2N9PC

Solution structure of rnf126 n-terminal zinc finger domain in complex with bag6 ubiquitin-like domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
100
Chain Sequence
MAHHHHHHVDDDDKMLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into the E3 ligase, RNF126.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF126
total genus 11
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n9pC00
3SHQA 1V81A 2VRRB 3VAWA 4CO7A 2LGYA 1J0GA 3MTNB 2MBHA 4WQOB 4F8CB 2M4NA 4W9KA 1WX8A 3DBHI 4OVVA 3RZFA 3A4RA 3M63B 4DHJD 5BO4B 3WIMA 3T8MA 1NDDA 4ANWA 3L10B 4MEMA 2LD9A 3A1QA 3SD5A 4BKSD 4JQWC 2DENB 2EKEC 2N9PC 4X57B 1WR1A 2NPTA 2JWZA 4LJOB 3AULA 2LXCA 2LVPA 3ZUNA 2GBNA 2KN5A 4HCNB 2IO0B 4HDOA 5L95C 1RFAA 3B08A 1A5RA 4LDTB 2A5UA 1WZ3A 2CS4A 2QHOA 4B9KA 1I42A 3GZNI 3IBEA 2IZVB 2K6DB 2MBOA 5LXIB 2C9WB 3QC8B 4MSQB 3H7PA 4HCPB 4B6WA 3VTWA 1IP9A 2IBIB 1Y8RC 3IG3A 2J0JA 3TJPA 3QIJA 1OGWA 3JW0X 1WF9A 4GDKA 4WJPA 2CU1A 3ZDMC 3L08A 2K6QA 4IW0A 5CHWA 3VHTC 1GJZA 2KFJA 2GBKA 3KVFB 2N9EB 4XZ4A 3DVGY 2V1YA 4P7IA 4MJSB 2OOBB 2FCMA 3ZVVA 3OAWA 3L54A 4J6IA 5AZHA 2LRWA 4ZRJA 4EZLA 4AJYB 3V6EB 2MA9B 3HK0A 3TL5A 1UD7A 4ZRIA 4GDLA 3ZNHB 1E5WA 3L0WB 2KJHB 1Z2MA 2N7EA 1UBQA 1V9JA 1TGZB 1EF5A 2GBJA 2DYBA 2JT4B 4AP4C 3EHVA 1E8WA 4KDIC 2M8SA 3QA8A 2KC2A 3KUCB 4BKTA 3R7RA 4W9DA 4MGKE 2K39A 1EF1A 4BFRA 4KSLC 2RR9A 3HM6X 2CHWA 2IO1B 2MQJA 2L8JA 1XT9B 4WJQA 2KOXA 3PV1A 1WGGA 2NBWB 2KTRB 1WGDA 4I6NB 2JRHA 3A4SC 3PHXB 3NOBA 2O2VB 1VCBA 5CTRC 5DCNA 1RRBA 1IYFA 5JHAA 2DZMA 3HHMA 4WWPA 2MSED 1BT0A 2BYVE 2ZNVC 5DPWA 1HE8A 1WYWB 1MG8A 2D3GA 3A9KB 2W9NA 1KJTA 2XK5A 2O6VA 2KQ7A 3MHSD 1WX9A 4HWIB 4PYZA 4XX5A 3X23A 2C7HA 5AZFA 3Q3FA 5L83A 2C60A 2R2OA 3VUYA 1L2NA 2N7DA 2IY0B 4BOSC 3B0AA 3RULA 3T9LA 2KXJA 2KO3A 3ZW3A 2BF8B 1WJ6A 3M95A 2KVRA 1WFYA 4FADA 4NY0A 2ZJDA 4HJKA 3IVFA 3CF6E 1V5TA 4ANXA 4FJVB 2KHWB 3P2BA 2JXXA 2KTFA 3U7DA 5D2MB 2BPSA 3ZIMA 1V5OA 2KWCA 3PTFC 2KANA 3NY5A 2PEAA 3ML9A 1WJUA 2I1KA 2FAZA 4PYUA 1G6JA 1WXVA 3ZTDA 3LJ3A 4A20A 3PZDA 1KLVA 4IC7B 4LCDE 4ICVA 2HTHA 3VUXA 2KKCA 1I35A 2M17A 2YLMA 3H7PB 3L13A 4B95A 4ANUA 3PREA 4FULA 4FHJA 4II2B 4TUUA 5GMVA 4M0WB 5DPTA 5EDSA 3PGEA 4W9CA 5LXHA 4AWJA 2BKRB 1LQBA 3W1YA 3SDLC 3H6NA 4MGZE 4IM3A 2KMCA 1R4NI 2M1MA 1IPGA 2C7MB 4W9FA 4WJNA 1SIFA 2AL3A 1UELA 3GOEA 1P1AA 2LI5A 3VH3B 4HPLB 3S2AA 2PPHA 4PS3A 5E6OA 1WXSA 3Q3JA 4JGHB 3DBSA 4ANVA 4IWPA 2L76A 2CHZA 4GIVA 2WYQA 4W9JA 1WH3A 3RT3B 1E8YA 1H4RA 2MRPA 2DAJA 2KNBA 3KUZA 2ZNVB 3WA0A 1C3TA 4CYEA 1E7UA 1WXMA 4G50A 5TR5A 2GBMA 3L17A 3RYTA 4EOYA 1LXDA 2L0TA 4I6LB 1GNUA 2KMAA 3VFKA 3NHEB 1YQBA 4ICUA 3QQ8B 3R7QA 4ZYNA 3WAMA 1WE6A 3LDZE 2G4SA 4GSWA 3UINB 4LJPB 3ZNGC 2N4FA 4HXDA 4JIOU 2KZRA 4DK5A 2PE9A 3V60A 1F9JA 3D32A 4W9IA 5JHBA 1RAXA 2XBBC 1WGRA 4G11A 3AXCA 3WANA 1PQSA 3BY4B 4LDTD 4W9EA 2ASQA 3PPAA 1R4MI 3L16A 2M0XA 1JRUA 4NQKE 4FHKA 5J17A 3H9DA 1WJ4A 3CMMB 2YVCA 3ZO5B 1EO6A 3UGBB 2L0FA 2RD0A 3R3MA 4KZ0A 4RM8A 2EMSA 2ZPYA 4DHZE 5E6NA 1D3ZA 3SU8X 2KLGA 5G55A 2LZ6A 2D2QA 3RD2A 2KJRA 5D6JB 4IWQA 2D11A 2MCNB 3QWZB 2O2VA 4WWOA 3JYUA 5AEKB 3ZDTA 3DCGA 1S1QB 3IHPC 2IO3B 3QJZA 2AYOB 3RZWC 4IG7B 2OJRA 1WI0A 4EZJA 2ZCCA 2K8BA 3KYCD 1ZGUB 1SGHA 1ISNA 1WMHA 3RCZA 4DDID 1OQYA 2MBBB 2N1WA 1YX6B 2MLBA 2KK8A 2O6VB 2JZZA 3ENEA 3KYDD 4N9F4 3A9JA 5CHVC 5DPRA 2KTRA 1TZ1A 2BYFA 2CR5A 3UQBA 2JY6A 2ZVNA 2G45B 2NVUI 1LFDA 4NJ6A 4BVUC 1YIWA 3APDA 2JVCA 2ZZPB 3N3KB 3HM3A 3QCAA 3ZRCA 2KX3A 2KWUB 1OTRB 4KZCA 1Z5SB 3NS8A 1X1MA 1Q0WB 2GBRA 2XEWA 2LRUA 2MWSB 4G3XB 2L3ZA 4KIKA 4IM2A 1XD3B 4NNJB 1OEYJ 4PS7A 3X0WA 3UIPB 4WJOA 4RMAA 2ZPNA 3BINA 1WY8A 2KX0A 4MGYE 2NR2A 2FCQA 3N30A 3O65B 4M8MA 1UZXB 2WWZA 3CSFA 3TMPB 3PHWB 2DZJA 2JRIB 4MSMB 1WX7A 3ZNID 2MP2A 1EUVB 4A3OA 4TKNA 3AU4A 4AJWA 3PVLA 2JF5A 2Z59B 3K9PB 2RSUA 4BKGA 5E6PA 2KDIA 1UH6A 3VTVA 2IYDB 4MGIE 3DBRI 4OVUA 1WRDB 2O6VD 3KH0A 1J19A 4HPMB 1P9DU 4NQLB 1XQQA 1H8CA 2CHXA 4JL9A 4FJZA 4KDLB 1FXTB 4MM3A 4WWNA 3RUIB 2J7QB 1YJ1A 4DHJB 3JVZX 3ECIA 4K7WA 2KFKA 2L00B 3PLUA 1WXAA 2AWTA 3ML8A 3NZUA 1WE7A 1J8CA 1WIAA 2KQSA 4CHKA 4F1SA 2MX2A 3ALBA 5C1ZA 2HD5B 2C7NB 1TTNA 4DBGA 3AU5A 2JPHA 2DHZA 2D10A 3EFUA 2C5LC 2FNJB 3TBLD 4GGQA 2FIDA 3OJ4B 1AARA 3DQVA 1V2YA 3AI5A 3H7SA 4BBNC 3QARA 2LUEA 2R2QA 4M8NA 4TQ1A 1UGMA 2V4LA 2LGXA 3ZNZB 3DPDA 3UF8A 4BBNF 3EECA 1M94A 3A9JB 4K7UA 3H1UA 4MDKE 3V62A 5KHOA 4NAWB 2J0MA 4PS8A 2DYMA 4A3PA 2WX0A 4GU2A 4FBJB 3IFWB 2WDTB 4TV3A 3A1QB 2BWFA 5AZGA 3DBLI 4HVBA 1WM3A 1TBEA 3W1SA 4K81A 3M3JA 5HKHA 1UBIA 1GC6A 3VVWB 1L7YA 2Z0DB 5JZEB 1WGYA 2K25A 1CMXB 3QX1A 3WALA 2DX5B 2DZKA 2BGFA 1KOTA 1LM8B 4W9GA 2KWVB 1GG3A 3KUDB 3TIXA 2J0KA 2KJ6A 4GOCA 4G0NB 2LXAA 2L05A 5J18A 1P98A 3QK0A 2GOWA 2NBVB 2LVOA 4KIKB 3JSVB 5DPSA 4ZDVA 1P0RA 2IY1B 3V6CB 1RLFA 4NJ7A 3VDZA 3APFA 2LJ5A 2KD0A 4WAAA 2L7RA 5G2NA 3PT2B 1K8RB 4W9HA 4GXBA 2FCNA 2DYOA 4AUQC 1P3QU 2NS5A 3HIZA 5D94A 2MP2B 2LGDA 2WX1A 1GUAB 2BWES 1WM2A 1T0YA 4EKUA 2IO2B 2NBUA 2A4ZA 3DOWA 3PLVA 4F7ZA 4HK2A 2HJ8A 3TCAA 4E71A 4W9LA 2KLCA 4AOFA 1V80A 3WAOA 4E3CA 2K8HA 4DDGD 1V6EA 2KDBA 1Q1OA 2Z0EB 1C1YB 2FIFA 2BYEA 1U4AA 4BOZB 4GMVA 5JH5C 2LASA 4DXAB 2ZEQA 4JLCA 2B3AA 2KDEB 2DAFA 5CHFA 2DZIA 4MJSA 3ZTCA 1WMHB 3APCA 1NBFC 4E74A 3V61A 3PSEB 5LLIA 1KM7A 3ZKJC 4TQ0A 5FR6A 2LVQA 4EUTA 4GDLB 2UWQA 2JUOA 3EC8A 4DWFA 4FJYA 3VTUA 3W1SC 1S3SG 3U8ZA 2AEHA 3DVGX 3DVNV 4ZRKA 3CSTA 3OJ3A 3PRMB 2MW5A 3OLMD 2RGFA 4IWOA 1VD2A 3VXWA 1QZEA 2UYZB 4KVGB 2NPTB 2MBQA 4FA6A 1ZW7A 2JZ3B 2N1VA 3M62B 5IAAC 4DHZB 4EZKA 1Q5WB 1E90A 3C0RB 3A9KA 4I6PA 4MELA 2BKFA 3VH4B 1WGHA 4FN2A 4NPNA 4KV2A 2I1JA 2KDFB 2KFKB 3NZSA 3MJWA 4IM0A 3I3TB 1OEYA 4GB9A 3WAPA 4ASWC 3VUWA 2LWPA 4NAWA 1V86A 1E7VA 1WJNA 2NCNA 2K8CA 4YL8A 4IUMB 5D7GA 2V3SA 2REXA 3PRZA 1GC7A 3KW5B 4XC2A 2PE6B 2ZVOA 2GMIC 2HE7A 4BKSA 1E8ZA 3VQIA 4GDKB 3UIOB 2G4DB 3DDCB 5KHQA 4EFOA 4KSKC 3A33B 3UQAA 1WZ0A 2PJHA 4II3B 1NI2A 2N9XA 4MH0E 3ZLZA 3QHTA 2D07B 2G3QB 4EEWA 3ONSA 4HDQA 2KC1A 3PS6A 2ZCBA 1E8XA 2EMTA 2Y5BB 1WR6E 2AL6A 4K7SA 1ZKHA 4FLHA 1YD8U 2K1FA 2FCSA 3ZRFA 3JSVA 2CKHB 5IA7A 3U30A 1V49A 1YX5B 3PRPB 3B1LX 4RM9A 5J2RA 4K1RB 3QAQA 5C23A 4GN1A 3K9OB 5CX3A 2MBEA 2RPQA 3N32A 3R66C 2FUHB 4HLEA 1SE9A 2XK5B 3DVNU 4URKA
chains in the Genus database with same CATH superfamily
