2N9PC

Solution structure of rnf126 n-terminal zinc finger domain in complex with bag6 ubiquitin-like domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
100
Chain Sequence
MAHHHHHHVDDDDKMLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into the E3 ligase, RNF126.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF126
total genus 11
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n9pC00
2ZCCA 1WGYA 3IHPC 4HK2A 1ISNA 2Y5BB 2FCSA 3EHVA 3VH4B 1TZ1A 1E7VA 1RLFA 2LRWA 4TV3A 2KFJA 4GMVA 3ZTDA 3QX1A 3RCZA 4IWPA 3O65B 2IYDB 2WWZA 3RD2A 4K7UA 2NPTA 4KV2A 3U7DA 2IY1B 1E5WA 2R2OA 1WYWB 2Z59B 3EFUA 2BPSA 2AWTA 2O2VB 3DCGA 3KYCD 3DPDA 3VTVA 2EMTA 2IBIB 1M94A 2RGFA 2LUEA 2KWCA 4ICUA 3PTFC 1GC6A 1ZGUB 2DYMA 4IG7B 3TL5A 2IO0B 2KOXA 1V2YA 4MGZE 4W9DA 4AUQC 4HDQA 5AEKB 3VTUA 1WF9A 3V60A 2NVUI 4TQ1A 2DZMA 2AL3A 4MH0E 3H9DA 2NCNA 3H6NA 1AARA 2L76A 3H7PA 3EECA 5G55A 3UQAA 1C3TA 1YJ1A 2LGYA 4GXBA 2PE6B 4CO7A 4MELA 4TKNA 3UINB 4E74A 4NJ7A 4OVUA 5DPRA 2KX0A 1RFAA 2LGDA 1PQSA 2N1WA 2LASA 4AWJA 3PGEA 1OEYJ 4II3B 2O6VB 3CSTA 2CR5A 2JRHA 4KSKC 2C9WB 2YLMA 4LJPB 3UIOB 2RSUA 1IP9A 2N1VA 2LJ5A 2L7RA 4EEWA 3L16A 2KWVB 2PE9A 2XK5A 4GDLB 2KTRA 3KUZA 2N9EB 4LDTB 2KD0A 2C5LC 2LZ6A 3LJ3A 4DWFA 2MSED 4HLEA 3VAWA 4BKSD 1WXMA 2VRRB 2N7EA 2KJ6A 2WYQA 3NY5A 3QWZB 4G50A 1V5OA 2MA9B 4YL8A 4EZKA 2NPTB 4EFOA 2N7DA 2IO3B 2GBMA 2K25A 3AU5A 4KDIC 2KQ7A 4GN1A 4IWOA 3PLVA 3R7QA 4FADA 1YQBA 3JVZX 2L00B 2J0MA 2V4LA 4F8CB 2M17A 3N3KB 4WQOB 3JW0X 4FN2A 4DHZB 5HKHA 4WWOA 1WR6E 3AI5A 3UGBB 5D94A 4JIOU 2D07B 3QA8A 2KK8A 4M0WB 5IAAC 3ZUNA 4RM8A 5CX3A 3R3MA 4WJOA 3PHWB 1KM7A 2JUOA 5D7GA 4KSLC 4MJSB 4RM9A 2L0TA 4BKSA 5DPSA 4KZ0A 3P2BA 5DPTA 2BKRB 4IC7B 2MP2B 2ZNVB 1SIFA 4P7IA 2EKEC 2KHWB 2ZVNA 3UIPB 2W9NA 3QAQA 2HD5B 1WY8A 2L05A 4HPMB 3VHTC 1TBEA 4B9KA 5JZEB 2MX2A 4NJ6A 4W9EA 3V62A 5CTRC 3CMMB 3NS8A 3U8ZA 3X0WA 2ASQA 4ZRKA 2OOBB 4NQKE 2K6DB 3L08A 4GB9A 5CHFA 3D32A 3WA0A 2BYFA 1WR1A 3KVFB 3PSEB 4W9FA 3TIXA 3ZDTA 5L83A 5CHWA 1WXAA 1TGZB 4MDKE 2MBQA 5KHQA 3HIZA 4GDLA 3WAOA 2NS5A 1XQQA 4KIKB 3L54A 4B95A 2MW5A 3L13A 3ML8A 4LJOB 1UGMA 3UF8A 1U4AA 2LVPA 1L7YA 3NZUA 1Q0WB 4J6IA 4NAWA 2L3ZA 2K39A 2KFKB 3ONSA 2K8HA 4FA6A 2DZKA 1S1QB 1I35A 3DOWA 4NNJB 2I1KA 1JRUA 1WGDA 4JQWC 3QHTA 5DCNA 1IYFA 2MBBB 3SD5A 4FJZA 2BYEA 1WH3A 2N9XA 3RZWC 3VH3B 2FIFA 4MM3A 3PRMB 3RULA 3NOBA 1WM2A 1OTRB 5E6OA 3A1QA 4ANWA 2B3AA 3ZRCA 4A20A 4HWIB 3ZNGC 4HVBA 3QJZA 4URKA 3SDLC 4LCDE 1GC7A 3W1SA 4DDGD 4WJPA 3SHQA 2KNBA 1X1MA 1P98A 4BBNC 3EC8A 4FLHA 3W1YA 1Q1OA 2BWFA 3DBHI 2KJRA 3HHMA 3M3JA 4K7SA 1J0GA 3WAPA 2DX5B 2REXA 2MP2A 4WJQA 3VQIA 2J0JA 2A4ZA 2KC2A 1Y8RC 1V49A 1BT0A 2IY0B 2KO3A 5JHAA 4EKUA 2A5UA 2M1MA 4TQ0A 1E8WA 2L0FA 2DYBA 1UH6A 2GBKA 3IFWB 4PS8A 1V5TA 2LD9A 2HJ8A 3KUDB 2FAZA 2IZVB 2KLGA 3JSVA 4DK5A 2JPHA 5IA7A 1YX5B 3WIMA 1WGRA 3PS6A 4EZJA 4HXDA 3M95A 2O2VA 2FNJB 3TMPB 5LXIB 4GGQA 2GBNA 2PJHA 3RYTA 2C60A 2LXCA 4I6LB 5D6JB 2K6QA 4W9IA 3KH0A 4KIKA 3TCAA 2IO2B 2XK5B 3GOEA 4XC2A 2KTRB 1UELA 2KDBA 2GOWA 2KMCA 1GG3A 2CKHB 4DHJB 2G3QB 1OGWA 5GMVA 2KFKA 1LFDA 1YX6B 2LWPA 4CHKA 3U30A 2KVRA 2LVOA 4HCNB 3JSVB 1YD8U 1J19A 1YIWA 4NPNA 5J18A 3HM6X 3M62B 4G3XB 1T0YA 3S2AA 2UWQA 1EO6A 2Z0EB 3Q3FA 4BFRA 3A4RA 3H7SA 2MRPA 3QQ8B 3ENEA 3RUIB 4HPLB 1SE9A 4XZ4A 4NY0A 2DYOA 3APDA 1IPGA 3A1QB 3ZNHB 3IG3A 4M8MA 1WXSA 1WX7A 5AZGA 1S3SG 1TTNA 2BYVE 3MHSD 1D3ZA 5G2NA 3HK0A 2BKFA 3GZNI 2DAJA 4BOZB 1UBIA 5AZHA 2FCQA 2WX0A 3OLMD 3OJ3A 1I42A 1V81A 5FR6A 1NBFC 2WX1A 3N30A 2CHXA 4B6WA 1GUAB 2MLBA 2ZPYA 2ZNVC 5TR5A 1WX8A 4PS3A 5AZFA 1G6JA 2ZZPB 2KWUB 2PEAA 3ML9A 3T9LA 1WZ3A 5EDSA 3APCA 2DAFA 1V86A 3R66C 2GBRA 3ZRFA 3PLUA 2FUHB 4JGHB 3ZNZB 3RZFA 2I1JA 2FIDA 1EF5A 2AEHA 4GDKA 3DVGY 4IWQA 3KW5B 1E7UA 3IVFA 3ZTCA 4A3OA 4ANVA 2JWZA 5L95C 4HDOA 4I6NB 4W9LA 1WXVA 2ZEQA 2JXXA 3A4SC 4BBNF 1J8CA 2KTFA 2UYZB 4IM3A 3V61A 5JHBA 2L8JA 3MJWA 4FULA 4RMAA 5D2MB 4PS7A 3C0RB 3OAWA 3B08A 3V6CB 4E71A 1Z2MA 3ECIA 4EUTA 4NAWB 2ZJDA 2JVCA 2XEWA 4K1RB 4W9CA 2Z0DB 1NDDA 1WMHA 2ZPNA 2ZCBA 3A33B 3BINA 3T8MA 3UQBA 3ZLZA 1EUVB 4FJVB 2KZRA 1P3QU 1XT9B 3PT2B 3Q3JA 4G0NB 1C1YB 3A9JB 1Z5SB 1LQBA 5JH5C 1KOTA 2G45B 5LLIA 2D11A 3M63B 2M4NA 4M8NA 2ZVOA 4FHJA 1LM8B 1VD2A 2GMIC 2BWES 2LI5A 1CMXB 1WGGA 3H7PB 2MWSB 3HM3A 3WANA 3I3TB 2D2QA 1WFYA 2XBBC 2N4FA 3N32A 2MQJA 3TJPA 4DHZE 2FCNA 2KKCA 1WGHA 4ANXA 4F7ZA 5J17A 3OJ4B 1E8ZA 2NBUA 1WE7A 2KLCA 1WJ4A 2QHOA 3PRZA 3QIJA 4WWPA 2LXAA 3L17A 3A9JA 4G11A 2WDTB 3JYUA 2MBOA 3DBRI 2MCNB 2AL6A 4ZDVA 2KDIA 2KN5A 1RAXA 1LXDA 2K8BA 2GBJA 2CHWA 3X23A 4ANUA 2V1YA 2FCMA 2JF5A 2KDEB 4GDKB 2O6VD 3NZSA 4N9F4 3PVLA 4W9HA 3BY4B 1P9DU 3KYDD 2BF8B 1WM3A 2G4SA 1UBQA 2V3SA 3VFKA 4DXAB 2HE7A 1E8XA 1R4MI 1A5RA 3MTNB 2JRIB 3QK0A 4MSQB 4PYZA 4GSWA 1Q5WB 2LRUA 1F9JA 4BKGA 3W1SC 2KJHB 1EF1A 4PYUA 1HE8A 1H8CA 3QARA 4TUUA 3ALBA 3DQVA 1WJNA 2EMSA 4W9GA 3L10B 4II2B 4KVGB 1WI0A 1L2NA 2JY6A 2J0KA 4DHJD 2PPHA 2J7QB 1WJUA 4JLCA 3R7RA 4FHKA 2JZ3B 4DDID 1V80A 2LVQA 1XD3B 2NBWB 2KDFB 3ZKJC 1KLVA 4GOCA 1VCBA 1GNUA 1WJ6A 4MSMB 5LXHA 1H4RA 2BGFA 3QC8B 3B0AA 1ZKHA 4ZRIA 3DBSA 3PZDA 2O6VA 2M8SA 2DENB 4NQLB 4X57B 5C23A 2JT4B 4F1SA 3VUXA 4IUMB 1WE6A 1WZ0A 3AULA 3DVNU 2RR9A 1KJTA 3CF6E 4IM0A 3VTWA 3ZNID 4W9KA 3PHXB 2CS4A 2CHZA 3PPAA 1E8YA 4LDTD 5E6PA 1E90A 4ICVA 3ZO5B 2HTHA 4WAAA 2IO1B 4FJYA 2G4DB 5DPWA 4IM2A 1UD7A 4HCPB 3QCAA 3PV1A 2C7HA 4GIVA 1OEYA 2DZIA 3KUCB 1MG8A 2C7NB 2DZJA 3VVWB 2RPQA 3A9KB 3DBLI 2D3GA 4MEMA 5J2RA 1SGHA 4ZRJA 3PRPB 4CYEA 3B1LX 4BKTA 1P0RA 4K81A 2KC1A 3LDZE 2D10A 2RD0A 3RT3B 3VUWA 4AJYB 4KDLB 2KANA 3K9OB 3DDCB 1OQYA 1NI2A 2N9PC 2DHZA 2C7MB 4BVUC 2MBEA 4GU2A 4AP4C 2KXJA 4E3CA 2JZZA 4WWNA 4ZYNA 1K8RB 4AJWA 3A9KA 3DVNV 4FBJB 1GJZA 4K7WA 3ZW3A 4HJKA 2KQSA 3AU4A 2YVCA 2OJRA 1WMHB 4JL9A 4MGIE 4MJSA 3VDZA 1FXTB 4W9JA 1R4NI 5E6NA 3WALA 1UZXB 2K1FA 4KZCA 4EZLA 3DVGX 1WRDB 5KHOA 3WAMA 3ZVVA 1WIAA 4ASWC 4OVVA 4WJNA 1WX9A 3IBEA 5BO4B 2CU1A 4I6PA 3VXWA 3VUYA 1V6EA 2KX3A 2M0XA 2MBHA 2K8CA 2NBVB 3K9PB 4IW0A 2NR2A 3TBLD 1P1AA 4XX5A 2LGXA 4A3PA 4MGKE 3CSFA 4EOYA 4DBGA 5C1ZA 3NHEB 3V6EB 1QZEA 1RRBA 3ZIMA 2AYOB 3ZDMC 3H1UA 3APFA 3L0WB 4AOFA 4BOSC 3AXCA 3PREA 2KMAA 1V9JA 1ZW7A 5CHVC 3SU8X 2R2QA 4MGYE
chains in the Genus database with same CATH superfamily
