG3A 4WJPA 4LDTD 4G3XB 3L16A 4A3OA 3WIMA 3AI5A 3ML8A 1WGYA 3A4SC 2KJ6A 1WR6E 4BOZB 1J19A 4LCDE 1Z5SB 2KWUB 5DPTA 2G45B 2LVQA 4K81A 2GBMA 2JRHA 4ANVA 5CHVC 4DWFA 4G11A 1HE8A 1WI0A 2C60A 2Z0EB 1D3ZA 3A4RA 2Z59B 3A9JA 4IM0A 4DDID 3DQVA 1RFAA 5E6NA 3LJ3A 1V81A 2XK5A 4MDKE 4B95A 3ML9A 1SE9A 1TZ1A 3OAWA 3TBLD 2MWSB 4W9HA 5JHAA 3ENEA 4IWPA 2NVUI 1WGGA 3JSVA 1V9JA 2PE9A 4RMAA 4GXBA 2O6VA 5J17A 3TJPA 2DZIA 2GBJA 2JT4B 4TQ0A 2JXXA 2DZJA 2JY6A 2ZVOA 4NAWB 2ZNVB 4HCPB 3HHMA 4PS3A 3SU8X 4IM2A 4JQWC 2FCSA 2RD0A 4GN1A 4MGIE 4JIOU 4EZJA 2WWZA 3C0RB 3H7PA 5CX3A 3VH4B 4BBNF 1UBQA 3HIZA 1I42A 3H7PB 5DPWA 4X57B 3VUWA 3V6EB 2ZVNA 4ZRKA 4CYEA 1WY8A 2KOXA 1KOTA 1WGDA 2MLBA 5E6PA 2BWFA 3MTNB 4BVUC 3NY5A 1R4MI 3A33B 5JH5C 4KV2A 1P9DU 1LM8B 2REXA 1Q0WB 4G0NB 3H1UA 2KC2A 5CTRC 4HLEA 3UIOB 3HM6X 2KMAA 3AU4A 2FUHB 1V5TA 4HJKA 5C1ZA 3DVGX 4GIVA 4AP4C 3MJWA 3H7SA 1E90A 2KDEB 1KLVA 1TGZB 1WFYA 2KANA 1U4AA 4J6IA 2LGDA 5AZGA 2LD9A 3QA8A 4LDTB 3UINB 4PS7A 3VFKA 4DBGA 4W9CA 1XQQA 4K7UA 2ZNVC 5D6JB 1J8CA 1IYFA 2KNBA 3EC8A 3K9PB 4FHJA 1YQBA 2KFJA 4IW0A 2N9XA 1QZEA 3QIJA 4WWOA 4I6PA 3M62B 4ZYNA 1GJZA 3AULA 2NBVB 2J0MA 1PQSA 4NJ7A 2L0FA 4MEMA 4HVBA 1XT9B 3QARA 4FJYA 2C7MB 3L54A 4FBJB 4XX5A 2JZ3B 3ZW3A 2KJHB 2N9EB 2PEAA 4W9JA 4W9IA 1RRBA 1UZXB 4JL9A 2UWQA 4F7ZA 1VCBA 3IBEA 4DDGD 2J0KA 1WRDB 2LRUA 3NZUA 3Q3JA 2KTFA 3M63B 4DHZB 1WIAA 3PRZA 4NQKE 4EZLA 1OTRB 2NCNA 1E8ZA 5TR5A 3DOWA 2KWCA 2MSED 4GGQA 4IG7B 4E71A 3NHEB 2KDFB 2IO3B 3CSTA 4MELA 2NBUA 2HE7A 4GDLA 4EUTA 3PLUA 2DZKA 1E8YA 4BOSC 4WAAA 1UGMA 1YX5B 1XD3B 1OEYJ 2N7DA 4FJVB 3TMPB 4GOCA 4HPLB 4DHJB 3SDLC 3ZTDA 1V2YA 2AWTA 1SIFA 3ECIA 5KHQA 2JUOA 1GUAB 2MBOA 3HK0A 4KSKC 5J18A 3QJZA 3CF6E 2CU1A 2KN5A 4A3PA 3RUIB 2L8JA 3DPDA 1WE6A 3DBHI 3HM3A 4GDLB 3CSFA 1ZGUB 2L76A 2GBRA 4M0WB 3AU5A 3QC8B 3WAPA 2CKHB 3ZRFA 1WXAA 3ZKJC 4MGKE 4MJSA 4NQLB 5FR6A 2KD0A 2LI5A 4B6WA 4MJSB 4W9GA 4MSMB 3TL5A 1CMXB 2K8BA 4JGHB 4PYUA 3DBSA 3KUDB 2I1KA 2KQSA 3KUZA 1H8CA 3V60A 2QHOA 3RT3B 1E8WA 3DBLI 4DHZE 3VDZA 1NBFC 1GNUA 2KDBA 3APFA 3WAMA 1WM3A 4E3CA 1E5WA 4FHKA 3UQBA 1E7UA 3B08A 3QCAA 3DVGY 2I1JA 1UD7A 1V6EA 2DHZA 2RGFA 3ALBA 3H9DA 4I6NB 1TBEA 4WWPA 3ZNZB 2KC1A 4WJOA 2FCNA 5IA7A 3PHWB 2MQJA 4HXDA 3NOBA 1GC7A 3V62A 3L13A 3KYDD 4I6LB 5AEKB 1X1MA 5DPSA 2MCNB 3V61A 3VTVA 4MM3A 4ZRJA 4ANXA 3VVWB 1BT0A 1V86A 4W9KA 1S1QB 2GMIC 4NJ6A 1YX6B 3WAOA 2KQ7A 2O6VD 2Y5BB 2IO0B 2JPHA 3QQ8B 2Z0DB 4II2B 5L95C 2L00B 3ZDTA 1WJUA 4FJZA 1WX9A 3OLMD 2MBQA 4DHJD 3T8MA 1RLFA 4HCNB 4HK2A 3ZVVA 4FA6A 4RM8A 3WANA 2ZEQA 3JYUA 3PTFC 4FN2A 1RAXA 2DAFA 2R2QA 4EEWA 3A9JB 1KM7A 1YD8U 3ZLZA 3W1YA 3KH0A 1S3SG 1TTNA 3IFWB 4B9KA 2V4LA 4TQ1A 4KDIC 4TKNA 4CHKA 2IY0B 4HDQA 4IWOA 3N32A 3N30A 4BFRA 3JW0X 3IHPC 4ASWC 2A5UA 5DCNA 1WJ4A 1V49A 3DBRI 2ZZPB 4KZCA 3O65B 4K7WA 3BINA 3RYTA 4MGYE 4YL8A 2AL6A 3VUYA 2C7HA 4ICUA 1OQYA 2LASA 4NAWA 3ZRCA 3RZWC 3S2AA 2K25A 2LXAA 4BKSA 1WE7A 1VD2A 2L0TA 2YLMA 4WJQA 2JZZA 3L0WB 1EF5A 2GBNA 2NBWB 5LLIA 1IP9A 1WX8A 2MBEA 3R7QA 4GSWA 1T0YA 2KXJA 4EOYA 3CMMB 1Q1OA 2KDIA 4OVUA 2DX5B 2BYVE 2AEHA 2MRPA 2BYEA 2K6DB 3W1SC 1KJTA 4WQOB 4AWJA 1ISNA 1Y8RC 2LJ5A 2K1FA 3A9KA 4WWNA 3VXWA 2D10A 2C9WB 4LJOB 5E6OA 2IYDB 2PE6B 2KMCA 3EHVA 3ONSA 1IPGA 2KWVB 2KLGA 2KHWB 3B1LX 2LVPA 2M8SA 2IZVB 1WJNA 2IY1B 2FIDA 1P1AA 1WZ0A 2BKRB 2KK8A 3VQIA 3PVLA 2O6VB 3SD5A 4NPNA 2KLCA 2N7EA 3BY4B 2ZCBA 1WGHA 2ZPNA 3P2BA 3PREA 4A20A 2RPQA 2WDTB 3PGEA 2J0JA 2KTRB 4IUMB 4FLHA 4M8NA 5EDSA 2LGXA 1WR1A 2KZRA 2VRRB 2IBIB 4K1RB 1WMHA 2BPSA 4ANWA 2MP2A 2L3ZA 2M17A 2HD5B 2LGYA 3EECA 1WF9A 5CHFA 2GBKA 2XEWA 1ZKHA 2FNJB 3K9OB 1YIWA 1P98A 3LDZE 2N9PC 4RM9A 2FIFA 1R4NI 3DDCB 5BO4B 2CHZA 2FCMA 2G3QB 3UIPB 1WXVA 2ZJDA 2MP2B 3OJ4B 1LFDA 3AXCA 4KSLC 3SHQA 2HTHA 2M1MA 2MBHA 2WYQA 4JLCA 4TV3A 2ASQA 2W9NA 4KIKA 4N9F4 4PS8A 2L05A 3RULA 1H4RA 1YJ1A 4K7SA 2KTRA 4URKA 3TIXA 2PPHA 2FCQA 3A1QB 1EO6A 4KVGB 4GU2A 5AZFA 2D07B 2N1WA 1WX7A 2ZPYA 4W9EA 2LWPA 5JHBA 3RD2A 1WJ6A 4W9DA 5AZHA 2FAZA 1L2NA 3IVFA 2DAJA 2D3GA 3M3JA 2B3AA 2KX0A 2KFKB 1MG8A 3QK0A 2KJRA 4EZKA 1FXTB 4HWIB 2A4ZA 2CHWA 2ZCCA 1ZW7A 3V6CB 2BWES 2LZ6A 3KYCD 3R66C 1Q5WB 3X23A 3PLVA 1WM2A 3IG3A 3L08A 3A9KB 5KHOA 2O2VB 2R2OA 3MHSD 3QHTA 4P7IA 1WZ3A 2G4SA 4HPMB 3ZO5B 1WXMA 4DXAB 4ZDVA 2DZMA 3ZDMC 2JF5A 5J2RA 2IO2B 5LXIB 2UYZB 1J0GA 5D7GA 2CR5A 2DENB 1E7VA 2NPTB 4AJYB 5HKHA 3B0AA 4ICVA 3N3KB 4E74A 1UELA 5L83A 3A1QA 2AYOB 2K8HA 4M8MA 2K8CA 4OVVA 1SGHA 3Q3FA 1JRUA 2XK5B 2EKEC 2N1VA 2N4FA 2JWZA 3L10B 4TUUA 3JSVB 2V1YA 4BKSD 3VAWA 3PSEB 3PPAA 4GDKA 2RR9A 3APDA 4NY0A 4GMVA 3RZFA 2V3SA 3VHTC 3WA0A 2PJHA 2G4DB 3M95A 3ZNHB 2M4NA 2O2VA 3OJ3A 3R7RA 4DK5A 3APCA 5GMVA 3KVFB 1WGRA 4W9LA 5DPRA 2BF8B 3QX1A 3TCAA 5IAAC 3U7DA 4FULA 2RSUA 4MH0E 5CHWA 4FADA 4IC7B 4GDKB 2EMSA 1G6JA 5G55A 3VUXA 4KDLB 3U8ZA 2GOWA 4ANUA 2CS4A 2MX2A 1UH6A 5D2MB 3PHXB 4EFOA 2L7RA 4HDOA 1V80A 1EF1A 2KX3A 3ZNID 2NPTA 1WH3A 1K8RB 2IO1B 3DVNV 2LXCA 1LXDA 4IM3A 5C23A 3UF8A 3KUCB 2NR2A 2KO3A 2WX0A 3PT2B 2C5LC 4EKUA 2LVOA 2MW5A 4G50A 2DYMA 1V5OA 3QWZB 4ZRIA 3VTWA 2D2QA 2NS5A 3U30A 4NNJB 3VH3B 3PV1A 2AL3A 2JRIB 1E8XA 1C3TA 2K39A 3I3TB 2HJ8A 3KW5B 5D94A 2M0XA 4GB9A 2OJRA 2YVCA 4XC2A 3PS6A 2BKFA 3ZTCA 4F8CB 2XBBC 2KFKA 2D11A 2DYOA 2JVCA 1EUVB 3WALA 1C1YB 2KVRA 1I35A 4AOFA 1M94A 5G2NA 3DCGA 2BYFA 4BBNC 1LQBA 3PRPB 1WYWB 3H6NA 3W1SA 3D32A 1AARA 3RCZA 2LUEA 2MA9B 5LXHA 2J7QB 4BKGA 4AJWA 3ZIMA 2DYBA 1F9JA 1GC6A 3QAQA 4W9FA 4KIKB 4CO7A 1A5RA 1UBIA 2C7NB 2CHXA 2K6QA 3UGBB 3PZDA 3JVZX 2KKCA 3ZNGC 3DVNU 3L17A 3GZNI
chains in the Genus database with same CATH superfamily
1OEYA 4F1SA 3UQAA 2WP9B 4C7YA 1K50A 2AQ1B 3R3MA 4II3B 2PVOD 1SSNA 1P3QU 3AE7B 4WJNA 1NYQA 1Z2MA 3BYTB 1OGWA 3R8BA 5G5GA 1GG3A 2IPKD 1PGBA 4RH6A 3TSSA 5AUKA 1EM7A 5DPTA 2G9HD 1E0ZA 1JW9D 2C60A 2Z0EB 1D3ZA 2QCZA 4IM0A 1RFAA 4MDKE 1V81A 2W54A 1I4RA 3ML9A 1SF0A 1TZ1A 3TBLD 2MWSB 2KYWA 3ENEA 4IWPA 1P7FA 4GXBA 3W9CB 2JXXA 2DZJA 2JY6A 4PS3A 4IM2A 2FCSA 2RD0A 4BBNF 1UBQA 2MJEA 1NENB 1I42A 3H7PB 3RN9C 1KOTA 5E6PA 4US9A 2BWFA 1R4MI 3A33B 5JH5C 2AQ3B 1Q0WB 2IGHA 3VR8B 3HM6X 2KMAA 2QJLA 1V5TA 2BB5A 3MJWA 3H7SA 3RNEC 1TGZB 2KANA 3DWGC 1ZOYB 4LDTB 4PS7A 1XQQA 3EC8A 1J7AA 2QC8A 1XXGA 1TKGA 3FC4A 2NMQA 1YJJA 4I6PA 1GJZA 3AULA 2NBVB 2YEPF 2L0FA 1F2RI 3SR6A 2D3BA 5T8IA 2WXOA 4FJYA 4FBJB 3ZW3A 2WHIA 2KJHB 2PEAA 1NEKB 1UZXB 4JL9A 2UWQA 4DDGD 2J0KA 2LRUA 4DHZB 2KTFA 3T3NA 2I2YA 3PRZA 1J7BA 1E8ZA 1PGAA 1M4VA 3CSTA 2HE7A 1SE2A 1VZ7A 1AYFA 2X8XX 2KACA 1XD3B 3N20C 1OEYJ 2N7DA 3AE8B 3TMPB 4HPLB 1PDXA 1V2YA 5JXVA 3ECIA 2JUOA 1GUAB 5J18A 3QJZA 3VR9B 3AEGB 1FNVA 1NYRA 2CU1A 1JQ4A 2PIAA 3RUIB 2L8JA 3DBHI 2L76A 4LLGM 3AU5A 3WAPA 4MGKE 4MJSA 2WQYB 3TL5A 4PYUA 1N62A 3KUZA 4HEA1 1F77A 4NAMA 1H8CA 1GOZA 1QT9A 4DHZE 2M19A 2L1AA 2KDBA 1MVKA 3APFA 3WAMA 3DVGY 2I1JA 1UD7A 3H9DA 4WWPA 2RGFA 1TBEA 2KC1A 4RF1A 2L32A 4QAYA 3NOBA 1GC7A 3V62A 3KYDD 1VJKA 3NZ3A 1X1MA 3V61A 1I4GA 1DYQA 2LGSA 4W9KA 3AN1A 3Q2AC 3WAOA 2O6VD 4II2B 5L95C 1WJUA 4BAXA 2EELA 1FRDA 2NTSA 2MBQA 4DHJD 3T8MA 2MH7A 4TSSA 4FA6A 3JYUA 3W1YA 4TQ1A 4CHKA 1EWYC 4HDQA 4REZA 3AEEB 1OFFA 3IHPC 