1OFFA 2M4NA 3BVMA 4W9KA 1WX8A 5BYRA 3T8MA 4ANWA 2WXOA 4MEMA 3SD5A 4M01A 1FNUA 5AUIA 1TZOA 1KTKA 2XNAC 4HCNB 4M02A 2WXLA 1DGJA 3AECB 1A5RA 4LDTB 3IXSA 1I42A 3GZNI 3IBEA 2C9WB 1B9RA 4A8XC 5C3JB 2IBIB 1Y8RC 4J3OD 3IG3A 3AH7A 1MG4A 3Q6BA 1KLUD 2CU1A 2JZPA 1GJZA 4NZLB 3KVFB 1VZ7A 4MJSB 2MJEA 2OOBB 3OAWA 4DXGA 2MEKA 2MA9B 4ZRIA 1WWTA 4RF0A 3ZGZA 1E5WA 3MC8A 3L4PA 4C56C 2DYBA 4LLGM 3R8BA 4KDIC 1ZDXA 4W9DA 4MGKE 2K39A 4KKIA 2CHWA 4K3BA 4WJQA 1WGGA 2NBWB 1WGDA 2JRHA 3PHXB 3NOBA 1VCBA 5CTRC 4R3DA 3TEZA 5JHAA 2DZMA 3HHMA 2BYVE 1B1ZA 1EU4A 1MG8A 2WDVB 3A9KB 1F52A 2W9NA 3NRZA 1TKEA 4PYZA 3Q3FA 2R2OA 1VR9A 3ZJVA 1MJDA 2IY0B 2ZW1A 4JPSA 1UWXA 3RULA 2KXJA 1J7AA 4NY0A 3IVFA 1V5TA 1YN5A 2EELA 3RNAC 3FILB 4XDDA 1V5OA 3PTFC 1Y56A 3IT4B 3NY5A 2INCC 2I1KA 5G5HA 2BB6A 4ICVA 4L1BA 3HVZA 4AQ7A 1ET9A 4II2B 4W9CA 4AWJA 1K50A 4LNNA 3AE1B 2M1MA 5FR3A 2LI5A 4MH8A 4JGHB 2CHZA 3ETRA 1WH3A 2MRPA 4UDUC 1L6VA 1C3TA 5TR5A 3ZXVA 1GNUA 3U2SC 3VFKA 1LO5D 4ZYNA 3WAMA 1SIJA 1E6EB 4BAXA 2DWQA 4LJPB 3Q14C 1XLPA 1RAXA 4MACA 3BY4B 1QOBA 2H89B 4NQKE 5J17A 4WAFA 5IOIA 3TUOA 3V3XA 3ZO5B 1EO6A 3LYYA 2L0FA 3R3MA 1ZOYB 4RM8A 2KT7A 3NVWA 2D2QA 3RD2A 1L0VB 1V97A 2D11A 3JYUA 4L23A 3QJZA 3Q8BA 2AYOB 2V4IB 3RZWC 3KYCD 1ZGUB 1WMHA 1NI3A 4DDID 1YX6B 2N1WA 1NEKB 4N9F4 4N58A 1HZ6A 4A55A 5I4DA 2JY6A 2ZVNA 4P1CC 1VRAB 2G45B 4NJ6A 1FXAA 1YIWA 2ZZPB 1T3QA 3ZRCA 1JMLA 1L0XB 3GZNB 4KZCA 1Z5SB 3NS8A 2M0AA 4S0RA 1Q0WB 1OEYJ 3UIPB 3BINA 4MGYE 3ZJTA 2FCQA 3N30A 2WWZA 3AEEB 3PHWB 2JRIB 3ZNID 3MC0B 4RNAA 1FNVA 4AJWA 2RSUA 4BKGA 1TIFA 5E6PA 4OVZA 1UH6A 2BYTA 3DBRI 2O6VD 4HPMB 1P9DU 2SAKA 3RUIB 1FIQA 3Q8CA 2J7QB 4K7WA 3PLUA 1WE7A 4CHKA 3ALBA 2HD5B 2EKIA 1JW9D 1TTNA 1WRIA 2C5LC 3TBLD 4GGQA 2FIDA 3AI5A 4M8NA 2KACA 4ZYSA 3DPDA 3GS2A 1M94A 4IKGA 2GI9A 5BMGA 4MDKE 4FBJB 4GU2A 2DLBA 3VVWB 2Z0DB 1WSPA 1T0QC 4Q2JA 1I4QA 2K25A 3QX1A 3WALA 2PW9A 2PIAA 5BYQA 4W9GA 2KJ6A 3PZ8A 4GOCA 2LXAA 2K0PA 2BS2B 2AQ2B 1RM6C 1P98A 3ABVB 2GOWA 2NBVB 4NJCA 4KIKB 3JSVB 1P0RA 1QLBB 4NJ7A 3AE5B 4B0MA 4JWUC 5G2NA 3Q2AC 2NS5A 1ZXHA 2ZW0A 3ZYYX 5D94A 4N6EB 2MP2B 3NVZA 1GUAB 2GB1A 4EKUA 2IO2B 3EFCA 4F7ZA 3SR6A 4HK2A 3AB5A 4E71A 2KLCA 1V80A 4DDGD 1FEHA 2Z0EB 4MM3B 4H2AA 5JH5C 4DXAB 2B3AA 2L83A 3MP9A 4WIPA 5FR6A 1MVKA 2LVQA 4GDLB 3EC8A 4DWFA 1IBXA 3W1SC 1S3SG 3U8ZA 2AEHA 3C19A 5G5GA 2MW5A 3VXWA 4C00A 2MBQA 4RGOS 2N1VA 3M62B 3AE6B 2IJ0A 1E90A 2BKFA 4ZRPA 1WGHA 2FBWB 4FN2A 2WQYB 2IPKD 3NZSA 1OEYA 4ASWC 4NAWA 1V86A 2K8CA 5D7GA 1F0ZA 1BUIC 2V3SA 2PE6B 3AE8B 4P6VF 2GMIC 3VQIA 4ARCA 2X38A 5KHQA 3A33B 4II3B 2PJHA 1NI2A 2WXHA 2G3QB 3ONSA 3TEYA 2KC1A 3PS6A 3RI7C 1JWAD 2Y5BB 5BMHA 1WR6E 1QOGA 1R4NB 5IA7A 1NYQA 4LNFA 4KX6B 3DBHB 4RM9A 4M0WA 4K1RB 3E56A 4USAA 4REZA 2MJ3A 3N32A 2FUHB 3DVNU 2VRRB 1J0GA 2JXTA 2RDHA 1NDDA 2DBYA 3L10B 4OHJA 2QEJC 2DENB 4X57B 1WR1A 3W2DA 4YTPB 3ZUNA 2IO0B 5L95C 2A5UA 2QHOA 2K6DB 2MBOA 2JWUA 2E3TA 4B6WA 3R2IA 1HXYD 1RFKA 2J0JA 3QIJA 1OGWA 3JW0X 2KYWA 2K5PA 3ZDMC 4IW0A 3I63C 5CHWA 2K22A 1F2RC 3ZVVA 3L54A 3HK0A 3RN9C 3L0WB 3MFGA 1I4XA 2L32A 1V9JA 1TGZB 1EF5A 2JT4B 5HG2A 4AP4C 2M8SA 3QA8A 4BKTA 2QSDA 1DYQA 1EF1A 4KSLC 2IO1B 1GPXA 1XT9B 1CJEA 4IOIE 3A4SC 2M56B 2O2VB 4C4VB 4WWPA 2MSED 1HE8A 2PVGC 2O6VA 2KQ7A 5IKCM 2JX5A 3KWVA 4D2KA 2C7HA 3ZJUA 2C60A 2FUG1 3VUYA 1L2NA 1FMAD 2N7DA 4XWTA 1KLGD 1WJ6A 4RF1A 2KVRA 4HJKA 1JCKB 3EUB2 4ANXA 2BPSA 3H8HA 2KWCA 1QKZA 3ML9A 1QILA 1G6JA 3ZTDA 3RNCC 1JALA 4LCDE 3VUXA 1YJJA 3L13A 4B95A 3PREA 1JWUD 1WXQA 5EDSA 5LXHA 1F2RI 1IGCA 2BKRB 3H6NA 4MGZE 4IM3A 4W9FA 2L1AA 1SIFA 3GOEA 2WNMA 2QMTA 2AQ1B 2PPHA 1WXSA 3Q3JA 4ANVA 2L76A 4W9JA 2WYQA 3T3NA 2DAJA 3WA0A 1NVID 3NZ3A 3RYTA 1LXDA 4I6LB 5GXGB 2LHEA 2LGSA 1SE2A 3LDZE 3UINB 4PK1A 2N4FA 2LJIA 1KFYB 4DK5A 3KQ4A 3D32A 5JHBA 1VZ8A 1WGRA 2WS3B 4QAYA 3AXCA 3WANA 1PGBA 2AX5A 4KKJA 2ASQA 1R4MI 3L16A 3TSSA 2VH2A 1JRUA 2N9KA 3Q8AA 4FHKA 1WJ4A 2YVCA 5E6NA 2KLGA 5G55A 3AM9A 4DQOC 4LNIA 5D6JB 1NYRA 4IWQA 3BK2A 4OZBA 4WWOA 4C7YA 3SFDB 2IO3B 1UGJA 2QC8A 4EZJA 2ZCCA 3KYDD 3ENEA 1DOYA 2JZZA 3NVVA 5DPRA 1MHHE 2KTRA 2WGSA 2NVUI 1LFDA 1YN4A 4A9AA 3N3KB 2KWUB 1OTRB 3AE2B 1X1MA 1TKYA 4KIKA 4G3XB 4YXDB 2LRUA 2MWSB 3HVDA 2L3ZA 4IM2A 1XD3B 2N7JA 4PS7A 1XLNA 3O65B 3CSFA 3TMPB 4MSMB 2QDFA 4RFBA 2MP2A 4A6QA 2Z59B 3E9SA 4JX1C 1L0YB 4MGIE 4HJGE 4NQLB 3RPFC 1UWMA 2CHXA 4JL9A 5IN7A 4MM3A 1FXTB 1QOFA 1YJ1A 4DHJB 3JVZX 1ET6A 3ECIA 2KFKA 2FE8A 1D5XC 2AWTA 3NZUA 1OQRA 2KQSA 1UUPA 5C1ZA 3CIRB 1N5WA 2MH7A 5D3IB 3AU5A 2JPHA 2DHZA 2D10A 1XCTL 1TY2A 4HKQA 3DQVA 2LUEA 1L5PA 2INDC 2PTLA 4TQ1A 2V4LA 2LGXA 3ZNZB 2PLPA 3UF8A 4BBNF 4P1BC 1TS4A 1VDVA 3BZDB 4YSZB 3H1UA 3V62A 1YJIA 4NAWB 2J0MA 2DYMA 2WX0A 2N0SB 1RYJA 4TV3A 2BWFA 4K81A 5HKHA 1N60A 5FK9C 3P42A 2ONQA 5HFYA 2K9XA 1WGYA 1CMXB 2DX5B 1LM8B 3P4QB 2W55A 3KUDB 3TIXA 2J0KA 4G0NB 1HQRD 3Q8FA 4HKZE 5DPSA 2Y5PA 2GLSA 3V6CB 1RLFA 2V0GA 1XO3A 3APFA 2LJ5A 4WAAA 3PT2B 1K8RB 2JQRB 4GXBA 2FCNA 1V8CA 5EE1A 1TS3A 2LGDA 1WM2A 2HJ1A 2NBUA 2KAJA 3AE9B 2HDEA 3TCAA 4AS1A 3PZ7A 4AOFA 1XF5L 2FIFA 1XLQA 2BYEA 1A70A 2ZEQA 1C9FA 1Q10A 4MJSA 3AEDB 4E74A 1JRPA 2TSSA 4P16A 3ZKJC 4TQ0A 3N9YC 2NTTA 3VTUA 1CZPA 4YTNB 3T3OA 3PRMB 4IWOA 3URYA 5MPOA 4DHZB 2JZ3B 3C0RB 3A9KA 4I6PA 3RNFC 4ZHOA 4IM0A 3I3TB 1E7VA 1VLBA 3IT6B 2NCNA 1SE4A 3PRZA 2ZVOA 2HE7A 1E8ZA 2NTSA 3UIOB 2G4DB 2W82A 1RWSA 4KSKC 3UQAA 1MFWA 3GB1A 1FXIA 2D07B 4EEWA 5H8YE 1D5ZC 2ZCBA 1SBBB 3AEGB 4C7ZA 4K7SA 1C4CA 2FCSA 1QT9A 1V49A 4C4VA 3PRPB 1E9MA 2GRIA 5J2RA 5C23A 4GN1A 1AWDA 3K9OB 2RPQA 3R66C 1UF0A 1KF6B 3AEBB 1EU3A 1FRRA 2MBHA 4WQOB 4F8CB 2OJWA 3I9V1 1K51A 3MC9A 3Q8EA 3DBHI 4OVVA 3RZFA 3A4RA 3WIMA 2ON8A 3KWLA 3Q3MC 3A1QA 4BKSD 4JWSC 1JROA 3DWMA 1VZ6A 2EKEC 2JWZA 3AULA 2D5GA 2W3RA 2LVPA 4K3CA 3RNBC 4LK0M 2GBNA 3FKYA 1RFAA 1XCQL 2V3NA 3HUIA 1FCCC 1WZ3A 2CS4A 2KDMA 4B9KA 1SE3A 4FXCA 5LXIB 3QC8B 4HCPB 1IP9A 1E7PB 3TJPA 3L08A 2K6QA 3N20C 2GBKA 1F1HA 4XZ4A 3DVGY 3P1MA 2FCMA 1GOZA 4J6IA 2LRWA 4AJYB 3V6EB 4ZOHC 1UD7A 1PYWD 1L4DB 2BQQA 2MHJA 2N7EA 3U52E 1PDXA 2J4XA 3BK1A 3EHVA 1E8WA 2KC2A 2WDRB 2K3UA 3KUCB 3R7RA 4BFRA 1GAQB 1LGRA 4KGRA 2MQJA 3FAHA 2J42A 2WXFA 4HRSA 1PFDA 1D6EC 1TT5B 1RRBA 1IYFA 2BW2A 5EE3A 5DPWA 2OHFA 1ZE3D 1KJTA 2XK5A 2JSVX 3MHSD 2I38A 1J7CA 5AZFA 5L83A 3T9LA 1XEEA 3M95A 1PGXA 1WFYA 2ZJDA 3CF6E 4HPPA 4US9A 1C79A 2KTFA 3FC4A 4US8A 3ZIMA 3BIID 2KANA 2PEAA 1WJUA 3CWIA 2FAZA 2V3PA 4PYUA 4ZRQA 4A20A 3PZDA 4IC7B 2WXIA 2HTHA 1FFUA 3C8YA 3H7PB 1CK1A 4FULA 5GMVA 4FHJA 2OEDA 4TUUA 5LNK1 5DPTA 1J7BA 2WXPA 1HEZE 3W1YA 3SDLC 2KMCA 1IPGA 1FPYA 1UELA 3P4RB 2WXJA 3S2AA 4PS3A 3VRBB 5E6OA 1PGAA 4IWPA 4YSYB 1E8YA 1EWCA 1H4RA 3NJTA 1V1OA 1N5XA 3KUZA 2D3BA 1E7UA 4G50A 4EOYA 2L0TA 2KMAA 2KVZA 3NHEB 3QQ8B 3R7QA 4A90A 1WE6A 2G4SA 1MI0A 3ZNGC 4HXDA 2KZRA 3AEAB 1F9JA 4W9IA 2J53A 4WWMA 4YTMB 2XBBC 5E6JA 4G11A 1N61A 1PQSA 2UU7A 4W9EA 4OW0A 3PPAA 3H9DA 3AE4B 3N1XC 2QCZA 4KZ0A 2ZPYA 4DHZE 2B76B 1E10A 5FKAC 1IUEA 5AEKB 3VR8B 3DCGA 3ZDTA 3IHPC 1HZ5A 3RNEC 1WI0A 2K8BA 1FO4A 1ISNA 3RCZA 1OQYA 4EE2A 2KK8A 2MLBA 1C4AA 3A9JA 1TZ1A 3IAM1 2CR5A 3UQBA 1BXTA 1P7EA 1WGKA 1YNTE 2RDBC 2XEWA 3X0WA 4WJOA 4XGAB 2KX0A 2DZJA 1WX7A 1IBXB 1EUVB 4A3OA 3AU4A 3B9JA 2JF5A 3K9PB 3VTVA 2IYDB 4S17A 1J19A 1ZDVA 3MJ5A 3IAS1 1XQQA 1H8CA 4FJZA 4KDLB 3MHZA 3BWUD 3FILA 1WXAA 3Q69A 3RFZB 1J8CA 1WIAA 4F1SA 2W54A 1T0RC 1SJHD 2YEPB 2R61A 4DBGA 1SEBD 4MT5A 4LNOA 1K53A 2VH1A 3EFUA 1AARA 4BBNC 3QARA 1UGMA 3EECA 1R7SA 3LXFA 3A9JB 1SB3C 3DWGC 4PS8A 3IFWB 2WDTB 3DBLI 4HVBA 2JYTA 1TBEA 3W1SA 3M3JA 1GC6A 2SEBD 3GE8C 4N59A 2BGFA 1FFVA 1GG3A 1M4VA 3AE3B 2LFIA 2L05A 1SXTA 3QK0A 2LVOA 4ZDVA 4LTUA 2IY1B 2L7RA 4LNKA 4W9HA 2DYOA 1P3QU 3I57A 3HIZA 1DOXA 4XYCA 1AYFA 1T0YA 2IGGA 4W9LA 2PKOA 2K8HA 3BYTB 1C1YB 4BOZB 4GMVA 1SSNA 2LASA 3PO0A 4JLCA 2KDEB 5CHFA 3ZTCA 3UI3A 1WMHB 1NBFC 1YOVB 3V61A 5LLIA 4EUTA 2UWQA 2JUOA 4ZRKA 3OJ3A 3OLMD 2D3CA 1YN3A 1VD2A 2BS4B 1QZEA 2WXNA 2VZKD 2NPTB 1ACCA 3U7ZA 4FA6A 5IAAC 1I4PA 2G9HD 1FNWA 1DOIA 3BVGA 2I1JA 2KDFB 3MJWA 2V9HA 4GB9A 3WAPA 3VUWA 1WJNA 2D3AA 3N1ZC 4YL8A 1L6UA 2H88B 2REXA 1GC7A 3KW5B 4XC2A 4ARIA 2WU5B 1STEA 4BKSA 4GDKB 4HROA 4KGTA 