2N9PC

Solution structure of rnf126 n-terminal zinc finger domain in complex with bag6 ubiquitin-like domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
100
structure length
100
Chain Sequence
MAHHHHHHVDDDDKMLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF126
publication title Structural and functional insights into the E3 ligase, RNF126.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2n9pC00
3UGBB 3TCAA 4HK2A 1S1QB 4GIVA 2KC2A 2IO2B 1E8YA 4WJQA 2FUHB 3SDLC 1EUVB 2WDTB 4BKTA 2ZPYA 3V6EB 3VTVA 2BYEA 3A9KB 3H7PB 1WR6E 2L7RA 4GDLB 5C23A 4KIKA 3L54A 1V80A 2M1MA 4GN1A 4RMAA 4G3XB 4ICUA 3VUWA 2MW5A 3PS6A 3T9LA 1WJNA 1M94A 2KTFA 3H7SA 1OQYA 2CKHB 2XEWA 3Q3FA 2KTRB 1XQQA 4G11A 3WALA 2I1KA 3HHMA 2KLCA 4DHZB 4EZLA 3U7DA 3W1SC 3A9JB 2K6DB 5DPRA 3EECA 3MTNB 3QJZA 4PS7A 1V6EA 1UH6A 2G45B 2G3QB 2ZNVB 4MDKE 4BBNF 2J0MA 3PGEA 1J0GA 5JHBA 2K39A 1WXMA 2AYOB 2KWUB 4GDKA 3WAMA 5L95C 3KUZA 4FLHA 5HKHA 2HE7A 2DZJA 3HK0A 2V4LA 3ZDMC 2BYFA 3QC8B 3L10B 5AZGA 2N9PC 3R66C 4MGZE 3VH3B 4EEWA 2WYQA 2K8CA 1WM3A 1WX9A 2BF8B 4F7ZA 3Q3JA 4NNJB 3UIPB 1IYFA 1U4AA 3U30A 1E7VA 1UD7A 2C7NB 2O2VA 2YLMA 2MP2A 4HWIB 4MGYE 1NI2A 2JWZA 4G0NB 5G55A 2KDIA 3PLVA 4CYEA 3APCA 3IBEA 1F9JA 2JT4B 4WWOA 2M0XA 2MA9B 4BKSA 2KD0A 3ZKJC 3A9KA 4WQOB 5AEKB 4URKA 2YVCA 2Z0EB 2DZKA 3KVFB 1MG8A 1WJUA 2BWFA 4YL8A 2N9EB 5E6PA 3AXCA 2IY0B 4K7UA 3ZW3A 2GBRA 1WZ3A 1WX7A 2NVUI 2OJRA 2RPQA 2MX2A 4W9DA 3EHVA 1WM2A 2J0KA 3V60A 4IWOA 1RFAA 5J17A 4W9GA 1IPGA 4W9HA 3RZWC 4K7WA 3A1QA 1UZXB 4XZ4A 3UINB 2ZVOA 3RD2A 2N4FA 1EF1A 2B3AA 2O6VD 4P7IA 3X23A 3ZNHB 2UYZB 1LQBA 3PRMB 4EZJA 4HCNB 3PRPB 4A20A 3WANA 2PE6B 2BGFA 1V86A 2LVQA 2V1YA 5JH5C 4GB9A 2K8HA 4EKUA 1GG3A 2ZVNA 3A33B 3JSVB 2D07B 4A3OA 2KXJA 1UBIA 1GC6A 1WMHB 2D2QA 1ISNA 4OVUA 1YD8U 2KNBA 4MM3A 2O6VA 4GSWA 2DZMA 2QHOA 2KJRA 1P3QU 3B08A 3N3KB 2JRHA 4XX5A 3T8MA 2MBBB 4B95A 1WGRA 4DDID 1OEYA 1E90A 1YJ1A 1OEYJ 4G50A 4ANXA 4DWFA 3ZTCA 4F1SA 3ML9A 3IG3A 5D94A 3TBLD 1H8CA 3ZUNA 4KDIC 2C60A 2D11A 2ASQA 4FBJB 3WAOA 1E8ZA 2NS5A 1UBQA 4IM2A 4FHJA 2DAJA 2KOXA 4FJYA 3R7QA 1C1YB 3JYUA 4DXAB 3MJWA 4ANWA 1D3ZA 2ZNVC 3APDA 3DBRI 3QWZB 4MSMB 3JVZX 1TGZB 2KANA 4PYUA 3AULA 3VFKA 2JPHA 2FNJB 3B1LX 4HCPB 4MGIE 3VUXA 5JHAA 1GUAB 1SE9A 3DVGX 2FCQA 2KK8A 5FR6A 4HLEA 4I6LB 2IO0B 3P2BA 5G2NA 2PJHA 2MBEA 4B9KA 1K8RB 4WJPA 3PRZA 5E6NA 1GNUA 3PVLA 1P98A 4ZRKA 2N1VA 3H1UA 4ZDVA 3DVNU 4DBGA 3M95A 1V2YA 3V62A 3NS8A 2DX5B 3APFA 2GBKA 4JQWC 4LDTD 3TIXA 3TMPB 4M8MA 1L7YA 1Q1OA 1NBFC 4W9EA 1WY8A 1RAXA 1XT9B 5D6JB 3X0WA 3L13A 4E3CA 5DPWA 2MCNB 4NQKE 2L05A 2CHXA 3UQBA 1G6JA 1E8WA 3PT2B 4M0WB 3U8ZA 2LJ5A 4HPLB 2IO1B 4DK5A 5E6OA 3ZNID 2FAZA 1ZGUB 2IYDB 1QZEA 4WWPA 3QA8A 5IAAC 3PHWB 2NBVB 1TZ1A 5J18A 1RRBA 3ZLZA 2K1FA 3DDCB 3PZDA 4TKNA 3ZO5B 3ML8A 2NBUA 5LLIA 4NAWB 4K7SA 2AEHA 1WI0A 2AL3A 2LGXA 3L08A 2EKEC 2XK5A 3N32A 4I6PA 4JIOU 4MJSA 1CMXB 2KDFB 1WRDB 4WAAA 2FCSA 4HVBA 1YQBA 2G4DB 2L76A 3M63B 2R2QA 2MBOA 4NJ6A 4BKSD 4HDOA 4KSKC 4NQLB 3WAPA 4RM8A 2KFKB 1BT0A 3DCGA 3SHQA 1WXVA 1E8XA 2NCNA 4BKGA 4EOYA 1Z2MA 2GMIC 4WJOA 3KYDD 4X57B 2HD5B 3A4RA 3R7RA 3S2AA 3KUCB 1P1AA 1WGDA 5JZEB 2KN5A 2ZZPB 3MHSD 1C3TA 2OOBB 4I6NB 1I35A 2Y5BB 3L17A 2R2OA 3QARA 3PTFC 3H7PA 3VUYA 3QQ8B 3EFUA 4GDLA 4FJZA 5J2RA 3K9PB 2N9XA 1AARA 4HDQA 2KX3A 3B0AA 2KQ7A 2LI5A 3DVNV 4ICVA 5DCNA 2K25A 4AP4C 2GBJA 2KDEB 4KVGB 3QK0A 4LCDE 5BO4B 2IY1B 1WE7A 1XD3B 2BYVE 2KX0A 1WJ4A 4BFRA 2KTRA 4W9IA 3VH4B 4HPMB 2LVOA 2HTHA 2LRWA 2WX1A 2HJ8A 2KHWB 4EUTA 1UELA 1IP9A 2LRUA 3A9JA 4W9KA 4II3B 1E7UA 3QX1A 2KZRA 1ZKHA 2MQJA 3LDZE 4E71A 3QIJA 1R4NI 2JVCA 3CMMB 3VHTC 4XC2A 4OVVA 3NY5A 1YX6B 4DHJD 2WX0A 3RCZA 1WX8A 4BBNC 4TQ0A 4IM0A 1GC7A 5CHVC 5L83A 2MBQA 2CHWA 1HE8A 5C1ZA 2A5UA 3NZUA 2BWES 3K9OB 4IG7B 1KJTA 1WZ0A 4KZ0A 4PYZA 1NDDA 2KO3A 1JRUA 4K1RB 5DPSA 3ZTDA 2D10A 3M3JA 2L8JA 1WXAA 4KIKB 2EMTA 4PS3A 4AUQC 3KYCD 3AI5A 3IHPC 3V6CB 3HM3A 3ZIMA 4CO7A 5D2MB 1WJ6A 2CS4A 4IWPA 1WE6A 1WGHA 1L2NA 4MEMA 3VQIA 2LVPA 1V5OA 4LJPB 2RD0A 5GMVA 1WH3A 3HIZA 3OAWA 4EZKA 4W9LA 4ZRIA 4WWNA 2ZEQA 3PHXB 4RM9A 2JUOA 2JZZA 2C5LC 1J19A 2JZ3B 3QHTA 5CHFA 3M62B 4LDTB 2N7DA 5AZHA 2D3GA 2MLBA 3HM6X 2L0TA 1I42A 3KUDB 4DHZE 2LGDA 1SIFA 3CSFA 3NHEB 1H4RA 4CHKA 2C7MB 3BINA 3OLMD 5KHQA 2REXA 3CSTA 3OJ3A 5EDSA 4IWQA 1P0RA 2CU1A 2PE9A 1KM7A 2J7QB 1PQSA 3JSVA 5AZFA 3WIMA 2KWVB 1E5WA 2G4SA 1EO6A 2KQSA 3R3MA 1WMHA 3RZFA 4GGQA 1VCBA 4GXBA 1UGMA 3C0RB 4W9JA 1Z5SB 4GMVA 2FIDA 3DQVA 4ASWC 3DBHI 4HXDA 1KLVA 2C7HA 3ALBA 4EFOA 3V61A 2NPTB 3ECIA 3UF8A 1Y8RC 3EC8A 2DENB 4W9FA 1KOTA 4GU2A 1WFYA 2L3ZA 3QCAA 1Q5WB 2DYBA 5CX3A 3LJ3A 5LXIB 3UIOB 2KVRA 3A1QB 3NOBA 2KFJA 3AU4A 3PREA 3QAQA 2GBMA 4MSQB 3DBLI 3BY4B 2DYOA 2IZVB 2NR2A 1WIAA 2ZCCA 4AOFA 2IBIB 2RR9A 4FA6A 4TQ1A 1WGGA 4ANUA 2KKCA 2Z59B 4FADA 4FJVB 4J6IA 3GZNI 4MGKE 1LFDA 2LGYA 2FCNA 2MRPA 2J0JA 3SU8X 1FXTB 4JGHB 4FN2A 3VTUA 4ANVA 2EMSA 4A3PA 3CF6E 2DZIA 1YX5B 1RLFA 4MELA 2IO3B 2DAFA 2LZ6A 3PV1A 2O6VB 1V49A 3PPAA 1WR1A 2V3SA 3RULA 2LUEA 4II2B 4NPNA 2GOWA 2AWTA 4IUMB 1TTNA 3VDZA 3L0WB 4IC7B 4DHJB 2KLGA 2MWSB 4N9F4 4FULA 3JW0X 2JF5A 1V5TA 2JXXA 2I1JA 3DOWA 4ZYNA 1LM8B 2A4ZA 2DHZA 1Q0WB 1TBEA 2LXCA 2RGFA 2M17A 4WJNA 1WXSA 3RUIB 2KJ6A 