1SJHD 1TS2A 5DCNA 3AE6B 4R3DA 3DBRI 2VZKB 4PK1A 1AW7A 1R4MB 3BINA 3ZXRA 1FFVA 4KGTA 2LHEA 3VUYA 3RZWC 3CWIA 2LXAA 1KLGD 2GBNA 1KTKA 2MBEA 3R7QA 1RM6C 4EOYA 4MACA 2NTTA 2MRPA 2BYEA 1TS4A 1ISNA 1Y8RC 2LJ5A 2K1FA 3AECB 4LJOB 3ONSA 2Y5PA 2KLGA 2KHWB 1T5XD 3B1LX 1TS3A 1ET9A 1EU3A 2BKRB 1WZ0A 3ZJUA 3PVLA 1J7CA 3SD5A 3BY4B 2ZPNA 1WGHA 4A20A 3P2BA 2IGDA 3PGEA 1XLNA 4IUMB 2V3NA 2LMCA 3E56A 1N5WA 4UDUC 2HD5B 3PO0A 3LDZE 3Q8CA 4M0WA 4CQNA 2FCMA 1T0RC 1LFDA 3AXCA 3W5VB 2WYQA 4JLCA 4TV3A 2L83A 2W9NA 4KIKA 1H4RA 2L52A 1YJ1A 2KTRA 3CIRB 3FILB 3TIXA 2PPHA 2FCQA 3A1QB 4US8A 4KVGB 3ABVB 3AE1B 2N1WA 1WJ6A 1FNWA 2DAJA 2D3GA 3Q3NC 2KFKB 2AX5A 2KJRA 3X23A 3R66C 1WM2A 3IG3A 3A9KB 2R2OA 3TEXA 3SFDB 3MHSD 3ZO5B 1WZ3A 1GAQB 1N5XA 4ZHOA 1J0GA 5D7GA 2CR5A 4KGSA 3N3KB 3BVGA 2K8CA 4OVVA 1SGHA 2CU3A 2N1VA 2PVGC 3AB5A 2V1YA 1C79A 3PSEB 4M00A 3M95A 2V4IB 3APCA 1WGRA 3TCAA 3ZJVA 2RSUA 4IC7B 4GDKB 4OVZA 5G55A 4KDLB 3U8ZA 3V3XA 1KF6B 1N63A 2WLBA 1FMAD 2K3UA 3UF8A 4IM3A 2IJ0A 1FCLA 2Y3AA 1E6EB 2C5LC 2DYMA 2J4XA 2NS5A 3AE5B 3U30A 3GB1A 4IOIE 3PV1A 2AL3A 2JRIB 1C3TA 3Q3MC 3P4QB 3PZ7A 3KW5B 2HJ8A 5D94A 2M0XA 4GB9A 2YVCA 3BYYB 2BKFA 5FK9C 4F8CB 1XLPA 2KFKA 1YN3A 1EUVB 3DBRB 1LQBA 1QF6A 2AQ2B 3HRDD 5HFYA 1AARA 5LXHA 2MA9B 2GB1A 4H2AA 4BKGA 4AJWA 3ZIMA 1GC6A 1MHXA 4KIKB 2K6QA 2KMMA 1NDDA 3EFUA 2H88B 3AEAB 2JZPA 4MSQB 3MFGA 2ICIA 1UNSA 1ZXIA 4KZ0A 3VTUA 4MGZE 4BKTA 4LDTD 4NJCA 3Q6BA 4A3OA 2VH2A 3WIMA 3A4SC 4KKIA 2WS3B 1Z5SB 1T0QC 2GBMA 4ANVA 4K3BA 5CHVC 4DWFA 1HE8A 1L5PA 2SAKA 3A4RA 2Z59B 2WXJA 2XK5A 3NVYA 2WU5B 1SE9A 3OAWA 2ON8A 4W9HA 5JHAA 3DWMA 3AM9A 1V9JA 1ZXHA 5J17A 2GBJA 1K51A 4RGNA 3NUHB 2BBCA 4M02A 3HHMA 3B9JA 2FE8A 4XDDA 4MGIE 4JIOU 4EZJA 2WWZA 1ENFA 4X57B 4GLSC 3V6EB 4WQMA 1WRIA 2MLBA 3NY5A 4P1CC 4KV2A 1HA5A 1LM8B 5C1ZA 4HJKA 4RGTA 4GIVA 1U4AA 2LD9A 1GB4A 4W9CA 4K7UA 3RNCC 2WXFA 3MJ5A 1YQBA 2KFJA 2N9XA 1QZEA 5BMGA 4HROA 4WWOA 4LK0M 2J0MA 4NJ7A 4MEMA 1XT9B 2C7MB 1VZ8A 1ROEA 1RRBA 1TIFA 2WDVB 5BYSA 4XE0A 3MC8A 3IBEA 4A8XC 1WRDB 3NZUA 2QSDA 4NQKE 1OTRB 3ZQ4A 2MSED 3NG0A 3NHEB 2KDFB 2QILA 2IO3B 4MELA 3Q8AA 4EUTA 3IAM1 1R4NB 2DZKA 2BTEA 2BS3B 1YX5B 1PUTA 1JWUD 3T3OA 2CJOA 4DHJB 3SDLC 2AWTA 3LYYA 1C78A 2INNE 2KN5A 3NVVA 3DPDA 4GDLB 2Y5CA 3QC8B 3ZRFA 2CKHB 4RNAA 5E6JA 3ZKJC 3ZYYX 2KD0A 2VZKD 1ZPSA 4W9GA 1CMXB 2K8BA 3KUDB 1KLUD 1OQRA 1D5MC 3VDZA 4E3CA 2GI9A 1E5WA 1E7UA 3B08A 3QCAA 4XX5A 1V6EA 4ZYSA 4ITKA 1KRHA 4HXDA 3L13A 4I6LB 3B2GA 4MM3A 2WGSA 3J9CA 1BT0A 1K52A 1V86A 1RFKA 2WDRB 1RYJA 2FUG1 4NJ6A 4ARIA 1T0SC 1JWBD 2PKOA 2Y5BB 2IO0B 2HDEA 5HHDG 4FJZA 3OLMD 2W3SA 2LFIA 3IAS1 2PMVA 4B0MA 1HXYD 4HCNB 1HTOA 3AE3B 1JWSD 2WXRA 4HK2A 4RM8A 3WANA 2ZEQA 2UU7A 2MEKA 2LJIA 2R2QA 4S0RA 4ZRPA 4TKNA 2KN4A 2IY0B 3SEBA 1ZUD2 4BFRA 2A5UA 1WJ4A 3BK1A 4MGYE 4YL8A 2LASA 1ZP0B 3ZRCA 1EU4A 3AEFB 2L0TA 2YLMA 2E6XA 3I57A 2JZZA 3L0WB 1EF5A 2NBWB 1IP9A 1T0YA 3AE4B 1TYGB 1FXIA 2GRIA 2KDIA 5MPOA 2DX5B 2D5GA 2K6DB 4N58A 1KJTA 1YQ4B 5I4DA 1P7EA 2IYDB 2PE6B 3EHVA 3ETRA 4RGMA 2IY1B 2M56B 2D3AA 5IO9A 4HKZE 4ZOHC 2KLCA 2BQQA 3BVZA 5G5HA 2VH1A 2J0JA 1FRRA 4FLHA 4M8NA 3DBHB 2LGXA 1WR1A 2VRRB 2BPSA 2L3ZA 2M17A 2LGYA 2K9XA 2JWUA 1TJEA 2XEWA 3AEDB 5CHFA 5C3JB 1ZKHA 1YIWA 3DDCB 1MG4A 1R4NI 1HQRD 3Q8EA 1FCCC 1PGXA 2N0SB 1K53A 1WXVA 2ZJDA 4XYCA 4EE2A 3Q8BA 2HTHA 2M1MA 2MBHA 1RWSA 3VRAB 1C4AA 2JX5A 1EO6A 4GU2A 1TKEA 1WX7A 3RD2A 2V3PA 1A70A 2FAZA 1L2NA 1MI0A 4LNNA 1ACCA 1XCTL 1YOVB 1YQ3B 1ZDVA 2H89B 4HWIB 2ZCCA 1NI3A 2BWES 4ZHPA 4NZLB 2O2VB 4P7IA 4RCOA 2N7JA 5J2RA 1QILA 4AJYB 3B0AA 4E74A 5L83A 2K8HA 4M8MA 4HPPA 2OJWA 2N4FA 2JYTA 4XGAB 2JWZA 3GP7A 3L10B 4TUUA 3VAWA 3WA0A 4GDKA 4NY0A 2PJHA 2M4NA 2WXLA 3R7RA 2FBWB 4FULA 4KX6B 2XNAC 4FADA 1UUPA 2JSVX 2EMSA 4DQOC 1FFUA 3PHXB 2L7RA 4HDOA 3H8HA 1EF1A 2KX3A 2QEJC 1E9MA 1XEEA 3AH7A 1WH3A 1SB3C 1B1ZA 2LXCA 5C23A 1XLOA 4EKUA 4IDIA 2KWDA 2MW5A 3QWZB 2E3TA 3U4EG 2V9HA 3PS6A 2XBBC 2D11A 4FXCA 2V0GA 1MJDA 2DYOA 3WALA 4AOFA 1M94A 5G2NA 3DCGA 4C4VA 4YXDB 1KFYB 3W1SA 3D32A 1SJED 2WXHA 4Q2JA 2DYBA 2BB6A 2Q5WD 1QOBA 2C7NB 3UGBB 1GB1A 4ZRIA 1JROA 3ZNGC 4G0NB 3L17A 3P63A 2LRWA 4AUQC 4IWQA 2LUMA 2BGFA 1B9RA 2EMTA 3NZSA 1WMHB 2WX1A 5JZEB 3GOEA 1WXSA 2DWQA 4XZ4A 2OOBB 4G3XB 3L16A 2INPE 3TEWA 3ML8A 1IGDA 4LCDE 2KWUB 1XO3A 2G45B 3B2FA 4K81A 3I9V1 4G11A 4WH4A 3C8YA 1AWDA 5D3IB 1WI0A 3A9JA 3DQVA 1ESFA 5E6NA 4A90A 3LJ3A 5IP4D 1WGGA 1C4CA 4RMAA 2O6VA 3TJPA 2DZIA 3MP9A 1D5XC 4NAWB 2ZVOA 1F1HA 3TEYA 2W55A 4JQWC 4GN1A 3H7PA 3VH4B 5CX3A 2OEDA 1DGJA 3HIZA 3VUWA 2KOXA 4BVUC 3DHHC 3Q3OC 3MTNB 2WXNA 2REXA 2Z8LA 1L0YB 3IXSA 3H1UA 4HLEA 3Q8FA 3UIOB 3W2DA 2BVCA 3AU4A 2FUHB 3DVGX 2RDHA 4AP4C 1E90A 2KDEB 1WFYA 4N6EB 3MC9A 3VFKA 4L2YA 4DBGA 1PYWD 2ZNVC 4YTMB 1J8CA 1SEBD 1IYFA 4IKGA 4IW0A 1QOGA 4J3OD 3M62B 4ZYNA 4C80A 1PQSA 3WCQA 1D5ZC 4HVBA 3TUOA 1TS5A 2JZ3B 4W9JA 4W9IA 1C77A 4F7ZA 4XDCA 2MHJA 3OWEB 4C56C 5IOIA 3M63B 1WIAA 4EZLA 2NCNA 2KWCA 4E71A 1ET6A 1L4DB 1KH0A 1FIQA 1V8CA 3AE9B 3KWVA 3VRBB 4WAAA 5BMHA 1TY0A 1UGMA 4OW0A 2K0PA 1I4QA 2ZW0A 2ONQA 4GOCA 2JQRB 1YN5A 3ZTDA 1SIFA 3LB8C 4L23A 2MBOA 3EFCA 1XCQL 1VDVA 2RMMA 3MHZA 3Q69A 4A3PA 4YSXB 1ZGUB 3NRZA 4ZRQA 1Q10A 3P4PB 3W5UB 4NQLB 4MM3B 2LI5A 4B6WA 4MJSB 3AMZA 4MSMB 4JGHB 2KQSA 3SFEB 1YNTE 3V60A 2QHOA 1E8WA 1GNUA 1TZOA 1WM3A 4TMAB 1SIJA 2KAJA 3UQBA 1T6BX 2DHZA 5IA7A 3GS2A 3RNAC 1FD6A 3EUB2 5DPSA 3NVWA 3VTVA 4ZRJA 3RI7C 2G1EA 4ANXA 1QQRA 1N61A 1SBBB 3LXFA 1S1QB 2GMIC 2N9LA 2WXQA 2MJDA 1JCKB 2KQ7A 5EE0A 1T3QA 3QQ8B 2B76B 2Z0DB 2L00B 1WX9A 1WYGA 1CJEA 2R61A 4OZAA 3AV8A 3PTFC 4FN2A 2DAFA 5EE1A 4EEWA 3A9JB 1KM7A 4OZCA 3ZLZA 3KH0A 1S3SG 1TTNA 3URYA 2V4LA 4KDIC 2IGGA 2XN9C 1IUEA 3N32A 3JW0X 4ASWC 1XF5L 1V49A 2BS2B 2ZZPB 5IN7A 2INDC 4A9AA 4NAWA 1OQYA 1L4ZB 4WURA 3ZGZA 1WE7A 1VD2A 1PFDA 2J53A 1WX8A 4YT0B 4GSWA 2KXJA 3GZNB 2BYVE 4C7ZA 3W1SC 3BWUD 1AN8A 1MFWA 4L1BA 1YMHE 2RDGA 3A9KA 2D10A 5E6OA 1IBXA 2KMCA 4ARCA 1IPGA 2BW2A 4M01A 2M8SA 1FXAA 4JPSA 2IZVB 2LGIA 2KVZA 2FIDA 4P6VF 3PREA 1MHHE 2KDMA 1WSPA 3E9SA 2KTRB 2DBYA 1F0ZA 2KZRA 2IBIB 2QMTA 3I63C 4K1RB 1WMHA 4ANWA 2MP2A 3EECA 1WF9A 2GBKA 4RM9A 5BO4B 2CHZA 1YN4A 2G3QB 3UIPB 3OJ4B 2MP2B 4KSLC 1F52A 4N9F4 4PS8A 4JX1C 2JU6X 2RPVA 5C2TB 3NVZA 5JHBA 5AZHA 3AE2B 3M3JA 1UWXA 1VRAB 4EZKA 1FXTB 2M0AA 2A4ZA 2LZ6A 5GXGB 1Q5WB 3PLVA 3Q14C 4DXAB 2G4SA 1I7HA 4HPMB 1WXMA 4XWTA 5TSSA 2DZMA 3ZDMC 3UI3A 1WGKA 2I38A 3V05A 3A1QA 2AYOB 2J52A 5H8YE 4N59A 2XK5B 2EKEC 1ZE3D 4BKSD 5AUIA 2N9KA 3PPAA 2RR9A 3APDA 4GMVA 2G4DB 3ZNHB 1QLBB 2YEPB 3OJ3A 1CZPA 3KQ4A 5GMVA 4DK5A 3KVFB 4W9LA 4LNFA 2BF8B 3U7ZA 4D2KA 4YTNB 5CHWA 1SE4A 4LNOA 1G6JA 3VUXA 4RF0A 2CS4A 2K5PA 2MX2A 4WAFA 1UH6A 3BZDB 4USAA 3AEBB 4EFOA 1V80A 3R2IA 2W82A 3BIID 1LO5D 4HRSA 2KO3A 3PT2B 1FEHA 1VZ6A 1VLBA 4O1NA 1V5OA 2KT7A 3VTWA 2D2QA 3VH3B 2PLPA 1E8XA 2K39A 4OZBA 3I3TB 5EE9A 2LHDA 1CQVA 5HI1A 2JVCA 1C1YB 2KVRA 1I35A 2BYFA 4BBNC 2BT6A 1WYWB 3H6NA 2WXIA 3RCZA 2WXPA 5FR3A 4W9FA 1I4HA 2HTME 1A5RA 3MC0B 1UBIA 2ACZB 3PZDA 3P42A 2KKCA 3DVNU 3GZNI 3T9LA 1UF0A 3X0WA 2J42A 1C76A 2WNMA 4LJPB 4PYZA 4KGRA 1FM0D 2MBBB 5H92C 1QOAA 3DBLB 1P0RA 3ZUNA 1L7YA 