4EFOA 1WZ0A 1UNSA 2WXRA 2N9XA 4MH0E 3ZLZA 2BBCA 4CQNA 1HTQA 2EMTA 2Y3AA 4GLSC 2AL6A 4FLHA 2G1EA 2K1FA 1YX5B 3EGRA 3QAQA 2MBEA 1SE9A 2XK5B 4URKA 3SHQA 1N63A 1V81A 3VAWA 4CO7A 2LGYA 3MTNB 3Q3NC 4DHJD 3M63B 5BO4B 2LD9A 3BVZA 4JQWC 2N9PC 4WQMA 2NPTA 3U4EG 4LJOB 5H92C 2WP9B 2LXCA 4YT0B 3AEFB 2KN5A 4IDIA 2Y5CA 4HDOA 1D5MC 2W3SA 3B08A 2ACZB 1FCLA 1KRHA 2IZVB 2IDYA 4MSQB 2RPVA 3H7PA 3VTWA 1BMLC 4NAMA 3GE3C 1WF9A 4GDKA 4WJPA 3VHTC 2KFJA 2N9EB 2V1YA 4P7IA 3AV8A 1JQ4A 5AZHA 4ZRJA 4EZLA 3TL5A 2MJDA 4GDLA 3ZNHB 2JYEA 2KJHB 4PT5A 3ZXRA 1Z2MA 1C4PA 1ZP0B 2I2YA 1UBQA 2BVCA 2ICIA 2GBJA 4M00A 5D3DA 2IGDA 4RGMA 2HTME 2RMMA 2RR9A 3HM6X 2L8JA 3P4SB 2KOXA 3PV1A 2WXMA 2KTRB 2QILA 4I6NB 4RCOA 4KGSA 1FM0D 5DCNA 5JXVA 2ZNVC 1BT0A 2WXKA 1WYWB 1TS5A 3AE7B 2BB5A 1EM7A 2QIEB 2D3GA 2LEKA 1CQVA 3I5JC 1WX9A 2VZKB 4HWIB 4XX5A 3X23A 4OZAA 2LUMA 5TSSA 2JU6X 4BOSC 3B0AA 3V05A 2WXQA 2KO3A 1F77A 1I7HA 3ZW3A 3GP7A 2BF8B 4FADA 1WYGA 2INPE 4BZAA 4FJVB 2KHWB 3NG0A 3P2BA 2JXXA 2L52A 2AQ3B 3U7DA 5D2MB 2BS3B 1FD6A 1WXVA 3LJ3A 2YEPF 1QQRA 1KLVA 3AN1A 2KKCA 1I35A 2M17A 2YLMA 1T6BX 1JWBD 4ACFA 4ANUA 4WURA 4M0WB 4ITKA 1ESFA 3PGEA 1MPEA 1LQBA 4XDCA 1R4NI 2C7MB 4WJNA 3OG5A 2AL3A 1L4ZB 1P1AA 3VH3B 4HPLB 3VRAB 2QJLA 3DBSA 3RMKC 4GIVA 1FRDA 1XXGA 3RT3B 2KNBA 2CJOA 2ZNVB 4CYEA 1WXMA 2GBMA 3L17A 3N1YC 1GB1A 1KH0A 1YQBA 4ICUA 2PVOD 1GB4A 2X8XX 2XN9C 4XWWA 1SF0A 4GSWA 4JIOU 2E6XA 2PE9A 3V60A 1C76A 1K52A 5T8IA 1I4RA 2WLBA 2KWDA 2BT6A 1HTOA 2IGHA 1AW7A 1OQQA 4LDTD 2M0XA 2N9LA 3CMMB 3HRDD 1HA5A 3UGBB 1TYGB 2RD0A 4HEA1 3TEWA 2LHDA 1XLOA 2EMSA 1D3ZA 3SU8X 1EWYC 2LZ6A 2CU3A 4B0EA 2KJRA 3KLSX 1JWMD 3BYYB 1R4MB 2MCNB 3QWZB 1C78A 2O2VA 2NMQA 4RH6A 3W5VB 1S1QB 1I4HA 1ZPSA 2LGIA 4IG7B 2OJRA 1SGHA 1SJED 1TJEA 2MBBB 2O6VB 3R2TA 5CHVC 1PUTA 1ROEA 2BYFA 3DBLB 4BVUC 4WH4A 3WCQA 2WHIA 3APDA 2JVCA 3QCAA 3HM3A 2KX3A 4L2YA 5C2TB 2GBRA 3B2GA 3DBRB 1V1PA 4NNJB 4RMAA 2ZPNA 1JWSD 1WY8A 3AMZA 3SFEB 2NR2A 4M8MA 1UZXB 5IP4D 5IO9A 4TKNA 3PVLA 2KDIA 4OVUA 1WRDB 3KH0A 4WWNA 2L00B 4JE3B 2KQ4X 3ML8A 2MX2A 1C77A 2C7NB 1ZUD2 3TEXA 2FNJB 3OJ4B 1V2YA 3H7SA 2CJNA 2LMCA 2R2QA 1YQ3B 1ENFA 3W9CB 3B2FA 1QOAA 5EE0A 4K7UA 5HI1A 1ZXIA 2RDGA 2Q5WD 5KHOA 4A3PA 1D4BA 2M19A 3A1QB 4O1NA 5AZGA 3RNGC 1WM3A 3OWEB 2BTEA 1UBIA 1L7YA 1V1PB 3W5UB 5JZEB 2J52A 4XE0A 2DZKA 4DXFA 1KOTA 2KWVB 3P63A 1N6ZA 2Z8LA 1I4GA 5AUKA 5J18A 1T0SC 3NUHB 3NS1A 3VDZA 2KD0A 4AUQC 1E0ZA 1TKGA 2WX1A 2BWES 2A4ZA 3DOWA 3PLVA 2HJ8A 4E3CA 3WAOA 1YMHE 1V6EA 2KDBA 1Q1OA 1U4AA 3DHIC 3EA6A 1TS2A 2DAFA 2DZIA 3APCA 5HHDG 3PSEB 3NVYA 2KMMA 1KM7A 1IGDA 4FJYA 1MHXA 4TSSA 3DVGX 3DVNV 3CSTA 2RGFA 2PMVA 3Q3OC 1P7FA 2UYZB 4KVGB 2WU2B 1ZW7A 3VR9B 4EZKA 1Q5WB 3DHHC 1NENB 4RGNA 4MELA 3VH4B 1QF6A 4NPNA 4KV2A 2KFKB 4OZCA 2WDQB 1N62A 4C80A 5EE9A 2LWPA 4IUMB 5BYSA 3J9CA 4TMAB 2INNE 2KN4A 2WXGA 3DDCB 3DHGC 3ZQ4A 3LB8C 3O13A 3QHTA 1YQ4B 4HDQA 1E8XA 1T5XD 3P4PB 1ZKHA 4YSXB 1YD8U 4ZHPA 3ZRFA 3JSVA 2CKHB 3U30A 3B1LX 1TY0A 5CX3A 4RGTA 1AN8A 1VJKA 3SEBA 5BMIA 4YWGG 2DNFA 4HLEA
chains in the Genus database with same CATH topology
3SHQA 1V81A 2VRRB 3VAWA 4CO7A 2LGYA 1J0GA 3MTNB 2MBHA 4WQOB 4F8CB 2M4NA 4W9KA 1WX8A 3DBHI 4OVVA 3RZFA 3A4RA 3M63B 4DHJD 5BO4B 3WIMA 3T8MA 1NDDA 4ANWA 3L10B 4MEMA 2LD9A 3A1QA 3SD5A 4BKSD 4JQWC 2DENB 2EKEC 2N9PC 4X57B 1WR1A 2NPTA 2JWZA 4LJOB 3AULA 2LXCA 2LVPA 3ZUNA 2GBNA 2KN5A 4HCNB 2IO0B 4HDOA 5L95C 1RFAA 3B08A 1A5RA 4LDTB 2A5UA 1WZ3A 2CS4A 2QHOA 4B9KA 1I42A 3GZNI 3IBEA 2IZVB 2K6DB 2MBOA 5LXIB 2C9WB 3QC8B 4MSQB 3H7PA 4HCPB 4B6WA 3VTWA 1IP9A 2IBIB 1Y8RC 3IG3A 2J0JA 3TJPA 3QIJA 1OGWA 3JW0X 1WF9A 4GDKA 4WJPA 2CU1A 3ZDMC 3L08A 2K6QA 4IW0A 5CHWA 3VHTC 1GJZA 2KFJA 2GBKA 3KVFB 2N9EB 4XZ4A 3DVGY 2V1YA 4P7IA 4MJSB 2OOBB 2FCMA 3ZVVA 3OAWA 3L54A 4J6IA 5AZHA 2LRWA 4ZRJA 4EZLA 4AJYB 3V6EB 2MA9B 3HK0A 3TL5A 1UD7A 4ZRIA 4GDLA 3ZNHB 1E5WA 3L0WB 2KJHB 1Z2MA 2N7EA 1UBQA 1V9JA 1TGZB 1EF5A 2GBJA 2DYBA 2JT4B 4AP4C 3EHVA 1E8WA 4KDIC 2M8SA 3QA8A 2KC2A 3KUCB 4BKTA 3R7RA 4W9DA 4MGKE 2K39A 1EF1A 4BFRA 4KSLC 2RR9A 3HM6X 2CHWA 2IO1B 2MQJA 2L8JA 1XT9B 4WJQA 2KOXA 3PV1A 1WGGA 2NBWB 2KTRB 1WGDA 4I6NB 2JRHA 3A4SC 3PHXB 3NOBA 2O2VB 1VCBA 5CTRC 5DCNA 1RRBA 1IYFA 5JHAA 2DZMA 3HHMA 4WWPA 2MSED 1BT0A 2BYVE 2ZNVC 5DPWA 1HE8A 1WYWB 1MG8A 2D3GA 3A9KB 2W9NA 1KJTA 2XK5A 2O6VA 2KQ7A 3MHSD 1WX9A 4HWIB 4PYZA 4XX5A 3X23A 2C7HA 5AZFA 3Q3FA 5L83A 2C60A 2R2OA 3VUYA 1L2NA 2N7DA 2IY0B 4BOSC 3B0AA 3RULA 3T9LA 2KXJA 2KO3A 3ZW3A 2BF8B 1WJ6A 3M95A 2KVRA 1WFYA 4FADA 4NY0A 2ZJDA 4HJKA 3IVFA 3CF6E 1V5TA 4ANXA 4FJVB 2KHWB 3P2BA 2JXXA 2KTFA 3U7DA 5D2MB 2BPSA 3ZIMA 1V5OA 2KWCA 3PTFC 2KANA 3NY5A 2PEAA 3ML9A 1WJUA 2I1KA 2FAZA 4PYUA 1G6JA 1WXVA 3ZTDA 3LJ3A 4A20A 3PZDA 1KLVA 4IC7B 4LCDE 4ICVA 2HTHA 3VUXA 2KKCA 1I35A 2M17A 2YLMA 3H7PB 3L13A 4B95A 4ANUA 3PREA 4FULA 4FHJA 4II2B 4TUUA 5GMVA 4M0WB 5DPTA 5EDSA 3PGEA 4W9CA 5LXHA 4AWJA 2BKRB 1LQBA 3W1YA 3SDLC 3H6NA 4MGZE 4IM3A 2KMCA 1R4NI 2M1MA 1IPGA 2C7MB 4W9FA 4WJNA 1SIFA 2AL3A 1UELA 3GOEA 1P1AA 2LI5A 3VH3B 4HPLB 3S2AA 2PPHA 4PS3A 5E6OA 1WXSA 3Q3JA 4JGHB 3DBSA 4ANVA 4IWPA 2L76A 2CHZA 4GIVA 2WYQA 4W9JA 1WH3A 3RT3B 1E8YA 1H4RA 2MRPA 2DAJA 2KNBA 3KUZA 2ZNVB 3WA0A 1C3TA 4CYEA 1E7UA 1WXMA 4G50A 5TR5A 2GBMA 3L17A 3RYTA 4EOYA 1LXDA 2L0TA 4I6LB 1GNUA 2KMAA 3VFKA 3NHEB 1YQBA 4ICUA 3QQ8B 3R7QA 4ZYNA 3WAMA 1WE6A 3LDZE 2G4SA 4GSWA 3UINB 4LJPB 3ZNGC 2N4FA 4HXDA 4JIOU 2KZRA 4DK5A 2PE9A 3V60A 1F9JA 3D32A 4W9IA 5JHBA 1RAXA 2XBBC 1WGRA 4G11A 3AXCA 3WANA 1PQSA 3BY4B 4LDTD 4W9EA 2ASQA 3PPAA 1R4MI 3L16A 2M0XA 1JRUA 4NQKE 4FHKA 5J17A 3H9DA 1WJ4A 3CMMB 2YVCA 3ZO5B 1EO6A 3UGBB 2L0FA 2RD0A 3R3MA 4KZ0A 4RM8A 2EMSA 2ZPYA 4DHZE 5E6NA 1D3ZA 3SU8X 2KLGA 5G55A 2LZ6A 2D2QA 3RD2A 2KJRA 5D6JB 4IWQA 2D11A 2MCNB 3QWZB 2O2VA 4WWOA 3JYUA 5AEKB 3ZDTA 3DCGA 1S1QB 3IHPC 2IO3B 3QJZA 2AYOB 3RZWC 4IG7B 2OJRA 1WI0A 4EZJA 2ZCCA 2K8BA 3KYCD 1ZGUB 1SGHA 1ISNA 1WMHA 3RCZA 4DDID 1OQYA 2MBBB 2N1WA 1YX6B 2MLBA 2KK8A 2O6VB 2JZZA 3ENEA 3KYDD 4N9F4 3A9JA 5CHVC 5DPRA 2KTRA 1TZ1A 2BYFA 2CR5A 3UQBA 2JY6A 2ZVNA 2G45B 2NVUI 1LFDA 4NJ6A 4BVUC 1YIWA 3APDA 2JVCA 2ZZPB 3N3KB 3HM3A 3QCAA 3ZRCA 2KX3A 2KWUB 1OTRB 4KZCA 1Z5SB 3NS8A 1X1MA 1Q0WB 2GBRA 2XEWA 2LRUA 2MWSB 4G3XB 2L3ZA 4KIKA 4IM2A 1XD3B 4NNJB 1OEYJ 4PS7A 3X0WA 3UIPB 4WJOA 4RMAA 2ZPNA 3BINA 1WY8A 2KX0A 4MGYE 2NR2A 2FCQA 3N30A 3O65B 4M8MA 1UZXB 2WWZA 3CSFA 3TMPB 3PHWB 2DZJA 2JRIB 4MSMB 1WX7A 3ZNID 2MP2A 1EUVB 4A3OA 4TKNA 3AU4A 4AJWA 3PVLA 2JF5A 2Z59B 3K9PB 2RSUA 4BKGA 5E6PA 2KDIA 1UH6A 3VTVA 2IYDB 4MGIE 3DBRI 4OVUA 1WRDB 2O6VD 3KH0A 1J19A 4HPMB 1P9DU 4NQLB 1XQQA 1H8CA 2CHXA 4JL9A 4FJZA 4KDLB 1FXTB 4MM3A 4WWNA 3RUIB 2J7QB 1YJ1A 4DHJB 3JVZX 3ECIA 4K7WA 2KFKA 2L00B 3PLUA 1WXAA 2AWTA 3ML8A 3NZUA 1WE7A 1J8CA 1WIAA 2KQSA 4CHKA 4F1SA 2MX2A 3ALBA 5C1ZA 2HD5B 2C7NB 1TTNA 4DBGA 3AU5A 2JPHA 2DHZA 2D10A 3EFUA 2C5LC 2FNJB 3TBLD 4GGQA 2FIDA 3OJ4B 1AARA 3DQVA 1V2YA 3AI5A 3H7SA 4BBNC 3QARA 2LUEA 2R2QA 4M8NA 4TQ1A 1UGMA 2V4LA 2LGXA 3ZNZB 3DPDA 3UF8A 4BBNF 3EECA 1M94A 3A9JB 4K7UA 3H1UA 4MDKE 3V62A 5KHOA 4NAWB 2J0MA 4PS8A 2DYMA 4A3PA 2WX0A 4GU2A 4FBJB 3IFWB 2WDTB 4TV3A 3A1QB 2BWFA 5AZGA 3DBLI 4HVBA 1WM3A 1TBEA 3W1SA 4K81A 3M3JA 5HKHA 1UBIA 1GC6A 3VVWB 