4HJKA 2L0FA 1X1MA 2KMCA 3TJPA 2NPTA 4JLCA 3GOEA 2UWQA 2KDBA 1SGHA 2K8BA 4NAWA 1EF5A 2ZCBA 2CHZA 2N1WA 3OJ4B 4TUUA 5LXHA 2CR5A 3H6NA 2MBHA 2FIFA 4KDLB 2FCMA 4AJWA 4GOCA 4MH0E 1GJZA 1OTRB 1ZW7A 2GBNA 4W9CA 5DPTA 2M8SA 3UQAA 2KFKA 3D32A 4FHKA 4DDGD 2MSED 5D7GA 5CHWA 3ZDTA 2LWPA 2BKFA 1V9JA 1P9DU 1WYWB 3DPDA 4JL9A 2Z0DB 3PSEB 4IM3A 2LASA 2LXAA 1V81A 3IVFA 2KC1A 3IFWB 3ZNZB 4BOZB 3VAWA 4IW0A 4LJOB 2BPSA 4KSLC 3DBSA 2RSUA 3DVGY 1VD2A 4PS8A 1OGWA 3ENEA 3I3TB 2XBBC 4KV2A 3RYTA 1A5RA 1T0YA 2WWZA 3W1YA 2PEAA 2VRRB 2NBWB 3PLUA 2JRIB 2KWCA 3ZVVA 2C9WB 4NY0A 2LD9A 5TR5A 3ZRCA 2DYMA 4AJYB 2ZJDA 3NZSA 3ONSA 4F8CB 2ZPNA 3SD5A 2N7EA 3A4SC 2KMAA 4KZCA 5IA7A 1J8CA 2PPHA 4GDKB 3O65B 4ZRJA 5CTRC 3ZRFA 1YIWA 2KJHB 1S3SG 3VTWA 1LXDA 2XK5B 5KHOA 3VVWB 3H9DA 4MJSB 3WA0A 3ZNGC 4M8NA 2BKRB 3N30A 4NJ7A 3VXWA 3L16A 3RT3B 3AU5A 3W1SA 3TL5A 4B6WA 4BOSC 2JY6A 3KW5B 3KH0A 4BVUC 1R4MI 2K6QA 4AWJA 2W9NA 1WF9A 2AL6A 1WGYA 2L00B 4K81A 4TV3A 2M4NA 2O2VB 2MP2B 4E74A
chains in the Genus database with same CATH superfamily
1S1QB 2AQ3B 4WJQA 2FUHB 3SDLC 1GB1A 2WDTB 4BKTA 2V3PA 3IXSA 2L7RA 2ZW1A 3I5JC 4IKGA 3BIID 5FK9C 4D2KA 4ICUA 3VUWA 3ZJTA 1M94A 4NZLB 1EU3A 3Q3FA 1FEHA 2KTRB 3WALA 3HHMA 4DHZB 1DGJA 3QJZA 1SE4A 3E9SA 1NYRA 3TEYA 2ZNVB 4BBNF 3PGEA 1J0GA 2QJLA 2HE7A 3HK0A 4YTMB 3L10B 5AZGA 2N9PC 4EEWA 4F7ZA 1QT9A 3Q3JA 2N7JA 2O2VA 2YLMA 2MP2A 1NI2A 4CYEA 1F9JA 2H89B 1N62A 4LLGM 4WWOA 3P1MA 3ZGZA 3ZKJC 5AEKB 1N6ZA 2YVCA 2Z0EB 2DZKA 3KVFB 3SFDB 4ZHOA 2WU5B 3ZW3A 2RPQA 2MJ3A 4P1BC 2J0KA 3V60A 4W9HA 3Q8FA 2EKIA 2ONQA 3RD2A 1EF1A 2ACZB 2KVZA 3ZQ4A 2BGFA 4RGOS 3GP7A 2N9KA 4GB9A 2OHFA 2ZVNA 1C4CA 1R4MB 2L32A 1FCCC 2KNBA 2E6XA 4GSWA 1E0ZA 2DZMA 2QHOA 4MACA 2KJRA 3SEBA 4KGSA 1MI0A 3N3KB 2MBBB 1MFWA 2BS4B 1E90A 1Q10A 1YJ1A 4G50A 3ZTCA 4YTNB 3TBLD 5D94A 3ZUNA 3R8BA 2C60A 4USAA 1XXGA 4FHJA 2DAJA 2KOXA 3N20C 3R7QA 3JYUA 3MJWA 1D3ZA 4OZAA 1TGZB 2KANA 3AULA 2JPHA 1QOFA 2FNJB 2M56B 1JW9D 5JHAA 1SE9A 1ZE3D 2FCQA 2WXJA 4I6LB 3GS2A 4WJPA 5E6NA 4REZA 4ZRKA 4DBGA 3AE4B 2DX5B 4JQWC 1Q1OA 2FUG1 1KLUD 1XT9B 1T0RC 4NQKE 2CHXA 1G6JA 1EWYC 1E8WA 4M0WB 2NTSA 3U8ZA 3AE3B 3AN1A 4WWPA 2NBVB 1TZ1A 5J18A 3Q3MC 3ZO5B 5LLIA 4K7SA 1JWAD 1WI0A 2AL3A 3L08A 2LMCA 4MJSA 2KDFB 4HVBA 4XE0A 2G4DB 4BKSD 3M63B 2R2QA 2MBOA 1K52A 2PVGC 1BT0A 3DCGA 4X57B 3ZYYX 2ZZPB 3MHSD 1C3TA 4I6NB 3C8YA 2R2OA 3PTFC 2G1EA 3QQ8B 5J2RA 3DVNV 1TIFA 2KX0A 4M0WA 1EM7A 4IDIA 4P6VF 1UELA 4W9KA 5AUKA 1E7UA 1MG4A 2I38A 2KZRA 1ZKHA 1EWCA 2GI9A 3VHTC 4XC2A 2CU3A 1DOIA 2WX0A 3RCZA 1WX8A 4L23A 1GAQB 1OFFA 3DBRB 4AS1A 3NZUA 2BWES 3K9OB 1UNSA 2AQ1B 5DPSA 1AW7A 4KIKB 4PS3A 3EA6A 1ENFA 3ZIMA 2CS4A 3UI3A 4KX6B 2KYWA 3VRAB 1CK1A 4CQNA 2RD0A 3NVVA 5BMHA 2JUOA 1E7PB 1WYGA 2N7DA 3HM6X 2GB1A 2WXGA 1TY2A 4DHZE 2QEJC 1HZ6A 1H4RA 2INNE 2V3NA 4AQ7A 3BINA 2LEKA 5EDSA 2J7QB 1PQSA 1ZOYB 1HZ5A 4GGQA 2WDRB 4W9JA 1SE2A 2PVOD 3GE3C 1TKYA 2BTEA 4HXDA 4EFOA 2N0SB 2IPKD 2NPTB 1MPEA 1JMLA 1PGBA 1MJDA 1Q5WB 2DYBA 5CX3A 1TJEA 1P7EA 1FM0D 3BY4B 1TS5A 2DYOA 2NR2A 1SE3A 1WIAA 2RR9A 4TQ1A 1FXIA 1UUPA 3LB8C 1R4NB 2FCNA 4JGHB 1XO3A 4B0MA 1L6UA 1YX5B 4MELA 2IO3B 3N9YC 2JYTA 3ZJVA 2LZ6A 4WH4A 2O6VB 1FNWA 3IAM1 2GOWA 4IUMB 1R7SA 4C4VB 1J7BA 1YNTE 3VDZA 3L0WB 3EUB2 2JYEA 4FULA 3NG0A 2JXXA 1LO5D 4WURA 2LXCA 1SEBD 2M17A 1EU4A 2LGSA 2KJ6A 2L0FA 2NPTA 4JLCA 1TKGA 3GOEA 3TEWA 2KDBA 4NAWA 3NUHB 3SFEB 3OJ4B 4KGRA 3H6NA 4LNOA 4GOCA 1GJZA 3UQAA 3BYTB 3Q14C 4DDGD 4XDCA 2MSED 3LYYA 3U4EG 1P9DU 1WYWB 3DPDA 1F2RC 2Z0DB 2ICIA 4BOZB 2JXTA 3AEEB 2BPSA 1SB3C 2IDYA 1OGWA 1JWUD 1BUIC 3W1YA 5EE1A 2VRRB 2W54A 5TR5A 5EE9A 4O1NA 3DBHB 1L6VA 1YQ4B 3J9CA 2DLBA 4GDKB 1YIWA 1LXDA 2XK5B 3H9DA 3GB1A 4M8NA 1JWMD 3DWMA 3ETRA 3L16A 3RT3B 3AU5A 1R4MI 3R2TA 1T0QC 2V0GA 3VH4B 3BWUD 2RDGA 3TCAA 2QC8A 2KC2A 3GZNB 5T8IA 2PIAA 3I57A 3VTVA 2BYEA 3H7PB 1STEA 3VRBB 5C23A 1V80A 4G3XB 1JALA 5BYQA 3H7SA 1OQYA 2BVCA 2CKHB 4G11A 3L4PA 3A9JB 2K6DB 5DPRA 2INCC 1UH6A 2G45B 5IOIA 2G3QB 1MVKA 2J0MA 1MHXA 1QQRA 2K39A 4GDKA 2WXKA 4C80A 3VH3B 2KT7A 3RI7C 1WM3A 1WX9A 1IYFA 4NNJB 3UIPB 1U4AA 2DWQA 2C7NB 1F52A 1TKEA 4G0NB 5G55A 3RNGC 3APCA 4HKQA 1QOGA 1T6BX 3LXFA 5BMIA 4YL8A 2N9EB 3AXCA 3DWGC 4K7UA 3N1ZC 2NVUI 2OJRA 2R61A 3EHVA 2AQ2B 4W9GA 4K7WA 3A1QA 2N4FA 2B3AA 2K22A 1K50A 1SSNA 3BVGA 4P7IA 3WCQA 3ZNHB 4EZJA 3RFZB 3BZDB 4HCNB 3PRPB 1RM6C 3AM9A 3WANA 1V86A 2V1YA 3JSVB 1YN4A 3AMZA 1GC6A 1ACCA 2D2QA 4OVUA 1WGKA 1RYJA 2KQ4X 2CJNA 1N63A 2BB6A 3B08A 1E10A 4DDID 3RPFC 1OEYA 3IT6B 1MHHE 1QF6A 3ML9A 4ARCA 4US9A 2BB5A 2D11A 2ASQA 4FBJB 1FO4A 3ZXRA 2NS5A 1CQVA 4FJYA 3DBRI 5HG2A 3QWZB 4PYUA 3U7ZA 4XWWA 4HCPB 3AEDB 3VR9B 3DVGX 2KK8A 4J3OD 4HLEA 2WLBA 1E9MA 1GNUA 1DOXA 3H1UA 2AX5A 3M95A 3TIXA 4LDTD 3TMPB 2JSVX 4W9EA 1RAXA 3X0WA 4E3CA 1J7AA 1WRIA 2NTTA 2IO1B 4C7YA 5E6OA 3ZNID 1XLQA 2L83A 3QA8A 3PHWB 2YEPF 3BK1A 2MJEA 1N5XA 1RRBA 3ZLZA 2KN4A 2K1FA 1C4AA 3ML8A 1P7FA 2QMTA 2AEHA 1FMAD 2WXOA 3N32A 1L5PA 1CMXB 1YQBA 2L76A 4M01A 2KFKB 1WXVA 2NCNA 2GMIC 3KYDD 3R7RA 3A4RA 3B9JA 3KUCB 1WGDA 5JZEB 3VR8B 2Y5BB 2W3SA 4OW0A 1ZXIA 1ESFA 3HUIA 1ZUD2 2N9XA 1AARA 2KX3A 2LI5A 5HFYA 4ICVA 3V05A 2K25A 1XLPA 2BBCA 4KVGB 1J7CA 3QK0A 1XLNA 4LCDE 1WE7A 2J53A 1HQRD 1WJ4A 4BFRA 2KTRA 2GLSA 