1STEA 1NI2A 1CK1A 3NS8A 1UWMA 3PRMB 2BS4B 4YSZB 4WJPA 3AI5A 1WGYA 4K3CA 4JWSC 4JE3B 2KJ6A 3DHGC 1WR6E 4BOZB 1J19A 3I5JC 1JWAD 2LVQA 1DOXA 2JRHA 3FAHA 2JYEA 4DDID 2WXKA 3FKYA 2DNFA 4B95A 1TY2A 4XWWA 2NVUI 3JSVA 1WXQA 2PE9A 2WDQB 2WXGA 5EE3A 2ZW1A 2JT4B 4TQ0A 3U52E 2ZNVB 4HCPB 2GLSA 3SU8X 4HJGE 3C0RB 1FO4A 5DPWA 2HJ1A 2ZVNA 4ZRKA 4CYEA 1WY8A 1WGDA 1P9DU 3RNFC 1YJIA 4ACFA 2KC2A 5CTRC 1HZ6A 1E7PB 4YTPB 1BMLC 1KLVA 1HEZE 3BK2A 4J6IA 5BYRA 4DXGA 2LGDA 5AZGA 3QA8A 3UINB 5D6JB 3N1ZC 4JWUC 2W3RA 3N1XC 2QIEB 2KNBA 4MT5A 3K9PB 4FHJA 2PTLA 3QIJA 1N60A 1SE3A 2OHFA 4BZAA 5HG2A 3QARA 3L54A 1IGCA 2N9EB 3TEZA 3IT6B 1VCBA 1V97A 3Q3JA 3ZXVA 5BYQA 1E10A 5TR5A 3DOWA 3RPFC 4IG7B 4GGQA 3N1YC 1D6EC 2NBUA 4GDLA 4WIPA 3PLUA 1E8YA 3O13A 4AQ7A 4BOSC 2LEKA 3FILA 3KWLA 4FJVB 1I4PA 5KHQA 3HK0A 4KSKC 1TKYA 3CF6E 1V1PA 1WWTA 4LNIA 1WE6A 4PT5A 3HM3A 5BMIA 3CSFA 2GBRA 1I4XA 4M0WB 1WXAA 5FR6A 1JRPA 1LGRA 3DBSA 2I1KA 3RNBC 3RT3B 3DBLI 1NBFC 1SXTA 3RNGC 4FHKA 1HTQA 4LNKA 1NVID 4AS1A 3ZNZB 3ALBA 2BYTA 4I6NB 4WJOA 2FCNA 3PHWB 3OG5A 1C9FA 1N6ZA 2MQJA 5AEKB 2MCNB 3VVWB 4KKJA 1OQQA 1YX6B 2JPHA 3ZDTA 1BXTA 1RLFA 1GPXA 1C4PA 3ZVVA 1D4BA 4YWGG 3P1MA 1RAXA 3IT4B 2WU2B 1R7SA 1YD8U 3IFWB 4B9KA 3ZJTA 2KQ4X 4IWOA 3N30A 1Y56A 4LTUA 4A6QA 3HUIA 3L4PA 4KZCA 3O65B 4K7WA 4P16A 1F2RC 2PW9A 3RYTA 2AL6A 2C7HA 4ICUA 3S2AA 2K25A 4BKSA 4B0EA 4WJQA 1EWCA 5LLIA 3CMMB 1Q1OA 1IBXB 5IKCM 4OVUA 1MPEA 2AEHA 4WQOB 4WWMA 4AWJA 4WWNA 3VXWA 1L6UA 2C9WB 3RFZB 2X38A 2KWVB 1TT5B 2LVPA 5LNK1 1WJNA 1P1AA 2KK8A 3VQIA 2O6VB 4NPNA 2MJ3A 1L6VA 2N7EA 2ZCBA 2RPQA 3U2SC 2WDTB 1JWMD 5EDSA 1JALA 1JMLA 3GE3C 2FNJB 4A55A 3K9OB 2INCC 1P98A 2N9PC 2FIFA 3GE8C 5FKAC 3KLSX 4DXFA 3SHQA 2IDYA 2ASQA 2L05A 3RULA 2TSSA 4K7SA 3RMKC 4URKA 5AZFA 2DLBA 3P4RB 2D07B 2ZPYA 4W9EA 2LWPA 3R2TA 3N9YC 4W9DA 3NS1A 1QKZA 3IVFA 4S17A 2B3AA 2KX0A 1MG8A 3QK0A 2CHWA 3V6CB 1ZW7A 2EKIA 1DOYA 3KYCD 3C19A 3L08A 5KHOA 3QHTA 4ZDVA 1UGJA 2JF5A 2JXTA 2IO2B 5LXIB 2UYZB 3DHIC 2DENB 4C00A 1E7VA 2NPTB 5HKHA 4P1BC 4ICVA 1UELA 2SEBD 1FPYA 3Q3FA 1JRUA 1V1OA 4MH8A 1FNUA 3JSVB 3RZFA 2WXMA 2K22A 2V3SA 3VHTC 1VR9A 3EA6A 2O2VA 5DPRA 3QX1A 5IAAC 2RDBC 1L0VB 4OHJA 3U7DA 4MH0E 2QDFA 1V1PB 4HKQA 2GOWA 4ANUA 5D2MB 1L0XB 4RFBA 3ZNID 2NPTA 1K8RB 2IO1B 3DVNV 1LXDA 3KUCB 2NR2A 5D3DA 2WX0A 1DOIA 2LVOA 3PZ8A 4G50A 3P4SB 4NNJB 1QOFA 2OJRA 4XC2A 3BVMA 3ZTCA 3EGRA 2D3CA 3HVDA 3NJTA 3PRPB 4C4VB 1BUIC 2LUEA 2J7QB 1HZ5A 3HVZA 1F9JA 3QAQA 4CO7A 4RGOS 2CJNA 1XLQA 2CHXA 4YSYB 1ZDXA 3JVZX
chains in the Genus database with same CATH topology
3T9LA 2LRWA 1OEYA 3X0WA 4AUQC 4F1SA 3UQAA 1NDDA 3EFUA 4IWQA 4LJPB 4MSQB 2BGFA 4PYZA 2MBBB 3R3MA 2EMTA 4II3B 3NZSA 4KZ0A 1P0RA 1WMHB 2WX1A 1P3QU 3ZUNA 1L7YA 4WJNA 5JZEB 1Z2MA 3GOEA 1NI2A 1WXSA 3NS8A 3VTUA 3PRMB 4MGZE 4BKTA 1OGWA 4XZ4A 2OOBB 1GG3A 4WJPA 4LDTD 4G3XB 3L16A 4A3OA 3WIMA 3AI5A 3ML8A 1WGYA 3A4SC 2KJ6A 1WR6E 4BOZB 1J19A 4LCDE 1Z5SB 2KWUB 5DPTA 2G45B 2LVQA 4K81A 2GBMA 2JRHA 4ANVA 5CHVC 4DWFA 4G11A 1HE8A 1WI0A 2C60A 2Z0EB 1D3ZA 3A4RA 2Z59B 3A9JA 4IM0A 4DDID 3DQVA 1RFAA 5E6NA 3LJ3A 1V81A 2XK5A 4MDKE 4B95A 3ML9A 1SE9A 1TZ1A 3OAWA 3TBLD 2MWSB 4W9HA 5JHAA 3ENEA 4IWPA 2NVUI 1WGGA 3JSVA 1V9JA 2PE9A 4RMAA 4GXBA 2O6VA 5J17A 3TJPA 2DZIA 2GBJA 2JT4B 4TQ0A 2JXXA 2DZJA 2JY6A 2ZVOA 4NAWB 2ZNVB 4HCPB 3HHMA 4PS3A 3SU8X 4IM2A 4JQWC 2FCSA 2RD0A 4GN1A 4MGIE 4JIOU 4EZJA 2WWZA 3C0RB 3H7PA 5CX3A 3VH4B 4BBNF 1UBQA 3HIZA 1I42A 3H7PB 5DPWA 4X57B 3VUWA 3V6EB 2ZVNA 4ZRKA 4CYEA 1WY8A 2KOXA 1KOTA 1WGDA 2MLBA 5E6PA 2BWFA 3MTNB 4BVUC 3NY5A 1R4MI 3A33B 5JH5C 4KV2A 1P9DU 1LM8B 2REXA 1Q0WB 4G0NB 3H1UA 2KC2A 5CTRC 4HLEA 3UIOB 3HM6X 2KMAA 3AU4A 2FUHB 1V5TA 4HJKA 5C1ZA 3DVGX 4GIVA 4AP4C 3MJWA 3H7SA 1E90A 2KDEB 1KLVA 1TGZB 1WFYA 2KANA 1U4AA 4J6IA 2LGDA 5AZGA 2LD9A 3QA8A 4LDTB 3UINB 4PS7A 3VFKA 4DBGA 4W9CA 1XQQA 4K7UA 2ZNVC 5D6JB 1J8CA 1IYFA 2KNBA 3EC8A 3K9PB 4FHJA 1YQBA 2KFJA 4IW0A 2N9XA 1QZEA 3QIJA 4WWOA 4I6PA 3M62B 4ZYNA 1GJZA 3AULA 2NBVB 2J0MA 1PQSA 4NJ7A 2L0FA 4MEMA 4HVBA 1XT9B 3QARA 4FJYA 2C7MB 3L54A 4FBJB 4XX5A 2JZ3B 3ZW3A 2KJHB 2N9EB 2PEAA 4W9JA 4W9IA 1RRBA 1UZXB 4JL9A 2UWQA 4F7ZA 1VCBA 3IBEA 4DDGD 2J0KA 1WRDB 2LRUA 3NZUA 3Q3JA 2KTFA 3M63B 4DHZB 1WIAA 3PRZA 4NQKE 4EZLA 1OTRB 2NCNA 1E8ZA 5TR5A 3DOWA 2KWCA 2MSED 4GGQA 4IG7B 4E71A 3NHEB 2KDFB 2IO3B 3CSTA 4MELA 2NBUA 2HE7A 4GDLA 4EUTA 3PLUA 2DZKA 1E8YA 4BOSC 4WAAA 1UGMA 1YX5B 1XD3B 1OEYJ 2N7DA 4FJVB 3TMPB 4GOCA 4HPLB 4DHJB 3SDLC 3ZTDA 1V2YA 2AWTA 1SIFA 3ECIA 5KHQA 2JUOA 1GUAB 2MBOA 3HK0A 4KSKC 5J18A 3QJZA 3CF6E 2CU1A 2KN5A 4A3PA 3RUIB 2L8JA 3DPDA 1WE6A 3DBHI 3HM3A 4GDLB 3CSFA 1ZGUB 2L76A 2GBRA 4M0WB 3AU5A 3QC8B 3WAPA 2CKHB 3ZRFA 1WXAA 3ZKJC 4MGKE 4MJSA 4NQLB 5FR6A 2KD0A 2LI5A 4B6WA 4MJSB 4W9GA 4MSMB 3TL5A 1CMXB 2K8BA 4JGHB 4PYUA 3DBSA 3KUDB 2I1KA 2KQSA 3KUZA 1H8CA 3V60A 2QHOA 3RT3B 1E8WA 3DBLI 4DHZE 3VDZA 1NBFC 1GNUA 2KDBA 3APFA 3WAMA 1WM3A 4E3CA 1E5WA 4FHKA 3UQBA 1E7UA 3B08A 3QCAA 3DVGY 2I1JA 1UD7A 1V6EA 2DHZA 2RGFA 3ALBA 3H9DA 4I6NB 1TBEA 4WWPA 3ZNZB 2KC1A 4WJOA 2FCNA 5IA7A 3PHWB 2MQJA 4HXDA 3NOBA 1GC7A 3V62A 3L13A 3KYDD 4I6LB 5AEKB 1X1MA 5DPSA 2MCNB 3V61A 3VTVA 4MM3A 4ZRJA 4ANXA 3VVWB 1BT0A 1V86A 4W9KA 1S1QB 2GMIC 4NJ6A 1YX6B 3WAOA 2KQ7A 2O6VD 2Y5BB 2IO0B 2JPHA 3QQ8B 2Z0DB 4II2B 5L95C 2L00B 3ZDTA 1WJUA 4FJZA 1WX9A 3OLMD 2MBQA 4DHJD 3T8MA 1RLFA 4HCNB 4HK2A 3ZVVA 4FA6A 4RM8A 3WANA 2ZEQA 3JYUA 3PTFC 4FN2A 1RAXA 2DAFA 2R2QA 4EEWA 3A9JB 1KM7A 1YD8U 3ZLZA 3W1YA 3KH0A 1S3SG 1TTNA 3IFWB 4B9KA 2V4LA 4TQ1A 4KDIC 4TKNA 4CHKA 2IY0B 4HDQA 4IWOA 3N32A 3N30A 4BFRA 3JW0X 3IHPC 4ASWC 2A5UA 5DCNA 1WJ4A 1V49A 3DBRI 2ZZPB 4KZCA 3O65B 4K7WA 3BINA 3RYTA 4MGYE 4YL8A 2AL6A 3VUYA 2C7HA 4ICUA 1OQYA 2LASA 4NAWA 3ZRCA 3RZWC 3S2AA 2K25A 2LXAA 4BKSA 1WE7A 1VD2A 2L0TA 2YLMA 4WJQA 2JZZA 3L0WB 1EF5A 2GBNA 2NBWB 5LLIA 1IP9A 1WX8A 2MBEA 3R7QA 4GSWA 1T0YA 2KXJA 4EOYA 3CMMB 1Q1OA 2KDIA 4OVUA 2DX5B 2BYVE 2AEHA 2MRPA 2BYEA 2K6DB 3W1SC 1KJTA 4WQOB 4AWJA 1ISNA 1Y8RC 2LJ5A 2K1FA 3A9KA 4WWNA 3VXWA 2D10A 2C9WB 4LJOB 5E6OA 2IYDB 2PE6B 2KMCA 3EHVA 3ONSA 1IPGA 2KWVB 2KLGA 2KHWB 3B1LX 2LVPA 2M8SA 2IZVB 1WJNA 2IY1B 2FIDA 1P1AA 1WZ0A 2BKRB 2KK8A 3VQIA 3PVLA 2O6VB 3SD5A 4NPNA 2KLCA 2N7EA 3BY4B 2ZCBA 1WGHA 2ZPNA 3P2BA 3PREA 4A20A 2RPQA 2WDTB 3PGEA 2J0JA 2KTRB 4IUMB 4FLHA 4M8NA 5EDSA 2LGXA 1WR1A 2KZRA 2VRRB 2IBIB 4K1RB 1WMHA 2BPSA 4ANWA 2MP2A 2L3ZA 2M17A 2HD5B 2LGYA 3EECA 1WF9A 5CHFA 2GBKA 2XEWA 1ZKHA 2FNJB 3K9OB 1YIWA 1P98A 3LDZE 2N9PC 4RM9A 2FIFA 1R4NI 3DDCB 5BO4B 2CHZA 2FCMA 2G3QB 3UIPB 1WXVA 2ZJDA 2MP2B 3OJ4B 1LFDA 3AXCA 4KSLC 3SHQA 2HTHA 2M1MA 2MBHA 2WYQA 4JLCA 4TV3A 2ASQA 2W9NA 4KIKA 4N9F4 4PS8A 2L05A 3RULA 1H4RA 1YJ1A 4K7SA 2KTRA 4URKA 3TIXA 2PPHA 2FCQA 3A1QB 1EO6A 4KVGB 4GU2A 5AZFA 2D07B 2N1WA 1WX7A 2ZPYA 4W9EA 2LWPA 5JHBA 3RD2A 1WJ6A 4W9DA 5AZHA 2FAZA 1L2NA 3IVFA 2DAJA 2D3GA 3M3JA 2B3AA 2KX0A 2KFKB 1MG8A 3QK0A 2KJRA 4EZKA 1FXTB 4HWIB 2A4ZA 2CHWA 2ZCCA 1ZW7A 3V6CB 2BWES 2LZ6A 3KYCD 3R66C 1Q5WB 3X23A 3PLVA 1WM2A 3IG3A 3L08A 3A9KB 5KHOA 2O2VB 2R2OA 3MHSD 3QHTA 4P7IA 1WZ3A 2G4SA 4HPMB 3ZO5B 1WXMA 4DXAB 4ZDVA 2DZMA 3ZDMC 2JF5A 