1L7YA 2Z0DB 5JZEB 1WGYA 2K25A 1CMXB 3QX1A 3WALA 2DX5B 2DZKA 2BGFA 1KOTA 1LM8B 4W9GA 2KWVB 1GG3A 3KUDB 3TIXA 2J0KA 2KJ6A 4GOCA 4G0NB 2LXAA 2L05A 5J18A 1P98A 3QK0A 2GOWA 2NBVB 2LVOA 4KIKB 3JSVB 5DPSA 4ZDVA 1P0RA 2IY1B 3V6CB 1RLFA 4NJ7A 3VDZA 3APFA 2LJ5A 2KD0A 4WAAA 2L7RA 5G2NA 3PT2B 1K8RB 4W9HA 4GXBA 2FCNA 2DYOA 4AUQC 1P3QU 2NS5A 3HIZA 5D94A 2MP2B 2LGDA 2WX1A 1GUAB 2BWES 1WM2A 1T0YA 4EKUA 2IO2B 2NBUA 2A4ZA 3DOWA 3PLVA 4F7ZA 4HK2A 2HJ8A 3TCAA 4E71A 4W9LA 2KLCA 4AOFA 1V80A 3WAOA 4E3CA 2K8HA 4DDGD 1V6EA 2KDBA 1Q1OA 2Z0EB 1C1YB 2FIFA 2BYEA 1U4AA 4BOZB 4GMVA 5JH5C 2LASA 4DXAB 2ZEQA 4JLCA 2B3AA 2KDEB 2DAFA 5CHFA 2DZIA 4MJSA 3ZTCA 1WMHB 3APCA 1NBFC 4E74A 3V61A 3PSEB 5LLIA 1KM7A 3ZKJC 4TQ0A 5FR6A 2LVQA 4EUTA 4GDLB 2UWQA 2JUOA 3EC8A 4DWFA 4FJYA 3VTUA 3W1SC 1S3SG 3U8ZA 2AEHA 3DVGX 3DVNV 4ZRKA 3CSTA 3OJ3A 3PRMB 2MW5A 3OLMD 2RGFA 4IWOA 1VD2A 3VXWA 1QZEA 2UYZB 4KVGB 2NPTB 2MBQA 4FA6A 1ZW7A 2JZ3B 2N1VA 3M62B 5IAAC 4DHZB 4EZKA 1Q5WB 1E90A 3C0RB 3A9KA 4I6PA 4MELA 2BKFA 3VH4B 1WGHA 4FN2A 4NPNA 4KV2A 2I1JA 2KDFB 2KFKB 3NZSA 3MJWA 4IM0A 3I3TB 1OEYA 4GB9A 3WAPA 4ASWC 3VUWA 2LWPA 4NAWA 1V86A 1E7VA 1WJNA 2NCNA 2K8CA 4YL8A 4IUMB 5D7GA 2V3SA 2REXA 3PRZA 1GC7A 3KW5B 4XC2A 2PE6B 2ZVOA 2GMIC 2HE7A 4BKSA 1E8ZA 3VQIA 4GDKB 3UIOB 2G4DB 3DDCB 5KHQA 4EFOA 4KSKC 3A33B 3UQAA 1WZ0A 2PJHA 4II3B 1NI2A 2N9XA 4MH0E 3ZLZA 3QHTA 2D07B 2G3QB 4EEWA 3ONSA 4HDQA 2KC1A 3PS6A 2ZCBA 1E8XA 2EMTA 2Y5BB 1WR6E 2AL6A 4K7SA 1ZKHA 4FLHA 1YD8U 2K1FA 2FCSA 3ZRFA 3JSVA 2CKHB 5IA7A 3U30A 1V49A 1YX5B 3PRPB 3B1LX 4RM9A 5J2RA 4K1RB 3QAQA 5C23A 4GN1A 3K9OB 5CX3A 2MBEA 2RPQA 3N32A 3R66C 2FUHB 4HLEA 1SE9A 2XK5B 3DVNU 4URKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHQ A;  1V81 A;  2VRR B;  3VAW A;  4CO7 A;  2LGY A;  1J0G A;  3MTN B;  2MBH A;  4WQO B;  4F8C B;  2M4N A;  4W9K A;  1WX8 A;  3DBH I;  4OVV A;  3RZF A;  3A4R A;  3M63 B;  4DHJ D;  5BO4 B;  3WIM A;  3T8M A;  1NDD A;  4ANW A;  3L10 B;  4MEM A;  2LD9 A;  3A1Q A;  3SD5 A;  4BKS D;  4JQW C;  2DEN B;  2EKE C;  2N9P C;  4X57 B;  1WR1 A;  2NPT A;  2JWZ A;  4LJO B;  3AUL A;  2LXC A;  2LVP A;  3ZUN A;  2GBN A;  2KN5 A;  4HCN B;  2IO0 B;  4HDO A;  5L95 C;  1RFA A;  3B08 A;  1A5R A;  4LDT B;  2A5U A;  1WZ3 A;  2CS4 A;  2QHO A;  4B9K A;  1I42 A;  3GZN I;  3IBE A;  2IZV B;  2K6D B;  2MBO A;  5LXI B;  2C9W B;  3QC8 B;  4MSQ B;  3H7P A;  4HCP B;  4B6W A;  3VTW A;  1IP9 A;  2IBI B;  1Y8R C;  3IG3 A;  2J0J A;  3TJP A;  3QIJ A;  1OGW A;  3JW0 X;  1WF9 A;  4GDK A;  4WJP A;  2CU1 A;  3ZDM C;  3L08 A;  2K6Q A;  4IW0 A;  5CHW A;  3VHT C;  1GJZ A;  2KFJ A;  2GBK A;  3KVF B;  2N9E B;  4XZ4 A;  3DVG Y;  2V1Y A;  4P7I A;  4MJS B;  2OOB B;  2FCM A;  3ZVV A;  3OAW A;  3L54 A;  4J6I A;  5AZH A;  2LRW A;  4ZRJ A;  4EZL A;  4AJY B;  3V6E B;  2MA9 B;  3HK0 A;  3TL5 A;  1UD7 A;  4ZRI A;  4GDL A;  3ZNH B;  1E5W A;  3L0W B;  2KJH B;  1Z2M A;  2N7E A;  1UBQ A;  1V9J A;  1TGZ B;  1EF5 A;  2GBJ A;  2DYB A;  2JT4 B;  4AP4 C;  3EHV A;  1E8W A;  4KDI C;  2M8S A;  3QA8 A;  2KC2 A;  3KUC B;  4BKT A;  3R7R A;  4W9D A;  4MGK E;  2K39 A;  1EF1 A;  4BFR A;  4KSL C;  2RR9 A;  3HM6 X;  2CHW A;  2IO1 B;  2MQJ A;  2L8J A;  1XT9 B;  4WJQ A;  2KOX A;  3PV1 A;  1WGG A;  2NBW B;  2KTR B;  1WGD A;  4I6N B;  2JRH A;  3A4S C;  3PHX B;  3NOB A;  2O2V B;  1VCB A;  5CTR C;  5DCN A;  1RRB A;  1IYF A;  5JHA A;  2DZM A;  3HHM A;  4WWP A;  2MSE D;  1BT0 A;  2BYV E;  2ZNV C;  5DPW A;  1HE8 A;  1WYW B;  1MG8 A;  2D3G A;  3A9K B;  2W9N A;  1KJT A;  2XK5 A;  2O6V A;  2KQ7 A;  3MHS D;  1WX9 A;  4HWI B;  4PYZ A;  4XX5 A;  3X23 A;  2C7H A;  5AZF A;  3Q3F A;  5L83 A;  2C60 A;  2R2O A;  3VUY A;  1L2N A;  2N7D A;  2IY0 B;  4BOS C;  3B0A A;  3RUL A;  3T9L A;  2KXJ A;  2KO3 A;  3ZW3 A;  2BF8 B;  1WJ6 A;  3M95 A;  2KVR A;  1WFY A;  4FAD A;  4NY0 A;  2ZJD A;  4HJK A;  3IVF A;  3CF6 E;  1V5T A;  4ANX A;  4FJV B;  2KHW B;  3P2B A;  2JXX A;  2KTF A;  3U7D A;  5D2M B;  2BPS A;  3ZIM A;  1V5O A;  2KWC A;  3PTF C;  2KAN A;  3NY5 A;  2PEA A;  3ML9 A;  1WJU A;  2I1K A;  2FAZ A;  4PYU A;  1G6J A;  1WXV A;  3ZTD A;  3LJ3 A;  4A20 A;  3PZD A;  1KLV A;  4IC7 B;  4LCD E;  4ICV A;  2HTH A;  3VUX A;  2KKC A;  1I35 A;  2M17 A;  2YLM A;  3H7P B;  3L13 A;  4B95 A;  4ANU A;  3PRE A;  4FUL A;  4FHJ A;  4II2 B;  4TUU A;  5GMV A;  4M0W B;  5DPT A;  5EDS A;  3PGE A;  4W9C A;  5LXH A;  4AWJ A;  2BKR B;  1LQB A;  3W1Y A;  3SDL C;  3H6N A;  4MGZ E;  4IM3 A;  2KMC A;  1R4N I;  2M1M A;  1IPG A;  2C7M B;  4W9F A;  4WJN A;  1SIF A;  2AL3 A;  1UEL A;  3GOE A;  1P1A A;  2LI5 A;  3VH3 B;  4HPL B;  3S2A A;  2PPH A;  4PS3 A;  5E6O A;  1WXS A;  3Q3J A;  4JGH B;  3DBS A;  4ANV A;  4IWP A;  2L76 A;  2CHZ A;  4GIV A;  2WYQ A;  4W9J A;  1WH3 A;  3RT3 B;  1E8Y A;  1H4R A;  2MRP A;  2DAJ A;  2KNB A;  3KUZ A;  2ZNV B;  3WA0 A;  1C3T A;  4CYE A;  1E7U A;  1WXM A;  4G50 A;  5TR5 A;  2GBM A;  3L17 A;  3RYT A;  4EOY A;  1LXD A;  2L0T A;  4I6L B;  1GNU A;  2KMA A;  3VFK A;  3NHE B;  1YQB A;  4ICU A;  3QQ8 B;  3R7Q A;  4ZYN A;  3WAM A;  1WE6 A;  3LDZ E;  2G4S A;  4GSW A;  3UIN B;  4LJP B;  3ZNG C;  2N4F A;  4HXD A;  4JIO U;  2KZR A;  4DK5 A;  2PE9 A;  3V60 A;  1F9J A;  3D32 A;  4W9I A;  5JHB A;  1RAX A;  2XBB C;  1WGR A;  4G11 A;  3AXC A;  3WAN A;  1PQS A;  3BY4 B;  4LDT D;  4W9E A;  2ASQ A;  3PPA A;  1R4M I;  3L16 A;  2M0X A;  1JRU A;  4NQK E;  4FHK A;  5J17 A;  3H9D A;  1WJ4 A;  3CMM B;  2YVC A;  3ZO5 B;  1EO6 A;  3UGB B;  2L0F A;  2RD0 A;  3R3M A;  4KZ0 A;  4RM8 A;  2EMS A;  2ZPY A;  4DHZ E;  5E6N A;  1D3Z A;  3SU8 X;  2KLG A;  5G55 A;  2LZ6 A;  2D2Q A;  3RD2 A;  2KJR A;  5D6J B;  4IWQ A;  2D11 A;  2MCN B;  3QWZ B;  2O2V A;  4WWO A;  3JYU A;  5AEK B;  3ZDT A;  3DCG A;  1S1Q B;  3IHP C;  2IO3 B;  3QJZ A;  2AYO B;  3RZW C;  4IG7 B;  2OJR A;  1WI0 A;  4EZJ A;  2ZCC A;  2K8B A;  3KYC D;  1ZGU B;  1SGH A;  1ISN A;  1WMH A;  3RCZ A;  4DDI D;  1OQY A;  2MBB B;  2N1W A;  1YX6 B;  2MLB A;  2KK8 A;  2O6V B;  2JZZ A;  3ENE A;  3KYD D;  4N9F 4;  3A9J A;  5CHV C;  5DPR A;  2KTR A;  1TZ1 A;  2BYF A;  2CR5 A;  3UQB A;  2JY6 A;  2ZVN A;  2G45 B;  2NVU I;  1LFD A;  4NJ6 A;  4BVU C;  1YIW A;  3APD A;  2JVC A;  2ZZP B;  3N3K B;  3HM3 A;  3QCA A;  3ZRC A;  2KX3 A;  2KWU B;  1OTR B;  4KZC A;  1Z5S B;  3NS8 A;  1X1M A;  1Q0W B;  2GBR A;  2XEW A;  2LRU A;  2MWS B;  4G3X B;  2L3Z A;  4KIK A;  4IM2 A;  1XD3 B;  4NNJ B;  1OEY J;  4PS7 A;  3X0W A;  3UIP B;  4WJO A;  4RMA A;  2ZPN A;  3BIN A;  1WY8 A;  2KX0 A;  4MGY E;  2NR2 A;  2FCQ A;  3N30 A;  3O65 B;  4M8M A;  1UZX B;  2WWZ A;  3CSF A;  3TMP B;  3PHW B;  2DZJ A;  2JRI B;  4MSM B;  1WX7 A;  3ZNI D;  2MP2 A;  1EUV B;  4A3O A;  4TKN A;  3AU4 A;  4AJW A;  3PVL A;  2JF5 A;  2Z59 B;  3K9P B;  2RSU A;  4BKG A;  5E6P A;  2KDI A;  1UH6 A;  3VTV A;  2IYD B;  4MGI E;  3DBR I;  4OVU A;  1WRD B;  2O6V D;  3KH0 A;  1J19 A;  4HPM B;  1P9D U;  4NQL B;  1XQQ A;  1H8C A;  2CHX A;  4JL9 A;  4FJZ A;  4KDL B;  1FXT B;  4MM3 A;  4WWN A;  3RUI B;  2J7Q B;  1YJ1 A;  4DHJ B;  3JVZ X;  3ECI A;  4K7W A;  2KFK A;  2L00 B;  3PLU A;  1WXA A;  2AWT A;  3ML8 A;  3NZU A;  1WE7 A;  1J8C A;  