4LTUA 2LVOA 2WX1A 2KHWB 1PDXA 4OHJA 1R4NI 3E56A 1YX6B 2WDQB 5CHVC 2MBQA 2CHWA 1ZXHA 5C1ZA 2LJIA 4IG7B 1KJTA 1KLGD 5FR3A 1I4QA 1PGXA 3AE8B 2D10A 2L8JA 1V8CA 3AE7B 3BVMA 3AI5A 3V6CB 2N9LA 3HVZA 3TEZA 5D2MB 1WJ6A 1ZPSA 4IWPA 4HROA 3VQIA 1OQQA 2WHIA 1QOAA 3AEBB 4W9LA 4ZRIA 4A55A 4RM9A 2YEPB 2C5LC 2JZ3B 1C78A 4JWSC 3M62B 4LDTB 2KDMA 1C79A 1ROEA 5EE3A 4LNFA 3AEGB 1LGRA 2JWUA 3KUDB 2LGDA 4OVZA 2J4XA 3NHEB 1HXYD 3OLMD 3KWLA 5KHQA 3Q69A 1V97A 3CSTA 4IWQA 2PE9A 1KM7A 2G4SA 3R3MA 5D3DA 3C0RB 1Z5SB 4GMVA 2FIDA 4LNNA 3DBHI 3ALBA 5FKAC 2L1AA 4WWMA 3ECIA 3EC8A 1KOTA 1ZP0B 4ZYSA 3LJ3A 1V1OA 1YN5A 1E6EB 3KWVA 4MT5A 3OWEB 4FA6A 3N1XC 2Z59B 4FADA 3GZNI 1PYWD 4ZRQA 1ET9A 4ANVA 1VLBA 4MM3B 5HI1A 4XDDA 1V49A 1KF6B 4YSYB 4M00A 4II2B 4NPNA 3N1YC 1NENB 1UF0A 2M19A 2AWTA 1WSPA 1KFYB 1TTNA 2MWSB 1FD6A 2RDHA 3JW0X 2WXFA 1BMLC 3ZXVA 1LM8B 3HRDD 4L1BA 4XYCA 2UWQA 4LK0M 2CHZA 3P4RB 1IUEA 2JQRB 3T3OA 5H8YE 1GPXA 1ZW7A 4W9CA 2M8SA 4FHKA 3AECB 4OZCA 5D7GA 2BKFA 1V9JA 2ZW0A 1SBBB 3FILB 3PSEB 3IVFA 3IFWB 1XEEA 3VAWA 3BK2A 1L0VB 3FC4A 2LFIA 2RSUA 3DVGY 2XBBC 2IJ0A 1VR9A 2XNAC 2G9HD 4DXGA 2WWZA 3NVZA 4ITKA 4N59A 4DXFA 2JRIB 3URYA 4TSSA 3ZRCA 4AJYB 3ONSA 4ZRPA 2ZPNA 3SD5A 5IA7A 1J8CA 2PPHA 4YSXB 3O65B 5CTRC 3VTWA 3VVWB 2B76B 3N30A 1L4ZB 4N6EB 4BOSC 3KW5B 3DBLB 4AWJA 2AL6A 1WGYA 2L00B 2V4IB 3SR6A 2JX5A 4E74A 3UGBB 4HK2A 2WS3B 3MC9A 2IGHA 4ACFA 2LHEA 3A9KB 4GDLB 1XF5L 2D3AA 4KIKA 1PFDA 3L54A 2M1MA 3FKYA 4RMAA 1VDVA 1N60A 3PS6A 2INPE 1QLBB 2KTFA 1GOZA 1UGJA 2XEWA 1XQQA 2I1KA 1YOVB 2KLCA 3U7DA 3W1SC 1I4XA 3MTNB 4PS7A 2D5GA 4A9AA 3Q3NC 1GB4A 4FLHA 5HKHA 3MFGA 1KRHA 2V4LA 3MP9A 2BYFA 4HEA1 1FXAA 3QC8B 3ZDMC 1IBXB 3R66C 3O13A 4MGZE 2K8CA 1HTQA 3U30A 3NVWA 1E7VA 1UD7A 2PTLA 4HWIB 2WNMA 4MGYE 2JWZA 2KDIA 3PLVA 2VH1A 1QKZA 2NMQA 3P4PB 2M0XA 4BKSA 1FFVA 2KD0A 3A9KA 4WQOB 3IT4B 4URKA 2BWFA 4KKIA 5E6PA 2IY0B 2FBWB 1WZ3A 1WX7A 1FNUA 1YN3A 2LHDA 4ZHPA 1RFAA 1IPGA 1UZXB 4JX1C 2RMMA 1D4BA 2UYZB 1LQBA 1F1HA 1JRPA 2PE6B 2LVQA 4HJGE 2WXLA 2ON8A 4EE2A 1CZPA 3A33B 4C00A 2D07B 1UBIA 1WMHB 1ISNA 1YD8U 2O6VA 2WDVB 2K5PA 4WAFA 4HKZE 4C4VA 2I2YA 2BQQA 4Q2JA 4DWFA 3IG3A 1I4PA 1H8CA 2LUMA 4KDIC 2Y5PA 3RNCC 1E8ZA 1UBQA 1C1YB 4DXAB 3NVYA 4ANWA 2WGSA 3APDA 2JZPA 4MSMB 2Q5WD 1HEZE 4MGIE 1AYFA 3VUXA 1GUAB 3IAS1 3Q8BA 2IO0B 2PJHA 1D5XC 1V2YA 3APFA 2GBKA 1YJIA 1L7YA 1SF0A 4M8MA 1RFKA 4BZAA 2SEBD 1WY8A 3L13A 2L05A 1L0XB 3UQBA 3AV8A 3PT2B 2LJ5A 4WQMA 1C9FA 4DK5A 1F0ZA 2FAZA 2L52A 2LGIA 4P1CC 1WWTA 3MC0B 3PZDA 3CWIA 2NBUA 2EKEC 2XK5A 4I6PA 1AWDA 4WAAA 2FCSA 3AE5B 4KSKC 3WAPA 1F2RI 1E8XA 4BKGA 5IP4D 2WXIA 4WJOA 1K51A 1NYQA 1P1AA 2KN5A 2OOBB 1I35A 3L17A 2WP9B 3QARA 3H7PA 4FJZA 3K9PB 3B0AA 4A6QA 2KMMA 4AP4C 2GBJA 2KDEB 2K3UA 2TSSA 5BO4B 1XD3B 2XN9C 3EFCA 4W9IA 1XCQL 2PMVA 3DHGC 2HTHA 2LRWA 4RCOA 4EUTA 1IP9A 2LRUA 3A9JA 3QX1A 2MQJA 3LDZE 2BYTA 3QIJA 2JVCA 3CMMB 2KWDA 3C19A 4DHJD 4TQ0A 1SJHD 5L83A 4US8A 1HE8A 1NEKB 1WZ0A 3B2GA 4KZ0A 4PYZA 2Y3AA 2KO3A 1L4DB 3W9CB 4K1RB 3ZTDA 4RGNA 4YWGG 4AUQC 2PKOA 3KYCD 4MH8A 3HM3A 3P42A 4CO7A 1SJED 1A70A 3EGRA 3B2FA 1CJEA 4K3BA 1WE6A 1WGHA 1L2NA 4LJPB 5GMVA 3HIZA 4WWNA 2ZEQA 3HVDA 2JZZA 5AZHA 2D3GA 5BYRA 2MLBA 2FE8A 4LNIA 3CSFA 4PK1A 1FFUA 2REXA 3OJ3A 1P0RA 3JSVA 5AZFA 2KWVB 1E5WA 2KQSA 1EO6A 3NZ3A 3RZFA 2Y5CA 5D3IB 1VCBA 4GXBA 3H8HA 3DQVA 4ASWC 3AEFB 1KLVA 2C7HA 3V61A 3Q2AC 3UF8A 1Y8RC 2DENB 4H2AA 1WFYA 3QCAA 1XLOA 5LXIB 3AE1B 3UIOB 2KVRA 3NOBA 3KQ4A 4C7ZA 3PREA 3QAQA 3DBLI 2IZVB 3RN9C 2ZCCA 4FXCA 2IBIB 1PUTA 2X38A 3AH7A 1WGGA 4MGKE 1JWBD 2GRIA 1LFDA 2MRPA 1FXTB 2RDBC 3VTUA 3AE2B 3CF6E 1FRDA 1TY0A 4YT0B 3PV1A 3MHZA 5G5HA 4B0EA 1WR1A 4L2YA 3RULA 3ZJUA 1YQ3B 1NVID 4IC7B 4DHJB 1KH0A 1T5XD 3TUOA 2JF5A 1V5TA 2I1JA 2EELA 2RGFA 4RF0A 3TJPA 3BVZA 3KLSX 1EF5A 2ZCBA 5LXHA 2N1WA 2K0PA 2CR5A 2KACA 2FIFA 2KAJA 2FCMA 4AJWA 4MH0E 2MEKA 4RGMA 2GBNA 5DPTA 2MH7A 2KFKA 1C4PA 4YTPB 2M0AA 1JWSD 4IM3A 2RPVA 4LJOB 4KSLC 3DBSA 1VRAB 1HA5A 3NJTA 3ENEA 3I3TB 1TS3A 3RYTA 2NBWB 3PLUA 4NY0A 1I7HA 1RWSA 2IGDA 4F8CB 3NZSA 2N7EA 4KZCA 2KMAA 4ZRJA 4KGTA 2KJHB 1S3SG 5KHOA 2BS3B 3AE9B 4MJSB 3MC8A 2BKRB 4NJ7A 3W5UB 3W1SA 2JY6A 4BVUC 2HJ1A 2K6QA 1DOYA 2QSDA 4K81A 4TV3A 3T3NA 4GIVA 1YJJA 2IO2B 1E8YA 1EUVB 2ZPYA 2H88B 3V6EB 1HTOA 3I63C 3PZ7A 4ARIA 1WR6E 5JXVA 3W2DA 2INDC 4GN1A 2MW5A 3T9LA 3DHHC 1WJNA 2WXNA 3Q6BA 4EZLA 3RNAC 3EECA 1V6EA 5AUIA 4NJCA 1SXTA 4MDKE 4N58A 5JHBA 2D3CA 3Q8CA 4RNAA 1WXMA 2AYOB 2KWUB 3BYYB 3WAMA 1V1PB 5L95C 3KUZA 2DZJA 5C3JB 1L0YB 2WYQA 1B1ZA 5I4DA 1FIQA 2BF8B 1JCKB 2BT6A 3R2IA 4C56C 1FRRA 3IBEA 2JT4B 1T3QA 2MA9B 2J52A 4JWUC 5G5GA 1MG8A 1WJUA 2JU6X 4S17A 2GBRA 2PLPA 4RGTA 2MX2A 4W9DA 1WM2A 4IWOA 5J17A 4JPSA 2QILA 3RZWC 2VZKD 4XZ4A 4KKJA 3UINB 5IKCM 2ZVOA 2O6VD 3AB5A 2QDFA 2V9HA 3X23A 3PRMB 3W5VB 3V3XA 4A20A 1D6EC 5JH5C 2K8HA 4EKUA 1GG3A 1V1PA 4A3OA 4NAMA 2KXJA 1D5MC 4MM3A 1ET6A 1FCLA 2WXQA 1P3QU 1TS2A 4XX5A 2JRHA 3T8MA 4B95A 1WGRA 1OEYJ 4ANXA 4F1SA 4BAXA 1DYQA 1VZ8A 5MPOA 3WAOA 3Q8AA 4IM2A 1AN8A 1Y56A 2ZNVC 3OG5A 3JVZX 3VFKA 3B1LX 4UDUC 5FR6A 1JROA 3P2BA 3U2SC 2WU2B 5G2NA 2MBEA 4B9KA 1K8RB 3PRZA 4A90A 3PVLA 3PO0A 1P98A 2K9XA 2N1VA 4ZDVA 3DVNU 3V62A 3NS8A 3FILA 4K3CA 1I4HA 1NBFC 1UWXA 4RFBA 5D6JB 1K53A 4QAYA 