5J2RA 2IO2B 5LXIB 2UYZB 1J0GA 5D7GA 2CR5A 2DENB 1E7VA 2NPTB 4AJYB 5HKHA 3B0AA 4ICVA 3N3KB 4E74A 1UELA 5L83A 3A1QA 2AYOB 2K8HA 4M8MA 2K8CA 4OVVA 1SGHA 3Q3FA 1JRUA 2XK5B 2EKEC 2N1VA 2N4FA 2JWZA 3L10B 4TUUA 3JSVB 2V1YA 4BKSD 3VAWA 3PSEB 3PPAA 4GDKA 2RR9A 3APDA 4NY0A 4GMVA 3RZFA 2V3SA 3VHTC 3WA0A 2PJHA 2G4DB 3M95A 3ZNHB 2M4NA 2O2VA 3OJ3A 3R7RA 4DK5A 3APCA 5GMVA 3KVFB 1WGRA 4W9LA 5DPRA 2BF8B 3QX1A 3TCAA 5IAAC 3U7DA 4FULA 2RSUA 4MH0E 5CHWA 4FADA 4IC7B 4GDKB 2EMSA 1G6JA 5G55A 3VUXA 4KDLB 3U8ZA 2GOWA 4ANUA 2CS4A 2MX2A 1UH6A 5D2MB 3PHXB 4EFOA 2L7RA 4HDOA 1V80A 1EF1A 2KX3A 3ZNID 2NPTA 1WH3A 1K8RB 2IO1B 3DVNV 2LXCA 1LXDA 4IM3A 5C23A 3UF8A 3KUCB 2NR2A 2KO3A 2WX0A 3PT2B 2C5LC 4EKUA 2LVOA 2MW5A 4G50A 2DYMA 1V5OA 3QWZB 4ZRIA 3VTWA 2D2QA 2NS5A 3U30A 4NNJB 3VH3B 3PV1A 2AL3A 2JRIB 1E8XA 1C3TA 2K39A 3I3TB 2HJ8A 3KW5B 5D94A 2M0XA 4GB9A 2OJRA 2YVCA 4XC2A 3PS6A 2BKFA 3ZTCA 4F8CB 2XBBC 2KFKA 2D11A 2DYOA 2JVCA 1EUVB 3WALA 1C1YB 2KVRA 1I35A 4AOFA 1M94A 5G2NA 3DCGA 2BYFA 4BBNC 1LQBA 3PRPB 1WYWB 3H6NA 3W1SA 3D32A 1AARA 3RCZA 2LUEA 2MA9B 5LXHA 2J7QB 4BKGA 4AJWA 3ZIMA 2DYBA 1F9JA 1GC6A 3QAQA 4W9FA 4KIKB 4CO7A 1A5RA 1UBIA 2C7NB 2CHXA 2K6QA 3UGBB 3PZDA 3JVZX 2KKCA 3ZNGC 3DVNU 3L17A 3GZNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9L A;  2LRW A;  1OEY A;  3X0W A;  4AUQ C;  4F1S A;  3UQA A;  1NDD A;  3EFU A;  4IWQ A;  4LJP B;  4MSQ B;  2BGF A;  4PYZ A;  2MBB B;  3R3M A;  2EMT A;  4II3 B;  3NZS A;  4KZ0 A;  1P0R A;  1WMH B;  2WX1 A;  1P3Q U;  3ZUN A;  1L7Y A;  4WJN A;  5JZE B;  1Z2M A;  3GOE A;  1NI2 A;  1WXS A;  3NS8 A;  3VTU A;  3PRM B;  4MGZ E;  4BKT A;  1OGW A;  4XZ4 A;  2OOB B;  1GG3 A;  4WJP A;  4LDT D;  4G3X B;  3L16 A;  4A3O A;  3WIM A;  3AI5 A;  3ML8 A;  1WGY A;  3A4S C;  2KJ6 A;  1WR6 E;  4BOZ B;  1J19 A;  4LCD E;  1Z5S B;  2KWU B;  5DPT A;  2G45 B;  2LVQ A;  4K81 A;  2GBM A;  2JRH A;  4ANV A;  5CHV C;  4DWF A;  4G11 A;  1HE8 A;  1WI0 A;  2C60 A;  2Z0E B;  1D3Z A;  3A4R A;  2Z59 B;  3A9J A;  4IM0 A;  4DDI D;  3DQV A;  1RFA A;  5E6N A;  3LJ3 A;  1V81 A;  2XK5 A;  4MDK E;  4B95 A;  3ML9 A;  1SE9 A;  1TZ1 A;  3OAW A;  3TBL D;  2MWS B;  4W9H A;  5JHA A;  3ENE A;  4IWP A;  2NVU I;  1WGG A;  3JSV A;  1V9J A;  2PE9 A;  4RMA A;  4GXB A;  2O6V A;  5J17 A;  3TJP A;  2DZI A;  2GBJ A;  2JT4 B;  4TQ0 A;  2JXX A;  2DZJ A;  2JY6 A;  2ZVO A;  4NAW B;  2ZNV B;  4HCP B;  3HHM A;  4PS3 A;  3SU8 X;  4IM2 A;  4JQW C;  2FCS A;  2RD0 A;  4GN1 A;  4MGI E;  4JIO U;  4EZJ A;  2WWZ A;  3C0R B;  3H7P A;  5CX3 A;  3VH4 B;  4BBN F;  1UBQ A;  3HIZ A;  1I42 A;  3H7P B;  5DPW A;  4X57 B;  3VUW A;  3V6E B;  2ZVN A;  4ZRK A;  4CYE A;  1WY8 A;  2KOX A;  1KOT A;  1WGD A;  2MLB A;  5E6P A;  2BWF A;  3MTN B;  4BVU C;  3NY5 A;  1R4M I;  3A33 B;  5JH5 C;  4KV2 A;  1P9D U;  1LM8 B;  2REX A;  1Q0W B;  4G0N B;  3H1U A;  2KC2 A;  5CTR C;  4HLE A;  3UIO B;  3HM6 X;  2KMA A;  3AU4 A;  2FUH B;  1V5T A;  4HJK A;  5C1Z A;  3DVG X;  4GIV A;  4AP4 C;  3MJW A;  3H7S A;  1E90 A;  2KDE B;  1KLV A;  1TGZ B;  1WFY A;  2KAN A;  1U4A A;  4J6I A;  2LGD A;  5AZG A;  2LD9 A;  3QA8 A;  4LDT B;  3UIN B;  4PS7 A;  3VFK A;  4DBG A;  4W9C A;  1XQQ A;  4K7U A;  2ZNV C;  5D6J B;  1J8C A;  1IYF A;  2KNB A;  3EC8 A;  3K9P B;  4FHJ A;  1YQB A;  2KFJ A;  4IW0 A;  2N9X A;  1QZE A;  3QIJ A;  4WWO A;  4I6P A;  3M62 B;  4ZYN A;  1GJZ A;  3AUL A;  2NBV B;  2J0M A;  1PQS A;  4NJ7 A;  2L0F A;  4MEM A;  4HVB A;  1XT9 B;  3QAR A;  4FJY A;  2C7M B;  3L54 A;  4FBJ B;  4XX5 A;  2JZ3 B;  3ZW3 A;  2KJH B;  2N9E B;  2PEA A;  4W9J A;  4W9I A;  1RRB A;  1UZX B;  4JL9 A;  2UWQ A;  4F7Z A;  1VCB A;  3IBE A;  4DDG D;  2J0K A;  1WRD B;  2LRU A;  3NZU A;  3Q3J A;  2KTF A;  3M63 B;  4DHZ B;  1WIA A;  3PRZ A;  4NQK E;  4EZL A;  1OTR B;  2NCN A;  1E8Z A;  5TR5 A;  3DOW A;  2KWC A;  2MSE D;  4GGQ A;  4IG7 B;  4E71 A;  3NHE B;  2KDF B;  2IO3 B;  3CST A;  4MEL A;  2NBU A;  2HE7 A;  4GDL A;  4EUT A;  3PLU A;  2DZK A;  1E8Y A;  4BOS C;  4WAA A;  1UGM A;  1YX5 B;  1XD3 B;  1OEY J;  2N7D A;  4FJV B;  3TMP B;  4GOC A;  4HPL B;  4DHJ B;  3SDL C;  3ZTD A;  1V2Y A;  2AWT A;  1SIF A;  3ECI A;  5KHQ A;  2JUO A;  1GUA B;  2MBO A;  3HK0 A;  4KSK C;  5J18 A;  3QJZ A;  3CF6 E;  2CU1 A;  2KN5 A;  4A3P A;  3RUI B;  2L8J A;  3DPD A;  1WE6 A;  3DBH I;  3HM3 A;  4GDL B;  3CSF A;  1ZGU B;  2L76 A;  2GBR A;  4M0W B;  3AU5 A;  3QC8 B;  3WAP A;  2CKH B;  3ZRF A;  1WXA A;  3ZKJ C;  4MGK E;  4MJS A;  4NQL B;  5FR6 A;  2KD0 A;  2LI5 A;  4B6W A;  4MJS B;  4W9G A;  4MSM B;  3TL5 A;  1CMX B;  2K8B A;  4JGH B;  4PYU A;  3DBS A;  3KUD B;  2I1K A;  2KQS A;  3KUZ A;  1H8C A;  3V60 A;  2QHO A;  3RT3 B;  1E8W A;  3DBL I;  4DHZ E;  3VDZ A;  1NBF C;  1GNU A;  2KDB A;  3APF A;  3WAM A;  1WM3 A;  4E3C A;  1E5W A;  4FHK A;  3UQB A;  1E7U A;  3B08 A;  3QCA A;  3DVG Y;  2I1J A;  1UD7 A;  1V6E A;  2DHZ A;  2RGF A;  3ALB A;  3H9D A;  4I6N B;  1TBE A;  4WWP A;  3ZNZ B;  2KC1 A;  4WJO A;  2FCN A;  5IA7 A;  3PHW B;  2MQJ A;  4HXD A;  3NOB A;  1GC7 A;  3V62 A;  3L13 A;  3KYD D;  4I6L B;  5AEK B;  1X1M A;  5DPS A;  2MCN B;  3V61 A;  3VTV A;  4MM3 A;  4ZRJ A;  4ANX A;  3VVW B;  1BT0 A;  1V86 A;  4W9K A;  1S1Q B;  2GMI C;  4NJ6 A;  1YX6 B;  3WAO A;  2KQ7 A;  2O6V D;  2Y5B B;  2IO0 B;  2JPH A;  3QQ8 B;  2Z0D B;  4II2 B;  5L95 C;  2L00 B;  3ZDT A;  1WJU A;  4FJZ A;  1WX9 A;  3OLM D;  2MBQ A;  4DHJ D;  3T8M A;  1RLF A;  4HCN B;  4HK2 A;  3ZVV A;  4FA6 A;  4RM8 A;  3WAN A;  2ZEQ A;  3JYU A;  3PTF C;  4FN2 A;  1RAX A;  2DAF A;  2R2Q A;  4EEW A;  3A9J B;  1KM7 A;  1YD8 U;  3ZLZ A;  3W1Y A;  3KH0 A;  1S3S G;  1TTN A;  3IFW B;  4B9K A;  2V4L A;  4TQ1 A;  4KDI C;  4TKN A;  4CHK A;  2IY0 B;  4HDQ A;  4IWO A;  3N32 A;  3N30 A;  4BFR A;  3JW0 X;  3IHP C;  4ASW C;  2A5U A;  5DCN A;  1WJ4 A;  1V49 A;  3DBR I;  2ZZP B;  4KZC A;  3O65 B;  4K7W A;  3BIN A;  3RYT A;  4MGY E;  4YL8 A;  2AL6 A;  3VUY A;  2C7H A;  4ICU A;  1OQY A;  2LAS A;  4NAW A;  3ZRC A;  3RZW C;  3S2A A;  2K25 A;  2LXA A;  4BKS A;  1WE7 A;  1VD2 A;  2L0T A;  2YLM A;  4WJQ A;  2JZZ A;  3L0W B;  1EF5 A;  2GBN A;  2NBW B;  5LLI A;  1IP9 A;  1WX8 A;  2MBE A;  3R7Q A;  4GSW A;  1T0Y A;  2KXJ A;  4EOY A;  3CMM B;  1Q1O A;  2KDI A;  4OVU A;  2DX5 B;  2BYV E;  2AEH A;  2MRP A;  2BYE A;  2K6D B;  3W1S C;  1KJT A;  4WQO B;  4AWJ A;  1ISN A;  1Y8R C;  2LJ5 A;  2K1F A;  3A9K A;  4WWN A;  3VXW A;  2D10 A;  2C9W B;  4LJO B;  5E6O A;  2IYD B;  2PE6 B;  2KMC A;  3EHV A;  3ONS A;  1IPG A;  2KWV B;  2KLG A;  2KHW B;  3B1L X;  2LVP A;  2M8S A;  2IZV B;  1WJN A;  2IY1 B;  2FID A;  1P1A A;  1WZ0 A;  2BKR B;  2KK8 A;  3VQI A;  3PVL A;  2O6V B;  3SD5 A;  4NPN A;  2KLC A;  2N7E A;  3BY4 B;  2ZCB A;  1WGH A;  2ZPN A;  3P2B A;  3PRE A;  4A20 A;  2RPQ A;  2WDT B;  3PGE A;  2J0J A;  2KTR B;  4IUM B;  4FLH A;  4M8N A;  5EDS A;  2LGX A;  1WR1 A;  2KZR A;  2VRR B;  2IBI B;  4K1R B;  1WMH A;  2BPS A;  4ANW A;  2MP2 A;  2L3Z A;  2M17 A;  2HD5 B;  2LGY A;  3EEC A;  1WF9 A;  5CHF A;  2GBK A;  2XEW A;  1ZKH A;  2FNJ B;  3K9O B;  