1WIA A;  2KQS A;  4CHK A;  4F1S A;  2MX2 A;  3ALB A;  5C1Z A;  2HD5 B;  2C7N B;  1TTN A;  4DBG A;  3AU5 A;  2JPH A;  2DHZ A;  2D10 A;  3EFU A;  2C5L C;  2FNJ B;  3TBL D;  4GGQ A;  2FID A;  3OJ4 B;  1AAR A;  3DQV A;  1V2Y A;  3AI5 A;  3H7S A;  4BBN C;  3QAR A;  2LUE A;  2R2Q A;  4M8N A;  4TQ1 A;  1UGM A;  2V4L A;  2LGX A;  3ZNZ B;  3DPD A;  3UF8 A;  4BBN F;  3EEC A;  1M94 A;  3A9J B;  4K7U A;  3H1U A;  4MDK E;  3V62 A;  5KHO A;  4NAW B;  2J0M A;  4PS8 A;  2DYM A;  4A3P A;  2WX0 A;  4GU2 A;  4FBJ B;  3IFW B;  2WDT B;  4TV3 A;  3A1Q B;  2BWF A;  5AZG A;  3DBL I;  4HVB A;  1WM3 A;  1TBE A;  3W1S A;  4K81 A;  3M3J A;  5HKH A;  1UBI A;  1GC6 A;  3VVW B;  1L7Y A;  2Z0D B;  5JZE B;  1WGY A;  2K25 A;  1CMX B;  3QX1 A;  3WAL A;  2DX5 B;  2DZK A;  2BGF A;  1KOT A;  1LM8 B;  4W9G A;  2KWV B;  1GG3 A;  3KUD B;  3TIX A;  2J0K A;  2KJ6 A;  4GOC A;  4G0N B;  2LXA A;  2L05 A;  5J18 A;  1P98 A;  3QK0 A;  2GOW A;  2NBV B;  2LVO A;  4KIK B;  3JSV B;  5DPS A;  4ZDV A;  1P0R A;  2IY1 B;  3V6C B;  1RLF A;  4NJ7 A;  3VDZ A;  3APF A;  2LJ5 A;  2KD0 A;  4WAA A;  2L7R A;  5G2N A;  3PT2 B;  1K8R B;  4W9H A;  4GXB A;  2FCN A;  2DYO A;  4AUQ C;  1P3Q U;  2NS5 A;  3HIZ A;  5D94 A;  2MP2 B;  2LGD A;  2WX1 A;  1GUA B;  2BWE S;  1WM2 A;  1T0Y A;  4EKU A;  2IO2 B;  2NBU A;  2A4Z A;  3DOW A;  3PLV A;  4F7Z A;  4HK2 A;  2HJ8 A;  3TCA A;  4E71 A;  4W9L A;  2KLC A;  4AOF A;  1V80 A;  3WAO A;  4E3C A;  2K8H A;  4DDG D;  1V6E A;  2KDB A;  1Q1O A;  2Z0E B;  1C1Y B;  2FIF A;  2BYE A;  1U4A A;  4BOZ B;  4GMV A;  5JH5 C;  2LAS A;  4DXA B;  2ZEQ A;  4JLC A;  2B3A A;  2KDE B;  2DAF A;  5CHF A;  2DZI A;  4MJS A;  3ZTC A;  1WMH B;  3APC A;  1NBF C;  4E74 A;  3V61 A;  3PSE B;  5LLI A;  1KM7 A;  3ZKJ C;  4TQ0 A;  5FR6 A;  2LVQ A;  4EUT A;  4GDL B;  2UWQ A;  2JUO A;  3EC8 A;  4DWF A;  4FJY A;  3VTU A;  3W1S C;  1S3S G;  3U8Z A;  2AEH A;  3DVG X;  3DVN V;  4ZRK A;  3CST A;  3OJ3 A;  3PRM B;  2MW5 A;  3OLM D;  2RGF A;  4IWO A;  1VD2 A;  3VXW A;  1QZE A;  2UYZ B;  4KVG B;  2NPT B;  2MBQ A;  4FA6 A;  1ZW7 A;  2JZ3 B;  2N1V A;  3M62 B;  5IAA C;  4DHZ B;  4EZK A;  1Q5W B;  1E90 A;  3C0R B;  3A9K A;  4I6P A;  4MEL A;  2BKF A;  3VH4 B;  1WGH A;  4FN2 A;  4NPN A;  4KV2 A;  2I1J A;  2KDF B;  2KFK B;  3NZS A;  3MJW A;  4IM0 A;  3I3T B;  1OEY A;  4GB9 A;  3WAP A;  4ASW C;  3VUW A;  2LWP A;  4NAW A;  1V86 A;  1E7V A;  1WJN A;  2NCN A;  2K8C A;  4YL8 A;  4IUM B;  5D7G A;  2V3S A;  2REX A;  3PRZ A;  1GC7 A;  3KW5 B;  4XC2 A;  2PE6 B;  2ZVO A;  2GMI C;  2HE7 A;  4BKS A;  1E8Z A;  3VQI A;  4GDK B;  3UIO B;  2G4D B;  3DDC B;  5KHQ A;  4EFO A;  4KSK C;  3A33 B;  3UQA A;  1WZ0 A;  2PJH A;  4II3 B;  1NI2 A;  2N9X A;  4MH0 E;  3ZLZ A;  3QHT A;  2D07 B;  2G3Q B;  4EEW A;  3ONS A;  4HDQ A;  2KC1 A;  3PS6 A;  2ZCB A;  1E8X A;  2EMT A;  2Y5B B;  1WR6 E;  2AL6 A;  4K7S A;  1ZKH A;  4FLH A;  1YD8 U;  2K1F A;  2FCS A;  3ZRF A;  3JSV A;  2CKH B;  5IA7 A;  3U30 A;  1V49 A;  1YX5 B;  3PRP B;  3B1L X;  4RM9 A;  5J2R A;  4K1R B;  3QAQ A;  5C23 A;  4GN1 A;  3K9O B;  5CX3 A;  2MBE A;  2RPQ A;  3N32 A;  3R66 C;  2FUH B;  4HLE A;  1SE9 A;  2XK5 B;  3DVN U;  4URK A; 
#chains in the Genus database with same CATH topology
 1OFF A;  2M4N A;  3BVM A;  4W9K A;  1WX8 A;  5BYR A;  3T8M A;  4ANW A;  2WXO A;  4MEM A;  3SD5 A;  4M01 A;  1FNU A;  5AUI A;  1TZO A;  1KTK A;  2XNA C;  4HCN B;  4M02 A;  2WXL A;  1DGJ A;  3AEC B;  1A5R A;  4LDT B;  3IXS A;  1I42 A;  3GZN I;  3IBE A;  2C9W B;  1B9R A;  4A8X C;  5C3J B;  2IBI B;  1Y8R C;  4J3O D;  3IG3 A;  3AH7 A;  1MG4 A;  3Q6B A;  1KLU D;  2CU1 A;  2JZP A;  1GJZ A;  4NZL B;  3KVF B;  1VZ7 A;  4MJS B;  2MJE A;  2OOB B;  3OAW A;  4DXG A;  2MEK A;  2MA9 B;  4ZRI A;  1WWT A;  4RF0 A;  3ZGZ A;  1E5W A;  3MC8 A;  3L4P A;  4C56 C;  2DYB A;  4LLG M;  3R8B A;  4KDI C;  1ZDX A;  4W9D A;  4MGK E;  2K39 A;  4KKI A;  2CHW A;  4K3B A;  4WJQ A;  1WGG A;  2NBW B;  1WGD A;  2JRH A;  3PHX B;  3NOB A;  1VCB A;  5CTR C;  4R3D A;  3TEZ A;  5JHA A;  2DZM A;  3HHM A;  2BYV E;  1B1Z A;  1EU4 A;  1MG8 A;  2WDV B;  3A9K B;  1F52 A;  2W9N A;  3NRZ A;  1TKE A;  4PYZ A;  3Q3F A;  2R2O A;  1VR9 A;  3ZJV A;  1MJD A;  2IY0 B;  2ZW1 A;  4JPS A;  1UWX A;  3RUL A;  2KXJ A;  1J7A A;  4NY0 A;  3IVF A;  1V5T A;  1YN5 A;  2EEL A;  3RNA C;  3FIL B;  4XDD A;  1V5O A;  3PTF C;  1Y56 A;  3IT4 B;  3NY5 A;  2INC C;  2I1K A;  5G5H A;  2BB6 A;  4ICV A;  4L1B A;  3HVZ A;  4AQ7 A;  1ET9 A;  4II2 B;  4W9C A;  4AWJ A;  1K50 A;  4LNN A;  3AE1 B;  2M1M A;  5FR3 A;  2LI5 A;  4MH8 A;  4JGH B;  2CHZ A;  3ETR A;  1WH3 A;  2MRP A;  4UDU C;  1L6V A;  1C3T A;  5TR5 A;  3ZXV A;  1GNU A;  3U2S C;  3VFK A;  1LO5 D;  4ZYN A;  3WAM A;  1SIJ A;  1E6E B;  4BAX A;  2DWQ A;  4LJP B;  3Q14 C;  1XLP A;  1RAX A;  4MAC A;  3BY4 B;  1QOB A;  2H89 B;  4NQK E;  5J17 A;  4WAF A;  5IOI A;  3TUO A;  3V3X A;  3ZO5 B;  1EO6 A;  3LYY A;  2L0F A;  3R3M A;  1ZOY B;  4RM8 A;  2KT7 A;  3NVW A;  2D2Q A;  3RD2 A;  1L0V B;  1V97 A;  2D11 A;  3JYU A;  4L23 A;  3QJZ A;  3Q8B A;  2AYO B;  2V4I B;  3RZW C;  3KYC D;  1ZGU B;  1WMH A;  1NI3 A;  4DDI D;  1YX6 B;  2N1W A;  1NEK B;  4N9F 4;  4N58 A;  1HZ6 A;  4A55 A;  5I4D A;  2JY6 A;  2ZVN A;  4P1C C;  1VRA B;  2G45 B;  4NJ6 A;  1FXA A;  1YIW A;  2ZZP B;  1T3Q A;  3ZRC A;  1JML A;  1L0X B;  3GZN B;  4KZC A;  1Z5S B;  3NS8 A;  2M0A A;  4S0R A;  1Q0W B;  1OEY J;  3UIP B;  3BIN A;  4MGY E;  3ZJT A;  2FCQ A;  3N30 A;  2WWZ A;  3AEE B;  3PHW B;  2JRI B;  3ZNI D;  3MC0 B;  4RNA A;  1FNV A;  4AJW A;  2RSU A;  4BKG A;  1TIF A;  5E6P A;  4OVZ A;  1UH6 A;  2BYT A;  3DBR I;  2O6V D;  4HPM B;  1P9D U;  2SAK A;  3RUI B;  1FIQ A;  3Q8C A;  2J7Q B;  4K7W A;  3PLU A;  1WE7 A;  4CHK A;  3ALB A;  2HD5 B;  2EKI A;  1JW9 D;  1TTN A;  1WRI A;  2C5L C;  3TBL D;  4GGQ A;  2FID A;  3AI5 A;  4M8N A;  2KAC A;  4ZYS A;  3DPD A;  3GS2 A;  1M94 A;  4IKG A;  2GI9 A;  5BMG A;  4MDK E;  4FBJ B;  4GU2 A;  2DLB A;  3VVW B;  2Z0D B;  1WSP A;  1T0Q C;  4Q2J A;  1I4Q A;  2K25 A;  3QX1 A;  3WAL A;  2PW9 A;  2PIA A;  5BYQ A;  4W9G A;  2KJ6 A;  3PZ8 A;  4GOC A;  2LXA A;  2K0P A;  2BS2 B;  2AQ2 B;  1RM6 C;  1P98 A;  3ABV B;  2GOW A;  2NBV B;  4NJC A;  4KIK B;  3JSV B;  1P0R A;  1QLB B;  4NJ7 A;  3AE5 B;  4B0M A;  4JWU C;  5G2N A;  3Q2A C;  2NS5 A;  1ZXH A;  2ZW0 A;  3ZYY X;  5D94 A;  4N6E B;  2MP2 B;  3NVZ A;  1GUA B;  2GB1 A;  4EKU A;  2IO2 B;  3EFC A;  4F7Z A;  3SR6 A;  4HK2 A;  3AB5 A;  4E71 A;  2KLC A;  1V80 A;  4DDG D;  1FEH A;  2Z0E B;  4MM3 B;  4H2A A;  5JH5 C;  4DXA B;  2B3A A;  2L83 A;  3MP9 A;  4WIP A;  5FR6 A;  1MVK A;  2LVQ A;  4GDL B;  3EC8 A;  4DWF A;  1IBX A;  3W1S C;  1S3S G;  3U8Z A;  2AEH A;  3C19 A;  5G5G A;  2MW5 A;  3VXW A;  4C00 A;  2MBQ A;  4RGO S;  2N1V A;  3M62 B;  3AE6 B;  2IJ0 A;  1E90 A;  2BKF A;  4ZRP A;  1WGH A;  2FBW B;  4FN2 A;  2WQY B;  2IPK D;  3NZS A;  1OEY A;  4ASW C;  4NAW A;  1V86 A;  2K8C A;  5D7G A;  1F0Z A;  1BUI C;  2V3S A;  2PE6 B;  3AE8 B;  4P6V F;  2GMI C;  3VQI A;  4ARC A;  2X38 A;  5KHQ A;  3A33 B;  4II3 B;  2PJH A;  1NI2 A;  2WXH A;  2G3Q B;  3ONS A;  3TEY