1WGYA 1ISNA 2Y5BB 2FCSA 4LTUA 3EHVA 1TZ1A 1E7VA 2KFJA 2J53A 3E9SA 3RD2A 3U7DA 2IY1B 1WYWB 2O2VB 3I5JC 3KYCD 3VTVA 2KWCA 4ICUA 3PTFC 1GC6A 1ZGUB 4MGZE 1C4PA 4W9DA 4HDQA 3VTUA 1WF9A 3V60A 1KLUD 4MH0E 4YT0B 1L6VA 1YN4A 4RH6A 3UQAA 1YJ1A 1I4QA 3UINB 4TKNA 4OVUA 4PT5A 4WQMA 3P4QB 2LJIA 2N1WA 1PFDA 2IGHA 3PGEA 1YOVB 2O6VB 3AEDB 4LJPB 2RSUA 1IP9A 2WU5B 2LJ5A 1Y56A 4EEWA 2XK5A 3GP7A 4LDTB 2KD0A 2C5LC 1MG4A 1WXMA 3QWZB 1V5OA 4KKJA 1ESFA 4NAMA 4KDIC 1XO3A 1L0XB 1J7BA 3PLVA 1XCTL 1YQBA 5IP4D 1N62A 5LNK1 3JVZX 3U52E 4TMAB 2OJWA 1N61A 1TIFA 2HDEA 3QA8A 2KK8A 4M0WB 5IAAC 3ZUNA 5CX3A 4IOIE 4WJOA 2M0AA 1XXGA 4KSLC 4ZRPA 4BKSA 3BYYB 2XNAC 2EKEC 4ARCA 3NZ3A 1VRAB 2W9NA 2L05A 4B9KA 5FR3A 4NJ6A 1GB1A 1T5XD 1ZP0B 2D3CA 3AE9B 2OOBB 3WA0A 1WR1A 3RPFC 1WXAA 4MDKE 3NJTA 5KHQA 2CU3A 5BYRA 1D6EC 4KIKB 5AUIA 3R8BA 2WXFA 2WDQB 3UF8A 1U4AA 2D3AA 2L3ZA 4ZOHC 2K39A 2K8HA 4FA6A 3VRBB 4NNJB 5AUKA 3V3XA 3RNAC 4WURA 1WGDA 3NVWA 1WH3A 3RULA 3NVVA 3RNCC 4ANWA 4HWIB 3QJZA 3SDLC 1QOAA 1GC7A 4WJPA 1TY0A 3SHQA 5EE0A 2KNBA 1UWMA 1X1MA 1Q1OA 2BWFA 3DBHI 3M3JA 3MC8A 4HEA1 4P1BC 1Y8RC 1BT0A 2IY0B 2KO3A 2A5UA 2M1MA 3VR9B 2GBKA 3NVZA 3WCQA 2KLGA 3JSVA 2N9LA 1YN3A 2JPHA 1YX5B 2ON8A 1NYRA 3SFDB 4US9A 3C19A 5LXIB 4UDUC 2PJHA 5G5GA 5D6JB 1FM0D 4W9IA 4KIKA 4YSZB 2WXLA 1GG3A 2J52A 1QLBB 4BZAA 5GMVA 2KFKA 2N0SB 2LWPA 2LVOA 2BW2A 2BYTA 1YD8U 1J19A 1YIWA 4AQ7A 1TJEA 3AH7A 1VDVA 1TS5A 3GZNB 1EO6A 1VZ8A 2Z0EB 3ENEA 3I9V1 4A90A 3APDA 4R3DA 4LNNA 1FXAA 3AV8A 1WX7A 1TTNA 3MHSD 1TT5B 4M0WA 3HK0A 4JWSC 2BKFA 1TZOA 1UBIA 1SB3C 1I42A 2W3RA 4B6WA 1GUAB 1L6UA 2SEBD 3EA6A 1G6JA 2ZZPB 2KWUB 2PEAA 1JROA 1WZ3A 1NENB 2WXQA 3PLUA 3RZFA 2I1JA 4YTNB 2AEHA 4IWQA 3KW5B 1E7UA 2RDGA 1DOXA 1HEZE 2QMTA 4HDOA 3DWGC 2JXXA 4BBNF 3V61A 4RMAA 1EU4A 3C0RB 3Q2AC 3BVGA 1ZOYB 4K1RB 2DBYA 1HZ5A 4A6QA 2KZRA 1D5MC 1L4ZB 3Q3JA 5JH5C 3P63A 1T3QA 2D11A 2WU2B 2M4NA 4M8NA 1VD2A 4LK0M 2BWES 3Q8BA 3N32A 3TJPA 2FCNA 2BB5A 1RWSA 5J17A 3RMKC 1RYJA 1WE7A 2QHOA 2FBWB 2LXAA 4WWPA 4O1NA 1SSNA 2MBOA 3AEGB 3DBRI 2MCNB 2K22A 2KN5A 2WXRA 1JCKB 4GDKB 4N9F4 3PVLA 2BF8B 1UBQA 2V3SA 3VRAB 3MTNB 2JRIB 2OEDA 3HVZA 2KJHB 1F1HA 1HE8A 3DQVA 4W9GA 3L10B 4II2B 4DHJD 1WJUA 2JZ3B 4DDID 4GOCA 1VCBA 1GNUA 1WWTA 5IN7A 1ZDVA 5MPOA 2V3NA 4C7ZA 3PZDA 5C23A 2JT4B 3TUOA 3AULA 2RR9A 4IM0A 5H8YE 2CHZA 1E8YA 4LDTD 1QQRA 2HTHA 3HVDA 1SIJA 5DPWA 4IM2A 3MHZA 4HKZE 4XDDA 2DZJA 2XN9C 1K51A 4ZRJA 3B1LX 1UNSA 3PZ7A 3P4PB 3LDZE 1VZ7A 2D10A 1ENFA 5H92C 4AJYB 4KDLB 2H89B 3FAHA 1XLNA 2N9PC 4E3CA 2MBEA 4GU2A 1FCLA 2KXJA 4WWNA 2EKIA 4AJWA 3A9KA 3DVNV 4K7WA 2Y3AA 4YTPB 4HJKA 3AU4A 4MJSA 4LNFA 3VDZA 2WQYB 1D4BA 2WNMA 2K1FA 4EZLA 3J9CA 4RFBA 1L0YB 1WX9A 3IBEA 5BO4B 2CU1A 2WXHA 1V6EA 3GE8C 4Q2JA 4IW0A 2NR2A 2WLBA 2LGXA 3CSFA 3NHEB 1RRBA 3ZDMC 2GB1A 3ZXVA 3AXCA 3PREA 3SU8X 3BK1A 4MGYE 2G9HD 2QEJC 2LRWA 4TV3A 3ZTDA 3RCZA 3U7ZA 3AB5A 2WWZA 4K7UA 2NPTA 2K9XA 4KV2A 2R2OA 3EFUA 4C4VA 2AWTA 1IGDA 2EMTA 2J42A 2RGFA 4KKIA 5G5HA 2DWQA 2DYMA 4IG7B 4AUQC 1N5XA 2DZMA 1A70A 2LEKA 2BS2B 2L76A 1FRRA 1C3TA 2PE6B 4CO7A 2KYWA 1EWYC 2KQ4X 4E74A 3NVYA 5DPRA 2RMMA 1EWCA 4WIPA 4AWJA 4II3B 2HTME 2CR5A 2JRHA 4KSKC 2LMCA 4ZRQA 2N1VA 1TS2A 1RM6C 2PMVA 3HUIA 1ZXHA 2PE9A 2KTRA 2N9EB 1JQ4A 3AE8B 3AEBB 3LJ3A 4BKSD 3KLSX 2KJ6A 2V3PA 1YMHE 2B76B 4L23A 2NPTB 1KRHA 4EFOA 2N7DA 2IO3B 3IAS1 3AU5A 1WXQA 4FADA 4IDIA 2L00B 1CQVA 2J0MA 2V4LA 5EE3A 2M17A 4WQOB 4DHZB 5HKHA 4WWOA 1WR6E 3UGBB 4LNIA 2INCC 1T0QC 1IBXA 1HQRD 1KM7A 2LHDA 3AMZA 4US8A 5BMIA 1V8CA 4RM9A 4XWWA 5DPSA 4KZ0A 2JZPA 3P2BA 2WDRB 2ZNVB 1XLPA 3UIPB 1WY8A 3V62A 2ASQA 3Q8AA 5D3IB 3L08A 5CHFA 2QCZA 4W9FA 3PSEB 1TGZB 2GLSA 1IGCA 1F2RC 1XQQA 4RCOA 3L54A 3W5UB 4B95A 3L13A 4LNKA 3DHHC 4H2AA 3ZJUA 1SJHD 2LVPA 4NAWA 1Q0WB 4XDCA 4BAXA 1GAQB 2DZKA 1JWAD 2KT7A 4KX6B 5BMHA 2I1KA 4JQWC 4FJZA 3ZJVA 2N9XA 3VH3B 2FIFA 1K50A 1F52A 1V1OA 2M19A 4NJCA 3PZ8A 3ZNGC 3MP9A 4URKA 3IXSA 4P6VF 3RN9C 2PVGC 1TS4A 1PGAA 3SEBA 2QJLA 3EC8A 1SXTA 4WJQA 3VQIA 4CQNA 2KC2A 1P7EA 4IKGA 4TQ0A 1UH6A 3IFWB 2LD9A 3RNBC 4DK5A 2FAZA 4HXDA 3M95A 2O2VA 3TMPB 4GGQA 3KWLA 1B9RA 2K6QA 1JWBD 4XC2A 4WWMA 2KDBA 4DHJB 2HJ1A 3DBRB 1LFDA 3LYYA 3U30A 1AYFA 4HCNB 3JSVB 5T8IA 3HM6X 1FXIA 1CZPA 2UWQA 3Q3FA 3RUIB 1SE9A 2MJ3A 3A1QB 5AZGA 2MJEA 2BYVE 2X38A 2BB6A 1TYGB 2QDFA 2DAJA 2ONQA 4BOZB 3OLMD 1YN5A 3Q3NC 3Q69A 3Q3MC 1JWUD 1V81A 5FR6A 1NBFC 1BUIC 1P7FA 2AX5A 2MLBA 4PS3A 5AZFA 5EDSA 1T6BX 2DAFA 1V86A 3R66C 1GPXA 5EE9A 2FUHB 1EF5A 2WS3B 4RGMA 3TEWA 2JWZA 4PK1A 1HA5A 4I6NB 4L2YA 2ICIA 2ZEQA 4YXDB 3A4SC 1F0ZA 2Y5PA 2L8JA 2E6XA 1FPYA 3MJWA 3ZQ4A 4EUTA 3ECIA 1FD6A 4NAWB 3AEAB 2ZJDA 2UU7A 2XEWA 2Q5WD 5GXGB 1GOZA 1ET6A 3AEFB 3T8MA 3UQBA 3ZLZA 1EUVB 5IOIA 1P3QU 2NMQA 1Z5SB 2LGSA 1KOTA 1PYWD 5LLIA 3M63B 4DQOC 4FHJA 1LM8B 2YEPF 1WGGA 3HM3A 3WANA 2D2QA 1VJKA 3AE7B 2XBBC 2N4FA 4DHZE 2V0GA 4F7ZA 3OJ4B 5HI1A 3L17A 2N7JA 3MFGA 1DOYA 2I2YA 1RAXA 1J7CA 4ANUA 4W9HA 3BY4B 1P9DU 1DGJA 1PUTA 1WM3A 2WGSA 3VFKA 4DXAB 2D3BA 2LRUA 3TEXA 1H8CA 1J7AA 1R7SA 1WI0A 1XF5L 1HXYD 4OZBA 2X8XX 4JLCA 1DYQA 4FHKA 1V80A 3ZKJC 1H4RA 2BGFA 2DLBA 3B0AA 4ZRIA 2M8SA 4IUMB 5FK9C 1KJTA 1K52A 2EELA 4ICVA 4N59A 2WXPA 1UD7A 1NYQA 4RF1A 4HCPB 3QCAA 3PV1A 1OEYA 2R61A 1MG8A 1AW7A 2RPQA 3A9KB 1I7HA 3UI3A 2D3GA 2RDBC 1FRDA 1P0RA 2KC1A 3SFEB 2L1AA 2RD0A 4K3BA 4ZHPA 1QT9A 3VUWA 2JX5A 2I38A 3Q8CA 1NI2A 2C7MB 4YTMB 4FBJB 3PO0A 2BT6A 2OJRA 4W9JA 1R4NI 2Y5CA 5E6NA 1MJDA 3DVGX 2WXMA 4RGTA 4OVVA 4WJNA 2FUG1 3KWVA 2KX3A 4XYCA 2M0XA 2K0PA 3BVMA 1QILA 3TBLD 1JWMD 4C4VB 3ZIMA 3CIRB 3H1UA 3APFA 3L0WB 2E3TA 4P16A 4RNAA 3B2GA 3ZXRA 1YJJA 5CHVC 1HTQA 1Q10A 3V05A 2ZCCA 4HK2A 3VH4B 1XEEA 4M02A 2LGIA 1UF0A 2IYDB 3AM9A 1E5WA 2BPSA 2IBIB 2WHIA 1M94A 5D3DA 2LUEA 1V1PB 2IO0B 2OHFA 5AEKB 3R2TA 2WDVB 2MH7A 1MFWA 3IT4B 1ZXIA 3H9DA 3H6NA 3H7PA 5G55A 3EECA 2LGYA 4MELA 1EM7A 4REZA 4A8XC 1FMAD 1QOGA 4NJ7A 4TSSA 2PIAA 2LGDA 2BS4B 3SR6A 3RI7C 1CJEA 4HPPA 1I4GA 1YJIA 3DHIC 1C9FA 1L0VB 1N5WA 3ZYYX 4DXFA 3OWEB 3L16A 2BBCA 2KWVB 2LHEA 2LUMA 2LZ6A 4A55A 1CK1A 2VH1A 2VRRB 2MJDA 1JWSD 4G50A 3NY5A 1NVID 2MA9B 4YL8A 2GBMA 3Q8EA 2RDHA 4IWOA 3RNEC 3N1YC 2KAJA 2WXGA 3JW0X 3AI5A 5D94A 2V4IB 3R3MA 4L1BA 3PHWB 5D7GA 4B0MA 1ET9A 2JXTA 4IC7B 2K3UA 3TEZA 1N6ZA 1ROEA 2ZVNA 3QAQA 3VHTC 4HPMB 1B1ZA 1TBEA 1E10A 3CMMB 3NS8A 3X0WA 4ZRKA 2KVZA 4GB9A 3NRZA 3C8YA 1E7PB 3TIXA 3EUB2 3Q6BA 4RGOS 1QOFA 2L83A 1PGXA 3ML8A 4LJOB 1SEBD 1UGMA 3NZUA 4J6IA 4D2KA 2KFKB 4C7YA 1I35A 3DOWA 1ZUD2 3OG5A 3QHTA 2MBBB 3AECB 1HZ6A 3SD5A 3AE6B 3RZWC 3PRMB 1XLOA 3NOBA 1WM2A 1SE3A 4WAFA 2B3AA 4JE3B 4HVBA 3AE4B 4K3CA 4RGNA 4DDGD 4BBNC 4FLHA 2W54A 2KJRA 1J0GA 3WAPA 3W9CB 2REXA 1NEKB 2NTTA 4ZHOA 1V49A 4NZLB 4MM3B 1M4VA 5JHAA 4EKUA 3AE3B 3LXFA 1V5TA 2HJ8A 3KUDB 5JXVA 2WXOA 1WGRA 3PS6A 4EZJA 3H8HA 2FNJB 4FXCA 2GBNA 1QF6A 1QOBA 3RYTA 1KFYB 2K5PA 2C60A 2LXCA 4I6LB 3TCAA 2IO2B 2XK5B 1FCCC 1UELA 2KMCA 2GOWA 2CKHB 1OGWA 4M00A 3MC0B 4CHKA 3AE5B 4HROA 3ETRA 2LFIA 5J18A 1F2RI 3M62B 2WXIA 1I4PA 2PW9A 4BFRA 3A4RA 3QQ8B 1N60A 2MEKA 4HPLB 4XZ4A 4NY0A 2WP9B 1IPGA 1OQQA 3URYA 1WYGA 2NTSA 5G2NA 4KGRA 2KDMA 4C56C 3AE2B 1KLGD 5AZHA 2CJOA 3OJ3A 2VZKD 2QILA 2ZW0A 2IGDA 2GI9A 2CHXA 2ZNVC 3KQ4A 3ML9A 4J3OD 1MHXA 3T9LA 1GB4A 3APCA 2GBRA 3ZRFA 4JGHB 5HHDG 3ZNZB 3LB8C 2FIDA 1DOIA 3ABVB 4GDKA 3ZTCA 3IVFA 3RNFC 4W9LA 2JSVX 2UYZB 5JHBA 4FULA 1XCQL 3OAWA 3B08A 3Q14C 3V6CB 1Z2MA 1JMLA 3E56A 3BINA 4N6EB 2DNFA 2QC8A 3FKYA 1LGRA 4FJVB 3IT6B 3NUHB 3A9JB 1LQBA 1TS3A 3GS2A 2ZVOA 2LI5A 1NI3A 2MWSB 3H7PB 2MQJA 1IUEA 1E8ZA 1C76A 2KLCA 2WXNA 4MACA 1FO4A 4G11A 2WDTB 4EE2A 2L52A 2YEPB 1I4HA 1LXDA 2GBJA 4QAYA 4MT5A 2R2QA 2JF5A 1OFFA 2KDEB 2V9HA 1L5PA 2O6VD 3W5VB 1WGKA 2G4SA 2ZW1A 2HE7A 2INDC 1E8XA 1R4MI 3I57A 3N9YC 3QK0A 3U2SC 1F9JA 3L4PA 4BKGA 1MHHE 3W1SC 1EF1A 4YWGG 1STEA 3QARA 4TUUA 3ALBA 1WJNA 2EMSA 1I4XA 1L2NA 2JY6A 3AN1A 2J7QB 2ACZB 3BK2A 2LVQA 1XD3B 2KDFB 2GRIA 1WJ6A 1FIQA 4MSMB 1FNVA 1ZKHA 3DBSA 2G1EA 3RNGC 1JRPA 4F1SA 3VUXA 1WE6A 2JYEA 3VTWA 3PHXB 2CS4A 3PPAA 5E6PA 1E90A 2IO1B 2G4DB 2AQ2B 1C77A 1ZE3D 1HTOA 2DZIA 3KUCB 5E6JA 3DBLI 5J2RA 3PRPB 4WH4A 5C2TB 1FNWA 1QKZA 3FILB 