1YIW A;  1P98 A;  3LDZ E;  2N9P C;  4RM9 A;  2FIF A;  1R4N I;  3DDC B;  5BO4 B;  2CHZ A;  2FCM A;  2G3Q B;  3UIP B;  1WXV A;  2ZJD A;  2MP2 B;  3OJ4 B;  1LFD A;  3AXC A;  4KSL C;  3SHQ A;  2HTH A;  2M1M A;  2MBH A;  2WYQ A;  4JLC A;  4TV3 A;  2ASQ A;  2W9N A;  4KIK A;  4N9F 4;  4PS8 A;  2L05 A;  3RUL A;  1H4R A;  1YJ1 A;  4K7S A;  2KTR A;  4URK A;  3TIX A;  2PPH A;  2FCQ A;  3A1Q B;  1EO6 A;  4KVG B;  4GU2 A;  5AZF A;  2D07 B;  2N1W A;  1WX7 A;  2ZPY A;  4W9E A;  2LWP A;  5JHB A;  3RD2 A;  1WJ6 A;  4W9D A;  5AZH A;  2FAZ A;  1L2N A;  3IVF A;  2DAJ A;  2D3G A;  3M3J A;  2B3A A;  2KX0 A;  2KFK B;  1MG8 A;  3QK0 A;  2KJR A;  4EZK A;  1FXT B;  4HWI B;  2A4Z A;  2CHW A;  2ZCC A;  1ZW7 A;  3V6C B;  2BWE S;  2LZ6 A;  3KYC D;  3R66 C;  1Q5W B;  3X23 A;  3PLV A;  1WM2 A;  3IG3 A;  3L08 A;  3A9K B;  5KHO A;  2O2V B;  2R2O A;  3MHS D;  3QHT A;  4P7I A;  1WZ3 A;  2G4S A;  4HPM B;  3ZO5 B;  1WXM A;  4DXA B;  4ZDV A;  2DZM A;  3ZDM C;  2JF5 A;  5J2R A;  2IO2 B;  5LXI B;  2UYZ B;  1J0G A;  5D7G A;  2CR5 A;  2DEN B;  1E7V A;  2NPT B;  4AJY B;  5HKH A;  3B0A A;  4ICV A;  3N3K B;  4E74 A;  1UEL A;  5L83 A;  3A1Q A;  2AYO B;  2K8H A;  4M8M A;  2K8C A;  4OVV A;  1SGH A;  3Q3F A;  1JRU A;  2XK5 B;  2EKE C;  2N1V A;  2N4F A;  2JWZ A;  3L10 B;  4TUU A;  3JSV B;  2V1Y A;  4BKS D;  3VAW A;  3PSE B;  3PPA A;  4GDK A;  2RR9 A;  3APD A;  4NY0 A;  4GMV A;  3RZF A;  2V3S A;  3VHT C;  3WA0 A;  2PJH A;  2G4D B;  3M95 A;  3ZNH B;  2M4N A;  2O2V A;  3OJ3 A;  3R7R A;  4DK5 A;  3APC A;  5GMV A;  3KVF B;  1WGR A;  4W9L A;  5DPR A;  2BF8 B;  3QX1 A;  3TCA A;  5IAA C;  3U7D A;  4FUL A;  2RSU A;  4MH0 E;  5CHW A;  4FAD A;  4IC7 B;  4GDK B;  2EMS A;  1G6J A;  5G55 A;  3VUX A;  4KDL B;  3U8Z A;  2GOW A;  4ANU A;  2CS4 A;  2MX2 A;  1UH6 A;  5D2M B;  3PHX B;  4EFO A;  2L7R A;  4HDO A;  1V80 A;  1EF1 A;  2KX3 A;  3ZNI D;  2NPT A;  1WH3 A;  1K8R B;  2IO1 B;  3DVN V;  2LXC A;  1LXD A;  4IM3 A;  5C23 A;  3UF8 A;  3KUC B;  2NR2 A;  2KO3 A;  2WX0 A;  3PT2 B;  2C5L C;  4EKU A;  2LVO A;  2MW5 A;  4G50 A;  2DYM A;  1V5O A;  3QWZ B;  4ZRI A;  3VTW A;  2D2Q A;  2NS5 A;  3U30 A;  4NNJ B;  3VH3 B;  3PV1 A;  2AL3 A;  2JRI B;  1E8X A;  1C3T A;  2K39 A;  3I3T B;  2HJ8 A;  3KW5 B;  5D94 A;  2M0X A;  4GB9 A;  2OJR A;  2YVC A;  4XC2 A;  3PS6 A;  2BKF A;  3ZTC A;  4F8C B;  2XBB C;  2KFK A;  2D11 A;  2DYO A;  2JVC A;  1EUV B;  3WAL A;  1C1Y B;  2KVR A;  1I35 A;  4AOF A;  1M94 A;  5G2N A;  3DCG A;  2BYF A;  4BBN C;  1LQB A;  3PRP B;  1WYW B;  3H6N A;  3W1S A;  3D32 A;  1AAR A;  3RCZ A;  2LUE A;  2MA9 B;  5LXH A;  2J7Q B;  4BKG A;  4AJW A;  3ZIM A;  2DYB A;  1F9J A;  1GC6 A;  3QAQ A;  4W9F A;  4KIK B;  4CO7 A;  1A5R A;  1UBI A;  2C7N B;  2CHX A;  2K6Q A;  3UGB B;  3PZD A;  3JVZ X;  2KKC A;  3ZNG C;  3DVN U;  3L17 A;  3GZN I; 
#chains in the Genus database with same CATH topology
 1OEY A;  4F1S A;  3UQA A;  2WP9 B;  4C7Y A;  1K50 A;  2AQ1 B;  3R3M A;  4II3 B;  2PVO D;  1SSN A;  1P3Q U;  3AE7 B;  4WJN A;  1NYQ A;  1Z2M A;  3BYT B;  1OGW A;  3R8B A;  5G5G A;  1GG3 A;  2IPK D;  1PGB A;  4RH6 A;  3TSS A;  5AUK A;  1EM7 A;  5DPT A;  2G9H D;  1E0Z A;  1JW9 D;  2C60 A;  2Z0E B;  1D3Z A;  2QCZ A;  4IM0 A;  1RFA A;  4MDK E;  1V81 A;  2W54 A;  1I4R A;  3ML9 A;  1SF0 A;  1TZ1 A;  3TBL D;  2MWS B;  2KYW A;  3ENE A;  4IWP A;  1P7F A;  4GXB A;  3W9C B;  2JXX A;  2DZJ A;  2JY6 A;  4PS3 A;  4IM2 A;  2FCS A;  2RD0 A;  4BBN F;  1UBQ A;  2MJE A;  1NEN B;  1I42 A;  3H7P B;  3RN9 C;  1KOT A;  5E6P A;  4US9 A;  2BWF A;  1R4M I;  3A33 B;  5JH5 C;  2AQ3 B;  1Q0W B;  2IGH A;  3VR8 B;  3HM6 X;  2KMA A;  2QJL A;  1V5T A;  2BB5 A;  3MJW A;  3H7S A;  3RNE C;  1TGZ B;  2KAN A;  3DWG C;  1ZOY B;  4LDT B;  4PS7 A;  1XQQ A;  3EC8 A;  1J7A A;  2QC8 A;  1XXG A;  1TKG A;  3FC4 A;  2NMQ A;  1YJJ A;  4I6P A;  1GJZ A;  3AUL A;  2NBV B;  2YEP F;  2L0F A;  1F2R I;  3SR6 A;  2D3B A;  5T8I A;  2WXO A;  4FJY A;  4FBJ B;  3ZW3 A;  2WHI A;  2KJH B;  2PEA A;  1NEK B;  1UZX B;  4JL9 A;  2UWQ A;  4DDG D;  2J0K A;  2LRU A;  4DHZ B;  2KTF A;  3T3N A;  2I2Y A;  3PRZ A;  1J7B A;  1E8Z A;  1PGA A;  1M4V A;  3CST A;  2HE7 A;  1SE2 A;  1VZ7 A;  1AYF A;  2X8X X;  2KAC A;  1XD3 B;  3N20 C;  1OEY J;  2N7D A;  3AE8 B;  3TMP B;  4HPL B;  1PDX A;  1V2Y A;  5JXV A;  3ECI A;  2JUO A;  1GUA B;  5J18 A;  3QJZ A;  3VR9 B;  3AEG B;  1FNV A;  1NYR A;  2CU1 A;  1JQ4 A;  2PIA A;  3RUI B;  2L8J A;  3DBH I;  2L76 A;  4LLG M;  3AU5 A;  3WAP A;  4MGK E;  4MJS A;  2WQY B;  3TL5 A;  4PYU A;  1N62 A;  3KUZ A;  4HEA 1;  1F77 A;  4NAM A;  1H8C A;  1GOZ A;  1QT9 A;  4DHZ E;  2M19 A;  2L1A A;  2KDB A;  1MVK A;  3APF A;  3WAM A;  3DVG Y;  2I1J A;  1UD7 A;  3H9D A;  4WWP A;  2RGF A;  1TBE A;  2KC1 A;  4RF1 A;  2L32 A;  4QAY A;  3NOB A;  1GC7 A;  3V62 A;  3KYD D;  1VJK A;  3NZ3 A;  1X1M A;  3V61 A;  1I4G A;  1DYQ A;  2LGS A;  4W9K A;  3AN1 A;  3Q2A C;  3WAO A;  2O6V D;  4II2 B;  5L95 C;  1WJU A;  4BAX A;  2EEL A;  1FRD A;  2NTS A;  2MBQ A;  4DHJ D;  3T8M A;  2MH7 A;  4TSS A;  4FA6 A;  3JYU A;  3W1Y A;  4TQ1 A;  4CHK A;  1EWY C;  4HDQ A;  4REZ A;  3AEE B;  1OFF A;  3IHP C;  1SJH D;  1TS2 A;  5DCN A;  3AE6 B;  4R3D A;  3DBR I;  2VZK B;  4PK1 A;  1AW7 A;  1R4M B;  3BIN A;  3ZXR A;  1FFV A;  4KGT A;  2LHE A;  3VUY A;  3RZW C;  3CWI A;  2LXA A;  1KLG D;  2GBN A;  1KTK A;  2MBE A;  3R7Q A;  1RM6 C;  4EOY A;  4MAC A;  2NTT A;  2MRP A;  2BYE A;  1TS4 A;  1ISN A;  1Y8R C;  2LJ5 A;  2K1F A;  3AEC B;  4LJO B;  3ONS A;  2Y5P A;  2KLG A;  2KHW B;  1T5X D;  3B1L X;  1TS3 A;  1ET9 A;  1EU3 A;  2BKR B;  1WZ0 A;  3ZJU A;  3PVL A;  1J7C A;  3SD5 A;  3BY4 B;  2ZPN A;  1WGH A;  4A20 A;  3P2B A;  2IGD A;  3PGE A;  1XLN A;  4IUM B;  2V3N A;  2LMC A;  3E56 A;  1N5W A;  4UDU C;  2HD5 B;  3PO0 A;  3LDZ E;  3Q8C A;  4M0W A;  4CQN A;  2FCM A;  1T0R C;  1LFD A;  3AXC A;  3W5V B;  2WYQ A;  4JLC A;  4TV3 A;  2L83 A;  2W9N A;  4KIK A;  1H4R A;  2L52 A;  1YJ1 A;  2KTR A;  3CIR B;  3FIL B;  3TIX A;  2PPH A;  2FCQ A;  3A1Q B;  4US8 A;  4KVG B;  3ABV B;  3AE1 B;  2N1W A;  1WJ6 A;  1FNW A;  2DAJ A;  2D3G A;  3Q3N C;  2KFK B;  2AX5 A;  2KJR A;  3X23 A;  3R66 C;  1WM2 A;  3IG3 A;  3A9K B;  2R2O A;  3TEX A;  3SFD B;  3MHS D;  3ZO5 B;  1WZ3 A;  1GAQ B;  1N5X A;  4ZHO A;  1J0G A;  5D7G A;  2CR5 A;  4KGS A;  3N3K B;  3BVG A;  2K8C A;  4OVV A;  1SGH A;  2CU3 A;  2N1V A;  2PVG C;  3AB5 A;  2V1Y A;  1C79 A;  3PSE B;  4M00 A;  3M95 A;  2V4I B;  3APC A;  1WGR A;  3TCA A;  3ZJV A;  2RSU A;  4IC7 B;  4GDK B;  4OVZ A;  5G55 A;  4KDL B;  3U8Z A;  3V3X A;  1KF6 B;  1N63 A;  2WLB A;  1FMA D;  2K3U A;  3UF8 A;  4IM3 A;  2IJ0 A;  1FCL A;  2Y3A A;  1E6E B;  2C5L C;  2DYM A;  2J4X A;  2NS5 A;  3AE5 B;  3U30 A;  3GB1 A;  4IOI E;  3PV1 A;  2AL3 A;  2JRI B;  1C3T A;  3Q3M C;  3P4Q B;  3PZ7 A;  3KW5 B;  2HJ8 A;  5D94 A;  2M0X A;  4GB9 A;  2YVC A;  3BYY B;  2BKF A;  5FK9 C;  4F8C B;  1XLP A;  2KFK A;  1YN3 A;  1EUV B;  3DBR B;  1LQB A;  1QF6 A;  2AQ2 B;  3HRD D;  5HFY A;  1AAR A;  5LXH A;  2MA9 B;  