4RF1A 5DPWA 2MCNB 3RNBC 3TSSA 4HPLB 2WQYB 1ZGUB 2IYDB 1QZEA 5IAAC 1VZ6A 1TYGB 5GXGB 3DDCB 1IGDA 4TKNA 3RMKC 4NAWB 2W55A 2LGXA 2UU7A 1JQ4A 5H92C 2WXHA 4JIOU 1WRDB 2WXPA 4NJ6A 4HDOA 4NQLB 4RM8A 3SHQA 4EOYA 2D3BA 1PGAA 1M4VA 1Z2MA 3CIRB 1XCTL 2PW9A 2HD5B 3S2AA 1TZOA 1F77A 2VZKB 3VUYA 3EFUA 4GDLA 4OZBA 4HDQA 1YMHE 2KQ7A 4TMAB 5DCNA 2IY1B 3I9V1 4YXDB 2BYVE 3DHIC 1TS4A 4HPMB 5IO9A 4M02A 2HJ8A 1IGCA 4II3B 4P16A 4E71A 4ZOHC 4OVVA 3NY5A 2HTME 4BBNC 3NRZA 4IM0A 1GC7A 2DNFA 2QIEB 2A5UA 1IBXA 1NDDA 3AEAB 1FNVA 1JRUA 3M3JA 2QCZA 1WXAA 2EMTA 1BXTA 4HRSA 3IHPC 5BMGA 2Z8LA 1C77A 4MEMA 2LVPA 1V5OA 1WH3A 3OAWA 4EZKA 3PZ8A 3PHXB 2HDEA 4A8XC 1J19A 5CHFA 3QHTA 1I4RA 1TT5B 1WXQA 3Q3OC 5TSSA 2L0TA 1I42A 2VH2A 2W82A 1VZ7A 1SIFA 1QILA 1N5WA 4CHKA 1OQRA 2C7MB 4IOIE 3RNEC 3GE8C 1VJKA 3RNFC 2CU1A 4S0RA 3U52E 3WIMA 2SAKA 2OJWA 5BYSA 1WMHA 3Q8EA 1UGMA 5C2TB 4YSZB 2IGGA 2E3TA 4W9FA 3P4SB 4GU2A 2L3ZA 3NS1A 1UWMA 5LNK1 3P4QB 3A1QB 2KFJA 3AU4A 2GBMA 4MSQB 1C76A 5HHDG 4AOFA 1D5ZC 3MJ5A 4HPPA 4ANUA 2KKCA 4FJVB 4J6IA 4JE3B 2LGYA 2OEDA 5EE0A 2J0JA 3SU8X 4FN2A 3AE6B 2W3RA 2EMSA 4A3PA 2DZIA 1RLFA 2DAFA 3PPAA 2V3SA 5E6JA 2LUEA 2KLGA 1FPYA 4N9F4 4WIPA 1T0SC 4ZYNA 3DOWA 2A4ZA 2DHZA 1Q0WB 1TBEA 2J42A 4PT5A 4R3DA 4WJNA 1WXSA 3RUIB 4LNKA 4HJKA 1X1MA 2KMCA 2BS2B 1SGHA 2K8BA 3FAHA 4TUUA 3ABVB 4DQOC 3P63A 2WXMA 2MBHA 4KDLB 4GLSC 1KTKA 5IN7A 1OTRB 3D32A 4XGAB 5CHWA 3ZDTA 2LWPA 4RH6A 4JL9A 2DBYA 1I4GA 2MJDA 1B9RA 2LASA 2LXAA 1V81A 4XWTA 2KC1A 3ZNZB 1N61A 4IW0A 3TEXA 1VD2A 4PS8A 4KV2A 1A5RA 1T0YA 2PEAA 1SIJA 2KWCA 3ZVVA 2C9WB 1QOBA 2LD9A 2X8XX 2DYMA 2WXRA 1ZDXA 2ZJDA 3A4SC 3ZRFA 2BW2A 3WA0A 3ZNGC 2MHJA 3VXWA 1ZDVA 4B6WA 3TL5A 1NI3A 3KH0A 2W9NA 1WF9A 2M4NA 2O2VB 2CJOA 2MP2B
chains in the Genus database with same CATH topology
3UGBB 3TCAA 4HK2A 1S1QB 4GIVA 2KC2A 2IO2B 1E8YA 4WJQA 2FUHB 3SDLC 1EUVB 2WDTB 4BKTA 2ZPYA 3V6EB 3VTVA 2BYEA 3A9KB 3H7PB 1WR6E 2L7RA 4GDLB 5C23A 4KIKA 3L54A 1V80A 2M1MA 4GN1A 4RMAA 4G3XB 4ICUA 3VUWA 2MW5A 3PS6A 3T9LA 1WJNA 1M94A 2KTFA 3H7SA 1OQYA 2CKHB 2XEWA 3Q3FA 2KTRB 1XQQA 4G11A 3WALA 2I1KA 3HHMA 2KLCA 4DHZB 4EZLA 3U7DA 3W1SC 3A9JB 2K6DB 5DPRA 3EECA 3MTNB 3QJZA 4PS7A 1V6EA 1UH6A 2G45B 2G3QB 2ZNVB 4MDKE 4BBNF 2J0MA 3PGEA 1J0GA 5JHBA 2K39A 1WXMA 2AYOB 2KWUB 4GDKA 3WAMA 5L95C 3KUZA 4FLHA 5HKHA 2HE7A 2DZJA 3HK0A 2V4LA 3ZDMC 2BYFA 3QC8B 3L10B 5AZGA 2N9PC 3R66C 4MGZE 3VH3B 4EEWA 2WYQA 2K8CA 1WM3A 1WX9A 2BF8B 4F7ZA 3Q3JA 4NNJB 3UIPB 1IYFA 1U4AA 3U30A 1E7VA 1UD7A 2C7NB 2O2VA 2YLMA 2MP2A 4HWIB 4MGYE 1NI2A 2JWZA 4G0NB 5G55A 2KDIA 3PLVA 4CYEA 3APCA 3IBEA 1F9JA 2JT4B 4WWOA 2M0XA 2MA9B 4BKSA 2KD0A 3ZKJC 3A9KA 4WQOB 5AEKB 4URKA 2YVCA 2Z0EB 2DZKA 3KVFB 1MG8A 1WJUA 2BWFA 4YL8A 2N9EB 5E6PA 3AXCA 2IY0B 4K7UA 3ZW3A 2GBRA 1WZ3A 1WX7A 2NVUI 2OJRA 2RPQA 2MX2A 4W9DA 3EHVA 1WM2A 2J0KA 3V60A 4IWOA 1RFAA 5J17A 4W9GA 1IPGA 4W9HA 3RZWC 4K7WA 3A1QA 1UZXB 4XZ4A 3UINB 2ZVOA 3RD2A 2N4FA 1EF1A 2B3AA 2O6VD 4P7IA 3X23A 3ZNHB 2UYZB 1LQBA 3PRMB 4EZJA 4HCNB 3PRPB 4A20A 3WANA 2PE6B 2BGFA 1V86A 2LVQA 2V1YA 5JH5C 4GB9A 2K8HA 4EKUA 1GG3A 2ZVNA 3A33B 3JSVB 2D07B 4A3OA 2KXJA 1UBIA 1GC6A 1WMHB 2D2QA 1ISNA 4OVUA 1YD8U 2KNBA 4MM3A 2O6VA 4GSWA 2DZMA 2QHOA 2KJRA 1P3QU 3B08A 3N3KB 2JRHA 4XX5A 3T8MA 2MBBB 4B95A 1WGRA 4DDID 1OEYA 1E90A 1YJ1A 1OEYJ 4G50A 4ANXA 4DWFA 3ZTCA 4F1SA 3ML9A 3IG3A 5D94A 3TBLD 1H8CA 3ZUNA 4KDIC 2C60A 2D11A 2ASQA 4FBJB 3WAOA 1E8ZA 2NS5A 1UBQA 4IM2A 4FHJA 2DAJA 2KOXA 4FJYA 3R7QA 1C1YB 3JYUA 4DXAB 3MJWA 4ANWA 1D3ZA 2ZNVC 3APDA 3DBRI 3QWZB 4MSMB 3JVZX 1TGZB 2KANA 4PYUA 3AULA 3VFKA 2JPHA 2FNJB 3B1LX 4HCPB 4MGIE 3VUXA 5JHAA 1GUAB 1SE9A 3DVGX 2FCQA 2KK8A 5FR6A 4HLEA 4I6LB 2IO0B 3P2BA 5G2NA 2PJHA 2MBEA 4B9KA 1K8RB 4WJPA 3PRZA 5E6NA 1GNUA 3PVLA 1P98A 4ZRKA 2N1VA 3H1UA 4ZDVA 3DVNU 4DBGA 3M95A 1V2YA 3V62A 3NS8A 2DX5B 3APFA 2GBKA 4JQWC 4LDTD 3TIXA 3TMPB 4M8MA 1L7YA 1Q1OA 1NBFC 4W9EA 1WY8A 1RAXA 1XT9B 5D6JB 3X0WA 3L13A 4E3CA 5DPWA 2MCNB 4NQKE 2L05A 2CHXA 3UQBA 1G6JA 1E8WA 3PT2B 4M0WB 3U8ZA 2LJ5A 4HPLB 2IO1B 4DK5A 5E6OA 3ZNID 2FAZA 1ZGUB 2IYDB 1QZEA 4WWPA 3QA8A 5IAAC 3PHWB 2NBVB 1TZ1A 5J18A 1RRBA 3ZLZA 2K1FA 3DDCB 3PZDA 4TKNA 3ZO5B 3ML8A 2NBUA 5LLIA 4NAWB 4K7SA 2AEHA 1WI0A 2AL3A 2LGXA 3L08A 2EKEC 2XK5A 3N32A 4I6PA 4JIOU 4MJSA 1CMXB 2KDFB 1WRDB 4WAAA 2FCSA 4HVBA 1YQBA 2G4DB 2L76A 3M63B 2R2QA 2MBOA 4NJ6A 4BKSD 4HDOA 4KSKC 4NQLB 3WAPA 4RM8A 2KFKB 1BT0A 3DCGA 3SHQA 1WXVA 1E8XA 2NCNA 4BKGA 4EOYA 1Z2MA 2GMIC 4WJOA 3KYDD 4X57B 2HD5B 3A4RA 3R7RA 3S2AA 3KUCB 1P1AA 1WGDA 5JZEB 2KN5A 2ZZPB 3MHSD 1C3TA 2OOBB 4I6NB 1I35A 2Y5BB 3L17A 2R2OA 3QARA 3PTFC 3H7PA 3VUYA 3QQ8B 3EFUA 4GDLA 4FJZA 5J2RA 3K9PB 2N9XA 1AARA 4HDQA 2KX3A 3B0AA 2KQ7A 2LI5A 3DVNV 4ICVA 5DCNA 2K25A 4AP4C 2GBJA 2KDEB 4KVGB 3QK0A 4LCDE 5BO4B 2IY1B 1WE7A 1XD3B 2BYVE 2KX0A 1WJ4A 4BFRA 2KTRA 4W9IA 3VH4B 4HPMB 2LVOA 2HTHA 2LRWA 2WX1A 2HJ8A 2KHWB 4EUTA 1UELA 1IP9A 2LRUA 3A9JA 4W9KA 4II3B 1E7UA 3QX1A 2KZRA 1ZKHA 2MQJA 3LDZE 4E71A 3QIJA 1R4NI 2JVCA 3CMMB 3VHTC 4XC2A 4OVVA 3NY5A 1YX6B 4DHJD 2WX0A 3RCZA 1WX8A 4BBNC 4TQ0A 4IM0A 1GC7A 5CHVC 5L83A 2MBQA 2CHWA 1HE8A 5C1ZA 2A5UA 3NZUA 2BWES 3K9OB 4IG7B 1KJTA 1WZ0A 4KZ0A 4PYZA 1NDDA 2KO3A 1JRUA 4K1RB 5DPSA 3ZTDA 2D10A 3M3JA 