A;  2KC1 A;  3PS6 A;  3RI7 C;  1JWA D;  2Y5B B;  5BMH A;  1WR6 E;  1QOG A;  1R4N B;  5IA7 A;  1NYQ A;  4LNF A;  4KX6 B;  3DBH B;  4RM9 A;  4M0W A;  4K1R B;  3E56 A;  4USA A;  4REZ A;  2MJ3 A;  3N32 A;  2FUH B;  3DVN U;  2VRR B;  1J0G A;  2JXT A;  2RDH A;  1NDD A;  2DBY A;  3L10 B;  4OHJ A;  2QEJ C;  2DEN B;  4X57 B;  1WR1 A;  3W2D A;  4YTP B;  3ZUN A;  2IO0 B;  5L95 C;  2A5U A;  2QHO A;  2K6D B;  2MBO A;  2JWU A;  2E3T A;  4B6W A;  3R2I A;  1HXY D;  1RFK A;  2J0J A;  3QIJ A;  1OGW A;  3JW0 X;  2KYW A;  2K5P A;  3ZDM C;  4IW0 A;  3I63 C;  5CHW A;  2K22 A;  1F2R C;  3ZVV A;  3L54 A;  3HK0 A;  3RN9 C;  3L0W B;  3MFG A;  1I4X A;  2L32 A;  1V9J A;  1TGZ B;  1EF5 A;  2JT4 B;  5HG2 A;  4AP4 C;  2M8S A;  3QA8 A;  4BKT A;  2QSD A;  1DYQ A;  1EF1 A;  4KSL C;  2IO1 B;  1GPX A;  1XT9 B;  1CJE A;  4IOI E;  3A4S C;  2M56 B;  2O2V B;  4C4V B;  4WWP A;  2MSE D;  1HE8 A;  2PVG C;  2O6V A;  2KQ7 A;  5IKC M;  2JX5 A;  3KWV A;  4D2K A;  2C7H A;  3ZJU A;  2C60 A;  2FUG 1;  3VUY A;  1L2N A;  1FMA D;  2N7D A;  4XWT A;  1KLG D;  1WJ6 A;  4RF1 A;  2KVR A;  4HJK A;  1JCK B;  3EUB 2;  4ANX A;  2BPS A;  3H8H A;  2KWC A;  1QKZ A;  3ML9 A;  1QIL A;  1G6J A;  3ZTD A;  3RNC C;  1JAL A;  4LCD E;  3VUX A;  1YJJ A;  3L13 A;  4B95 A;  3PRE A;  1JWU D;  1WXQ A;  5EDS A;  5LXH A;  1F2R I;  1IGC A;  2BKR B;  3H6N A;  4MGZ E;  4IM3 A;  4W9F A;  2L1A A;  1SIF A;  3GOE A;  2WNM A;  2QMT A;  2AQ1 B;  2PPH A;  1WXS A;  3Q3J A;  4ANV A;  2L76 A;  4W9J A;  2WYQ A;  3T3N A;  2DAJ A;  3WA0 A;  1NVI D;  3NZ3 A;  3RYT A;  1LXD A;  4I6L B;  5GXG B;  2LHE A;  2LGS A;  1SE2 A;  3LDZ E;  3UIN B;  4PK1 A;  2N4F A;  2LJI A;  1KFY B;  4DK5 A;  3KQ4 A;  3D32 A;  5JHB A;  1VZ8 A;  1WGR A;  2WS3 B;  4QAY A;  3AXC A;  3WAN A;  1PGB A;  2AX5 A;  4KKJ A;  2ASQ A;  1R4M I;  3L16 A;  3TSS A;  2VH2 A;  1JRU A;  2N9K A;  3Q8A A;  4FHK A;  1WJ4 A;  2YVC A;  5E6N A;  2KLG A;  5G55 A;  3AM9 A;  4DQO C;  4LNI A;  5D6J B;  1NYR A;  4IWQ A;  3BK2 A;  4OZB A;  4WWO A;  4C7Y A;  3SFD B;  2IO3 B;  1UGJ A;  2QC8 A;  4EZJ A;  2ZCC A;  3KYD D;  3ENE A;  1DOY A;  2JZZ A;  3NVV A;  5DPR A;  1MHH E;  2KTR A;  2WGS A;  2NVU I;  1LFD A;  1YN4 A;  4A9A A;  3N3K B;  2KWU B;  1OTR B;  3AE2 B;  1X1M A;  1TKY A;  4KIK A;  4G3X B;  4YXD B;  2LRU A;  2MWS B;  3HVD A;  2L3Z A;  4IM2 A;  1XD3 B;  2N7J A;  4PS7 A;  1XLN A;  3O65 B;  3CSF A;  3TMP B;  4MSM B;  2QDF A;  4RFB A;  2MP2 A;  4A6Q A;  2Z59 B;  3E9S A;  4JX1 C;  1L0Y B;  4MGI E;  4HJG E;  4NQL B;  3RPF C;  1UWM A;  2CHX A;  4JL9 A;  5IN7 A;  4MM3 A;  1FXT B;  1QOF A;  1YJ1 A;  4DHJ B;  3JVZ X;  1ET6 A;  3ECI A;  2KFK A;  2FE8 A;  1D5X C;  2AWT A;  3NZU A;  1OQR A;  2KQS A;  1UUP A;  5C1Z A;  3CIR B;  1N5W A;  2MH7 A;  5D3I B;  3AU5 A;  2JPH A;  2DHZ A;  2D10 A;  1XCT L;  1TY2 A;  4HKQ A;  3DQV A;  2LUE A;  1L5P A;  2IND C;  2PTL A;  4TQ1 A;  2V4L A;  2LGX A;  3ZNZ B;  2PLP A;  3UF8 A;  4BBN F;  4P1B C;  1TS4 A;  1VDV A;  3BZD B;  4YSZ B;  3H1U A;  3V62 A;  1YJI A;  4NAW B;  2J0M A;  2DYM A;  2WX0 A;  2N0S B;  1RYJ A;  4TV3 A;  2BWF A;  4K81 A;  5HKH A;  1N60 A;  5FK9 C;  3P42 A;  2ONQ A;  5HFY A;  2K9X A;  1WGY A;  1CMX B;  2DX5 B;  1LM8 B;  3P4Q B;  2W55 A;  3KUD B;  3TIX A;  2J0K A;  4G0N B;  1HQR D;  3Q8F A;  4HKZ E;  5DPS A;  2Y5P A;  2GLS A;  3V6C B;  1RLF A;  2V0G A;  1XO3 A;  3APF A;  2LJ5 A;  4WAA A;  3PT2 B;  1K8R B;  2JQR B;  4GXB A;  2FCN A;  1V8C A;  5EE1 A;  1TS3 A;  2LGD A;  1WM2 A;  2HJ1 A;  2NBU A;  2KAJ A;  3AE9 B;  2HDE A;  3TCA A;  4AS1 A;  3PZ7 A;  4AOF A;  1XF5 L;  2FIF A;  1XLQ A;  2BYE A;  1A70 A;  2ZEQ A;  1C9F A;  1Q10 A;  4MJS A;  3AED B;  4E74 A;  1JRP A;  2TSS A;  4P16 A;  3ZKJ C;  4TQ0 A;  3N9Y C;  2NTT A;  3VTU A;  1CZP A;  4YTN B;  3T3O A;  3PRM B;  4IWO A;  3URY A;  5MPO A;  4DHZ B;  2JZ3 B;  3C0R B;  3A9K A;  4I6P A;  3RNF C;  4ZHO A;  4IM0 A;  3I3T B;  1E7V A;  1VLB A;  3IT6 B;  2NCN A;  1SE4 A;  3PRZ A;  2ZVO A;  2HE7 A;  1E8Z A;  2NTS A;  3UIO B;  2G4D B;  2W82 A;  1RWS A;  4KSK C;  3UQA A;  1MFW A;  3GB1 A;  1FXI A;  2D07 B;  4EEW A;  5H8Y E;  1D5Z C;  2ZCB A;  1SBB B;  3AEG B;  4C7Z A;  4K7S A;  1C4C A;  2FCS A;  1QT9 A;  1V49 A;  4C4V A;  3PRP B;  1E9M A;  2GRI A;  5J2R A;  5C23 A;  4GN1 A;  1AWD A;  3K9O B;  2RPQ A;  3R66 C;  1UF0 A;  1KF6 B;  3AEB B;  1EU3 A;  1FRR A;  2MBH A;  4WQO B;  4F8C B;  2OJW A;  3I9V 1;  1K51 A;  3MC9 A;  3Q8E A;  3DBH I;  4OVV A;  3RZF A;  3A4R A;  3WIM A;  2ON8 A;  3KWL A;  3Q3M C;  3A1Q A;  4BKS D;  4JWS C;  1JRO A;  3DWM A;  1VZ6 A;  2EKE C;  2JWZ A;  3AUL A;  2D5G A;  2W3R A;  2LVP A;  4K3C A;  3RNB C;  4LK0 M;  2GBN A;  3FKY A;  1RFA A;  1XCQ L;  2V3N A;  3HUI A;  1FCC C;  1WZ3 A;  2CS4 A;  2KDM A;  4B9K A;  1SE3 A;  4FXC A;  5LXI B;  3QC8 B;  4HCP B;  1IP9 A;  1E7P B;  3TJP A;  3L08 A;  2K6Q A;  3N20 C;  2GBK A;  1F1H A;  4XZ4 A;  3DVG Y;  3P1M A;  2FCM A;  1GOZ A;  4J6I A;  2LRW A;  4AJY B;  3V6E B;  4ZOH C;  1UD7 A;  1PYW D;  1L4D B;  2BQQ A;  2MHJ A;  2N7E A;  3U52 E;  1PDX A;  2J4X A;  3BK1 A;  3EHV A;  1E8W A;  2KC2 A;  2WDR B;  2K3U A;  3KUC B;  3R7R A;  4BFR A;  1GAQ B;  1LGR A;  4KGR A;  2MQJ A;  3FAH A;  2J42 A;  2WXF A;  4HRS A;  1PFD A;  1D6E C;  1TT5 B;  1RRB A;  1IYF A;  2BW2 A;  5EE3 A;  5DPW A;  2OHF A;  1ZE3 D;  1KJT A;  2XK5 A;  2JSV X;  3MHS D;  2I38 A;  1J7C A;  5AZF A;  5L83 A;  3T9L A;  1XEE A;  3M95 A;  1PGX A;  1WFY A;  2ZJD A;  3CF6 E;  4HPP A;  4US9 A;  1C79 A;  2KTF A;  3FC4 A;  4US8 A;  3ZIM A;  3BII D;  2KAN A;  2PEA A;  1WJU A;  3CWI A;  2FAZ A;  2V3P A;  4PYU A;  4ZRQ A;  4A20 A;  3PZD A;  4IC7 B;  2WXI A;  2HTH A;  1FFU A;  3C8Y A;  3H7P B;  1CK1 A;  4FUL A;  5GMV A;  4FHJ A;  2OED A;  4TUU A;  5LNK 1;  5DPT A;  1J7B A;  2WXP A;  1HEZ E;  3W1Y A;  3SDL C;  2KMC A;  1IPG A;  1FPY A;  1UEL A;  3P4R B;  2WXJ A;  3S2A A;  4PS3 A;  3VRB B;  5E6O A;  1PGA A;  4IWP A;  4YSY B;  1E8Y A;  1EWC A;  1H4R A;  3NJT A;  1V1O A;  1N5X A;  3KUZ A;  2D3B A;  1E7U A;  4G50 A;  4EOY A;  2L0T A;  2KMA A;  2KVZ A;  3NHE B;  3QQ8 B;  3R7Q A;  4A90 A;  1WE6 A;  2G4S A;  1MI0 A;  3ZNG C;  4HXD A;  2KZR A;  3AEA B;  1F9J A;  4W9I A;  2J53 A;  4WWM A;  4YTM B;  2XBB C;  5E6J A;  4G11 A;  1N61 A;  1PQS A;  2UU7 A;  4W9E A;  4OW0 A;  3PPA A;  3H9D A;  3AE4 B;  3N1X C;  2QCZ A;  4KZ0 A;  2ZPY A;  4DHZ E;  2B76 B;  1E10 A;  5FKA C;  1IUE A;  5AEK B;  3VR8 B;  3DCG A;  3ZDT A;  3IHP C;  1HZ5 A;  3RNE C;  1WI0 A;  2K8B A;  1FO4 A;  1ISN A;  3RCZ A;  1OQY A;  4EE2 A;  2KK8 A;  2MLB A;  1C4A A;  3A9J A;  1TZ1 A;  3IAM 1;  2CR5 A;  3UQB A;  1BXT A;  1P7E A;  1WGK A;  1YNT E;  2RDB C;  2XEW A;  3X0W A;  4WJO A;  4XGA B;  2KX0 A;  2DZJ A;  1WX7 A;  1IBX B;  1EUV B;  4A3O A;  3AU4 A;  3B9J A;  2JF5 A;  3K9P B;  3VTV A;  2IYD B;  4S17 A;  1J19 A;  1ZDV A;  3MJ5 A;  3IAS 1;  1XQQ A;  1H8C A;  4FJZ A;  4KDL B;  3MHZ A;  3BWU D;  3FIL A;  1WXA A;  3Q69 A;  3RFZ B;  1J8C A;  1WIA A;  4F1S A;  2W54 A;  1T0R C;  1SJH D;  2YEP B;  2R61 A;  4DBG A;  1SEB D;  4MT5 A;  4LNO A;  1K53 A;  2VH1 A;  3EFU A;  1AAR A;  4BBN C;  3QAR A;  1UGM A;  3EEC