2GB1 A;  4H2A A;  4BKG A;  4AJW A;  3ZIM A;  1GC6 A;  1MHX A;  4KIK B;  2K6Q A;  2KMM A;  1NDD A;  3EFU A;  2H88 B;  3AEA B;  2JZP A;  4MSQ B;  3MFG A;  2ICI A;  1UNS A;  1ZXI A;  4KZ0 A;  3VTU A;  4MGZ E;  4BKT A;  4LDT D;  4NJC A;  3Q6B A;  4A3O A;  2VH2 A;  3WIM A;  3A4S C;  4KKI A;  2WS3 B;  1Z5S B;  1T0Q C;  2GBM A;  4ANV A;  4K3B A;  5CHV C;  4DWF A;  1HE8 A;  1L5P A;  2SAK A;  3A4R A;  2Z59 B;  2WXJ A;  2XK5 A;  3NVY A;  2WU5 B;  1SE9 A;  3OAW A;  2ON8 A;  4W9H A;  5JHA A;  3DWM A;  3AM9 A;  1V9J A;  1ZXH A;  5J17 A;  2GBJ A;  1K51 A;  4RGN A;  3NUH B;  2BBC A;  4M02 A;  3HHM A;  3B9J A;  2FE8 A;  4XDD A;  4MGI E;  4JIO U;  4EZJ A;  2WWZ A;  1ENF A;  4X57 B;  4GLS C;  3V6E B;  4WQM A;  1WRI A;  2MLB A;  3NY5 A;  4P1C C;  4KV2 A;  1HA5 A;  1LM8 B;  5C1Z A;  4HJK A;  4RGT A;  4GIV A;  1U4A A;  2LD9 A;  1GB4 A;  4W9C A;  4K7U A;  3RNC C;  2WXF A;  3MJ5 A;  1YQB A;  2KFJ A;  2N9X A;  1QZE A;  5BMG A;  4HRO A;  4WWO A;  4LK0 M;  2J0M A;  4NJ7 A;  4MEM A;  1XT9 B;  2C7M B;  1VZ8 A;  1ROE A;  1RRB A;  1TIF A;  2WDV B;  5BYS A;  4XE0 A;  3MC8 A;  3IBE A;  4A8X C;  1WRD B;  3NZU A;  2QSD A;  4NQK E;  1OTR B;  3ZQ4 A;  2MSE D;  3NG0 A;  3NHE B;  2KDF B;  2QIL A;  2IO3 B;  4MEL A;  3Q8A A;  4EUT A;  3IAM 1;  1R4N B;  2DZK A;  2BTE A;  2BS3 B;  1YX5 B;  1PUT A;  1JWU D;  3T3O A;  2CJO A;  4DHJ B;  3SDL C;  2AWT A;  3LYY A;  1C78 A;  2INN E;  2KN5 A;  3NVV A;  3DPD A;  4GDL B;  2Y5C A;  3QC8 B;  3ZRF A;  2CKH B;  4RNA A;  5E6J A;  3ZKJ C;  3ZYY X;  2KD0 A;  2VZK D;  1ZPS A;  4W9G A;  1CMX B;  2K8B A;  3KUD B;  1KLU D;  1OQR A;  1D5M C;  3VDZ A;  4E3C A;  2GI9 A;  1E5W A;  1E7U A;  3B08 A;  3QCA A;  4XX5 A;  1V6E A;  4ZYS A;  4ITK A;  1KRH A;  4HXD A;  3L13 A;  4I6L B;  3B2G A;  4MM3 A;  2WGS A;  3J9C A;  1BT0 A;  1K52 A;  1V86 A;  1RFK A;  2WDR B;  1RYJ A;  2FUG 1;  4NJ6 A;  4ARI A;  1T0S C;  1JWB D;  2PKO A;  2Y5B B;  2IO0 B;  2HDE A;  5HHD G;  4FJZ A;  3OLM D;  2W3S A;  2LFI A;  3IAS 1;  2PMV A;  4B0M A;  1HXY D;  4HCN B;  1HTO A;  3AE3 B;  1JWS D;  2WXR A;  4HK2 A;  4RM8 A;  3WAN A;  2ZEQ A;  2UU7 A;  2MEK A;  2LJI A;  2R2Q A;  4S0R A;  4ZRP A;  4TKN A;  2KN4 A;  2IY0 B;  3SEB A;  1ZUD 2;  4BFR A;  2A5U A;  1WJ4 A;  3BK1 A;  4MGY E;  4YL8 A;  2LAS A;  1ZP0 B;  3ZRC A;  1EU4 A;  3AEF B;  2L0T A;  2YLM A;  2E6X A;  3I57 A;  2JZZ A;  3L0W B;  1EF5 A;  2NBW B;  1IP9 A;  1T0Y A;  3AE4 B;  1TYG B;  1FXI A;  2GRI A;  2KDI A;  5MPO A;  2DX5 B;  2D5G A;  2K6D B;  4N58 A;  1KJT A;  1YQ4 B;  5I4D A;  1P7E A;  2IYD B;  2PE6 B;  3EHV A;  3ETR A;  4RGM A;  2IY1 B;  2M56 B;  2D3A A;  5IO9 A;  4HKZ E;  4ZOH C;  2KLC A;  2BQQ A;  3BVZ A;  5G5H A;  2VH1 A;  2J0J A;  1FRR A;  4FLH A;  4M8N A;  3DBH B;  2LGX A;  1WR1 A;  2VRR B;  2BPS A;  2L3Z A;  2M17 A;  2LGY A;  2K9X A;  2JWU A;  1TJE A;  2XEW A;  3AED B;  5CHF A;  5C3J B;  1ZKH A;  1YIW A;  3DDC B;  1MG4 A;  1R4N I;  1HQR D;  3Q8E A;  1FCC C;  1PGX A;  2N0S B;  1K53 A;  1WXV A;  2ZJD A;  4XYC A;  4EE2 A;  3Q8B A;  2HTH A;  2M1M A;  2MBH A;  1RWS A;  3VRA B;  1C4A A;  2JX5 A;  1EO6 A;  4GU2 A;  1TKE A;  1WX7 A;  3RD2 A;  2V3P A;  1A70 A;  2FAZ A;  1L2N A;  1MI0 A;  4LNN A;  1ACC A;  1XCT L;  1YOV B;  1YQ3 B;  1ZDV A;  2H89 B;  4HWI B;  2ZCC A;  1NI3 A;  2BWE S;  4ZHP A;  4NZL B;  2O2V B;  4P7I A;  4RCO A;  2N7J A;  5J2R A;  1QIL A;  4AJY B;  3B0A A;  4E74 A;  5L83 A;  2K8H A;  4M8M A;  4HPP A;  2OJW A;  2N4F A;  2JYT A;  4XGA B;  2JWZ A;  3GP7 A;  3L10 B;  4TUU A;  3VAW A;  3WA0 A;  4GDK A;  4NY0 A;  2PJH A;  2M4N A;  2WXL A;  3R7R A;  2FBW B;  4FUL A;  4KX6 B;  2XNA C;  4FAD A;  1UUP A;  2JSV X;  2EMS A;  4DQO C;  1FFU A;  3PHX B;  2L7R A;  4HDO A;  3H8H A;  1EF1 A;  2KX3 A;  2QEJ C;  1E9M A;  1XEE A;  3AH7 A;  1WH3 A;  1SB3 C;  1B1Z A;  2LXC A;  5C23 A;  1XLO A;  4EKU A;  4IDI A;  2KWD A;  2MW5 A;  3QWZ B;  2E3T A;  3U4E G;  2V9H A;  3PS6 A;  2XBB C;  2D11 A;  4FXC A;  2V0G A;  1MJD A;  2DYO A;  3WAL A;  4AOF A;  1M94 A;  5G2N A;  3DCG A;  4C4V A;  4YXD B;  1KFY B;  3W1S A;  3D32 A;  1SJE D;  2WXH A;  4Q2J A;  2DYB A;  2BB6 A;  2Q5W D;  1QOB A;  2C7N B;  3UGB B;  1GB1 A;  4ZRI A;  1JRO A;  3ZNG C;  4G0N B;  3L17 A;  3P63 A;  2LRW A;  4AUQ C;  4IWQ A;  2LUM A;  2BGF A;  1B9R A;  2EMT A;  3NZS A;  1WMH B;  2WX1 A;  5JZE B;  3GOE A;  1WXS A;  2DWQ A;  4XZ4 A;  2OOB B;  4G3X B;  3L16 A;  2INP E;  3TEW A;  3ML8 A;  1IGD A;  4LCD E;  2KWU B;  1XO3 A;  2G45 B;  3B2F A;  4K81 A;  3I9V 1;  4G11 A;  4WH4 A;  3C8Y A;  1AWD A;  5D3I B;  1WI0 A;  3A9J A;  3DQV A;  1ESF A;  5E6N A;  4A90 A;  3LJ3 A;  5IP4 D;  1WGG A;  1C4C A;  4RMA A;  2O6V A;  3TJP A;  2DZI A;  3MP9 A;  1D5X C;  4NAW B;  2ZVO A;  1F1H A;  3TEY A;  2W55 A;  4JQW C;  4GN1 A;  3H7P A;  3VH4 B;  5CX3 A;  2OED A;  1DGJ A;  3HIZ A;  3VUW A;  2KOX A;  4BVU C;  3DHH C;  3Q3O C;  3MTN B;  2WXN A;  2REX A;  2Z8L A;  1L0Y B;  3IXS A;  3H1U A;  4HLE A;  3Q8F A;  3UIO B;  3W2D A;  2BVC A;  3AU4 A;  2FUH B;  3DVG X;  2RDH A;  4AP4 C;  1E90 A;  2KDE B;  1WFY A;  4N6E B;  3MC9 A;  3VFK A;  4L2Y A;  4DBG A;  1PYW D;  2ZNV C;  4YTM B;  1J8C A;  1SEB D;  1IYF A;  4IKG A;  4IW0 A;  1QOG A;  4J3O D;  3M62 B;  4ZYN A;  4C80 A;  1PQS A;  3WCQ A;  1D5Z C;  4HVB A;  3TUO A;  1TS5 A;  2JZ3 B;  4W9J A;  4W9I A;  1C77 A;  4F7Z A;  4XDC A;  2MHJ A;  3OWE B;  4C56 C;  5IOI A;  3M63 B;  1WIA A;  4EZL A;  2NCN A;  2KWC A;  4E71 A;  1ET6 A;  1L4D B;  1KH0 A;  1FIQ A;  1V8C A;  3AE9 B;  3KWV A;  3VRB B;  4WAA A;  5BMH A;  1TY0 A;  1UGM A;  4OW0 A;  2K0P A;  1I4Q A;  2ZW0 A;  2ONQ A;  4GOC A;  2JQR B;  1YN5 A;  3ZTD A;  1SIF A;  3LB8 C;  4L23 A;  2MBO A;  3EFC A;  1XCQ L;  1VDV A;  2RMM A;  3MHZ A;  3Q69 A;  4A3P A;  4YSX B;  1ZGU B;  3NRZ A;  4ZRQ A;  1Q10 A;  3P4P B;  3W5U B;  4NQL B;  4MM3 B;  2LI5 A;  4B6W A;  4MJS B;  3AMZ A;  4MSM B;  4JGH B;  2KQS A;  3SFE B;  1YNT E;  3V60 A;  2QHO A;  1E8W A;  1GNU A;  1TZO A;  1WM3 A;  4TMA B;  1SIJ A;  2KAJ A;  3UQB A;  1T6B X;  2DHZ A;  5IA7 A;  3GS2 A;  3RNA C;  1FD6 A;  3EUB 2;  5DPS A;  3NVW A;  3VTV A;  4ZRJ A;  3RI7 C;  2G1E A;  4ANX A;  1QQR A;  1N61 A;  1SBB B;  3LXF A;  1S1Q B;  2GMI C;  2N9L A;  2WXQ A;  2MJD A;  1JCK B;  2KQ7 A;  5EE0 A;  1T3Q A;  3QQ8 B;  2B76 B;  2Z0D B;  2L00 B;  1WX9 A;  1WYG A;  1CJE A;  2R61 A;  4OZA A;  3AV8 A;  3PTF C;  4FN2 A;  2DAF A;  5EE1 A;  4EEW A;  3A9J B;  1KM7 A;  4OZC A;  3ZLZ A;  3KH0 A;  1S3S G;  1TTN A;  3URY A;  2V4L A;  4KDI C;  2IGG A;  2XN9 C;  1IUE A;  3N32 A;  3JW0 X;  4ASW C;  1XF5 L;  1V49 A;  2BS2 B;  2ZZP B;  5IN7 A;  2IND C;  4A9A A;  4NAW A;  1OQY A;  1L4Z B;  4WUR A;  3ZGZ A;  1WE7 A;  1VD2 A;  1PFD A;  2J53 A;  1WX8 A;  4YT0 B;  4GSW A;  2KXJ A;  3GZN B;  2BYV E;  4C7Z A;  3W1S C;  3BWU D;  1AN8 A;  1MFW A;  4L1B A;  1YMH E;  2RDG A;  3A9K A;  2D10 A;  5E6O A;  1IBX A;  2KMC A;  4ARC A;  1IPG A;  2BW2 A;  4M01 A;  2M8S A;  1FXA A;  4JPS A;  2IZV B;  2LGI A;  2KVZ A;  2FID A;  4P6V F;  3PRE A;  1MHH E;  2KDM A;  1WSP A;  3E9S