2L8JA 1WXAA 4KIKB 2EMTA 4PS3A 4AUQC 3KYCD 3AI5A 3IHPC 3V6CB 3HM3A 3ZIMA 4CO7A 5D2MB 1WJ6A 2CS4A 4IWPA 1WE6A 1WGHA 1L2NA 4MEMA 3VQIA 2LVPA 1V5OA 4LJPB 2RD0A 5GMVA 1WH3A 3HIZA 3OAWA 4EZKA 4W9LA 4ZRIA 4WWNA 2ZEQA 3PHXB 4RM9A 2JUOA 2JZZA 2C5LC 1J19A 2JZ3B 3QHTA 5CHFA 3M62B 4LDTB 2N7DA 5AZHA 2D3GA 2MLBA 3HM6X 2L0TA 1I42A 3KUDB 4DHZE 2LGDA 1SIFA 3CSFA 3NHEB 1H4RA 4CHKA 2C7MB 3BINA 3OLMD 5KHQA 2REXA 3CSTA 3OJ3A 5EDSA 4IWQA 1P0RA 2CU1A 2PE9A 1KM7A 2J7QB 1PQSA 3JSVA 5AZFA 3WIMA 2KWVB 1E5WA 2G4SA 1EO6A 2KQSA 3R3MA 1WMHA 3RZFA 4GGQA 1VCBA 4GXBA 1UGMA 3C0RB 4W9JA 1Z5SB 4GMVA 2FIDA 3DQVA 4ASWC 3DBHI 4HXDA 1KLVA 2C7HA 3ALBA 4EFOA 3V61A 2NPTB 3ECIA 3UF8A 1Y8RC 3EC8A 2DENB 4W9FA 1KOTA 4GU2A 1WFYA 2L3ZA 3QCAA 1Q5WB 2DYBA 5CX3A 3LJ3A 5LXIB 3UIOB 2KVRA 3A1QB 3NOBA 2KFJA 3AU4A 3PREA 3QAQA 2GBMA 4MSQB 3DBLI 3BY4B 2DYOA 2IZVB 2NR2A 1WIAA 2ZCCA 4AOFA 2IBIB 2RR9A 4FA6A 4TQ1A 1WGGA 4ANUA 2KKCA 2Z59B 4FADA 4FJVB 4J6IA 3GZNI 4MGKE 1LFDA 2LGYA 2FCNA 2MRPA 2J0JA 3SU8X 1FXTB 4JGHB 4FN2A 3VTUA 4ANVA 2EMSA 4A3PA 3CF6E 2DZIA 1YX5B 1RLFA 4MELA 2IO3B 2DAFA 2LZ6A 3PV1A 2O6VB 1V49A 3PPAA 1WR1A 2V3SA 3RULA 2LUEA 4II2B 4NPNA 2GOWA 2AWTA 4IUMB 1TTNA 3VDZA 3L0WB 4IC7B 4DHJB 2KLGA 2MWSB 4N9F4 4FULA 3JW0X 2JF5A 1V5TA 2JXXA 2I1JA 3DOWA 4ZYNA 1LM8B 2A4ZA 2DHZA 1Q0WB 1TBEA 2LXCA 2RGFA 2M17A 4WJNA 1WXSA 3RUIB 2KJ6A 4HJKA 2L0FA 1X1MA 2KMCA 3TJPA 2NPTA 4JLCA 3GOEA 2UWQA 2KDBA 1SGHA 2K8BA 4NAWA 1EF5A 2ZCBA 2CHZA 2N1WA 3OJ4B 4TUUA 5LXHA 2CR5A 3H6NA 2MBHA 2FIFA 4KDLB 2FCMA 4AJWA 4GOCA 4MH0E 1GJZA 1OTRB 1ZW7A 2GBNA 4W9CA 5DPTA 2M8SA 3UQAA 2KFKA 3D32A 4FHKA 4DDGD 2MSED 5D7GA 5CHWA 3ZDTA 2LWPA 2BKFA 1V9JA 1P9DU 1WYWB 3DPDA 4JL9A 2Z0DB 3PSEB 4IM3A 2LASA 2LXAA 1V81A 3IVFA 2KC1A 3IFWB 3ZNZB 4BOZB 3VAWA 4IW0A 4LJOB 2BPSA 4KSLC 3DBSA 2RSUA 3DVGY 1VD2A 4PS8A 1OGWA 3ENEA 3I3TB 2XBBC 4KV2A 3RYTA 1A5RA 1T0YA 2WWZA 3W1YA 2PEAA 2VRRB 2NBWB 3PLUA 2JRIB 2KWCA 3ZVVA 2C9WB 4NY0A 2LD9A 5TR5A 3ZRCA 2DYMA 4AJYB 2ZJDA 3NZSA 3ONSA 4F8CB 2ZPNA 3SD5A 2N7EA 3A4SC 2KMAA 4KZCA 5IA7A 1J8CA 2PPHA 4GDKB 3O65B 4ZRJA 5CTRC 3ZRFA 1YIWA 2KJHB 1S3SG 3VTWA 1LXDA 2XK5B 5KHOA 3VVWB 3H9DA 4MJSB 3WA0A 3ZNGC 4M8NA 2BKRB 3N30A 4NJ7A 3VXWA 3L16A 3RT3B 3AU5A 3W1SA 3TL5A 4B6WA 4BOSC 2JY6A 3KW5B 3KH0A 4BVUC 1R4MI 2K6QA 4AWJA 2W9NA 1WF9A 2AL6A 1WGYA 2L00B 4K81A 4TV3A 2M4NA 2O2VB 2MP2B 4E74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGB B;  3TCA A;  4HK2 A;  1S1Q B;  4GIV A;  2KC2 A;  2IO2 B;  1E8Y A;  4WJQ A;  2FUH B;  3SDL C;  1EUV B;  2WDT B;  4BKT A;  2ZPY A;  3V6E B;  3VTV A;  2BYE A;  3A9K B;  3H7P B;  1WR6 E;  2L7R A;  4GDL B;  5C23 A;  4KIK A;  3L54 A;  1V80 A;  2M1M A;  4GN1 A;  4RMA A;  4G3X B;  4ICU A;  3VUW A;  2MW5 A;  3PS6 A;  3T9L A;  1WJN A;  1M94 A;  2KTF A;  3H7S A;  1OQY A;  2CKH B;  2XEW A;  3Q3F A;  2KTR B;  1XQQ A;  4G11 A;  3WAL A;  2I1K A;  3HHM A;  2KLC A;  4DHZ B;  4EZL A;  3U7D A;  3W1S C;  3A9J B;  2K6D B;  5DPR A;  3EEC A;  3MTN B;  3QJZ A;  4PS7 A;  1V6E A;  1UH6 A;  2G45 B;  2G3Q B;  2ZNV B;  4MDK E;  4BBN F;  2J0M A;  3PGE A;  1J0G A;  5JHB A;  2K39 A;  1WXM A;  2AYO B;  2KWU B;  4GDK A;  3WAM A;  5L95 C;  3KUZ A;  4FLH A;  5HKH A;  2HE7 A;  2DZJ A;  3HK0 A;  2V4L A;  3ZDM C;  2BYF A;  3QC8 B;  3L10 B;  5AZG A;  2N9P C;  3R66 C;  4MGZ E;  3VH3 B;  4EEW A;  2WYQ A;  2K8C A;  1WM3 A;  1WX9 A;  2BF8 B;  4F7Z A;  3Q3J A;  4NNJ B;  3UIP B;  1IYF A;  1U4A A;  3U30 A;  1E7V A;  1UD7 A;  2C7N B;  2O2V A;  2YLM A;  2MP2 A;  4HWI B;  4MGY E;  1NI2 A;  2JWZ A;  4G0N B;  5G55 A;  2KDI A;  3PLV A;  4CYE A;  3APC A;  3IBE A;  1F9J A;  2JT4 B;  4WWO A;  2M0X A;  2MA9 B;  4BKS A;  2KD0 A;  3ZKJ C;  3A9K A;  4WQO B;  5AEK B;  4URK A;  2YVC A;  2Z0E B;  2DZK A;  3KVF B;  1MG8 A;  1WJU A;  2BWF A;  4YL8 A;  2N9E B;  5E6P A;  3AXC A;  2IY0 B;  4K7U A;  3ZW3 A;  2GBR A;  1WZ3 A;  1WX7 A;  2NVU I;  2OJR A;  2RPQ A;  2MX2 A;  4W9D A;  3EHV A;  1WM2 A;  2J0K A;  3V60 A;  4IWO A;  1RFA A;  5J17 A;  4W9G A;  1IPG A;  4W9H A;  3RZW C;  4K7W A;  3A1Q A;  1UZX B;  4XZ4 A;  3UIN B;  2ZVO A;  3RD2 A;  2N4F A;  1EF1 A;  2B3A A;  2O6V D;  4P7I A;  3X23 A;  3ZNH B;  2UYZ B;  1LQB A;  3PRM B;  4EZJ A;  4HCN B;  3PRP B;  4A20 A;  3WAN A;  2PE6 B;  2BGF A;  1V86 A;  2LVQ A;  2V1Y A;  5JH5 C;  4GB9 A;  2K8H A;  4EKU A;  1GG3 A;  2ZVN A;  3A33 B;  3JSV B;  2D07 B;  4A3O A;  2KXJ A;  1UBI A;  1GC6 A;  1WMH B;  2D2Q A;  1ISN A;  4OVU A;  1YD8 U;  2KNB A;  4MM3 A;  2O6V A;  4GSW A;  2DZM A;  2QHO A;  2KJR A;  1P3Q U;  3B08 A;  3N3K B;  2JRH A;  4XX5 A;  3T8M A;  2MBB B;  4B95 A;  1WGR A;  4DDI D;  1OEY A;  1E90 A;  1YJ1 A;  1OEY J;  4G50 A;  4ANX A;  4DWF A;  3ZTC A;  4F1S A;  3ML9 A;  3IG3 A;  5D94 A;  3TBL D;  1H8C A;  3ZUN A;  4KDI C;  2C60 A;  2D11 A;  2ASQ A;  4FBJ B;  3WAO A;  1E8Z A;  2NS5 A;  1UBQ A;  4IM2 A;  4FHJ A;  2DAJ A;  2KOX A;  4FJY A;  3R7Q A;  1C1Y B;  3JYU A;  4DXA B;  3MJW A;  4ANW A;  1D3Z A;  2ZNV C;  3APD A;  3DBR I;  3QWZ B;  4MSM B;  3JVZ X;  1TGZ B;  2KAN A;  4PYU A;  3AUL A;  3VFK A;  2JPH A;  2FNJ B;  3B1L X;  4HCP B;  4MGI E;  3VUX A;  5JHA A;  1GUA B;  1SE9 A;  3DVG X;  2FCQ A;  2KK8 A;  5FR6 A;  4HLE A;  4I6L B;  