3DDCB 3T3OA 4AP4C 1SE4A 3DWMA 4ZYNA 1K8RB 4C00A 4MGIE 2YVCA 4OW0A 3WALA 3WAMA 2KACA 1VR9A 5BMGA 4XWTA 2K8CA 3K9PB 2Z8LA 1P1AA 4EOYA 5C1ZA 2AYOB 4AOFA 5I4DA 3ZJTA 3DBLB 1ZW7A 5BYQA 1PDXA 4HKQA 1KH0A 3BWUD 3W2DA 3IHPC 4A9AA 1MPEA 2RPVA 3MJ5A 1RLFA 1C4CA 4GMVA 3QX1A 4IWPA 3O65B 5HFYA 4ARIA 4JX1C 1RFKA 2L32A 2PLPA 2Z59B 2BS3B 3DCGA 5EE1A 3DPDA 4XGAB 2IDYA 3TL5A 2KOXA 1V2YA 2NVUI 4TQ1A 2WXKA 4KGSA 2AL3A 2NCNA 4C80A 1AARA 4P1CC 4GXBA 1ZPSA 4LLGM 3EFCA 2KX0A 1RFAA 1UUPA 1PQSA 4YSXB 1OQRA 2LASA 1OEYJ 1VLBA 5TSSA 3CSTA 2C9WB 2YLMA 3I63C 3UIOB 5C3JB 4OZCA 2L7RA 4GDLB 3KUZA 2IGGA 4DWFA 2MSED 4HLEA 3VAWA 4JPSA 2N7EA 1ACCA 2WYQA 4EZKA 2IJ0A 1FNUA 1BMLC 2K25A 1D5ZC 1LO5D 1KTKA 2KQ7A 4GN1A 1F77A 3R7QA 2AQ3B 4F8CB 3BYTB 3N3KB 4OVZA 4FN2A 3FILA 1UGJA 4JIOU 2D07B 5IKCM 2VZKB 4RM8A 3Q3OC 2JUOA 1TKEA 2BTEA 4MJSB 2L0TA 1AWDA 5DPTA 2BKRB 2MP2B 4HJGE 1SIFA 4P7IA 2W3SA 2KHWB 2INNE 1YQ4B 5JZEB 2HD5B 2MX2A 4W9EA 5CTRC 2KWDA 3U8ZA 4NQKE 2K6DB 3D32A 4MH8A 2BYFA 3KVFB 3ZDTA 5L83A 5CHWA 3RFZB 2MBQA 3R2IA 3HIZA 4GDLA 3WAOA 1N63A 3EGRA 2NS5A 1MVKA 1TKGA 3TEYA 2MW5A 3B9JA 1L7YA 3ONSA 4YSYB 1S1QB 1SF0A 1JRUA 5DCNA 1AN8A 1ZDXA 4XE0A 1IYFA 2BYEA 3NG0A 4MM3A 1SE2A 2BQQA 1OTRB 5E6OA 3A1QA 4A20A 3ZRCA 2N9KA 2QIEB 1IBXB 3AEEB 4LCDE 3W1SA 1P98A 3W1YA 2QSDA 4K7SA 3HHMA 2M56B 2DX5B 2MP2A 1MI0A 2J0JA 2WXJA 2A4ZA 4AS1A 3N1ZC 1E8WA 2L0FA 2PTLA 4N58A 2DYBA 4PS8A 4OHJA 4USAA 2IZVB 5IA7A 3WIMA 3CWIA 1E6EB 2D5GA 4S0RA 4JWUC 3KH0A 3GB1A 3GOEA 2KTRB 3DHGC 2H88B 2G3QB 1T0RC 1YX6B 4HRSA 2KVRA 3BIID 1D5XC 2JU6X 4LNOA 1XLQA 4NPNA 4G3XB 4M01A 1T0YA 3S2AA 3H7SA 2MRPA 4KGTA 4RF0A 1PGBA 2DYOA 2JQRB 3ZNHB 3IG3A 4M8MA 1WXSA 1S3SG 1FFUA 2JWUA 1D3ZA 1TKYA 4GLSC 3GZNI 4ITKA 4ZYSA 2FCQA 2WX0A 1JALA 2WX1A 3N30A 2ZPYA 5TR5A 1WX8A 3P42A 3U4EG 3P1MA 1YQ3B 3ZGZA 3B2FA 1C78A 3DVGY 1WSPA 4A3OA 4ANVA 5L95C 4B0EA 1WXVA 5IO9A 1J8CA 2KTFA 4IM3A 5D2MB 4PS7A 2J4XA 4W9CA 2JVCA 2Z0DB 1NDDA 1WMHA 2ZPNA 1FEHA 2ZCBA 3A33B 3AE1B 5FKAC 2FE8A 1XT9B 2KN4A 3BVZA 1V97A 3PT2B 4G0NB 1C1YB 2SAKA 2KMMA 2G45B 3BZDB 2GMIC 1CMXB 3I3TB 1WFYA 1WRIA 2KKCA 2IPKD 1WGHA 4ANXA 1K53A 2NBUA 3QIJA 1WJ4A 3PRZA 3MC9A 3N1XC 3A9JA 3JYUA 2AL6A 4ZDVA 2KDIA 2BVCA 1R4MB 3VR8B 2K8BA 2CHWA 3X23A 2V1YA 2FCMA 3NZSA 2JYTA 4S17A 1V1PA 3KYDD 1A5RA 1JW9D 4MSQB 4PYZA 2MHJA 4GSWA 1Q5WB 1L4DB 3IAM1 4PYUA 1I4RA 4KVGB 2J0KA 2PPHA 2INPE 3R7RA 2PVOD 1E0ZA 2PKOA 5HG2A 2NBWB 1KLVA 5LXHA 1SBBB 1KF6B 2CJNA 3P4SB 3QC8B 2O6VA 2DENB 2W55A 4NQLB 4X57B 1C4AA 3DVNU 1WZ0A 3CF6E 3ZNID 4E71A 4W9KA 3T3NA 2AQ1B 2W82A 3ZO5B 1YNTE 4WAAA 4FJYA 1FFVA 2C7HA 4GIVA 1BXTA 2C7NB 3VVWB 4MEMA 1C79A 1SGHA 4CYEA 1E9MA 3GE3C 4BKTA 4K81A 3RT3B 3P4RB 4OZAA 2KANA 3K9OB 1OQYA 2DHZA 4BVUC 2JZZA 1EU3A 1GJZA 3O13A 3ZW3A 4DXGA 2KQSA 4JL9A 4ACFA 1WMHB 1FXTB 1UZXB 4KZCA 1WRDB 3N20C 5KHOA 3ZVVA 1WIAA 2TSSA 4ASWC 4I6PA 3VXWA 3VUYA 1UWXA 2MBHA 3TSSA 2NBVB 1R4NB 1T0SC 3DBHB 3HRDD 1VZ6A 2VH2A 4XX5A 5BYSA 4A3PA 4MGKE 1SJED 4DBGA 3FC4A 3V6EB 1QZEA 3NS1A 1TY2A 4BOSC 2KMAA 1V9JA 3Q8FA
chains in the Genus database with same CATH topology
2ZCCA 1WGYA 3IHPC 4HK2A 1ISNA 2Y5BB 2FCSA 3EHVA 3VH4B 1TZ1A 1E7VA 1RLFA 2LRWA 4TV3A 2KFJA 4GMVA 3ZTDA 3QX1A 3RCZA 4IWPA 3O65B 2IYDB 2WWZA 3RD2A 4K7UA 2NPTA 4KV2A 3U7DA 2IY1B 1E5WA 2R2OA 1WYWB 2Z59B 3EFUA 2BPSA 2AWTA 2O2VB 3DCGA 3KYCD 3DPDA 3VTVA 2EMTA 2IBIB 1M94A 2RGFA 2LUEA 2KWCA 4ICUA 3PTFC 1GC6A 1ZGUB 2DYMA 4IG7B 3TL5A 2IO0B 2KOXA 1V2YA 4MGZE 4W9DA 4AUQC 4HDQA 5AEKB 3VTUA 1WF9A 3V60A 2NVUI 4TQ1A 2DZMA 2AL3A 4MH0E 3H9DA 2NCNA 3H6NA 1AARA 2L76A 3H7PA 3EECA 5G55A 3UQAA 1C3TA 1YJ1A 2LGYA 4GXBA 2PE6B 4CO7A 4MELA 4TKNA 3UINB 4E74A 4NJ7A 4OVUA 5DPRA 2KX0A 1RFAA 2LGDA 1PQSA 2N1WA 2LASA 4AWJA 3PGEA 1OEYJ 4II3B 2O6VB 3CSTA 2CR5A 2JRHA 4KSKC 2C9WB 2YLMA 4LJPB 3UIOB 2RSUA 1IP9A 2N1VA 2LJ5A 2L7RA 4EEWA 3L16A 2KWVB 2PE9A 2XK5A 4GDLB 2KTRA 3KUZA 2N9EB 4LDTB 2KD0A 2C5LC 2LZ6A 3LJ3A 4DWFA 2MSED 4HLEA 3VAWA 4BKSD 1WXMA 2VRRB 2N7EA 2KJ6A 2WYQA 3NY5A 3QWZB 4G50A 1V5OA 2MA9B 4YL8A 4EZKA 2NPTB 4EFOA 2N7DA 2IO3B 2GBMA 2K25A 3AU5A 4KDIC 2KQ7A 4GN1A 4IWOA 3PLVA 3R7QA 4FADA 1YQBA 3JVZX 2L00B 2J0MA 2V4LA 4F8CB 2M17A 3N3KB 4WQOB 3JW0X 4FN2A 4DHZB 5HKHA 4WWOA 1WR6E 3AI5A 3UGBB 5D94A 4JIOU 2D07B 3QA8A 2KK8A 4M0WB 5IAAC 3ZUNA 4RM8A 5CX3A 3R3MA 4WJOA 3PHWB 1KM7A 2JUOA 5D7GA 4KSLC 4MJSB 4RM9A 2L0TA 4BKSA 5DPSA 4KZ0A 3P2BA 5DPTA 2BKRB 4IC7B 2MP2B 2ZNVB 1SIFA 4P7IA 2EKEC 2KHWB 2ZVNA 3UIPB 2W9NA 3QAQA 2HD5B 1WY8A 2L05A 4HPMB 3VHTC 1TBEA 4B9KA 5JZEB 2MX2A 4NJ6A 4W9EA 3V62A 5CTRC 3CMMB 3NS8A 3U8ZA 3X0WA 2ASQA 4ZRKA 2OOBB 4NQKE 2K6DB 3L08A 4GB9A 5CHFA 3D32A 3WA0A 2BYFA 1WR1A 3KVFB 3PSEB 4W9FA 3TIXA 3ZDTA 5L83A 5CHWA 1WXAA 1TGZB 4MDKE 2MBQA 5KHQA 3HIZA 4GDLA 3WAOA 2NS5A 1XQQA 4KIKB 3L54A 4B95A 2MW5A 3L13A 3ML8A 4LJOB 1UGMA 3UF8A 1U4AA 2LVPA 1L7YA 3NZUA 1Q0WB 4J6IA 4NAWA 2L3ZA 2K39A 2KFKB 3ONSA 2K8HA 4FA6A 2DZKA 1S1QB 1I35A 3DOWA 4NNJB 2I1KA 1JRUA 1WGDA 4JQWC 3QHTA 5DCNA 1IYFA 2MBBB 3SD5A 4FJZA 2BYEA 1WH3A 2N9XA 3RZWC 3VH3B 2FIFA 4MM3A 3PRMB 3RULA 3NOBA 1WM2A 1OTRB 5E6OA 3A1QA 4ANWA 2B3AA 3ZRCA 4A20A 4HWIB 3ZNGC 4HVBA 3QJZA 4URKA 3SDLC 4LCDE 1GC7A 3W1SA 4DDGD 4WJPA 3SHQA 2KNBA 1X1MA 1P98A 4BBNC 3EC8A 4FLHA 3W1YA 1Q1OA 2BWFA 3DBHI 2KJRA 3HHMA 3M3JA 4K7SA 1J0GA 3WAPA 2DX5B 2REXA 2MP2A 4WJQA 3VQIA 2J0JA 2A4ZA 2KC2A 1Y8RC 1V49A 1BT0A 2IY0B 2KO3A 5JHAA 4EKUA 2A5UA 2M1MA 4TQ0A 1E8WA 2L0FA 2DYBA 1UH6A 2GBKA 3IFWB 4PS8A 1V5TA 2LD9A 2HJ8A 3KUDB 2FAZA 2IZVB 2KLGA 3JSVA 4DK5A 2JPHA 5IA7A 1YX5B 3WIMA 1WGRA 3PS6A 4EZJA 4HXDA 3M95A 2O2VA 2FNJB 3TMPB 5LXIB 4GGQA 2GBNA 2PJHA 3RYTA 2C60A 2LXCA 4I6LB 5D6JB 2K6QA 4W9IA 3KH0A 4KIKA 3TCAA 2IO2B 2XK5B 3GOEA 4XC2A 2KTRB 1UELA 2KDBA 2GOWA 2KMCA 1GG3A 2CKHB 4DHJB 2G3QB 1OGWA 5GMVA 2KFKA 1LFDA 1YX6B 2LWPA 4CHKA 3U30A 2KVRA 2LVOA 4HCNB 3JSVB 1YD8U 1J19A 1YIWA 4NPNA 5J18A 3HM6X 3M62B 4G3XB 1T0YA 3S2AA 2UWQA 1EO6A 2Z0EB 3Q3FA 4BFRA 3A4RA 3H7SA 2MRPA 3QQ8B 3ENEA 3RUIB 4HPLB 1SE9A 4XZ4A 4NY0A 2DYOA 3APDA 1IPGA 3A1QB 3ZNHB 3IG3A 4M8MA 1WXSA 1WX7A 5AZGA 1S3SG 1TTNA 2BYVE 3MHSD 1D3ZA 5G2NA 3HK0A 2BKFA 3GZNI 2DAJA 4BOZB 1UBIA 5AZHA 2FCQA 2WX0A 3OLMD 3OJ3A 1I42A 1V81A 5FR6A 1NBFC 2WX1A 3N30A 2CHXA 4B6WA 1GUAB 2MLBA 2ZPYA 2ZNVC 5TR5A 1WX8A 4PS3A 5AZFA 1G6JA 2ZZPB 2KWUB 2PEAA 3ML9A 3T9LA 1WZ3A 5EDSA 3APCA 2DAFA 1V86A 3R66C 2GBRA 3ZRFA 3PLUA 2FUHB 4JGHB 3ZNZB 3RZFA 2I1JA 2FIDA 1EF5A 2AEHA 4GDKA 3DVGY 4IWQA 3KW5B 1E7UA 3IVFA 3ZTCA 4A3OA 4ANVA 2JWZA 5L95C 4HDOA 4I6NB 4W9LA 1WXVA 2ZEQA 2JXXA 3A4SC 4BBNF 1J8CA 2KTFA 2UYZB 4IM3A 3V61A 5JHBA 2L8JA 3MJWA 4FULA 4RMAA 5D2MB 4PS7A 3C0RB 3OAWA 3B08A 3V6CB 4E71A 1Z2MA 3ECIA 4EUTA 4NAWB 2ZJDA 2JVCA 2XEWA 4K1RB 4W9CA 2Z0DB 1NDDA 1WMHA 2ZPNA 2ZCBA 3A33B 3BINA 3T8MA 3UQBA 3ZLZA 1EUVB 4FJVB 2KZRA 1P3QU 1XT9B 3PT2B 3Q3JA 4G0NB 1C1YB 3A9JB 1Z5SB 1LQBA 5JH5C 1KOTA 2G45B 5LLIA 2D11A 3M63B 2M4NA 4M8NA 2ZVOA 4FHJA 1LM8B 1VD2A 2GMIC 2BWES 2LI5A 1CMXB 1WGGA 3H7PB 2MWSB 3HM3A 3WANA 3I3TB 2D2QA 1WFYA 2XBBC 2N4FA 3N32A 2MQJA 3TJPA 4DHZE 2FCNA 2KKCA 1WGHA 4ANXA 4F7ZA 5J17A 3OJ4B 1E8ZA 2NBUA 1WE7A 2KLCA 1WJ4A 2QHOA 3PRZA 3QIJA 4WWPA 2LXAA 3L17A 3A9JA 4G11A 2WDTB 3JYUA 2MBOA 3DBRI 2MCNB 2AL6A 4ZDVA 2KDIA 2KN5A 