A;  2KTR B;  2DBY A;  1F0Z A;  2KZR A;  2IBI B;  2QMT A;  3I63 C;  4K1R B;  1WMH A;  4ANW A;  2MP2 A;  3EEC A;  1WF9 A;  2GBK A;  4RM9 A;  5BO4 B;  2CHZ A;  1YN4 A;  2G3Q B;  3UIP B;  3OJ4 B;  2MP2 B;  4KSL C;  1F52 A;  4N9F 4;  4PS8 A;  4JX1 C;  2JU6 X;  2RPV A;  5C2T B;  3NVZ A;  5JHB A;  5AZH A;  3AE2 B;  3M3J A;  1UWX A;  1VRA B;  4EZK A;  1FXT B;  2M0A A;  2A4Z A;  2LZ6 A;  5GXG B;  1Q5W B;  3PLV A;  3Q14 C;  4DXA B;  2G4S A;  1I7H A;  4HPM B;  1WXM A;  4XWT A;  5TSS A;  2DZM A;  3ZDM C;  3UI3 A;  1WGK A;  2I38 A;  3V05 A;  3A1Q A;  2AYO B;  2J52 A;  5H8Y E;  4N59 A;  2XK5 B;  2EKE C;  1ZE3 D;  4BKS D;  5AUI A;  2N9K A;  3PPA A;  2RR9 A;  3APD A;  4GMV A;  2G4D B;  3ZNH B;  1QLB B;  2YEP B;  3OJ3 A;  1CZP A;  3KQ4 A;  5GMV A;  4DK5 A;  3KVF B;  4W9L A;  4LNF A;  2BF8 B;  3U7Z A;  4D2K A;  4YTN B;  5CHW A;  1SE4 A;  4LNO A;  1G6J A;  3VUX A;  4RF0 A;  2CS4 A;  2K5P A;  2MX2 A;  4WAF A;  1UH6 A;  3BZD B;  4USA A;  3AEB B;  4EFO A;  1V80 A;  3R2I A;  2W82 A;  3BII D;  1LO5 D;  4HRS A;  2KO3 A;  3PT2 B;  1FEH A;  1VZ6 A;  1VLB A;  4O1N A;  1V5O A;  2KT7 A;  3VTW A;  2D2Q A;  3VH3 B;  2PLP A;  1E8X A;  2K39 A;  4OZB A;  3I3T B;  5EE9 A;  2LHD A;  1CQV A;  5HI1 A;  2JVC A;  1C1Y B;  2KVR A;  1I35 A;  2BYF A;  4BBN C;  2BT6 A;  1WYW B;  3H6N A;  2WXI A;  3RCZ A;  2WXP A;  5FR3 A;  4W9F A;  1I4H A;  2HTM E;  1A5R A;  3MC0 B;  1UBI A;  2ACZ B;  3PZD A;  3P42 A;  2KKC A;  3DVN U;  3GZN I;  3T9L A;  1UF0 A;  3X0W A;  2J42 A;  1C76 A;  2WNM A;  4LJP B;  4PYZ A;  4KGR A;  1FM0 D;  2MBB B;  5H92 C;  1QOA A;  3DBL B;  1P0R A;  3ZUN A;  1L7Y A;  1STE A;  1NI2 A;  1CK1 A;  3NS8 A;  1UWM A;  3PRM B;  2BS4 B;  4YSZ B;  4WJP A;  3AI5 A;  1WGY A;  4K3C A;  4JWS C;  4JE3 B;  2KJ6 A;  3DHG C;  1WR6 E;  4BOZ B;  1J19 A;  3I5J C;  1JWA D;  2LVQ A;  1DOX A;  2JRH A;  3FAH A;  2JYE A;  4DDI D;  2WXK A;  3FKY A;  2DNF A;  4B95 A;  1TY2 A;  4XWW A;  2NVU I;  3JSV A;  1WXQ A;  2PE9 A;  2WDQ B;  2WXG A;  5EE3 A;  2ZW1 A;  2JT4 B;  4TQ0 A;  3U52 E;  2ZNV B;  4HCP B;  2GLS A;  3SU8 X;  4HJG E;  3C0R B;  1FO4 A;  5DPW A;  2HJ1 A;  2ZVN A;  4ZRK A;  4CYE A;  1WY8 A;  1WGD A;  1P9D U;  3RNF C;  1YJI A;  4ACF A;  2KC2 A;  5CTR C;  1HZ6 A;  1E7P B;  4YTP B;  1BML C;  1KLV A;  1HEZ E;  3BK2 A;  4J6I A;  5BYR A;  4DXG A;  2LGD A;  5AZG A;  3QA8 A;  3UIN B;  5D6J B;  3N1Z C;  4JWU C;  2W3R A;  3N1X C;  2QIE B;  2KNB A;  4MT5 A;  3K9P B;  4FHJ A;  2PTL A;  3QIJ A;  1N60 A;  1SE3 A;  2OHF A;  4BZA A;  5HG2 A;  3QAR A;  3L54 A;  1IGC A;  2N9E B;  3TEZ A;  3IT6 B;  1VCB A;  1V97 A;  3Q3J A;  3ZXV A;  5BYQ A;  1E10 A;  5TR5 A;  3DOW A;  3RPF C;  4IG7 B;  4GGQ A;  3N1Y C;  1D6E C;  2NBU A;  4GDL A;  4WIP A;  3PLU A;  1E8Y A;  3O13 A;  4AQ7 A;  4BOS C;  2LEK A;  3FIL A;  3KWL A;  4FJV B;  1I4P A;  5KHQ A;  3HK0 A;  4KSK C;  1TKY A;  3CF6 E;  1V1P A;  1WWT A;  4LNI A;  1WE6 A;  4PT5 A;  3HM3 A;  5BMI A;  3CSF A;  2GBR A;  1I4X A;  4M0W B;  1WXA A;  5FR6 A;  1JRP A;  1LGR A;  3DBS A;  2I1K A;  3RNB C;  3RT3 B;  3DBL I;  1NBF C;  1SXT A;  3RNG C;  4FHK A;  1HTQ A;  4LNK A;  1NVI D;  4AS1 A;  3ZNZ B;  3ALB A;  2BYT A;  4I6N B;  4WJO A;  2FCN A;  3PHW B;  3OG5 A;  1C9F A;  1N6Z A;  2MQJ A;  5AEK B;  2MCN B;  3VVW B;  4KKJ A;  1OQQ A;  1YX6 B;  2JPH A;  3ZDT A;  1BXT A;  1RLF A;  1GPX A;  1C4P A;  3ZVV A;  1D4B A;  4YWG G;  3P1M A;  1RAX A;  3IT4 B;  2WU2 B;  1R7S A;  1YD8 U;  3IFW B;  4B9K A;  3ZJT A;  2KQ4 X;  4IWO A;  3N30 A;  1Y56 A;  4LTU A;  4A6Q A;  3HUI A;  3L4P A;  4KZC A;  3O65 B;  4K7W A;  4P16 A;  1F2R C;  2PW9 A;  3RYT A;  2AL6 A;  2C7H A;  4ICU A;  3S2A A;  2K25 A;  4BKS A;  4B0E A;  4WJQ A;  1EWC A;  5LLI A;  3CMM B;  1Q1O A;  1IBX B;  5IKC M;  4OVU A;  1MPE A;  2AEH A;  4WQO B;  4WWM A;  4AWJ A;  4WWN A;  3VXW A;  1L6U A;  2C9W B;  3RFZ B;  2X38 A;  2KWV B;  1TT5 B;  2LVP A;  5LNK 1;  1WJN A;  1P1A A;  2KK8 A;  3VQI A;  2O6V B;  4NPN A;  2MJ3 A;  1L6V A;  2N7E A;  2ZCB A;  2RPQ A;  3U2S C;  2WDT B;  1JWM D;  5EDS A;  1JAL A;  1JML A;  3GE3 C;  2FNJ B;  4A55 A;  3K9O B;  2INC C;  1P98 A;  2N9P C;  2FIF A;  3GE8 C;  5FKA C;  3KLS X;  4DXF A;  3SHQ A;  2IDY A;  2ASQ A;  2L05 A;  3RUL A;  2TSS A;  4K7S A;  3RMK C;  4URK A;  5AZF A;  2DLB A;  3P4R B;  2D07 B;  2ZPY A;  4W9E A;  2LWP A;  3R2T A;  3N9Y C;  4W9D A;  3NS1 A;  1QKZ A;  3IVF A;  4S17 A;  2B3A A;  2KX0 A;  1MG8 A;  3QK0 A;  2CHW A;  3V6C B;  1ZW7 A;  2EKI A;  1DOY A;  3KYC D;  3C19 A;  3L08 A;  5KHO A;  3QHT A;  4ZDV A;  1UGJ A;  2JF5 A;  2JXT A;  2IO2 B;  5LXI B;  2UYZ B;  3DHI C;  2DEN B;  4C00 A;  1E7V A;  2NPT B;  5HKH A;  4P1B C;  4ICV A;  1UEL A;  2SEB D;  1FPY A;  3Q3F A;  1JRU A;  1V1O A;  4MH8 A;  1FNU A;  3JSV B;  3RZF A;  2WXM A;  2K22 A;  2V3S A;  3VHT C;  1VR9 A;  3EA6 A;  2O2V A;  5DPR A;  3QX1 A;  5IAA C;  2RDB C;  1L0V B;  4OHJ A;  3U7D A;  4MH0 E;  2QDF A;  1V1P B;  4HKQ A;  2GOW A;  4ANU A;  5D2M B;  1L0X B;  4RFB A;  3ZNI D;  2NPT A;  1K8R B;  2IO1 B;  3DVN V;  1LXD A;  3KUC B;  2NR2 A;  5D3D A;  2WX0 A;  1DOI A;  2LVO A;  3PZ8 A;  4G50 A;  3P4S B;  4NNJ B;  1QOF A;  2OJR A;  4XC2 A;  3BVM A;  3ZTC A;  3EGR A;  2D3C A;  3HVD A;  3NJT A;  3PRP B;  4C4V B;  1BUI C;  2LUE A;  2J7Q B;  1HZ5 A;  3HVZ A;  1F9J A;  3QAQ A;  4CO7 A;  4RGO S;  2CJN A;  1XLQ A;  2CHX A;  4YSY B;  1ZDX A;  3JVZ X; 
#chains in the Genus database with same CATH homology
 3T9L A;  2LRW A;  1OEY A;  3X0W A;  4AUQ C;  4F1S A;  3UQA A;  1NDD A;  3EFU A;  4IWQ A;  4LJP B;  4MSQ B;  2BGF A;  4PYZ A;  2MBB B;  3R3M A;  2EMT A;  4II3 B;  3NZS A;  4KZ0 A;  1P0R A;  1WMH B;  2WX1 A;  1P3Q U;  3ZUN A;  1L7Y A;  4WJN A;  5JZE B;  1Z2M A;  3GOE A;  1NI2 A;  1WXS A;  3NS8 A;  3VTU A;  3PRM B;  4MGZ E;  4BKT A;  1OGW A;  4XZ4 A;  2OOB B;  1GG3 A;  4WJP A;  4LDT D;  4G3X B;  3L16 A;  4A3O A;  3WIM A;  3AI5 A;  3ML8 A;  1WGY A;  3A4S C;  2KJ6 A;  1WR6 E;  4BOZ B;  1J19 A;  4LCD E;  1Z5S B;  2KWU B;  5DPT A;  2G45 B;  2LVQ A;  4K81 A;  2GBM A;  2JRH A;  4ANV A;  5CHV C;  4DWF A;  4G11 A;  1HE8 A;  1WI0 A;  2C60 A;  2Z0E B;  1D3Z A;  3A4R A;  2Z59 B;  3A9J A;  4IM0 A;  4DDI D;  3DQV A;  1RFA A;  5E6N A;  3LJ3 A;  1V81 A;  2XK5 A;  4MDK E;  4B95 A;  3ML9 A;  1SE9 A;  1TZ1 A;  3OAW A;  3TBL D;  2MWS B;  4W9H A;  5JHA A;  3ENE A;  4IWP A;  2NVU I;  1WGG A;  3JSV A;  1V9J A;  2PE9 A;  4RMA A;  4GXB A;  2O6V A;  5J17 A;  3TJP A;  2DZI A;  2GBJ A;  2JT4 B;  4TQ0 A;  2JXX A;  2DZJ A;  2JY6 A;  2ZVO A;  4NAW B;  2ZNV B;  4HCP B;  3HHM A;  4PS3 A;  3SU8 X;  4IM2 A;  4JQW C;  2FCS A;  2RD0 A;  4GN1 A;  4MGI E;  4JIO U;  4EZJ A;  2WWZ A;  3C0R B;  3H7P A;  5CX3 A;  3VH4 B;  4BBN F;  1UBQ A;  3HIZ A;  1I42 A;  3H7P B;  5DPW A;  4X57 B;  3VUW A;  3V6E B;  2ZVN A;  4ZRK A;  4CYE A;  1WY8 A;  2KOX A;  1KOT A;  1WGD A;  2MLB A;  5E6P A;  2BWF A;  3MTN B;  4BVU C;  3NY5 A;  1R4M I;  3A33 B;  5JH5 C;  4KV2 A;  1P9D U;  1LM8 B;  2REX A;  1Q0W B;  4G0N B;  3H1U A;  2KC2 A;  5CTR C;  4HLE A;  3UIO B;  3HM6 X;  