2IO0 B;  3P2B A;  5G2N A;  2PJH A;  2MBE A;  4B9K A;  1K8R B;  4WJP A;  3PRZ A;  5E6N A;  1GNU A;  3PVL A;  1P98 A;  4ZRK A;  2N1V A;  3H1U A;  4ZDV A;  3DVN U;  4DBG A;  3M95 A;  1V2Y A;  3V62 A;  3NS8 A;  2DX5 B;  3APF A;  2GBK A;  4JQW C;  4LDT D;  3TIX A;  3TMP B;  4M8M A;  1L7Y A;  1Q1O A;  1NBF C;  4W9E A;  1WY8 A;  1RAX A;  1XT9 B;  5D6J B;  3X0W A;  3L13 A;  4E3C A;  5DPW A;  2MCN B;  4NQK E;  2L05 A;  2CHX A;  3UQB A;  1G6J A;  1E8W A;  3PT2 B;  4M0W B;  3U8Z A;  2LJ5 A;  4HPL B;  2IO1 B;  4DK5 A;  5E6O A;  3ZNI D;  2FAZ A;  1ZGU B;  2IYD B;  1QZE A;  4WWP A;  3QA8 A;  5IAA C;  3PHW B;  2NBV B;  1TZ1 A;  5J18 A;  1RRB A;  3ZLZ A;  2K1F A;  3DDC B;  3PZD A;  4TKN A;  3ZO5 B;  3ML8 A;  2NBU A;  5LLI A;  4NAW B;  4K7S A;  2AEH A;  1WI0 A;  2AL3 A;  2LGX A;  3L08 A;  2EKE C;  2XK5 A;  3N32 A;  4I6P A;  4JIO U;  4MJS A;  1CMX B;  2KDF B;  1WRD B;  4WAA A;  2FCS A;  4HVB A;  1YQB A;  2G4D B;  2L76 A;  3M63 B;  2R2Q A;  2MBO A;  4NJ6 A;  4BKS D;  4HDO A;  4KSK C;  4NQL B;  3WAP A;  4RM8 A;  2KFK B;  1BT0 A;  3DCG A;  3SHQ A;  1WXV A;  1E8X A;  2NCN A;  4BKG A;  4EOY A;  1Z2M A;  2GMI C;  4WJO A;  3KYD D;  4X57 B;  2HD5 B;  3A4R A;  3R7R A;  3S2A A;  3KUC B;  1P1A A;  1WGD A;  5JZE B;  2KN5 A;  2ZZP B;  3MHS D;  1C3T A;  2OOB B;  4I6N B;  1I35 A;  2Y5B B;  3L17 A;  2R2O A;  3QAR A;  3PTF C;  3H7P A;  3VUY A;  3QQ8 B;  3EFU A;  4GDL A;  4FJZ A;  5J2R A;  3K9P B;  2N9X A;  1AAR A;  4HDQ A;  2KX3 A;  3B0A A;  2KQ7 A;  2LI5 A;  3DVN V;  4ICV A;  5DCN A;  2K25 A;  4AP4 C;  2GBJ A;  2KDE B;  4KVG B;  3QK0 A;  4LCD E;  5BO4 B;  2IY1 B;  1WE7 A;  1XD3 B;  2BYV E;  2KX0 A;  1WJ4 A;  4BFR A;  2KTR A;  4W9I A;  3VH4 B;  4HPM B;  2LVO A;  2HTH A;  2LRW A;  2WX1 A;  2HJ8 A;  2KHW B;  4EUT A;  1UEL A;  1IP9 A;  2LRU A;  3A9J A;  4W9K A;  4II3 B;  1E7U A;  3QX1 A;  2KZR A;  1ZKH A;  2MQJ A;  3LDZ E;  4E71 A;  3QIJ A;  1R4N I;  2JVC A;  3CMM B;  3VHT C;  4XC2 A;  4OVV A;  3NY5 A;  1YX6 B;  4DHJ D;  2WX0 A;  3RCZ A;  1WX8 A;  4BBN C;  4TQ0 A;  4IM0 A;  1GC7 A;  5CHV C;  5L83 A;  2MBQ A;  2CHW A;  1HE8 A;  5C1Z A;  2A5U A;  3NZU A;  2BWE S;  3K9O B;  4IG7 B;  1KJT A;  1WZ0 A;  4KZ0 A;  4PYZ A;  1NDD A;  2KO3 A;  1JRU A;  4K1R B;  5DPS A;  3ZTD A;  2D10 A;  3M3J A;  2L8J A;  1WXA A;  4KIK B;  2EMT A;  4PS3 A;  4AUQ C;  3KYC D;  3AI5 A;  3IHP C;  3V6C B;  3HM3 A;  3ZIM A;  4CO7 A;  5D2M B;  1WJ6 A;  2CS4 A;  4IWP A;  1WE6 A;  1WGH A;  1L2N A;  4MEM A;  3VQI A;  2LVP A;  1V5O A;  4LJP B;  2RD0 A;  5GMV A;  1WH3 A;  3HIZ A;  3OAW A;  4EZK A;  4W9L A;  4ZRI A;  4WWN A;  2ZEQ A;  3PHX B;  4RM9 A;  2JUO A;  2JZZ A;  2C5L C;  1J19 A;  2JZ3 B;  3QHT A;  5CHF A;  3M62 B;  4LDT B;  2N7D A;  5AZH A;  2D3G A;  2MLB A;  3HM6 X;  2L0T A;  1I42 A;  3KUD B;  4DHZ E;  2LGD A;  1SIF A;  3CSF A;  3NHE B;  1H4R A;  4CHK A;  2C7M B;  3BIN A;  3OLM D;  5KHQ A;  2REX A;  3CST A;  3OJ3 A;  5EDS A;  4IWQ A;  1P0R A;  2CU1 A;  2PE9 A;  1KM7 A;  2J7Q B;  1PQS A;  3JSV A;  5AZF A;  3WIM A;  2KWV B;  1E5W A;  2G4S A;  1EO6 A;  2KQS A;  3R3M A;  1WMH A;  3RZF A;  4GGQ A;  1VCB A;  4GXB A;  1UGM A;  3C0R B;  4W9J A;  1Z5S B;  4GMV A;  2FID A;  3DQV A;  4ASW C;  3DBH I;  4HXD A;  1KLV A;  2C7H A;  3ALB A;  4EFO A;  3V61 A;  2NPT B;  3ECI A;  3UF8 A;  1Y8R C;  3EC8 A;  2DEN B;  4W9F A;  1KOT A;  4GU2 A;  1WFY A;  2L3Z A;  3QCA A;  1Q5W B;  2DYB A;  5CX3 A;  3LJ3 A;  5LXI B;  3UIO B;  2KVR A;  3A1Q B;  3NOB A;  2KFJ A;  3AU4 A;  3PRE A;  3QAQ A;  2GBM A;  4MSQ B;  3DBL I;  3BY4 B;  2DYO A;  2IZV B;  2NR2 A;  1WIA A;  2ZCC A;  4AOF A;  2IBI B;  2RR9 A;  4FA6 A;  4TQ1 A;  1WGG A;  4ANU A;  2KKC A;  2Z59 B;  4FAD A;  4FJV B;  4J6I A;  3GZN I;  4MGK E;  1LFD A;  2LGY A;  2FCN A;  2MRP A;  2J0J A;  3SU8 X;  1FXT B;  4JGH B;  4FN2 A;  3VTU A;  4ANV A;  2EMS A;  4A3P A;  3CF6 E;  2DZI A;  1YX5 B;  1RLF A;  4MEL A;  2IO3 B;  2DAF A;  2LZ6 A;  3PV1 A;  2O6V B;  1V49 A;  3PPA A;  1WR1 A;  2V3S A;  3RUL A;  2LUE A;  4II2 B;  4NPN A;  2GOW A;  2AWT A;  4IUM B;  1TTN A;  3VDZ A;  3L0W B;  4IC7 B;  4DHJ B;  2KLG A;  2MWS B;  4N9F 4;  4FUL A;  3JW0 X;  2JF5 A;  1V5T A;  2JXX A;  2I1J A;  3DOW A;  4ZYN A;  1LM8 B;  2A4Z A;  2DHZ A;  1Q0W B;  1TBE A;  2LXC A;  2RGF A;  2M17 A;  4WJN A;  1WXS A;  3RUI B;  2KJ6 A;  4HJK A;  2L0F A;  1X1M A;  2KMC A;  3TJP A;  2NPT A;  4JLC A;  3GOE A;  2UWQ A;  2KDB A;  1SGH A;  2K8B A;  4NAW A;  1EF5 A;  2ZCB A;  2CHZ A;  2N1W A;  3OJ4 B;  4TUU A;  5LXH A;  2CR5 A;  3H6N A;  2MBH A;  2FIF A;  4KDL B;  2FCM A;  4AJW A;  4GOC A;  4MH0 E;  1GJZ A;  1OTR B;  1ZW7 A;  2GBN A;  4W9C A;  5DPT A;  2M8S A;  3UQA A;  2KFK A;  3D32 A;  4FHK A;  4DDG D;  2MSE D;  5D7G A;  5CHW A;  3ZDT A;  2LWP A;  2BKF A;  1V9J A;  1P9D U;  1WYW B;  3DPD A;  4JL9 A;  2Z0D B;  3PSE B;  4IM3 A;  2LAS A;  2LXA A;  1V81 A;  3IVF A;  2KC1 A;  3IFW B;  3ZNZ B;  4BOZ B;  3VAW A;  4IW0 A;  4LJO B;  2BPS A;  4KSL C;  3DBS A;  2RSU A;  3DVG Y;  1VD2 A;  4PS8 A;  1OGW A;  3ENE A;  3I3T B;  2XBB C;  4KV2 A;  3RYT A;  1A5R A;  1T0Y A;  2WWZ A;  3W1Y A;  2PEA A;  2VRR B;  2NBW B;  3PLU A;  2JRI B;  2KWC A;  3ZVV A;  2C9W B;  4NY0 A;  2LD9 A;  5TR5 A;  3ZRC A;  2DYM A;  4AJY B;  2ZJD A;  3NZS A;  3ONS A;  4F8C B;  2ZPN A;  3SD5 A;  2N7E A;  3A4S C;  2KMA A;  4KZC A;  5IA7 A;  1J8C A;  2PPH A;  4GDK B;  3O65 B;  4ZRJ A;  5CTR C;  3ZRF A;  1YIW A;  2KJH B;  1S3S G;  3VTW A;  1LXD A;  2XK5 B;  5KHO A;  3VVW B;  3H9D A;  4MJS B;  3WA0 A;  3ZNG C;  4M8N A;  2BKR B;  3N30 A;  4NJ7 A;  3VXW A;  3L16 A;  3RT3 B;  3AU5 A;  3W1S A;  3TL5 A;  4B6W A;  4BOS C;  2JY6 A;  3KW5 B;  3KH0 A;  4BVU C;  1R4M I;  2K6Q A;  4AWJ A;  2W9N A;  1WF9 A;  2AL6 A;  1WGY A;  2L00 B;  4K81 A;  4TV3 A;  2M4N A;  2O2V B;  2MP2 B;  4E74 A; 