1RAXA 1LXDA 2K8BA 2GBJA 2CHWA 3X23A 4ANUA 2V1YA 2FCMA 2JF5A 2KDEB 4GDKB 2O6VD 3NZSA 4N9F4 3PVLA 4W9HA 3BY4B 1P9DU 3KYDD 2BF8B 1WM3A 2G4SA 1UBQA 2V3SA 3VFKA 4DXAB 2HE7A 1E8XA 1R4MI 1A5RA 3MTNB 2JRIB 3QK0A 4MSQB 4PYZA 4GSWA 1Q5WB 2LRUA 1F9JA 4BKGA 3W1SC 2KJHB 1EF1A 4PYUA 1HE8A 1H8CA 3QARA 4TUUA 3ALBA 3DQVA 1WJNA 2EMSA 4W9GA 3L10B 4II2B 4KVGB 1WI0A 1L2NA 2JY6A 2J0KA 4DHJD 2PPHA 2J7QB 1WJUA 4JLCA 3R7RA 4FHKA 2JZ3B 4DDID 1V80A 2LVQA 1XD3B 2NBWB 2KDFB 3ZKJC 1KLVA 4GOCA 1VCBA 1GNUA 1WJ6A 4MSMB 5LXHA 1H4RA 2BGFA 3QC8B 3B0AA 1ZKHA 4ZRIA 3DBSA 3PZDA 2O6VA 2M8SA 2DENB 4NQLB 4X57B 5C23A 2JT4B 4F1SA 3VUXA 4IUMB 1WE6A 1WZ0A 3AULA 3DVNU 2RR9A 1KJTA 3CF6E 4IM0A 3VTWA 3ZNID 4W9KA 3PHXB 2CS4A 2CHZA 3PPAA 1E8YA 4LDTD 5E6PA 1E90A 4ICVA 3ZO5B 2HTHA 4WAAA 2IO1B 4FJYA 2G4DB 5DPWA 4IM2A 1UD7A 4HCPB 3QCAA 3PV1A 2C7HA 4GIVA 1OEYA 2DZIA 3KUCB 1MG8A 2C7NB 2DZJA 3VVWB 2RPQA 3A9KB 3DBLI 2D3GA 4MEMA 5J2RA 1SGHA 4ZRJA 3PRPB 4CYEA 3B1LX 4BKTA 1P0RA 4K81A 2KC1A 3LDZE 2D10A 2RD0A 3RT3B 3VUWA 4AJYB 4KDLB 2KANA 3K9OB 3DDCB 1OQYA 1NI2A 2N9PC 2DHZA 2C7MB 4BVUC 2MBEA 4GU2A 4AP4C 2KXJA 4E3CA 2JZZA 4WWNA 4ZYNA 1K8RB 4AJWA 3A9KA 3DVNV 4FBJB 1GJZA 4K7WA 3ZW3A 4HJKA 2KQSA 3AU4A 2YVCA 2OJRA 1WMHB 4JL9A 4MGIE 4MJSA 3VDZA 1FXTB 4W9JA 1R4NI 5E6NA 3WALA 1UZXB 2K1FA 4KZCA 4EZLA 3DVGX 1WRDB 5KHOA 3WAMA 3ZVVA 1WIAA 4ASWC 4OVVA 4WJNA 1WX9A 3IBEA 5BO4B 2CU1A 4I6PA 3VXWA 3VUYA 1V6EA 2KX3A 2M0XA 2MBHA 2K8CA 2NBVB 3K9PB 4IW0A 2NR2A 3TBLD 1P1AA 4XX5A 2LGXA 4A3PA 4MGKE 3CSFA 4EOYA 4DBGA 5C1ZA 3NHEB 3V6EB 1QZEA 1RRBA 3ZIMA 2AYOB 3ZDMC 3H1UA 3APFA 3L0WB 4AOFA 4BOSC 3AXCA 3PREA 2KMAA 1V9JA 1ZW7A 5CHVC 3SU8X 2R2QA 4MGYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCC A;  1WGY A;  3IHP C;  4HK2 A;  1ISN A;  2Y5B B;  2FCS A;  3EHV A;  3VH4 B;  1TZ1 A;  1E7V A;  1RLF A;  2LRW A;  4TV3 A;  2KFJ A;  4GMV A;  3ZTD A;  3QX1 A;  3RCZ A;  4IWP A;  3O65 B;  2IYD B;  2WWZ A;  3RD2 A;  4K7U A;  2NPT A;  4KV2 A;  3U7D A;  2IY1 B;  1E5W A;  2R2O A;  1WYW B;  2Z59 B;  3EFU A;  2BPS A;  2AWT A;  2O2V B;  3DCG A;  3KYC D;  3DPD A;  3VTV A;  2EMT A;  2IBI B;  1M94 A;  2RGF A;  2LUE A;  2KWC A;  4ICU A;  3PTF C;  1GC6 A;  1ZGU B;  2DYM A;  4IG7 B;  3TL5 A;  2IO0 B;  2KOX A;  1V2Y A;  4MGZ E;  4W9D A;  4AUQ C;  4HDQ A;  5AEK B;  3VTU A;  1WF9 A;  3V60 A;  2NVU I;  4TQ1 A;  2DZM A;  2AL3 A;  4MH0 E;  3H9D A;  2NCN A;  3H6N A;  1AAR A;  2L76 A;  3H7P A;  3EEC A;  5G55 A;  3UQA A;  1C3T A;  1YJ1 A;  2LGY A;  4GXB A;  2PE6 B;  4CO7 A;  4MEL A;  4TKN A;  3UIN B;  4E74 A;  4NJ7 A;  4OVU A;  5DPR A;  2KX0 A;  1RFA A;  2LGD A;  1PQS A;  2N1W A;  2LAS A;  4AWJ A;  3PGE A;  1OEY J;  4II3 B;  2O6V B;  3CST A;  2CR5 A;  2JRH A;  4KSK C;  2C9W B;  2YLM A;  4LJP B;  3UIO B;  2RSU A;  1IP9 A;  2N1V A;  2LJ5 A;  2L7R A;  4EEW A;  3L16 A;  2KWV B;  2PE9 A;  2XK5 A;  4GDL B;  2KTR A;  3KUZ A;  2N9E B;  4LDT B;  2KD0 A;  2C5L C;  2LZ6 A;  3LJ3 A;  4DWF A;  2MSE D;  4HLE A;  3VAW A;  4BKS D;  1WXM A;  2VRR B;  2N7E A;  2KJ6 A;  2WYQ A;  3NY5 A;  3QWZ B;  4G50 A;  1V5O A;  2MA9 B;  4YL8 A;  4EZK A;  2NPT B;  4EFO A;  2N7D A;  2IO3 B;  2GBM A;  2K25 A;  3AU5 A;  4KDI C;  2KQ7 A;  4GN1 A;  4IWO A;  3PLV A;  3R7Q A;  4FAD A;  1YQB A;  3JVZ X;  2L00 B;  2J0M A;  2V4L A;  4F8C B;  2M17 A;  3N3K B;  4WQO B;  3JW0 X;  4FN2 A;  4DHZ B;  5HKH A;  4WWO A;  1WR6 E;  3AI5 A;  3UGB B;  5D94 A;  4JIO U;  2D07 B;  3QA8 A;  2KK8 A;  4M0W B;  5IAA C;  3ZUN A;  4RM8 A;  5CX3 A;  3R3M A;  4WJO A;  3PHW B;  1KM7 A;  2JUO A;  5D7G A;  4KSL C;  4MJS B;  4RM9 A;  2L0T A;  4BKS A;  5DPS A;  4KZ0 A;  3P2B A;  5DPT A;  2BKR B;  4IC7 B;  2MP2 B;  2ZNV B;  1SIF A;  4P7I A;  2EKE C;  2KHW B;  2ZVN A;  3UIP B;  2W9N A;  3QAQ A;  2HD5 B;  1WY8 A;  2L05 A;  4HPM B;  3VHT C;  1TBE A;  4B9K A;  5JZE B;  2MX2 A;  4NJ6 A;  4W9E A;  3V62 A;  5CTR C;  3CMM B;  3NS8 A;  3U8Z A;  3X0W A;  2ASQ A;  4ZRK A;  2OOB B;  4NQK E;  2K6D B;  3L08 A;  4GB9 A;  5CHF A;  3D32 A;  3WA0 A;  2BYF A;  1WR1 A;  3KVF B;  3PSE B;  4W9F A;  3TIX A;  3ZDT A;  5L83 A;  5CHW A;  1WXA A;  1TGZ B;  4MDK E;  2MBQ A;  5KHQ A;  3HIZ A;  4GDL A;  3WAO A;  2NS5 A;  1XQQ A;  4KIK B;  3L54 A;  4B95 A;  2MW5 A;  3L13 A;  3ML8 A;  4LJO B;  1UGM A;  3UF8 A;  1U4A A;  2LVP A;  1L7Y A;  3NZU A;  1Q0W B;  4J6I A;  4NAW A;  2L3Z A;  2K39 A;  2KFK B;  3ONS A;  2K8H A;  4FA6 A;  2DZK A;  1S1Q B;  1I35 A;  3DOW A;  4NNJ B;  2I1K A;  1JRU A;  1WGD A;  4JQW C;  3QHT A;  5DCN A;  1IYF A;  2MBB B;  3SD5 A;  4FJZ A;  2BYE A;  1WH3 A;  2N9X A;  3RZW C;  3VH3 B;  2FIF A;  4MM3 A;  3PRM B;  3RUL A;  3NOB A;  1WM2 A;  1OTR B;  5E6O A;  3A1Q A;  4ANW A;  2B3A A;  3ZRC A;  4A20 A;  4HWI B;  3ZNG C;  4HVB A;  3QJZ A;  4URK A;  3SDL C;  4LCD E;  1GC7 A;  3W1S A;  4DDG D;  4WJP A;  3SHQ A;  2KNB A;  1X1M A;  1P98 A;  4BBN C;  3EC8 A;  4FLH A;  3W1Y A;  1Q1O A;  2BWF A;  3DBH I;  2KJR A;  3HHM A;  3M3J A;  4K7S A;  1J0G A;  3WAP A;  2DX5 B;  2REX A;  2MP2 A;  4WJQ A;  3VQI A;  2J0J A;  2A4Z A;  2KC2 A;  1Y8R C;  1V49 A;  1BT0 A;  2IY0 B;  2KO3 A;  5JHA A;  4EKU A;  2A5U A;  2M1M A;  4TQ0 A;  1E8W A;  2L0F A;  2DYB A;  1UH6 A;  2GBK A;  3IFW B;  4PS8 A;  1V5T A;  2LD9 A;  2HJ8 A;  3KUD B;  2FAZ A;  2IZV B;  2KLG A;  3JSV A;  4DK5 A;  2JPH A;  5IA7 A;  1YX5 B;  3WIM A;  1WGR A;  3PS6 A;  4EZJ A;  4HXD A;  3M95 A;  2O2V A;  2FNJ B;  3TMP B;  5LXI B;  4GGQ A;  2GBN A;  2PJH A;  3RYT A;  2C60 A;  2LXC A;  4I6L B;  5D6J B;  2K6Q A;  4W9I A;  3KH0 A;  4KIK A;  3TCA A;  2IO2 B;  2XK5 B;  3GOE A;  4XC2 A;  2KTR B;  1UEL A;  2KDB A;  2GOW A;  2KMC A;  1GG3 A;  2CKH B;  4DHJ B;  2G3Q B;  1OGW A;  5GMV A;  2KFK A;  1LFD A;  1YX6 B;  2LWP A;  4CHK A;  3U30 A;  2KVR A;  2LVO A;  4HCN B;  3JSV B;  1YD8 U;  1J19 A;  1YIW A;  4NPN A;  5J18 A;  3HM6 X;  3M62 B;  4G3X B;  1T0Y A;  3S2A A;  2UWQ A;  1EO6 A;  2Z0E B;  3Q3F A;  4BFR A;  3A4R A;  3H7S A;  2MRP A;  3QQ8 B;  3ENE A;  3RUI B;  4HPL B;  1SE9 A;  4XZ4 A;  4NY0 A;  2DYO A;  3APD A;  1IPG A;  3A1Q B;  3ZNH B;  3IG3 A;  4M8M A;  1WXS A;  1WX7 A;  5AZG A;  1S3S G;  1TTN A;  2BYV E;  3MHS D;  1D3Z A;  5G2N A;  3HK0 A;  2BKF A;  3GZN I;  2DAJ A;  4BOZ B;  1UBI A;  5AZH A;  2FCQ A;  2WX0 A;  3OLM D;  3OJ3 A;  1I42 A;  1V81 A;  5FR6 A;  1NBF C;  2WX1 A;  3N30 A;  2CHX A;  4B6W A;  1GUA B;  2MLB A;  2ZPY A;  2ZNV C;  5TR5 A;  1WX8 A;  4PS3 A;  5AZF A;  1G6J A;  2ZZP B;  2KWU B;  2PEA A;  3ML9 A;  3T9L A;  1WZ3 A;  5EDS A;  3APC A;  2DAF A;  1V86 A;  3R66 C;  2GBR A;  3ZRF A;  3PLU A;  2FUH B;  4JGH B;  3ZNZ B;  3RZF A;  2I1J A;  2FID A;  1EF5 A;  2AEH A;  4GDK A;  3DVG Y;  4IWQ A;  3KW5 B;  1E7U A;  3IVF A;  3ZTC A;  4A3O A;  4ANV A;  2JWZ A;  5L95 C;  4HDO A;  4I6N B;  4W9L A;  1WXV A;  2ZEQ A;  2JXX A;  3A4S C;  4BBN F;  1J8C A;  2KTF A;  2UYZ B;  4IM3 A;  3V61 A;  5JHB A;  2L8J A;  3MJW A;  4FUL A;  4RMA A;  5D2M B;  4PS7 A;  3C0R B;  3OAW A;  3B08 A;  3V6C B;  4E71 A;  1Z2M A;  3ECI A;  4EUT A;  4NAW B;  2ZJD A;  2JVC A;  2XEW A;  4K1R B;  4W9C A;  2Z0D B;  1NDD A;  1WMH A;  2ZPN A;  2ZCB A;  3A33 B;  3BIN A;  3T8M A;  