A;  1R7S A;  3LXF A;  3A9J B;  1SB3 C;  3DWG C;  4PS8 A;  3IFW B;  2WDT B;  3DBL I;  4HVB A;  2JYT A;  1TBE A;  3W1S A;  3M3J A;  1GC6 A;  2SEB D;  3GE8 C;  4N59 A;  2BGF A;  1FFV A;  1GG3 A;  1M4V A;  3AE3 B;  2LFI A;  2L05 A;  1SXT A;  3QK0 A;  2LVO A;  4ZDV A;  4LTU A;  2IY1 B;  2L7R A;  4LNK A;  4W9H A;  2DYO A;  1P3Q U;  3I57 A;  3HIZ A;  1DOX A;  4XYC A;  1AYF A;  1T0Y A;  2IGG A;  4W9L A;  2PKO A;  2K8H A;  3BYT B;  1C1Y B;  4BOZ B;  4GMV A;  1SSN A;  2LAS A;  3PO0 A;  4JLC A;  2KDE B;  5CHF A;  3ZTC A;  3UI3 A;  1WMH B;  1NBF C;  1YOV B;  3V61 A;  5LLI A;  4EUT A;  2UWQ A;  2JUO A;  4ZRK A;  3OJ3 A;  3OLM D;  2D3C A;  1YN3 A;  1VD2 A;  2BS4 B;  1QZE A;  2WXN A;  2VZK D;  2NPT B;  1ACC A;  3U7Z A;  4FA6 A;  5IAA C;  1I4P A;  2G9H D;  1FNW A;  1DOI A;  3BVG A;  2I1J A;  2KDF B;  3MJW A;  2V9H A;  4GB9 A;  3WAP A;  3VUW A;  1WJN A;  2D3A A;  3N1Z C;  4YL8 A;  1L6U A;  2H88 B;  2REX A;  1GC7 A;  3KW5 B;  4XC2 A;  4ARI A;  2WU5 B;  1STE A;  4BKS A;  4GDK B;  4HRO A;  4KGT A;  4EFO A;  1WZ0 A;  1UNS A;  2WXR A;  2N9X A;  4MH0 E;  3ZLZ A;  2BBC A;  4CQN A;  1HTQ A;  2EMT A;  2Y3A A;  4GLS C;  2AL6 A;  4FLH A;  2G1E A;  2K1F A;  1YX5 B;  3EGR A;  3QAQ A;  2MBE A;  1SE9 A;  2XK5 B;  4URK A;  3SHQ A;  1N63 A;  1V81 A;  3VAW A;  4CO7 A;  2LGY A;  3MTN B;  3Q3N C;  4DHJ D;  3M63 B;  5BO4 B;  2LD9 A;  3BVZ A;  4JQW C;  2N9P C;  4WQM A;  2NPT A;  3U4E G;  4LJO B;  5H92 C;  2WP9 B;  2LXC A;  4YT0 B;  3AEF B;  2KN5 A;  4IDI A;  2Y5C A;  4HDO A;  1D5M C;  2W3S A;  3B08 A;  2ACZ B;  1FCL A;  1KRH A;  2IZV B;  2IDY A;  4MSQ B;  2RPV A;  3H7P A;  3VTW A;  1BML C;  4NAM A;  3GE3 C;  1WF9 A;  4GDK A;  4WJP A;  3VHT C;  2KFJ A;  2N9E B;  2V1Y A;  4P7I A;  3AV8 A;  1JQ4 A;  5AZH A;  4ZRJ A;  4EZL A;  3TL5 A;  2MJD A;  4GDL A;  3ZNH B;  2JYE A;  2KJH B;  4PT5 A;  3ZXR A;  1Z2M A;  1C4P A;  1ZP0 B;  2I2Y A;  1UBQ A;  2BVC A;  2ICI A;  2GBJ A;  4M00 A;  5D3D A;  2IGD A;  4RGM A;  2HTM E;  2RMM A;  2RR9 A;  3HM6 X;  2L8J A;  3P4S B;  2KOX A;  3PV1 A;  2WXM A;  2KTR B;  2QIL A;  4I6N B;  4RCO A;  4KGS A;  1FM0 D;  5DCN A;  5JXV A;  2ZNV C;  1BT0 A;  2WXK A;  1WYW B;  1TS5 A;  3AE7 B;  2BB5 A;  1EM7 A;  2QIE B;  2D3G A;  2LEK A;  1CQV A;  3I5J C;  1WX9 A;  2VZK B;  4HWI B;  4XX5 A;  3X23 A;  4OZA A;  2LUM A;  5TSS A;  2JU6 X;  4BOS C;  3B0A A;  3V05 A;  2WXQ A;  2KO3 A;  1F77 A;  1I7H A;  3ZW3 A;  3GP7 A;  2BF8 B;  4FAD A;  1WYG A;  2INP E;  4BZA A;  4FJV B;  2KHW B;  3NG0 A;  3P2B A;  2JXX A;  2L52 A;  2AQ3 B;  3U7D A;  5D2M B;  2BS3 B;  1FD6 A;  1WXV A;  3LJ3 A;  2YEP F;  1QQR A;  1KLV A;  3AN1 A;  2KKC A;  1I35 A;  2M17 A;  2YLM A;  1T6B X;  1JWB D;  4ACF A;  4ANU A;  4WUR A;  4M0W B;  4ITK A;  1ESF A;  3PGE A;  1MPE A;  1LQB A;  4XDC A;  1R4N I;  2C7M B;  4WJN A;  3OG5 A;  2AL3 A;  1L4Z B;  1P1A A;  3VH3 B;  4HPL B;  3VRA B;  2QJL A;  3DBS A;  3RMK C;  4GIV A;  1FRD A;  1XXG A;  3RT3 B;  2KNB A;  2CJO A;  2ZNV B;  4CYE A;  1WXM A;  2GBM A;  3L17 A;  3N1Y C;  1GB1 A;  1KH0 A;  1YQB A;  4ICU A;  2PVO D;  1GB4 A;  2X8X X;  2XN9 C;  4XWW A;  1SF0 A;  4GSW A;  4JIO U;  2E6X A;  2PE9 A;  3V60 A;  1C76 A;  1K52 A;  5T8I A;  1I4R A;  2WLB A;  2KWD A;  2BT6 A;  1HTO A;  2IGH A;  1AW7 A;  1OQQ A;  4LDT D;  2M0X A;  2N9L A;  3CMM B;  3HRD D;  1HA5 A;  3UGB B;  1TYG B;  2RD0 A;  4HEA 1;  3TEW A;  2LHD A;  1XLO A;  2EMS A;  1D3Z A;  3SU8 X;  1EWY C;  2LZ6 A;  2CU3 A;  4B0E A;  2KJR A;  3KLS X;  1JWM D;  3BYY B;  1R4M B;  2MCN B;  3QWZ B;  1C78 A;  2O2V A;  2NMQ A;  4RH6 A;  3W5V B;  1S1Q B;  1I4H A;  1ZPS A;  2LGI A;  4IG7 B;  2OJR A;  1SGH A;  1SJE D;  1TJE A;  2MBB B;  2O6V B;  3R2T A;  5CHV C;  1PUT A;  1ROE A;  2BYF A;  3DBL B;  4BVU C;  4WH4 A;  3WCQ A;  2WHI A;  3APD A;  2JVC A;  3QCA A;  3HM3 A;  2KX3 A;  4L2Y A;  5C2T B;  2GBR A;  3B2G A;  3DBR B;  1V1P A;  4NNJ B;  4RMA A;  2ZPN A;  1JWS D;  1WY8 A;  3AMZ A;  3SFE B;  2NR2 A;  4M8M A;  1UZX B;  5IP4 D;  5IO9 A;  4TKN A;  3PVL A;  2KDI A;  4OVU A;  1WRD B;  3KH0 A;  4WWN A;  2L00 B;  4JE3 B;  2KQ4 X;  3ML8 A;  2MX2 A;  1C77 A;  2C7N B;  1ZUD 2;  3TEX A;  2FNJ B;  3OJ4 B;  1V2Y A;  3H7S A;  2CJN A;  2LMC A;  2R2Q A;  1YQ3 B;  1ENF A;  3W9C B;  3B2F A;  1QOA A;  5EE0 A;  4K7U A;  5HI1 A;  1ZXI A;  2RDG A;  2Q5W D;  5KHO A;  4A3P A;  1D4B A;  2M19 A;  3A1Q B;  4O1N A;  5AZG A;  3RNG C;  1WM3 A;  3OWE B;  2BTE A;  1UBI A;  1L7Y A;  1V1P B;  3W5U B;  5JZE B;  2J52 A;  4XE0 A;  2DZK A;  4DXF A;  1KOT A;  2KWV B;  3P63 A;  1N6Z A;  2Z8L A;  1I4G A;  5AUK A;  5J18 A;  1T0S C;  3NUH B;  3NS1 A;  3VDZ A;  2KD0 A;  4AUQ C;  1E0Z A;  1TKG A;  2WX1 A;  2BWE S;  2A4Z A;  3DOW A;  3PLV A;  2HJ8 A;  4E3C A;  3WAO A;  1YMH E;  1V6E A;  2KDB A;  1Q1O A;  1U4A A;  3DHI C;  3EA6 A;  1TS2 A;  2DAF A;  2DZI A;  3APC A;  5HHD G;  3PSE B;  3NVY A;  2KMM A;  1KM7 A;  1IGD A;  4FJY A;  1MHX A;  4TSS A;  3DVG X;  3DVN V;  3CST A;  2RGF A;  2PMV A;  3Q3O C;  1P7F A;  2UYZ B;  4KVG B;  2WU2 B;  1ZW7 A;  3VR9 B;  4EZK A;  1Q5W B;  3DHH C;  1NEN B;  4RGN A;  4MEL A;  3VH4 B;  1QF6 A;  4NPN A;  4KV2 A;  2KFK B;  4OZC A;  2WDQ B;  1N62 A;  4C80 A;  5EE9 A;  2LWP A;  4IUM B;  5BYS A;  3J9C A;  4TMA B;  2INN E;  2KN4 A;  2WXG A;  3DDC B;  3DHG C;  3ZQ4 A;  3LB8 C;  3O13 A;  3QHT A;  1YQ4 B;  4HDQ A;  1E8X A;  1T5X D;  3P4P B;  1ZKH A;  4YSX B;  1YD8 U;  4ZHP A;  3ZRF A;  3JSV A;  2CKH B;  3U30 A;  3B1L X;  1TY0 A;  5CX3 A;  4RGT A;  1AN8 A;  1VJK A;  3SEB A;  5BMI A;  4YWG G;  2DNF A;  4HLE A; 
#chains in the Genus database with same CATH homology
 3SHQ A;  1V81 A;  2VRR B;  3VAW A;  4CO7 A;  2LGY A;  1J0G A;  3MTN B;  2MBH A;  4WQO B;  4F8C B;  2M4N A;  4W9K A;  1WX8 A;  3DBH I;  4OVV A;  3RZF A;  3A4R A;  3M63 B;  4DHJ D;  5BO4 B;  3WIM A;  3T8M A;  1NDD A;  4ANW A;  3L10 B;  4MEM A;  2LD9 A;  3A1Q A;  3SD5 A;  4BKS D;  4JQW C;  2DEN B;  2EKE C;  2N9P C;  4X57 B;  1WR1 A;  2NPT A;  2JWZ A;  4LJO B;  3AUL A;  2LXC A;  2LVP A;  3ZUN A;  2GBN A;  2KN5 A;  4HCN B;  2IO0 B;  4HDO A;  5L95 C;  1RFA A;  3B08 A;  1A5R A;  4LDT B;  2A5U A;  1WZ3 A;  2CS4 A;  2QHO A;  4B9K A;  1I42 A;  3GZN I;  3IBE A;  2IZV B;  2K6D B;  2MBO A;  5LXI B;  2C9W B;  3QC8 B;  4MSQ B;  3H7P A;  4HCP B;  4B6W A;  3VTW A;  1IP9 A;  2IBI B;  1Y8R C;  3IG3 A;  2J0J A;  3TJP A;  3QIJ A;  1OGW A;  3JW0 X;  1WF9 A;  4GDK A;  4WJP A;  2CU1 A;  3ZDM C;  3L08 A;  2K6Q A;  4IW0 A;  5CHW A;  3VHT C;  1GJZ A;  2KFJ A;  2GBK A;  3KVF B;  2N9E B;  4XZ4 A;  3DVG Y;  2V1Y A;  4P7I A;  4MJS B;  2OOB B;  2FCM A;  3ZVV A;  3OAW A;  3L54 A;  4J6I A;  5AZH A;  2LRW A;  4ZRJ A;  4EZL A;  4AJY B;  3V6E B;  2MA9 B;  3HK0 A;  3TL5 A;  1UD7 A;  4ZRI A;  4GDL A;  3ZNH B;  1E5W A;  3L0W B;  2KJH B;  1Z2M A;  2N7E A;  1UBQ A;  1V9J A;  1TGZ B;  1EF5 A;  2GBJ A;  2DYB A;  2JT4 B;  4AP4 C;  3EHV A;  1E8W A;  4KDI C;  2M8S A;  3QA8 A;  2KC2 A;  3KUC B;  4BKT A;  3R7R A;  4W9D A;  4MGK E;  2K39 A;  1EF1 A;  4BFR A;  4KSL C;  2RR9 A;  3HM6 X;  2CHW A;  2IO1 B;  2MQJ A;  2L8J A;  1XT9 B;  4WJQ A;  2KOX A;  3PV1 A;  1WGG A;  2NBW B;  