#chains in the Genus database with same CATH topology
 1S1Q B;  2AQ3 B;  4WJQ A;  2FUH B;  3SDL C;  1GB1 A;  2WDT B;  4BKT A;  2V3P A;  3IXS A;  2L7R A;  2ZW1 A;  3I5J C;  4IKG A;  3BII D;  5FK9 C;  4D2K A;  4ICU A;  3VUW A;  3ZJT A;  1M94 A;  4NZL B;  1EU3 A;  3Q3F A;  1FEH A;  2KTR B;  3WAL A;  3HHM A;  4DHZ B;  1DGJ A;  3QJZ A;  1SE4 A;  3E9S A;  1NYR A;  3TEY A;  2ZNV B;  4BBN F;  3PGE A;  1J0G A;  2QJL A;  2HE7 A;  3HK0 A;  4YTM B;  3L10 B;  5AZG A;  2N9P C;  4EEW A;  4F7Z A;  1QT9 A;  3Q3J A;  2N7J A;  2O2V A;  2YLM A;  2MP2 A;  1NI2 A;  4CYE A;  1F9J A;  2H89 B;  1N62 A;  4LLG M;  4WWO A;  3P1M A;  3ZGZ A;  3ZKJ C;  5AEK B;  1N6Z A;  2YVC A;  2Z0E B;  2DZK A;  3KVF B;  3SFD B;  4ZHO A;  2WU5 B;  3ZW3 A;  2RPQ A;  2MJ3 A;  4P1B C;  2J0K A;  3V60 A;  4W9H A;  3Q8F A;  2EKI A;  2ONQ A;  3RD2 A;  1EF1 A;  2ACZ B;  2KVZ A;  3ZQ4 A;  2BGF A;  4RGO S;  3GP7 A;  2N9K A;  4GB9 A;  2OHF A;  2ZVN A;  1C4C A;  1R4M B;  2L32 A;  1FCC C;  2KNB A;  2E6X A;  4GSW A;  1E0Z A;  2DZM A;  2QHO A;  4MAC A;  2KJR A;  3SEB A;  4KGS A;  1MI0 A;  3N3K B;  2MBB B;  1MFW A;  2BS4 B;  1E90 A;  1Q10 A;  1YJ1 A;  4G50 A;  3ZTC A;  4YTN B;  3TBL D;  5D94 A;  3ZUN A;  3R8B A;  2C60 A;  4USA A;  1XXG A;  4FHJ A;  2DAJ A;  2KOX A;  3N20 C;  3R7Q A;  3JYU A;  3MJW A;  1D3Z A;  4OZA A;  1TGZ B;  2KAN A;  3AUL A;  2JPH A;  1QOF A;  2FNJ B;  2M56 B;  1JW9 D;  5JHA A;  1SE9 A;  1ZE3 D;  2FCQ A;  2WXJ A;  4I6L B;  3GS2 A;  4WJP A;  5E6N A;  4REZ A;  4ZRK A;  4DBG A;  3AE4 B;  2DX5 B;  4JQW C;  1Q1O A;  2FUG 1;  1KLU D;  1XT9 B;  1T0R C;  4NQK E;  2CHX A;  1G6J A;  1EWY C;  1E8W A;  4M0W B;  2NTS A;  3U8Z A;  3AE3 B;  3AN1 A;  4WWP A;  2NBV B;  1TZ1 A;  5J18 A;  3Q3M C;  3ZO5 B;  5LLI A;  4K7S A;  1JWA D;  1WI0 A;  2AL3 A;  3L08 A;  2LMC A;  4MJS A;  2KDF B;  4HVB A;  4XE0 A;  2G4D B;  4BKS D;  3M63 B;  2R2Q A;  2MBO A;  1K52 A;  2PVG C;  1BT0 A;  3DCG A;  4X57 B;  3ZYY X;  2ZZP B;  3MHS D;  1C3T A;  4I6N B;  3C8Y A;  2R2O A;  3PTF C;  2G1E A;  3QQ8 B;  5J2R A;  3DVN V;  1TIF A;  2KX0 A;  4M0W A;  1EM7 A;  4IDI A;  4P6V F;  1UEL A;  4W9K A;  5AUK A;  1E7U A;  1MG4 A;  2I38 A;  2KZR A;  1ZKH A;  1EWC A;  2GI9 A;  3VHT C;  4XC2 A;  2CU3 A;  1DOI A;  2WX0 A;  3RCZ A;  1WX8 A;  4L23 A;  1GAQ B;  1OFF A;  3DBR B;  4AS1 A;  3NZU A;  2BWE S;  3K9O B;  1UNS A;  2AQ1 B;  5DPS A;  1AW7 A;  4KIK B;  4PS3 A;  3EA6 A;  1ENF A;  3ZIM A;  2CS4 A;  3UI3 A;  4KX6 B;  2KYW A;  3VRA B;  1CK1 A;  4CQN A;  2RD0 A;  3NVV A;  5BMH A;  2JUO A;  1E7P B;  1WYG A;  2N7D A;  3HM6 X;  2GB1 A;  2WXG A;  1TY2 A;  4DHZ E;  2QEJ C;  1HZ6 A;  1H4R A;  2INN E;  2V3N A;  4AQ7 A;  3BIN A;  2LEK A;  5EDS A;  2J7Q B;  1PQS A;  1ZOY B;  1HZ5 A;  4GGQ A;  2WDR B;  4W9J A;  1SE2 A;  2PVO D;  3GE3 C;  1TKY A;  2BTE A;  4HXD A;  4EFO A;  2N0S B;  2IPK D;  2NPT B;  1MPE A;  1JML A;  1PGB A;  1MJD A;  1Q5W B;  2DYB A;  5CX3 A;  1TJE A;  1P7E A;  1FM0 D;  3BY4 B;  1TS5 A;  2DYO A;  2NR2 A;  1SE3 A;  1WIA A;  2RR9 A;  4TQ1 A;  1FXI A;  1UUP A;  3LB8 C;  1R4N B;  2FCN A;  4JGH B;  1XO3 A;  4B0M A;  1L6U A;  1YX5 B;  4MEL A;  2IO3 B;  3N9Y C;  2JYT A;  3ZJV A;  2LZ6 A;  4WH4 A;  2O6V B;  1FNW A;  3IAM 1;  2GOW A;  4IUM B;  1R7S A;  4C4V B;  1J7B A;  1YNT E;  3VDZ A;  3L0W B;  3EUB 2;  2JYE A;  4FUL A;  3NG0 A;  2JXX A;  1LO5 D;  4WUR A;  2LXC A;  1SEB D;  2M17 A;  1EU4 A;  2LGS A;  2KJ6 A;  2L0F A;  2NPT A;  4JLC A;  1TKG A;  3GOE A;  3TEW A;  2KDB A;  4NAW A;  3NUH B;  3SFE B;  3OJ4 B;  4KGR A;  3H6N A;  4LNO A;  4GOC A;  1GJZ A;  3UQA A;  3BYT B;  3Q14 C;  4DDG D;  4XDC A;  2MSE D;  3LYY A;  3U4E G;  1P9D U;  1WYW B;  3DPD A;  1F2R C;  2Z0D B;  2ICI A;  4BOZ B;  2JXT A;  3AEE B;  2BPS A;  1SB3 C;  2IDY A;  1OGW A;  1JWU D;  1BUI C;  3W1Y A;  5EE1 A;  2VRR B;  2W54 A;  5TR5 A;  5EE9 A;  4O1N A;  3DBH B;  1L6V A;  1YQ4 B;  3J9C A;  2DLB A;  4GDK B;  1YIW A;  1LXD A;  2XK5 B;  3H9D A;  3GB1 A;  4M8N A;  1JWM D;  3DWM A;  3ETR A;  3L16 A;  3RT3 B;  3AU5 A;  1R4M I;  3R2T A;  1T0Q C;  2V0G A;  3VH4 B;  3BWU D;  2RDG A;  3TCA A;  2QC8 A;  2KC2 A;  3GZN B;  5T8I A;  2PIA A;  3I57 A;  3VTV A;  2BYE A;  3H7P B;  1STE A;  3VRB B;  5C23 A;  1V80 A;  4G3X B;  1JAL A;  5BYQ A;  3H7S A;  1OQY A;  2BVC A;  2CKH B;  4G11 A;  3L4P A;  3A9J B;  2K6D B;  5DPR A;  2INC C;  1UH6 A;  2G45 B;  5IOI A;  2G3Q B;  1MVK A;  2J0M A;  1MHX A;  1QQR A;  2K39 A;  4GDK A;  2WXK A;  4C80 A;  3VH3 B;  2KT7 A;  3RI7 C;  1WM3 A;  1WX9 A;  1IYF A;  4NNJ B;  3UIP B;  1U4A