3UQB A;  3ZLZ A;  1EUV B;  4FJV B;  2KZR A;  1P3Q U;  1XT9 B;  3PT2 B;  3Q3J A;  4G0N B;  1C1Y B;  3A9J B;  1Z5S B;  1LQB A;  5JH5 C;  1KOT A;  2G45 B;  5LLI A;  2D11 A;  3M63 B;  2M4N A;  4M8N A;  2ZVO A;  4FHJ A;  1LM8 B;  1VD2 A;  2GMI C;  2BWE S;  2LI5 A;  1CMX B;  1WGG A;  3H7P B;  2MWS B;  3HM3 A;  3WAN A;  3I3T B;  2D2Q A;  1WFY A;  2XBB C;  2N4F A;  3N32 A;  2MQJ A;  3TJP A;  4DHZ E;  2FCN A;  2KKC A;  1WGH A;  4ANX A;  4F7Z A;  5J17 A;  3OJ4 B;  1E8Z A;  2NBU A;  1WE7 A;  2KLC A;  1WJ4 A;  2QHO A;  3PRZ A;  3QIJ A;  4WWP A;  2LXA A;  3L17 A;  3A9J A;  4G11 A;  2WDT B;  3JYU A;  2MBO A;  3DBR I;  2MCN B;  2AL6 A;  4ZDV A;  2KDI A;  2KN5 A;  1RAX A;  1LXD A;  2K8B A;  2GBJ A;  2CHW A;  3X23 A;  4ANU A;  2V1Y A;  2FCM A;  2JF5 A;  2KDE B;  4GDK B;  2O6V D;  3NZS A;  4N9F 4;  3PVL A;  4W9H A;  3BY4 B;  1P9D U;  3KYD D;  2BF8 B;  1WM3 A;  2G4S A;  1UBQ A;  2V3S A;  3VFK A;  4DXA B;  2HE7 A;  1E8X A;  1R4M I;  1A5R A;  3MTN B;  2JRI B;  3QK0 A;  4MSQ B;  4PYZ A;  4GSW A;  1Q5W B;  2LRU A;  1F9J A;  4BKG A;  3W1S C;  2KJH B;  1EF1 A;  4PYU A;  1HE8 A;  1H8C A;  3QAR A;  4TUU A;  3ALB A;  3DQV A;  1WJN A;  2EMS A;  4W9G A;  3L10 B;  4II2 B;  4KVG B;  1WI0 A;  1L2N A;  2JY6 A;  2J0K A;  4DHJ D;  2PPH A;  2J7Q B;  1WJU A;  4JLC A;  3R7R A;  4FHK A;  2JZ3 B;  4DDI D;  1V80 A;  2LVQ A;  1XD3 B;  2NBW B;  2KDF B;  3ZKJ C;  1KLV A;  4GOC A;  1VCB A;  1GNU A;  1WJ6 A;  4MSM B;  5LXH A;  1H4R A;  2BGF A;  3QC8 B;  3B0A A;  1ZKH A;  4ZRI A;  3DBS A;  3PZD A;  2O6V A;  2M8S A;  2DEN B;  4NQL B;  4X57 B;  5C23 A;  2JT4 B;  4F1S A;  3VUX A;  4IUM B;  1WE6 A;  1WZ0 A;  3AUL A;  3DVN U;  2RR9 A;  1KJT A;  3CF6 E;  4IM0 A;  3VTW A;  3ZNI D;  4W9K A;  3PHX B;  2CS4 A;  2CHZ A;  3PPA A;  1E8Y A;  4LDT D;  5E6P A;  1E90 A;  4ICV A;  3ZO5 B;  2HTH A;  4WAA A;  2IO1 B;  4FJY A;  2G4D B;  5DPW A;  4IM2 A;  1UD7 A;  4HCP B;  3QCA A;  3PV1 A;  2C7H A;  4GIV A;  1OEY A;  2DZI A;  3KUC B;  1MG8 A;  2C7N B;  2DZJ A;  3VVW B;  2RPQ A;  3A9K B;  3DBL I;  2D3G A;  4MEM A;  5J2R A;  1SGH A;  4ZRJ A;  3PRP B;  4CYE A;  3B1L X;  4BKT A;  1P0R A;  4K81 A;  2KC1 A;  3LDZ E;  2D10 A;  2RD0 A;  3RT3 B;  3VUW A;  4AJY B;  4KDL B;  2KAN A;  3K9O B;  3DDC B;  1OQY A;  1NI2 A;  2N9P C;  2DHZ A;  2C7M B;  4BVU C;  2MBE A;  4GU2 A;  4AP4 C;  2KXJ A;  4E3C A;  2JZZ A;  4WWN A;  4ZYN A;  1K8R B;  4AJW A;  3A9K A;  3DVN V;  4FBJ B;  1GJZ A;  4K7W A;  3ZW3 A;  4HJK A;  2KQS A;  3AU4 A;  2YVC A;  2OJR A;  1WMH B;  4JL9 A;  4MGI E;  4MJS A;  3VDZ A;  1FXT B;  4W9J A;  1R4N I;  5E6N A;  3WAL A;  1UZX B;  2K1F A;  4KZC A;  4EZL A;  3DVG X;  1WRD B;  5KHO A;  3WAM A;  3ZVV A;  1WIA A;  4ASW C;  4OVV A;  4WJN A;  1WX9 A;  3IBE A;  5BO4 B;  2CU1 A;  4I6P A;  3VXW A;  3VUY A;  1V6E A;  2KX3 A;  2M0X A;  2MBH A;  2K8C A;  2NBV B;  3K9P B;  4IW0 A;  2NR2 A;  3TBL D;  1P1A A;  4XX5 A;  2LGX A;  4A3P A;  4MGK E;  3CSF A;  4EOY A;  4DBG A;  5C1Z A;  3NHE B;  3V6E B;  1QZE A;  1RRB A;  3ZIM A;  2AYO B;  3ZDM C;  3H1U A;  3APF A;  3L0W B;  4AOF A;  4BOS C;  3AXC A;  3PRE A;  2KMA A;  1V9J A;  1ZW7 A;  5CHV C;  3SU8 X;  2R2Q A;  4MGY E; 
#chains in the Genus database with same CATH topology
 1WGY A;  1ISN A;  2Y5B B;  2FCS A;  4LTU A;  3EHV A;  1TZ1 A;  1E7V A;  2KFJ A;  2J53 A;  3E9S A;  3RD2 A;  3U7D A;  2IY1 B;  1WYW B;  2O2V B;  3I5J C;  3KYC D;  3VTV A;  2KWC A;  4ICU A;  3PTF C;  1GC6 A;  1ZGU B;  4MGZ E;  1C4P A;  4W9D A;  4HDQ A;  3VTU A;  1WF9 A;  3V60 A;  1KLU D;  4MH0 E;  4YT0 B;  1L6V A;  1YN4 A;  4RH6 A;  3UQA A;  1YJ1 A;  1I4Q A;  3UIN B;  4TKN A;  4OVU A;  4PT5 A;  4WQM A;  3P4Q B;  2LJI A;  2N1W A;  1PFD A;  2IGH A;  3PGE A;  1YOV B;  2O6V B;  3AED B;  4LJP B;  2RSU A;  1IP9 A;  2WU5 B;  2LJ5 A;  1Y56 A;  4EEW A;  2XK5 A;  3GP7 A;  4LDT B;  2KD0 A;  2C5L C;  1MG4 A;  1WXM A;  3QWZ B;  1V5O A;  4KKJ A;  1ESF A;  4NAM A;  4KDI C;  1XO3 A;  1L0X B;  1J7B A;  3PLV A;  1XCT L;  1YQB A;  5IP4 D;  1N62 A;  5LNK 1;  3JVZ X;  3U52 E;  4TMA B;  2OJW A;  1N61 A;  1TIF A;  2HDE A;  3QA8 A;  2KK8 A;  4M0W B;  5IAA C;  3ZUN A;  5CX3 A;  4IOI E;  4WJO A;  2M0A A;  1XXG A;  4KSL C;  4ZRP A;  4BKS A;  3BYY B;  2XNA C;  2EKE C;  4ARC A;  3NZ3 A;  1VRA B;  2W9N A;  2L05 A;  4B9K A;  5FR3 A;  4NJ6 A;  1GB1 A;  1T5X D;  1ZP0 B;  2D3C A;  3AE9 B;  2OOB B;  3WA0 A;  1WR1 A;  3RPF C;  1WXA A;  4MDK E;  3NJT A;  5KHQ A;  2CU3 A;  5BYR A;  1D6E C;  4KIK B;  5AUI A;  3R8B A;  2WXF A;  2WDQ B;  3UF8 A;  1U4A A;  2D3A A;  2L3Z A;  4ZOH C;  2K39 A;  2K8H A;  4FA6 A;  3VRB B;  4NNJ B;  5AUK A;  3V3X A;  3RNA C;  4WUR A;  1WGD A;  3NVW A;  1WH3 A;  3RUL A;  3NVV A;  3RNC C;  4ANW A;  4HWI B;  3QJZ A;  3SDL C;  1QOA A;  1GC7 A;  4WJP A;  1TY0 A;  3SHQ A;  5EE0 A;  2KNB A;  1UWM A;  1X1M A;  1Q1O A;  2BWF A;  3DBH I;  3M3J A;  3MC8 A;  4HEA 1;  4P1B C;  1Y8R C;  1BT0 A;  2IY0 B;  2KO3 A;  2A5U A;  2M1M A;  3VR9 B;  2GBK A;  3NVZ A;  3WCQ A;  2KLG A;  3JSV A;  2N9L A;  1YN3 A;  2JPH A;  1YX5 B;  2ON8 A;  1NYR A;  3SFD B;  4US9 A;  3C19 A;  5LXI B;  4UDU C;  2PJH A;  5G5G A;  5D6J B;  1FM0 D;  4W9I A;  4KIK A;  4YSZ B;  2WXL A;  1GG3 A;  2J52 A;  1QLB B;  4BZA A;  5GMV A;  2KFK A;  2N0S B;  2LWP A;  2LVO A;  2BW2 A;  2BYT A;  1YD8 U;  1J19 A;  1YIW A;  4AQ7 A;  1TJE A;  3AH7 A;  1VDV A;  1TS5 A;  3GZN B;  1EO6 A;  1VZ8 A;  2Z0E B;  3ENE A;  3I9V 1;  4A90 A;  3APD A;  4R3D A;  4LNN A;  1FXA A;  3AV8 A;  1WX7 A;  1TTN A;  3MHS D;  1TT5 B;  4M0W A;  3HK0 A;  4JWS C;  2BKF A;  1TZO A;  1UBI A;  1SB3 C;  1I42 A;  2W3R A;  4B6W A;  1GUA B;  1L6U A;  2SEB D;  3EA6 A;  1G6J A;  2ZZP B;  2KWU B;  2PEA A;  1JRO A;  1WZ3 A;  1NEN B;  2WXQ A;  3PLU A;  3RZF A;  2I1J A;  4YTN B;  2AEH A;  4IWQ A;  3KW5 B;  1E7U A;  2RDG A;  1DOX A;  1HEZ E;  2QMT A;  4HDO A;  3DWG C;  2JXX A;  4BBN F;  3V61 A;  4RMA A;  1EU4 A;  3C0R B;  3Q2A C;  3BVG A;  1ZOY B;  4K1R B;  2DBY A;  1HZ5 A;  4A6Q A;  2KZR A;  1D5M C;  1L4Z B;  3Q3J A;  5JH5 C;  3P63 A;  1T3Q A;  2D11 A;  2WU2 B;  2M4N A;  4M8N A;  1VD2 A;  4LK0 M;  2BWE S;  3Q8B A;  3N32 A;  3TJP A;  2FCN A;  2BB5 A;  1RWS A;  5J17 A;  3RMK C;  1RYJ A;  1WE7 A;  2QHO A;  2FBW B;  2LXA A;  4WWP A;  4O1N A;  1SSN A;  2MBO A;  3AEG B;  3DBR I;  2MCN B;  2K22 A;  2KN5 A;  2WXR A;  1JCK B;  4GDK B;  4N9F 4;  3PVL A;  2BF8 B;  1UBQ A;  2V3S A;  3VRA B;  3MTN B;  2JRI B;  2OED A;  3HVZ A;  2KJH B;  1F1H A;  1HE8 A;  3DQV A;  4W9G A;  3L10 B;  4II2 B;  4DHJ D;  1WJU A;  2JZ3 B;  4DDI D;  4GOC A;  1VCB A;  1GNU A;  1WWT A;  5IN7 A;  1ZDV A;  5MPO A;  2V3N A;  4C7Z A;  3PZD A;  5C23 A;  2JT4 B;  3TUO A;  3AUL A;  2RR9 A;  4IM0 A;  5H8Y E;  2CHZ A;  1E8Y A;  4LDT D;  1QQR A;  2HTH A;  3HVD A;  1SIJ A;  5DPW A;  4IM2 A;  3MHZ A;  4HKZ E;  4XDD A;  2DZJ A;  2XN9 C;  1K51 A;  4ZRJ A;  3B1L X;  1UNS A;  3PZ7 A;  3P4P B;  3LDZ E;  1VZ7 A;  2D10 A;  1ENF A;  5H92 C;  4AJY B;  4KDL B;  2H89 B;  3FAH A;  1XLN A;  2N9P C;  4E3C A;  2MBE A;  4GU2 A;  1FCL A;  2KXJ A;  4WWN A;  2EKI A;  4AJW A;  3A9K A;  3DVN V;  4K7W A;  2Y3A A;  4YTP B;  4HJK