2KTR B;  1WGD A;  4I6N B;  2JRH A;  3A4S C;  3PHX B;  3NOB A;  2O2V B;  1VCB A;  5CTR C;  5DCN A;  1RRB A;  1IYF A;  5JHA A;  2DZM A;  3HHM A;  4WWP A;  2MSE D;  1BT0 A;  2BYV E;  2ZNV C;  5DPW A;  1HE8 A;  1WYW B;  1MG8 A;  2D3G A;  3A9K B;  2W9N A;  1KJT A;  2XK5 A;  2O6V A;  2KQ7 A;  3MHS D;  1WX9 A;  4HWI B;  4PYZ A;  4XX5 A;  3X23 A;  2C7H A;  5AZF A;  3Q3F A;  5L83 A;  2C60 A;  2R2O A;  3VUY A;  1L2N A;  2N7D A;  2IY0 B;  4BOS C;  3B0A A;  3RUL A;  3T9L A;  2KXJ A;  2KO3 A;  3ZW3 A;  2BF8 B;  1WJ6 A;  3M95 A;  2KVR A;  1WFY A;  4FAD A;  4NY0 A;  2ZJD A;  4HJK A;  3IVF A;  3CF6 E;  1V5T A;  4ANX A;  4FJV B;  2KHW B;  3P2B A;  2JXX A;  2KTF A;  3U7D A;  5D2M B;  2BPS A;  3ZIM A;  1V5O A;  2KWC A;  3PTF C;  2KAN A;  3NY5 A;  2PEA A;  3ML9 A;  1WJU A;  2I1K A;  2FAZ A;  4PYU A;  1G6J A;  1WXV A;  3ZTD A;  3LJ3 A;  4A20 A;  3PZD A;  1KLV A;  4IC7 B;  4LCD E;  4ICV A;  2HTH A;  3VUX A;  2KKC A;  1I35 A;  2M17 A;  2YLM A;  3H7P B;  3L13 A;  4B95 A;  4ANU A;  3PRE A;  4FUL A;  4FHJ A;  4II2 B;  4TUU A;  5GMV A;  4M0W B;  5DPT A;  5EDS A;  3PGE A;  4W9C A;  5LXH A;  4AWJ A;  2BKR B;  1LQB A;  3W1Y A;  3SDL C;  3H6N A;  4MGZ E;  4IM3 A;  2KMC A;  1R4N I;  2M1M A;  1IPG A;  2C7M B;  4W9F A;  4WJN A;  1SIF A;  2AL3 A;  1UEL A;  3GOE A;  1P1A A;  2LI5 A;  3VH3 B;  4HPL B;  3S2A A;  2PPH A;  4PS3 A;  5E6O A;  1WXS A;  3Q3J A;  4JGH B;  3DBS A;  4ANV A;  4IWP A;  2L76 A;  2CHZ A;  4GIV A;  2WYQ A;  4W9J A;  1WH3 A;  3RT3 B;  1E8Y A;  1H4R A;  2MRP A;  2DAJ A;  2KNB A;  3KUZ A;  2ZNV B;  3WA0 A;  1C3T A;  4CYE A;  1E7U A;  1WXM A;  4G50 A;  5TR5 A;  2GBM A;  3L17 A;  3RYT A;  4EOY A;  1LXD A;  2L0T A;  4I6L B;  1GNU A;  2KMA A;  3VFK A;  3NHE B;  1YQB A;  4ICU A;  3QQ8 B;  3R7Q A;  4ZYN A;  3WAM A;  1WE6 A;  3LDZ E;  2G4S A;  4GSW A;  3UIN B;  4LJP B;  3ZNG C;  2N4F A;  4HXD A;  4JIO U;  2KZR A;  4DK5 A;  2PE9 A;  3V60 A;  1F9J A;  3D32 A;  4W9I A;  5JHB A;  1RAX A;  2XBB C;  1WGR A;  4G11 A;  3AXC A;  3WAN A;  1PQS A;  3BY4 B;  4LDT D;  4W9E A;  2ASQ A;  3PPA A;  1R4M I;  3L16 A;  2M0X A;  1JRU A;  4NQK E;  4FHK A;  5J17 A;  3H9D A;  1WJ4 A;  3CMM B;  2YVC A;  3ZO5 B;  1EO6 A;  3UGB B;  2L0F A;  2RD0 A;  3R3M A;  4KZ0 A;  4RM8 A;  2EMS A;  2ZPY A;  4DHZ E;  5E6N A;  1D3Z A;  3SU8 X;  2KLG A;  5G55 A;  2LZ6 A;  2D2Q A;  3RD2 A;  2KJR A;  5D6J B;  4IWQ A;  2D11 A;  2MCN B;  3QWZ B;  2O2V A;  4WWO A;  3JYU A;  5AEK B;  3ZDT A;  3DCG A;  1S1Q B;  3IHP C;  2IO3 B;  3QJZ A;  2AYO B;  3RZW C;  4IG7 B;  2OJR A;  1WI0 A;  4EZJ A;  2ZCC A;  2K8B A;  3KYC D;  1ZGU B;  1SGH A;  1ISN A;  1WMH A;  3RCZ A;  4DDI D;  1OQY A;  2MBB B;  2N1W A;  1YX6 B;  2MLB A;  2KK8 A;  2O6V B;  2JZZ A;  3ENE A;  3KYD D;  4N9F 4;  3A9J A;  5CHV C;  5DPR A;  2KTR A;  1TZ1 A;  2BYF A;  2CR5 A;  3UQB A;  2JY6 A;  2ZVN A;  2G45 B;  2NVU I;  1LFD A;  4NJ6 A;  4BVU C;  1YIW A;  3APD A;  2JVC A;  2ZZP B;  3N3K B;  3HM3 A;  3QCA A;  3ZRC A;  2KX3 A;  2KWU B;  1OTR B;  4KZC A;  1Z5S B;  3NS8 A;  1X1M A;  1Q0W B;  2GBR A;  2XEW A;  2LRU A;  2MWS B;  4G3X B;  2L3Z A;  4KIK A;  4IM2 A;  1XD3 B;  4NNJ B;  1OEY J;  4PS7 A;  3X0W A;  3UIP B;  4WJO A;  4RMA A;  2ZPN A;  3BIN A;  1WY8 A;  2KX0 A;  4MGY E;  2NR2 A;  2FCQ A;  3N30 A;  3O65 B;  4M8M A;  1UZX B;  2WWZ A;  3CSF A;  3TMP B;  3PHW B;  2DZJ A;  2JRI B;  4MSM B;  1WX7 A;  3ZNI D;  2MP2 A;  1EUV B;  4A3O A;  4TKN A;  3AU4 A;  4AJW A;  3PVL A;  2JF5 A;  2Z59 B;  3K9P B;  2RSU A;  4BKG A;  5E6P A;  2KDI A;  1UH6 A;  3VTV A;  2IYD B;  4MGI E;  3DBR I;  4OVU A;  1WRD B;  2O6V D;  3KH0 A;  1J19 A;  4HPM B;  1P9D U;  4NQL B;  1XQQ A;  1H8C A;  2CHX A;  4JL9 A;  4FJZ A;  4KDL B;  1FXT B;  4MM3 A;  4WWN A;  3RUI B;  2J7Q B;  1YJ1 A;  4DHJ B;  3JVZ X;  3ECI A;  4K7W A;  2KFK A;  2L00 B;  3PLU A;  1WXA A;  2AWT A;  3ML8 A;  3NZU A;  1WE7 A;  1J8C A;  1WIA A;  2KQS A;  4CHK A;  4F1S A;  2MX2 A;  3ALB A;  5C1Z A;  2HD5 B;  2C7N B;  1TTN A;  4DBG A;  3AU5 A;  2JPH A;  2DHZ A;  2D10 A;  3EFU A;  2C5L C;  2FNJ B;  3TBL D;  4GGQ A;  2FID A;  3OJ4 B;  1AAR A;  3DQV A;  1V2Y A;  3AI5 A;  3H7S A;  4BBN C;  3QAR A;  2LUE A;  2R2Q A;  4M8N A;  4TQ1 A;  1UGM A;  2V4L A;  2LGX A;  3ZNZ B;  3DPD A;  3UF8 A;  4BBN F;  3EEC A;  1M94 A;  3A9J B;  4K7U A;  3H1U A;  4MDK E;  3V62 A;  5KHO A;  4NAW B;  2J0M A;  4PS8 A;  2DYM A;  4A3P A;  2WX0 A;  4GU2 A;  4FBJ B;  3IFW B;  2WDT B;  4TV3 A;  3A1Q B;  2BWF A;  5AZG A;  3DBL I;  4HVB A;  1WM3 A;  1TBE A;  3W1S A;  4K81 A;  3M3J A;  5HKH A;  1UBI A;  1GC6 A;  3VVW B;  1L7Y A;  2Z0D B;  5JZE B;  1WGY A;  2K25 A;  1CMX B;  3QX1 A;  3WAL A;  2DX5 B;  2DZK A;  2BGF A;  1KOT A;  1LM8 B;  4W9G A;  2KWV B;  1GG3 A;  3KUD B;  3TIX A;  2J0K A;  2KJ6 A;  4GOC A;  4G0N B;  2LXA A;  2L05 A;  5J18 A;  1P98 A;  3QK0 A;  2GOW A;  2NBV B;  2LVO A;  4KIK B;  3JSV B;  5DPS A;  4ZDV A;  1P0R A;  2IY1 B;  3V6C B;  1RLF A;  4NJ7 A;  3VDZ A;  3APF A;  2LJ5 A;  2KD0 A;  4WAA A;  2L7R A;  5G2N A;  3PT2 B;  1K8R B;  4W9H A;  4GXB A;  2FCN A;  2DYO A;  4AUQ C;  1P3Q U;  2NS5 A;  3HIZ A;  5D94 A;  2MP2 B;  2LGD A;  2WX1 A;  1GUA B;  2BWE S;  1WM2 A;  1T0Y A;  4EKU A;  2IO2 B;  2NBU A;  2A4Z A;  3DOW A;  3PLV A;  4F7Z A;  4HK2 A;  2HJ8 A;  3TCA A;  4E71 A;  4W9L A;  2KLC A;  4AOF A;  1V80 A;  3WAO A;  4E3C A;  2K8H A;  4DDG D;  1V6E A;  2KDB A;  1Q1O A;  2Z0E B;  1C1Y B;  2FIF A;  2BYE A;  1U4A A;  4BOZ B;  4GMV A;  5JH5 C;  2LAS A;  4DXA B;  2ZEQ A;  4JLC A;  2B3A A;  2KDE B;  2DAF A;  5CHF A;  2DZI A;  4MJS A;  3ZTC A;  1WMH B;  3APC A;  1NBF C;  4E74 A;  3V61 A;  3PSE B;  5LLI A;  1KM7 A;  3ZKJ C;  4TQ0 A;  5FR6 A;  2LVQ A;  4EUT A;  4GDL B;  2UWQ A;  2JUO A;  3EC8 A;  4DWF A;  4FJY A;  3VTU A;  3W1S C;  1S3S G;  3U8Z A;  2AEH A;  3DVG X;  3DVN V;  4ZRK A;  3CST A;  3OJ3 A;  3PRM B;  2MW5 A;  3OLM D;  2RGF A;  4IWO A;  1VD2 A;  3VXW A;  1QZE A;  2UYZ B;  4KVG B;  2NPT B;  2MBQ A;  4FA6 A;  1ZW7 A;  2JZ3 B;  2N1V A;  3M62 B;  5IAA C;  4DHZ B;  4EZK A;  1Q5W B;  1E90 A;  3C0R B;  3A9K A;  4I6P A;  4MEL A;  2BKF A;  3VH4 B;  1WGH A;  4FN2 A;  4NPN A;  4KV2 A;  2I1J A;  2KDF B;  2KFK B;  3NZS A;  3MJW A;  4IM0 A;  3I3T B;  1OEY A;  4GB9 A;  3WAP A;  4ASW C;  3VUW A;  2LWP A;  4NAW A;  1V86 A;  1E7V A;  1WJN A;  2NCN A;  2K8C A;  4YL8 A;  4IUM B;  5D7G A;  2V3S A;  2REX A;  3PRZ A;  1GC7 A;  3KW5 B;  4XC2 A;  2PE6 B;  2ZVO A;  2GMI C;  2HE7 A;  4BKS A;  1E8Z A;  3VQI A;  4GDK B;  3UIO B;  2G4D B;  3DDC B;  5KHQ A;  4EFO A;  4KSK C;  3A33 B;  3UQA A;  1WZ0 A;  2PJH A;  4II3 B;  1NI2 A;  2N9X A;  4MH0 E;  3ZLZ A;  3QHT A;  2D07 B;  2G3Q B;  4EEW A;  3ONS A;  4HDQ A;  2KC1 A;  3PS6 A;  2ZCB A;  1E8X A;  2EMT A;  2Y5B B;  1WR6 E;  2AL6 A;  4K7S A;  1ZKH A;  4FLH A;  1YD8 U;  2K1F A;  2FCS A;  3ZRF A;  3JSV A;  2CKH B;  5IA7 A;  3U30 A;  1V49 A;  1YX5 B;  3PRP B;  3B1L X;  4RM9 A;  5J2R A;  4K1R B;  3QAQ A;  5C23 A;  4GN1 A;  3K9O B;  5CX3 A;  2MBE A;  2RPQ A;  3N32 A;  3R66 C;  2FUH B;  4HLE A;  1SE9 A;  2XK5 B;  3DVN U;  4URK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...