2KMA A;  3AU4 A;  2FUH B;  1V5T A;  4HJK A;  5C1Z A;  3DVG X;  4GIV A;  4AP4 C;  3MJW A;  3H7S A;  1E90 A;  2KDE B;  1KLV A;  1TGZ B;  1WFY A;  2KAN A;  1U4A A;  4J6I A;  2LGD A;  5AZG A;  2LD9 A;  3QA8 A;  4LDT B;  3UIN B;  4PS7 A;  3VFK A;  4DBG A;  4W9C A;  1XQQ A;  4K7U A;  2ZNV C;  5D6J B;  1J8C A;  1IYF A;  2KNB A;  3EC8 A;  3K9P B;  4FHJ A;  1YQB A;  2KFJ A;  4IW0 A;  2N9X A;  1QZE A;  3QIJ A;  4WWO A;  4I6P A;  3M62 B;  4ZYN A;  1GJZ A;  3AUL A;  2NBV B;  2J0M A;  1PQS A;  4NJ7 A;  2L0F A;  4MEM A;  4HVB A;  1XT9 B;  3QAR A;  4FJY A;  2C7M B;  3L54 A;  4FBJ B;  4XX5 A;  2JZ3 B;  3ZW3 A;  2KJH B;  2N9E B;  2PEA A;  4W9J A;  4W9I A;  1RRB A;  1UZX B;  4JL9 A;  2UWQ A;  4F7Z A;  1VCB A;  3IBE A;  4DDG D;  2J0K A;  1WRD B;  2LRU A;  3NZU A;  3Q3J A;  2KTF A;  3M63 B;  4DHZ B;  1WIA A;  3PRZ A;  4NQK E;  4EZL A;  1OTR B;  2NCN A;  1E8Z A;  5TR5 A;  3DOW A;  2KWC A;  2MSE D;  4GGQ A;  4IG7 B;  4E71 A;  3NHE B;  2KDF B;  2IO3 B;  3CST A;  4MEL A;  2NBU A;  2HE7 A;  4GDL A;  4EUT A;  3PLU A;  2DZK A;  1E8Y A;  4BOS C;  4WAA A;  1UGM A;  1YX5 B;  1XD3 B;  1OEY J;  2N7D A;  4FJV B;  3TMP B;  4GOC A;  4HPL B;  4DHJ B;  3SDL C;  3ZTD A;  1V2Y A;  2AWT A;  1SIF A;  3ECI A;  5KHQ A;  2JUO A;  1GUA B;  2MBO A;  3HK0 A;  4KSK C;  5J18 A;  3QJZ A;  3CF6 E;  2CU1 A;  2KN5 A;  4A3P A;  3RUI B;  2L8J A;  3DPD A;  1WE6 A;  3DBH I;  3HM3 A;  4GDL B;  3CSF A;  1ZGU B;  2L76 A;  2GBR A;  4M0W B;  3AU5 A;  3QC8 B;  3WAP A;  2CKH B;  3ZRF A;  1WXA A;  3ZKJ C;  4MGK E;  4MJS A;  4NQL B;  5FR6 A;  2KD0 A;  2LI5 A;  4B6W A;  4MJS B;  4W9G A;  4MSM B;  3TL5 A;  1CMX B;  2K8B A;  4JGH B;  4PYU A;  3DBS A;  3KUD B;  2I1K A;  2KQS A;  3KUZ A;  1H8C A;  3V60 A;  2QHO A;  3RT3 B;  1E8W A;  3DBL I;  4DHZ E;  3VDZ A;  1NBF C;  1GNU A;  2KDB A;  3APF A;  3WAM A;  1WM3 A;  4E3C A;  1E5W A;  4FHK A;  3UQB A;  1E7U A;  3B08 A;  3QCA A;  3DVG Y;  2I1J A;  1UD7 A;  1V6E A;  2DHZ A;  2RGF A;  3ALB A;  3H9D A;  4I6N B;  1TBE A;  4WWP A;  3ZNZ B;  2KC1 A;  4WJO A;  2FCN A;  5IA7 A;  3PHW B;  2MQJ A;  4HXD A;  3NOB A;  1GC7 A;  3V62 A;  3L13 A;  3KYD D;  4I6L B;  5AEK B;  1X1M A;  5DPS A;  2MCN B;  3V61 A;  3VTV A;  4MM3 A;  4ZRJ A;  4ANX A;  3VVW B;  1BT0 A;  1V86 A;  4W9K A;  1S1Q B;  2GMI C;  4NJ6 A;  1YX6 B;  3WAO A;  2KQ7 A;  2O6V D;  2Y5B B;  2IO0 B;  2JPH A;  3QQ8 B;  2Z0D B;  4II2 B;  5L95 C;  2L00 B;  3ZDT A;  1WJU A;  4FJZ A;  1WX9 A;  3OLM D;  2MBQ A;  4DHJ D;  3T8M A;  1RLF A;  4HCN B;  4HK2 A;  3ZVV A;  4FA6 A;  4RM8 A;  3WAN A;  2ZEQ A;  3JYU A;  3PTF C;  4FN2 A;  1RAX A;  2DAF A;  2R2Q A;  4EEW A;  3A9J B;  1KM7 A;  1YD8 U;  3ZLZ A;  3W1Y A;  3KH0 A;  1S3S G;  1TTN A;  3IFW B;  4B9K A;  2V4L A;  4TQ1 A;  4KDI C;  4TKN A;  4CHK A;  2IY0 B;  4HDQ A;  4IWO A;  3N32 A;  3N30 A;  4BFR A;  3JW0 X;  3IHP C;  4ASW C;  2A5U A;  5DCN A;  1WJ4 A;  1V49 A;  3DBR I;  2ZZP B;  4KZC A;  3O65 B;  4K7W A;  3BIN A;  3RYT A;  4MGY E;  4YL8 A;  2AL6 A;  3VUY A;  2C7H A;  4ICU A;  1OQY A;  2LAS A;  4NAW A;  3ZRC A;  3RZW C;  3S2A A;  2K25 A;  2LXA A;  4BKS A;  1WE7 A;  1VD2 A;  2L0T A;  2YLM A;  4WJQ A;  2JZZ A;  3L0W B;  1EF5 A;  2GBN A;  2NBW B;  5LLI A;  1IP9 A;  1WX8 A;  2MBE A;  3R7Q A;  4GSW A;  1T0Y A;  2KXJ A;  4EOY A;  3CMM B;  1Q1O A;  2KDI A;  4OVU A;  2DX5 B;  2BYV E;  2AEH A;  2MRP A;  2BYE A;  2K6D B;  3W1S C;  1KJT A;  4WQO B;  4AWJ A;  1ISN A;  1Y8R C;  2LJ5 A;  2K1F A;  3A9K A;  4WWN A;  3VXW A;  2D10 A;  2C9W B;  4LJO B;  5E6O A;  2IYD B;  2PE6 B;  2KMC A;  3EHV A;  3ONS A;  1IPG A;  2KWV B;  2KLG A;  2KHW B;  3B1L X;  2LVP A;  2M8S A;  2IZV B;  1WJN A;  2IY1 B;  2FID A;  1P1A A;  1WZ0 A;  2BKR B;  2KK8 A;  3VQI A;  3PVL A;  2O6V B;  3SD5 A;  4NPN A;  2KLC A;  2N7E A;  3BY4 B;  2ZCB A;  1WGH A;  2ZPN A;  3P2B A;  3PRE A;  4A20 A;  2RPQ A;  2WDT B;  3PGE A;  2J0J A;  2KTR B;  4IUM B;  4FLH A;  4M8N A;  5EDS A;  2LGX A;  1WR1 A;  2KZR A;  2VRR B;  2IBI B;  4K1R B;  1WMH A;  2BPS A;  4ANW A;  2MP2 A;  2L3Z A;  2M17 A;  2HD5 B;  2LGY A;  3EEC A;  1WF9 A;  5CHF A;  2GBK A;  2XEW A;  1ZKH A;  2FNJ B;  3K9O B;  1YIW A;  1P98 A;  3LDZ E;  2N9P C;  4RM9 A;  2FIF A;  1R4N I;  3DDC B;  5BO4 B;  2CHZ A;  2FCM A;  2G3Q B;  3UIP B;  1WXV A;  2ZJD A;  2MP2 B;  3OJ4 B;  1LFD A;  3AXC A;  4KSL C;  3SHQ A;  2HTH A;  2M1M A;  2MBH A;  2WYQ A;  4JLC A;  4TV3 A;  2ASQ A;  2W9N A;  4KIK A;  4N9F 4;  4PS8 A;  2L05 A;  3RUL A;  1H4R A;  1YJ1 A;  4K7S A;  2KTR A;  4URK A;  3TIX A;  2PPH A;  2FCQ A;  3A1Q B;  1EO6 A;  4KVG B;  4GU2 A;  5AZF A;  2D07 B;  2N1W A;  1WX7 A;  2ZPY A;  4W9E A;  2LWP A;  5JHB A;  3RD2 A;  1WJ6 A;  4W9D A;  5AZH A;  2FAZ A;  1L2N A;  3IVF A;  2DAJ A;  2D3G A;  3M3J A;  2B3A A;  2KX0 A;  2KFK B;  1MG8 A;  3QK0 A;  2KJR A;  4EZK A;  1FXT B;  4HWI B;  2A4Z A;  2CHW A;  2ZCC A;  1ZW7 A;  3V6C B;  2BWE S;  2LZ6 A;  3KYC D;  3R66 C;  1Q5W B;  3X23 A;  3PLV A;  1WM2 A;  3IG3 A;  3L08 A;  3A9K B;  5KHO A;  2O2V B;  2R2O A;  3MHS D;  3QHT A;  4P7I A;  1WZ3 A;  2G4S A;  4HPM B;  3ZO5 B;  1WXM A;  4DXA B;  4ZDV A;  2DZM A;  3ZDM C;  2JF5 A;  5J2R A;  2IO2 B;  5LXI B;  2UYZ B;  1J0G A;  5D7G A;  2CR5 A;  2DEN B;  1E7V A;  2NPT B;  4AJY B;  5HKH A;  3B0A A;  4ICV A;  3N3K B;  4E74 A;  1UEL A;  5L83 A;  3A1Q A;  2AYO B;  2K8H A;  4M8M A;  2K8C A;  4OVV A;  1SGH A;  3Q3F A;  1JRU A;  2XK5 B;  2EKE C;  2N1V A;  2N4F A;  2JWZ A;  3L10 B;  4TUU A;  3JSV B;  2V1Y A;  4BKS D;  3VAW A;  3PSE B;  3PPA A;  4GDK A;  2RR9 A;  3APD A;  4NY0 A;  4GMV A;  3RZF A;  2V3S A;  3VHT C;  3WA0 A;  2PJH A;  2G4D B;  3M95 A;  3ZNH B;  2M4N A;  2O2V A;  3OJ3 A;  3R7R A;  4DK5 A;  3APC A;  5GMV A;  3KVF B;  1WGR A;  4W9L A;  5DPR A;  2BF8 B;  3QX1 A;  3TCA A;  5IAA C;  3U7D A;  4FUL A;  2RSU A;  4MH0 E;  5CHW A;  4FAD A;  4IC7 B;  4GDK B;  2EMS A;  1G6J A;  5G55 A;  3VUX A;  4KDL B;  3U8Z A;  2GOW A;  4ANU A;  2CS4 A;  2MX2 A;  1UH6 A;  5D2M B;  3PHX B;  4EFO A;  2L7R A;  4HDO A;  1V80 A;  1EF1 A;  2KX3 A;  3ZNI D;  2NPT A;  1WH3 A;  1K8R B;  2IO1 B;  3DVN V;  2LXC A;  1LXD A;  4IM3 A;  5C23 A;  3UF8 A;  3KUC B;  2NR2 A;  2KO3 A;  2WX0 A;  3PT2 B;  2C5L C;  4EKU A;  2LVO A;  2MW5 A;  4G50 A;  2DYM A;  1V5O A;  3QWZ B;  4ZRI A;  3VTW A;  2D2Q A;  2NS5 A;  3U30 A;  4NNJ B;  3VH3 B;  3PV1 A;  2AL3 A;  2JRI B;  1E8X A;  1C3T A;  2K39 A;  3I3T B;  2HJ8 A;  3KW5 B;  5D94 A;  2M0X A;  4GB9 A;  2OJR A;  2YVC A;  4XC2 A;  3PS6 A;  2BKF A;  3ZTC A;  4F8C B;  2XBB C;  2KFK A;  2D11 A;  2DYO A;  2JVC A;  1EUV B;  3WAL A;  1C1Y B;  2KVR A;  1I35 A;  4AOF A;  1M94 A;  5G2N A;  3DCG A;  2BYF A;  4BBN C;  1LQB A;  3PRP B;  1WYW B;  3H6N A;  3W1S A;  3D32 A;  1AAR A;  3RCZ A;  2LUE A;  2MA9 B;  5LXH A;  2J7Q B;  4BKG A;  4AJW A;  3ZIM A;  2DYB A;  1F9J A;  1GC6 A;  3QAQ A;  4W9F A;  4KIK B;  4CO7 A;  1A5R A;  1UBI A;  2C7N B;  2CHX A;  2K6Q A;  3UGB B;  3PZD A;  3JVZ X;  2KKC A;  3ZNG C;  3DVN U;  3L17 A;  3GZN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...