A;  3AU4 A;  4MJS A;  4LNF A;  3VDZ A;  2WQY B;  1D4B A;  2WNM A;  2K1F A;  4EZL A;  3J9C A;  4RFB A;  1L0Y B;  1WX9 A;  3IBE A;  5BO4 B;  2CU1 A;  2WXH A;  1V6E A;  3GE8 C;  4Q2J A;  4IW0 A;  2NR2 A;  2WLB A;  2LGX A;  3CSF A;  3NHE B;  1RRB A;  3ZDM C;  2GB1 A;  3ZXV A;  3AXC A;  3PRE A;  3SU8 X;  3BK1 A;  4MGY E;  2G9H D;  2QEJ C;  2LRW A;  4TV3 A;  3ZTD A;  3RCZ A;  3U7Z A;  3AB5 A;  2WWZ A;  4K7U A;  2NPT A;  2K9X A;  4KV2 A;  2R2O A;  3EFU A;  4C4V A;  2AWT A;  1IGD A;  2EMT A;  2J42 A;  2RGF A;  4KKI A;  5G5H A;  2DWQ A;  2DYM A;  4IG7 B;  4AUQ C;  1N5X A;  2DZM A;  1A70 A;  2LEK A;  2BS2 B;  2L76 A;  1FRR A;  1C3T A;  2PE6 B;  4CO7 A;  2KYW A;  1EWY C;  2KQ4 X;  4E74 A;  3NVY A;  5DPR A;  2RMM A;  1EWC A;  4WIP A;  4AWJ A;  4II3 B;  2HTM E;  2CR5 A;  2JRH A;  4KSK C;  2LMC A;  4ZRQ A;  2N1V A;  1TS2 A;  1RM6 C;  2PMV A;  3HUI A;  1ZXH A;  2PE9 A;  2KTR A;  2N9E B;  1JQ4 A;  3AE8 B;  3AEB B;  3LJ3 A;  4BKS D;  3KLS X;  2KJ6 A;  2V3P A;  1YMH E;  2B76 B;  4L23 A;  2NPT B;  1KRH A;  4EFO A;  2N7D A;  2IO3 B;  3IAS 1;  3AU5 A;  1WXQ A;  4FAD A;  4IDI A;  2L00 B;  1CQV A;  2J0M A;  2V4L A;  5EE3 A;  2M17 A;  4WQO B;  4DHZ B;  5HKH A;  4WWO A;  1WR6 E;  3UGB B;  4LNI A;  2INC C;  1T0Q C;  1IBX A;  1HQR D;  1KM7 A;  2LHD A;  3AMZ A;  4US8 A;  5BMI A;  1V8C A;  4RM9 A;  4XWW A;  5DPS A;  4KZ0 A;  2JZP A;  3P2B A;  2WDR B;  2ZNV B;  1XLP A;  3UIP B;  1WY8 A;  3V62 A;  2ASQ A;  3Q8A A;  5D3I B;  3L08 A;  5CHF A;  2QCZ A;  4W9F A;  3PSE B;  1TGZ B;  2GLS A;  1IGC A;  1F2R C;  1XQQ A;  4RCO A;  3L54 A;  3W5U B;  4B95 A;  3L13 A;  4LNK A;  3DHH C;  4H2A A;  3ZJU A;  1SJH D;  2LVP A;  4NAW A;  1Q0W B;  4XDC A;  4BAX A;  1GAQ B;  2DZK A;  1JWA D;  2KT7 A;  4KX6 B;  5BMH A;  2I1K A;  4JQW C;  4FJZ A;  3ZJV A;  2N9X A;  3VH3 B;  2FIF A;  1K50 A;  1F52 A;  1V1O A;  2M19 A;  4NJC A;  3PZ8 A;  3ZNG C;  3MP9 A;  4URK A;  3IXS A;  4P6V F;  3RN9 C;  2PVG C;  1TS4 A;  1PGA A;  3SEB A;  2QJL A;  3EC8 A;  1SXT A;  4WJQ A;  3VQI A;  4CQN A;  2KC2 A;  1P7E A;  4IKG A;  4TQ0 A;  1UH6 A;  3IFW B;  2LD9 A;  3RNB C;  4DK5 A;  2FAZ A;  4HXD A;  3M95 A;  2O2V A;  3TMP B;  4GGQ A;  3KWL A;  1B9R A;  2K6Q A;  1JWB D;  4XC2 A;  4WWM A;  2KDB A;  4DHJ B;  2HJ1 A;  3DBR B;  1LFD A;  3LYY A;  3U30 A;  1AYF A;  4HCN B;  3JSV B;  5T8I A;  3HM6 X;  1FXI A;  1CZP A;  2UWQ A;  3Q3F A;  3RUI B;  1SE9 A;  2MJ3 A;  3A1Q B;  5AZG A;  2MJE A;  2BYV E;  2X38 A;  2BB6 A;  1TYG B;  2QDF A;  2DAJ A;  2ONQ A;  4BOZ B;  3OLM D;  1YN5 A;  3Q3N C;  3Q69 A;  3Q3M C;  1JWU D;  1V81 A;  5FR6 A;  1NBF C;  1BUI C;  1P7F A;  2AX5 A;  2MLB A;  4PS3 A;  5AZF A;  5EDS A;  1T6B X;  2DAF A;  1V86 A;  3R66 C;  1GPX A;  5EE9 A;  2FUH B;  1EF5 A;  2WS3 B;  4RGM A;  3TEW A;  2JWZ A;  4PK1 A;  1HA5 A;  4I6N B;  4L2Y A;  2ICI A;  2ZEQ A;  4YXD B;  3A4S C;  1F0Z A;  2Y5P A;  2L8J A;  2E6X A;  1FPY A;  3MJW A;  3ZQ4 A;  4EUT A;  3ECI A;  1FD6 A;  4NAW B;  3AEA B;  2ZJD A;  2UU7 A;  2XEW A;  2Q5W D;  5GXG B;  1GOZ A;  1ET6 A;  3AEF B;  3T8M A;  3UQB A;  3ZLZ A;  1EUV B;  5IOI A;  1P3Q U;  2NMQ A;  1Z5S B;  2LGS A;  1KOT A;  1PYW D;  5LLI A;  3M63 B;  4DQO C;  4FHJ A;  1LM8 B;  2YEP F;  1WGG A;  3HM3 A;  3WAN A;  2D2Q A;  1VJK A;  3AE7 B;  2XBB C;  2N4F A;  4DHZ E;  2V0G A;  4F7Z A;  3OJ4 B;  5HI1 A;  3L17 A;  2N7J A;  3MFG A;  1DOY A;  2I2Y A;  1RAX A;  1J7C A;  4ANU A;  4W9H A;  3BY4 B;  1P9D U;  1DGJ A;  1PUT A;  1WM3 A;  2WGS A;  3VFK A;  4DXA B;  2D3B A;  2LRU A;  3TEX A;  1H8C A;  1J7A A;  1R7S A;  1WI0 A;  1XF5 L;  1HXY D;  4OZB A;  2X8X X;  4JLC A;  1DYQ A;  4FHK A;  1V80 A;  3ZKJ C;  1H4R A;  2BGF A;  2DLB A;  3B0A A;  4ZRI A;  2M8S A;  4IUM B;  5FK9 C;  1KJT A;  1K52 A;  2EEL A;  4ICV A;  4N59 A;  2WXP A;  1UD7 A;  1NYQ A;  4RF1 A;  4HCP B;  3QCA A;  3PV1 A;  1OEY A;  2R61 A;  1MG8 A;  1AW7 A;  2RPQ A;  3A9K B;  1I7H A;  3UI3 A;  2D3G A;  2RDB C;  1FRD A;  1P0R A;  2KC1 A;  3SFE B;  2L1A A;  2RD0 A;  4K3B A;  4ZHP A;  1QT9 A;  3VUW A;  2JX5 A;  2I38 A;  3Q8C A;  1NI2 A;  2C7M B;  4YTM B;  4FBJ B;  3PO0 A;  2BT6 A;  2OJR A;  4W9J A;  1R4N I;  2Y5C A;  5E6N A;  1MJD A;  3DVG X;  2WXM A;  4RGT A;  4OVV A;  4WJN A;  2FUG 1;  3KWV A;  2KX3 A;  4XYC A;  2M0X A;  2K0P A;  3BVM A;  1QIL A;  3TBL D;  1JWM D;  4C4V B;  3ZIM A;  3CIR B;  3H1U A;  3APF A;  3L0W B;  2E3T A;  4P16 A;  4RNA A;  3B2G A;  3ZXR A;  1YJJ A;  5CHV C;  1HTQ A;  1Q10 A;  3V05 A;  2ZCC A;  4HK2 A;  3VH4 B;  1XEE A;  4M02 A;  2LGI A;  1UF0 A;  2IYD B;  3AM9 A;  1E5W A;  2BPS A;  2IBI B;  2WHI A;  1M94 A;  5D3D A;  2LUE A;  1V1P B;  2IO0 B;  2OHF A;  5AEK B;  3R2T A;  2WDV B;  2MH7 A;  1MFW A;  3IT4 B;  1ZXI A;  3H9D A;  3H6N A;  3H7P A;  5G55 A;  3EEC A;  2LGY A;  4MEL A;  1EM7 A;  4REZ A;  4A8X C;  1FMA D;  1QOG A;  4NJ7 A;  4TSS A;  2PIA A;  2LGD A;  2BS4 B;  3SR6 A;  3RI7 C;  1CJE A;  4HPP A;  1I4G A;  1YJI A;  3DHI C;  1C9F A;  1L0V B;  1N5W A;  3ZYY X;  4DXF A;  3OWE B;  3L16 A;  2BBC A;  2KWV B;  2LHE A;  2LUM A;  2LZ6 A;  4A55 A;  1CK1 A;  2VH1 A;  2VRR B;  2MJD A;  1JWS D;  4G50 A;  3NY5 A;  1NVI D;  2MA9 B;  4YL8 A;  2GBM A;  3Q8E A;  2RDH A;  4IWO A;  3RNE C;  3N1Y C;  2KAJ A;  2WXG A;  3JW0 X;  3AI5 A;  5D94 A;  2V4I B;  3R3M A;  4L1B A;  3PHW B;  5D7G A;  4B0M A;  1ET9 A;  2JXT A;  4IC7 B;  2K3U A;  3TEZ A;  1N6Z A;  1ROE A;  2ZVN A;  3QAQ A;  3VHT C;  4HPM B;  1B1Z A;  1TBE A;  1E10 A;  3CMM B;  3NS8 A;  3X0W A;  4ZRK A;  2KVZ A;  4GB9 A;  3NRZ A;  3C8Y A;  1E7P B;  3TIX A;  3EUB 2;  3Q6B A;  4RGO S;  1QOF A;  2L83 A;  1PGX A;  3ML8 A;  4LJO B;  1SEB D;  1UGM A;  3NZU A;  4J6I A;  4D2K A;  2KFK B;  4C7Y A;  1I35 A;  3DOW A;  1ZUD 2;  3OG5 A;  3QHT A;  2MBB B;  3AEC B;  1HZ6 A;  3SD5 A;  3AE6 B;  3RZW C;  3PRM B;  1XLO A;  3NOB A;  1WM2 A;  1SE3 A;  4WAF A;  2B3A A;  4JE3 B;  4HVB A;  3AE4 B;  4K3C A;  4RGN A;  4DDG D;  4BBN C;  4FLH A;  2W54 A;  2KJR A;  1J0G A;  3WAP A;  3W9C B;  2REX A;  1NEK B;  2NTT A;  4ZHO A;  1V49 A;  4NZL B;  4MM3 B;  1M4V A;  5JHA A;  4EKU A;  3AE3 B;  3LXF A;  1V5T A;  2HJ8 A;  3KUD B;  5JXV A;  2WXO A;  1WGR A;  3PS6 A;  4EZJ A;  3H8H A;  2FNJ B;  4FXC A;  2GBN A;  1QF6 A;  1QOB A;  3RYT A;  1KFY B;  2K5P A;  2C60 A;  2LXC A;  4I6L B;  3TCA A;  2IO2 B;  2XK5 B;  1FCC C;  1UEL A;  2KMC A;  2GOW A;  2CKH B;  1OGW A;  4M00 A;  3MC0 B;  4CHK A;  3AE5 B;  4HRO A;  3ETR A;  2LFI A;  5J18 A;  1F2R I;  3M62 B;  2WXI A;  1I4P A;  2PW9 A;  4BFR A;  3A4R A;  3QQ8 B;  1N60 A;  2MEK A;  4HPL B;  4XZ4 A;  4NY0 A;  2WP9 B;  1IPG A;  1OQQ A;  3URY A;  1WYG A;  2NTS A;  5G2N A;  4KGR A;  2KDM A;  4C56 C;  3AE2 B;  1KLG D;  5AZH A;  2CJO A;  3OJ3 A;  2VZK D;  2QIL A;  2ZW0 A;  2IGD A;  2GI9 A;  2CHX A;  2ZNV C;  3KQ4 A;  3ML9 A;  4J3O D;  1MHX A;  3T9L A;  1GB4 A;  3APC A;  2GBR A;  3ZRF A;  4JGH B;  5HHD G;  3ZNZ B;  3LB8 C;  2FID A;  1DOI A;  3ABV B;  4GDK A;  3ZTC A;  3IVF A;  3RNF C;  4W9L A;  2JSV X;  2UYZ B;  5JHB A;  4FUL A;  1XCQ L;  3OAW A;  3B08 A;  3Q14 C;  3V6C B;  1Z2M A;  1JML A;  3E56 A;  3BIN A;  4N6E B;  2DNF A;  2QC8 A;  3FKY A;  1LGR A;  4FJV B;  3IT6 B;  3NUH B;  3A9J B;  1LQB A;  1TS3 A;  3GS2 A;  2ZVO A;  2LI5 A;  1NI3 A;  2MWS B;  3H7P B;  2MQJ A;  1IUE A;  1E8Z A;  1C76 A;  2KLC A;  2WXN A;  4MAC A;  1FO4 A;  4G11 A;  2WDT B;  4EE2 A;  2L52 A;  2YEP B;  1I4H A;  1LXD A;  2GBJ A;  4QAY A;  4MT5 A;  2R2Q A;  2JF5 A;  1OFF A;  2KDE B;  2V9H A;  1L5P A;  2O6V D;  3W5V B;  1WGK A;  2G4S A;  2ZW1 A;  2HE7 A;  2IND C;  1E8X A;  1R4M I;  3I57 A;  3N9Y C;  3QK0 A;  3U2S C;  1F9J A;  3L4P A;  4BKG A;  1MHH E;  3W1S C;  1EF1 A;  4YWG G;  1STE A;  3QAR A;  4TUU A;  3ALB A;  1WJN A;  2EMS A;  1I4X A;  1L2N A;  2JY6 A;  3AN1 A;  2J7Q B;  2ACZ B;  3BK2 A;  2LVQ A;  1XD3 B;  2KDF B;  2GRI A;  1WJ6 A;  1FIQ A;  4MSM B;  1FNV A;  1ZKH A;  3DBS A;  2G1E A;  3RNG C;  1JRP A;  4F1S A;  3VUX A;  1WE6 A;  2JYE A;  3VTW A;  3PHX B;  2CS4 A;  3PPA A;  5E6P A;  1E90 A;  2IO1 B;  2G4D B;  2AQ2 B;  1C77 A;  1ZE3 D;  1HTO A;  2DZI A;  3KUC B;  5E6J A;  3DBL I;  5J2R A;  3PRP B;  4WH4 A;  5C2T B;  1FNW A;  1QKZ A;  3FIL B;  3DDC B;  3T3O A;  4AP4 C;  1SE4 A;  3DWM A;  4ZYN A;  1K8R B;  4C00 A;  4MGI E;  2YVC A;  4OW0 A;  3WAL A;  3WAM A;  2KAC A;  1VR9 A;  5BMG A;  4XWT A;  2K8C A;  3K9P B;  2Z8L A;  1P1A A;  4EOY A;  5C1Z A;  2AYO B;  4AOF A;  5I4D A;  3ZJT A;  3DBL B;  1ZW7 A;  5BYQ A;  1PDX A;  4HKQ A;  1KH0 A;  3BWU D;  3W2D A;  3IHP C;  4A9A A;  1MPE A;  2RPV A;  3MJ5 A;  1RLF A;  1C4C A;  4GMV A;  3QX1 A;  4IWP A;  3O65 B;  5HFY A;  4ARI A;  4JX1 C;  1RFK A;  2L32 A;  2PLP A;  2Z59 B;  2BS3 B;  3DCG A;  5EE1 A;  3DPD A;  4XGA B;  2IDY A;  3TL5 A;  2KOX A;  1V2Y A;  2NVU I;  4TQ1 A;  2WXK A;  4KGS A;  2AL3 A;  2NCN A;  4C80 A;  1AAR A;  4P1C C;  4GXB A;  1ZPS A;  4LLG M;  3EFC A;  2KX0 A;  1RFA A;  1UUP A;  1PQS A;  4YSX B;  1OQR A;  2LAS A;  1OEY J;  1VLB A;  5TSS A;  3CST A;  2C9W B;  2YLM A;  3I63 C;  3UIO B;  5C3J B;  4OZC A;  2L7R A;  4GDL B;  3KUZ A;  2IGG A;  4DWF A;  2MSE D;  4HLE A;  3VAW A;  4JPS A;  2N7E A;  1ACC A;  2WYQ A;  4EZK A;  2IJ0 A;  1FNU A;  1BML C;  2K25 A;  1D5Z C;  1LO5 D;  1KTK A;  2KQ7 A;  4GN1 A;  1F77 A;  3R7Q A;  2AQ3 B;  4F8C B;  3BYT B;  3N3K B;  4OVZ A;  4FN2 A;  3FIL A;  1UGJ A;  4JIO U;  2D07 B;  5IKC M;  2VZK B;  4RM8 A;  3Q3O C;  2JUO A;  1TKE A;  2BTE A;  4MJS B;  2L0T A;  1AWD A;  5DPT A;  2BKR B;  2MP2 B;  4HJG E;  1SIF A;  4P7I A;  2W3S A;  2KHW B;  2INN E;  1YQ4 B;  5JZE B;  2HD5 B;  2MX2 A;  4W9E A;  5CTR C;  2KWD A;  3U8Z A;  4NQK E;  2K6D B;  3D32 A;  4MH8 A;  2BYF A;  3KVF B;  3ZDT A;  5L83 A;  5CHW A;  3RFZ B;  2MBQ A;  3R2I A;  3HIZ A;  4GDL A;  3WAO A;  1N63 A;  3EGR A;  2NS5 A;  1MVK A;  1TKG A;  3TEY A;  2MW5 A;  3B9J A;  1L7Y A;  3ONS A;  4YSY B;  1S1Q B;  1SF0 A;  1JRU A;  5DCN A;  1AN8 A;  1ZDX A;  4XE0 A;  1IYF A;  2BYE A;  3NG0 A;  4MM3 A;  1SE2 A;  2BQQ A;  1OTR B;  5E6O A;  3A1Q A;  4A20 A;  3ZRC A;  2N9K A;  2QIE B;  1IBX B;  3AEE B;  4LCD E;  3W1S A;  1P98 A;  3W1Y A;  2QSD A;  4K7S A;  3HHM A;  2M56 B;  2DX5 B;  2MP2 A;  1MI0 A;  2J0J A;  2WXJ A;  2A4Z A;  4AS1 A;  3N1Z C;  1E8W A;  2L0F A;  2PTL A;  4N58 A;  2DYB A;  4PS8 A;  4OHJ A;  4USA A;  2IZV B;  5IA7 A;  3WIM A;  3CWI A;  1E6E B;  2D5G A;  4S0R A;  4JWU C;  3KH0 A;  3GB1 A;  3GOE A;  2KTR B;  3DHG C;  2H88 B;  2G3Q B;  1T0R C;  1YX6 B;  4HRS A;  2KVR A;  3BII D;  1D5X C;  2JU6 X;  4LNO A;  1XLQ A;  4NPN A;  4G3X B;  4M01 A;  1T0Y A;  3S2A A;  3H7S A;  2MRP A;  4KGT A;  4RF0 A;  1PGB A;  2DYO A;  2JQR B;  3ZNH B;  3IG3 A;  4M8M A;  1WXS A;  1S3S G;  1FFU A;  2JWU A;  1D3Z A;  1TKY A;  4GLS C;  3GZN I;  4ITK A;  4ZYS A;  2FCQ A;  2WX0 A;  1JAL A;  2WX1 A;  3N30 A;  2ZPY A;  5TR5 A;  1WX8 A;  3P42 A;  3U4E G;  3P1M A;  1YQ3 B;  3ZGZ A;  3B2F A;  1C78 A;  3DVG Y;  1WSP A;  4A3O A;  4ANV A;  5L95 C;  4B0E A;  1WXV A;  5IO9 A;  1J8C A;  2KTF A;  4IM3 A;  5D2M B;  4PS7 A;  2J4X A;  4W9C A;  2JVC A;  2Z0D B;  1NDD A;  1WMH A;  2ZPN A;  1FEH A;  2ZCB A;  3A33 B;  3AE1 B;  5FKA C;  2FE8 A;  1XT9 B;  2KN4 A;  3BVZ A;  1V97 A;  3PT2 B;  4G0N B;  1C1Y B;  2SAK A;  2KMM A;  2G45 B;  3BZD B;  2GMI C;  1CMX B;  3I3T B;  1WFY A;  1WRI A;  2KKC A;  2IPK D;  1WGH A;  4ANX A;  1K53 A;  2NBU A;  3QIJ A;  1WJ4 A;  3PRZ A;  3MC9 A;  3N1X C;  3A9J A;  3JYU A;  2AL6 A;  4ZDV A;  2KDI A;  2BVC A;  1R4M B;  3VR8 B;  2K8B A;  2CHW A;  3X23 A;  2V1Y A;  2FCM A;  3NZS A;  2JYT A;  4S17 A;  1V1P A;  3KYD D;  1A5R A;  1JW9 D;  4MSQ B;  4PYZ A;  2MHJ A;  4GSW A;  1Q5W B;  1L4D B;  3IAM 1;  4PYU A;  1I4R A;  4KVG B;  2J0K A;  2PPH A;  2INP E;  3R7R A;  2PVO D;  1E0Z A;  2PKO A;  5HG2 A;  2NBW B;  1KLV A;  5LXH A;  1SBB B;  1KF6 B;  2CJN A;  3P4S B;  3QC8 B;  2O6V A;  2DEN B;  2W55 A;  4NQL B;  4X57 B;  1C4A A;  3DVN U;  1WZ0 A;  3CF6 E;  3ZNI D;  4E71 A;  4W9K A;  3T3N A;  2AQ1 B;  2W82 A;  3ZO5 B;  1YNT E;  4WAA A;  4FJY A;  1FFV A;  2C7H A;  4GIV A;  1BXT A;  2C7N B;  3VVW B;  4MEM A;  1C79 A;  1SGH A;  4CYE A;  1E9M A;  3GE3 C;  4BKT A;  4K81 A;  3RT3 B;  3P4R B;  4OZA A;  2KAN A;  3K9O B;  1OQY A;  2DHZ A;  4BVU C;  2JZZ A;  1EU3 A;  1GJZ A;  3O13 A;  3ZW3 A;  4DXG A;  2KQS A;  4JL9 A;  4ACF A;  1WMH B;  1FXT B;  1UZX B;  4KZC A;  1WRD B;  3N20 C;  5KHO A;  3ZVV A;  1WIA A;  2TSS A;  4ASW C;  4I6P A;  3VXW A;  3VUY A;  1UWX A;  2MBH A;  3TSS A;  2NBV B;  1R4N B;  1T0S C;  3DBH B;  3HRD D;  1VZ6 A;  2VH2 A;  4XX5 A;  5BYS A;  4A3P A;  4MGK E;  1SJE D;  4DBG A;  3FC4 A;  3V6E B;  1QZE A;  3NS1 A;  1TY2 A;  4BOS C;  2KMA A;  1V9J A;  3Q8F A; 
#chains in the Genus database with same CATH homology
 2ZCC A;  1WGY A;  3IHP C;  4HK2 A;  1ISN A;  2Y5B B;  2FCS A;  3EHV A;  3VH4 B;  1TZ1 A;  1E7V A;  1RLF A;  2LRW A;  4TV3 A;  2KFJ A;  4GMV A;  3ZTD A;  3QX1 A;  3RCZ A;  4IWP A;  3O65 B;  2IYD B;  2WWZ A;  3RD2 A;  4K7U A;  2NPT A;  4KV2 A;  3U7D A;  2IY1 B;  1E5W A;  2R2O A;  1WYW B;  2Z59 B;  3EFU A;  2BPS A;  2AWT A;  2O2V B;  3DCG A;  3KYC D;  3DPD A;  3VTV A;  2EMT A;  2IBI B;  1M94 A;  2RGF A;  2LUE A;  2KWC A;  4ICU A;  3PTF C;  1GC6 A;  1ZGU B;  2DYM A;  4IG7 B;  3TL5 A;  2IO0 B;  2KOX A;  1V2Y A;  4MGZ E;  4W9D A;  4AUQ C;  4HDQ A;  5AEK B;  3VTU A;  1WF9 A;  3V60 A;  2NVU I;  4TQ1 A;  2DZM A;  2AL3 A;  4MH0 E;  3H9D A;  2NCN A;  3H6N A;  1AAR A;  2L76 A;  3H7P A;  3EEC A;  5G55 A;  3UQA A;  1C3T A;  1YJ1 A;  2LGY A;  4GXB A;  2PE6 B;  4CO7 A;  4MEL A;  4TKN A;  3UIN B;  4E74 A;  4NJ7 A;  4OVU A;  5DPR A;  2KX0 A;  1RFA A;  2LGD A;  1PQS A;  2N1W A;  2LAS A;  4AWJ A;  3PGE A;  1OEY J;  4II3 B;  2O6V B;  3CST A;  2CR5 A;  2JRH A;  4KSK C;  2C9W B;  2YLM A;  4LJP B;  3UIO B;  2RSU A;  1IP9 A;  2N1V A;  2LJ5 A;  2L7R A;  4EEW A;  3L16 A;  2KWV B;  2PE9 A;  2XK5 A;  4GDL B;  2KTR A;  3KUZ A;  2N9E B;  4LDT B;  2KD0 A;  2C5L C;  2LZ6 A;  3LJ3 A;  4DWF A;  2MSE D;  4HLE A;  3VAW A;  4BKS D;  1WXM A;  2VRR B;  2N7E A;  2KJ6 A;  2WYQ A;  3NY5 A;  3QWZ B;  4G50 A;  1V5O A;  2MA9 B;  4YL8 A;  4EZK A;  2NPT B;  4EFO A;  2N7D A;  2IO3 B;  2GBM A;  2K25 A;  3AU5 A;  4KDI C;  2KQ7 A;  4GN1 A;  4IWO A;  3PLV A;  3R7Q A;  4FAD A;  1YQB A;  3JVZ X;  2L00 B;  2J0M A;  2V4L A;  4F8C B;  2M17 A;  3N3K B;  4WQO B;  3JW0 X;  4FN2 A;  4DHZ B;  5HKH A;  4WWO A;  1WR6 E;  3AI5 A;  3UGB B;  5D94 A;  4JIO U;  2D07 B;  3QA8 A;  2KK8 A;  4M0W B;  5IAA C;  3ZUN A;  4RM8 A;  5CX3 A;  3R3M A;  4WJO A;  3PHW B;  1KM7 A;  2JUO A;  5D7G A;  4KSL C;  4MJS B;  4RM9 A;  2L0T A;  4BKS A;  5DPS A;  4KZ0 A;  3P2B A;  5DPT A;  2BKR B;  4IC7 B;  2MP2 B;  2ZNV B;  1SIF A;  4P7I A;  2EKE C;  2KHW B;  2ZVN A;  3UIP B;  2W9N A;  3QAQ A;  2HD5 B;  1WY8 A;  2L05 A;  4HPM B;  3VHT C;  1TBE A;  4B9K A;  5JZE B;  2MX2 A;  4NJ6 A;  4W9E A;  3V62 A;  5CTR C;  3CMM B;  3NS8 A;  3U8Z A;  3X0W A;  2ASQ A;  4ZRK A;  2OOB B;  4NQK E;  2K6D B;  3L08 A;  4GB9 A;  5CHF A;  3D32 A;  3WA0 A;  2BYF A;  1WR1 A;  3KVF B;  3PSE B;  4W9F A;  3TIX A;  3ZDT A;  5L83 A;  5CHW A;  1WXA A;  1TGZ B;  4MDK E;  2MBQ A;  5KHQ A;  3HIZ A;  4GDL A;  3WAO A;  2NS5 A;  1XQQ A;  4KIK B;  3L54 A;  4B95 A;  2MW5 A;  3L13 A;  3ML8 A;  4LJO B;  1UGM A;  3UF8 A;  1U4A A;  2LVP A;  1L7Y A;  3NZU A;  1Q0W B;  4J6I A;  4NAW A;  2L3Z A;  2K39 A;  2KFK B;  3ONS A;  2K8H A;  4FA6 A;  2DZK A;  1S1Q B;  1I35 A;  3DOW A;  4NNJ B;  2I1K A;  1JRU A;  1WGD A;  4JQW C;  3QHT A;  5DCN A;  1IYF A;  2MBB B;  3SD5 A;  4FJZ A;  2BYE A;  1WH3 A;  2N9X A;  3RZW C;  3VH3 B;  2FIF A;  4MM3 A;  3PRM B;  3RUL A;  3NOB A;  1WM2 A;  1OTR B;  5E6O A;  3A1Q A;  4ANW A;  2B3A A;  3ZRC A;  4A20 A;  4HWI B;  3ZNG C;  4HVB A;  3QJZ A;  4URK A;  3SDL C;  4LCD E;  1GC7 A;  3W1S A;  4DDG D;  4WJP A;  3SHQ A;  2KNB A;  1X1M A;  1P98 A;  4BBN C;  3EC8 A;  4FLH A;  3W1Y A;  1Q1O A;  2BWF A;  3DBH I;  2KJR A;  3HHM A;  3M3J A;  4K7S A;  1J0G A;  3WAP A;  2DX5 B;  2REX A;  2MP2 A;  4WJQ A;  3VQI A;  2J0J A;  2A4Z A;  2KC2 A;  1Y8R C;  1V49 A;  1BT0 A;  2IY0 B;  2KO3 A;  5JHA A;  4EKU A;  2A5U A;  2M1M A;  4TQ0 A;  1E8W A;  2L0F A;  2DYB A;  1UH6 A;  2GBK A;  3IFW B;  4PS8 A;  1V5T A;  2LD9 A;  2HJ8 A;  3KUD B;  2FAZ A;  2IZV B;  2KLG A;  3JSV A;  4DK5 A;  2JPH A;  5IA7 A;  1YX5 B;  3WIM A;  1WGR A;  3PS6 A;  4EZJ A;  4HXD A;  3M95 A;  2O2V A;  2FNJ B;  3TMP B;  5LXI B;  4GGQ A;  2GBN A;  2PJH A;  3RYT A;  2C60 A;  2LXC A;  4I6L B;  5D6J B;  2K6Q A;  4W9I A;  3KH0 A;  4KIK A;  3TCA A;  2IO2 B;  2XK5 B;  3GOE A;  4XC2 A;  2KTR B;  1UEL A;  2KDB A;  2GOW A;  2KMC A;  1GG3 A;  2CKH B;  4DHJ B;  2G3Q B;  1OGW A;  5GMV A;  2KFK A;  1LFD A;  1YX6 B;  2LWP A;  4CHK A;  3U30 A;  2KVR A;  2LVO A;  4HCN B;  3JSV B;  1YD8 U;  1J19 A;  1YIW A;  4NPN A;  5J18 A;  3HM6 X;  3M62 B;  4G3X B;  1T0Y A;  3S2A A;  2UWQ A;  1EO6 A;  2Z0E B;  3Q3F A;  4BFR A;  3A4R A;  3H7S A;  2MRP A;  3QQ8 B;  3ENE A;  3RUI B;  4HPL B;  1SE9 A;  4XZ4 A;  4NY0 A;  2DYO A;  3APD A;  1IPG A;  3A1Q B;  3ZNH B;  3IG3 A;  4M8M A;  1WXS A;  1WX7 A;  5AZG A;  1S3S G;  1TTN A;  2BYV E;  3MHS D;  1D3Z A;  5G2N A;  3HK0 A;  2BKF A;  3GZN I;  2DAJ A;  4BOZ B;  1UBI A;  5AZH A;  2FCQ A;  2WX0 A;  3OLM D;  3OJ3 A;  1I42 A;  1V81 A;  5FR6 A;  1NBF C;  2WX1 A;  3N30 A;  2CHX A;  4B6W A;  1GUA B;  2MLB A;  2ZPY A;  2ZNV C;  5TR5 A;  1WX8 A;  4PS3 A;  5AZF A;  1G6J A;  2ZZP B;  2KWU B;  2PEA A;  3ML9 A;  3T9L A;  1WZ3 A;  5EDS A;  3APC A;  2DAF A;  1V86 A;  3R66 C;  2GBR A;  3ZRF A;  3PLU A;  2FUH B;  4JGH B;  3ZNZ B;  3RZF A;  2I1J A;  2FID A;  1EF5 A;  2AEH A;  4GDK A;  3DVG Y;  4IWQ A;  3KW5 B;  1E7U A;  3IVF A;  3ZTC A;  4A3O A;  4ANV A;  2JWZ A;  5L95 C;  4HDO A;  4I6N B;  4W9L A;  1WXV A;  2ZEQ A;  2JXX A;  3A4S C;  4BBN F;  1J8C A;  2KTF A;  2UYZ B;  4IM3 A;  3V61 A;  5JHB A;  2L8J A;  3MJW A;  4FUL A;  4RMA A;  5D2M B;  4PS7 A;  3C0R B;  3OAW A;  3B08 A;  3V6C B;  4E71 A;  1Z2M A;  3ECI A;  4EUT A;  4NAW B;  2ZJD A;  2JVC A;  2XEW A;  4K1R B;  4W9C A;  2Z0D B;  1NDD A;  1WMH A;  2ZPN A;  2ZCB A;  3A33 B;  3BIN A;  3T8M A;  3UQB A;  3ZLZ A;  1EUV B;  4FJV B;  2KZR A;  1P3Q U;  1XT9 B;  3PT2 B;  3Q3J A;  4G0N B;  1C1Y B;  3A9J B;  1Z5S B;  1LQB A;  5JH5 C;  1KOT A;  2G45 B;  5LLI A;  2D11 A;  3M63 B;  2M4N A;  4M8N A;  2ZVO A;  4FHJ A;  1LM8 B;  1VD2 A;  2GMI C;  2BWE S;  2LI5 A;  1CMX B;  1WGG A;  3H7P B;  2MWS B;  3HM3 A;  3WAN A;  3I3T B;  2D2Q A;  1WFY A;  2XBB C;  2N4F A;  3N32 A;  2MQJ A;  3TJP A;  4DHZ E;  2FCN A;  2KKC A;  1WGH A;  4ANX A;  4F7Z A;  5J17 A;  3OJ4 B;  1E8Z A;  2NBU A;  1WE7 A;  2KLC A;  1WJ4 A;  2QHO A;  3PRZ A;  3QIJ A;  4WWP A;  2LXA A;  3L17 A;  3A9J A;  4G11 A;  2WDT B;  3JYU A;  2MBO A;  3DBR I;  2MCN B;  2AL6 A;  4ZDV A;  2KDI A;  2KN5 A;  1RAX A;  1LXD A;  2K8B A;  2GBJ A;  2CHW A;  3X23 A;  4ANU A;  2V1Y A;  2FCM A;  2JF5 A;  2KDE B;  4GDK B;  2O6V D;  3NZS A;  4N9F 4;  3PVL A;  4W9H A;  3BY4 B;  1P9D U;  3KYD D;  2BF8 B;  1WM3 A;  2G4S A;  1UBQ A;  2V3S A;  3VFK A;  4DXA B;  2HE7 A;  1E8X A;  1R4M I;  1A5R A;  3MTN B;  2JRI B;  3QK0 A;  4MSQ B;  4PYZ A;  4GSW A;  1Q5W B;  2LRU A;  1F9J A;  4BKG A;  3W1S C;  2KJH B;  1EF1 A;  4PYU A;  1HE8 A;  1H8C A;  3QAR A;  4TUU A;  3ALB A;  3DQV A;  1WJN A;  2EMS A;  4W9G A;  3L10 B;  4II2 B;  4KVG B;  1WI0 A;  1L2N A;  2JY6 A;  2J0K A;  4DHJ D;  2PPH A;  2J7Q B;  1WJU A;  4JLC A;  3R7R A;  4FHK A;  2JZ3 B;  4DDI D;  1V80 A;  2LVQ A;  1XD3 B;  2NBW B;  2KDF B;  3ZKJ C;  1KLV A;  4GOC A;  1VCB A;  1GNU A;  1WJ6 A;  4MSM B;  5LXH A;  1H4R A;  2BGF A;  3QC8 B;  3B0A A;  1ZKH A;  4ZRI A;  3DBS A;  3PZD A;  2O6V A;  2M8S A;  2DEN B;  4NQL B;  4X57 B;  5C23 A;  2JT4 B;  4F1S A;  3VUX A;  4IUM B;  1WE6 A;  1WZ0 A;  3AUL A;  3DVN U;  2RR9 A;  1KJT A;  3CF6 E;  4IM0 A;  3VTW A;  3ZNI D;  4W9K A;  3PHX B;  2CS4 A;  2CHZ A;  3PPA A;  1E8Y A;  4LDT D;  5E6P A;  1E90 A;  4ICV A;  3ZO5 B;  2HTH A;  4WAA A;  2IO1 B;  4FJY A;  2G4D B;  5DPW A;  4IM2 A;  1UD7 A;  4HCP B;  3QCA A;  3PV1 A;  2C7H A;  4GIV A;  1OEY A;  2DZI A;  3KUC B;  1MG8 A;  2C7N B;  2DZJ A;  3VVW B;  2RPQ A;  3A9K B;  3DBL I;  2D3G A;  4MEM A;  5J2R A;  1SGH A;  4ZRJ A;  3PRP B;  4CYE A;  3B1L X;  4BKT A;  1P0R A;  4K81 A;  2KC1 A;  3LDZ E;  2D10 A;  2RD0 A;  3RT3 B;  3VUW A;  4AJY B;  4KDL B;  2KAN A;  3K9O B;  3DDC B;  1OQY A;  1NI2 A;  2N9P C;  2DHZ A;  2C7M B;  4BVU C;  2MBE A;  4GU2 A;  4AP4 C;  2KXJ A;  4E3C A;  2JZZ A;  4WWN A;  4ZYN A;  1K8R B;  4AJW A;  3A9K A;  3DVN V;  4FBJ B;  1GJZ A;  4K7W A;  3ZW3 A;  4HJK A;  2KQS A;  3AU4 A;  2YVC A;  2OJR A;  1WMH B;  4JL9 A;  4MGI E;  4MJS A;  3VDZ A;  1FXT B;  4W9J A;  1R4N I;  5E6N A;  3WAL A;  1UZX B;  2K1F A;  4KZC A;  4EZL A;  3DVG X;  1WRD B;  5KHO A;  3WAM A;  3ZVV A;  1WIA A;  4ASW C;  4OVV A;  4WJN A;  1WX9 A;  3IBE A;  5BO4 B;  2CU1 A;  4I6P A;  3VXW A;  3VUY A;  1V6E A;  2KX3 A;  2M0X A;  2MBH A;  2K8C A;  2NBV B;  3K9P B;  4IW0 A;  2NR2 A;  3TBL D;  1P1A A;  4XX5 A;  2LGX A;  4A3P A;  4MGK E;  3CSF A;  4EOY A;  4DBG A;  5C1Z A;  3NHE B;  3V6E B;  1QZE A;  1RRB A;  3ZIM A;  2AYO B;  3ZDM C;  3H1U A;  3APF A;  3L0W B;  4AOF A;  4BOS C;  3AXC A;  3PRE A;  2KMA A;  1V9J A;  1ZW7 A;  5CHV C;  3SU8 X;  2R2Q A;  4MGY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...