A;  2DWQ A;  2C7N B;  1F52 A;  1TKE A;  4G0N B;  5G55 A;  3RNG C;  3APC A;  4HKQ A;  1QOG A;  1T6B X;  3LXF A;  5BMI A;  4YL8 A;  2N9E B;  3AXC A;  3DWG C;  4K7U A;  3N1Z C;  2NVU I;  2OJR A;  2R61 A;  3EHV A;  2AQ2 B;  4W9G A;  4K7W A;  3A1Q A;  2N4F A;  2B3A A;  2K22 A;  1K50 A;  1SSN A;  3BVG A;  4P7I A;  3WCQ A;  3ZNH B;  4EZJ A;  3RFZ B;  3BZD B;  4HCN B;  3PRP B;  1RM6 C;  3AM9 A;  3WAN A;  1V86 A;  2V1Y A;  3JSV B;  1YN4 A;  3AMZ A;  1GC6 A;  1ACC A;  2D2Q A;  4OVU A;  1WGK A;  1RYJ A;  2KQ4 X;  2CJN A;  1N63 A;  2BB6 A;  3B08 A;  1E10 A;  4DDI D;  3RPF C;  1OEY A;  3IT6 B;  1MHH E;  1QF6 A;  3ML9 A;  4ARC A;  4US9 A;  2BB5 A;  2D11 A;  2ASQ A;  4FBJ B;  1FO4 A;  3ZXR A;  2NS5 A;  1CQV A;  4FJY A;  3DBR I;  5HG2 A;  3QWZ B;  4PYU A;  3U7Z A;  4XWW A;  4HCP B;  3AED B;  3VR9 B;  3DVG X;  2KK8 A;  4J3O D;  4HLE A;  2WLB A;  1E9M A;  1GNU A;  1DOX A;  3H1U A;  2AX5 A;  3M95 A;  3TIX A;  4LDT D;  3TMP B;  2JSV X;  4W9E A;  1RAX A;  3X0W A;  4E3C A;  1J7A A;  1WRI A;  2NTT A;  2IO1 B;  4C7Y A;  5E6O A;  3ZNI D;  1XLQ A;  2L83 A;  3QA8 A;  3PHW B;  2YEP F;  3BK1 A;  2MJE A;  1N5X A;  1RRB A;  3ZLZ A;  2KN4 A;  2K1F A;  1C4A A;  3ML8 A;  1P7F A;  2QMT A;  2AEH A;  1FMA D;  2WXO A;  3N32 A;  1L5P A;  1CMX B;  1YQB A;  2L76 A;  4M01 A;  2KFK B;  1WXV A;  2NCN A;  2GMI C;  3KYD D;  3R7R A;  3A4R A;  3B9J A;  3KUC B;  1WGD A;  5JZE B;  3VR8 B;  2Y5B B;  2W3S A;  4OW0 A;  1ZXI A;  1ESF A;  3HUI A;  1ZUD 2;  2N9X A;  1AAR A;  2KX3 A;  2LI5 A;  5HFY A;  4ICV A;  3V05 A;  2K25 A;  1XLP A;  2BBC A;  4KVG B;  1J7C A;  3QK0 A;  1XLN A;  4LCD E;  1WE7 A;  2J53 A;  1HQR D;  1WJ4 A;  4BFR A;  2KTR A;  2GLS A;  4LTU A;  2LVO A;  2WX1 A;  2KHW B;  1PDX A;  4OHJ A;  1R4N I;  3E56 A;  1YX6 B;  2WDQ B;  5CHV C;  2MBQ A;  2CHW A;  1ZXH A;  5C1Z A;  2LJI A;  4IG7 B;  1KJT A;  1KLG D;  5FR3 A;  1I4Q A;  1PGX A;  3AE8 B;  2D10 A;  2L8J A;  1V8C A;  3AE7 B;  3BVM A;  3AI5 A;  3V6C B;  2N9L A;  3HVZ A;  3TEZ A;  5D2M B;  1WJ6 A;  1ZPS A;  4IWP A;  4HRO A;  3VQI A;  1OQQ A;  2WHI A;  1QOA A;  3AEB B;  4W9L A;  4ZRI A;  4A55 A;  4RM9 A;  2YEP B;  2C5L C;  2JZ3 B;  1C78 A;  4JWS C;  3M62 B;  4LDT B;  2KDM A;  1C79 A;  1ROE A;  5EE3 A;  4LNF A;  3AEG B;  1LGR A;  2JWU A;  3KUD B;  2LGD A;  4OVZ A;  2J4X A;  3NHE B;  1HXY D;  3OLM D;  3KWL A;  5KHQ A;  3Q69 A;  1V97 A;  3CST A;  4IWQ A;  2PE9 A;  1KM7 A;  2G4S A;  3R3M A;  5D3D A;  3C0R B;  1Z5S B;  4GMV A;  2FID A;  4LNN A;  3DBH I;  3ALB A;  5FKA C;  2L1A A;  4WWM A;  3ECI A;  3EC8 A;  1KOT A;  1ZP0 B;  4ZYS A;  3LJ3 A;  1V1O A;  1YN5 A;  1E6E B;  3KWV A;  4MT5 A;  3OWE B;  4FA6 A;  3N1X C;  2Z59 B;  4FAD A;  3GZN I;  1PYW D;  4ZRQ A;  1ET9 A;  4ANV A;  1VLB A;  4MM3 B;  5HI1 A;  4XDD A;  1V49 A;  1KF6 B;  4YSY B;  4M00 A;  4II2 B;  4NPN A;  3N1Y C;  1NEN B;  1UF0 A;  2M19 A;  2AWT A;  1WSP A;  1KFY B;  1TTN A;  2MWS B;  1FD6 A;  2RDH A;  3JW0 X;  2WXF A;  1BML C;  3ZXV A;  1LM8 B;  3HRD D;  4L1B A;  4XYC A;  2UWQ A;  4LK0 M;  2CHZ A;  3P4R B;  1IUE A;  2JQR B;  3T3O A;  5H8Y E;  1GPX A;  1ZW7 A;  4W9C A;  2M8S A;  4FHK A;  3AEC B;  4OZC A;  5D7G A;  2BKF A;  1V9J A;  2ZW0 A;  1SBB B;  3FIL B;  3PSE B;  3IVF A;  3IFW B;  1XEE A;  3VAW A;  3BK2 A;  1L0V B;  3FC4 A;  2LFI A;  2RSU A;  3DVG Y;  2XBB C;  2IJ0 A;  1VR9 A;  2XNA C;  2G9H D;  4DXG A;  2WWZ A;  3NVZ A;  4ITK A;  4N59 A;  4DXF A;  2JRI B;  3URY A;  4TSS A;  3ZRC A;  4AJY B;  3ONS A;  4ZRP A;  2ZPN A;  3SD5 A;  5IA7 A;  1J8C A;  2PPH A;  4YSX B;  3O65 B;  5CTR C;  3VTW A;  3VVW B;  2B76 B;  3N30 A;  1L4Z B;  4N6E B;  4BOS C;  3KW5 B;  3DBL B;  4AWJ A;  2AL6 A;  1WGY A;  2L00 B;  2V4I B;  3SR6 A;  2JX5 A;  4E74 A;  3UGB B;  4HK2 A;  2WS3 B;  3MC9 A;  2IGH A;  4ACF A;  2LHE A;  3A9K B;  4GDL B;  1XF5 L;  2D3A A;  4KIK A;  1PFD A;  3L54 A;  2M1M A;  3FKY A;  4RMA A;  1VDV A;  1N60 A;  3PS6 A;  2INP E;  1QLB B;  2KTF A;  1GOZ A;  1UGJ A;  2XEW A;  1XQQ A;  2I1K A;  1YOV B;  2KLC A;  3U7D A;  3W1S C;  1I4X A;  3MTN B;  4PS7 A;  2D5G A;  4A9A A;  3Q3N C;  1GB4 A;  4FLH A;  5HKH A;  3MFG A;  1KRH A;  2V4L A;  3MP9 A;  2BYF A;  4HEA 1;  1FXA A;  3QC8 B;  3ZDM C;  1IBX B;  3R66 C;  3O13 A;  4MGZ E;  2K8C A;  1HTQ A;  3U30 A;  3NVW A;  1E7V A;  1UD7 A;  2PTL A;  4HWI B;  2WNM A;  4MGY E;  2JWZ A;  2KDI A;  3PLV A;  2VH1 A;  1QKZ A;  2NMQ A;  3P4P B;  2M0X A;  4BKS A;  1FFV A;  2KD0 A;  3A9K A;  4WQO B;  3IT4 B;  4URK A;  2BWF A;  4KKI A;  5E6P A;  2IY0 B;  2FBW B;  1WZ3 A;  1WX7 A;  1FNU A;  1YN3 A;  2LHD A;  4ZHP A;  1RFA A;  1IPG A;  1UZX B;  4JX1 C;  2RMM A;  1D4B A;  2UYZ B;  1LQB A;  1F1H A;  1JRP A;  2PE6 B;  2LVQ A;  4HJG E;  2WXL A;  2ON8 A;  4EE2 A;  1CZP A;  3A33 B;  4C00 A;  2D07 B;  1UBI A;  1WMH B;  1ISN A;  1YD8 U;  2O6V A;  2WDV B;  2K5P A;  4WAF A;  4HKZ E;  4C4V A;  2I2Y A;  2BQQ A;  4Q2J A;  4DWF A;  3IG3 A;  1I4P A;  1H8C A;  2LUM A;  4KDI C;  2Y5P A;  3RNC C;  1E8Z A;  1UBQ A;  1C1Y B;  4DXA B;  3NVY A;  4ANW A;  2WGS A;  3APD A;  2JZP A;  4MSM B;  2Q5W D;  1HEZ E;  4MGI E;  1AYF A;  3VUX A;  1GUA B;  3IAS 1;  3Q8B A;  2IO0 B;  2PJH A;  1D5X C;  1V2Y A;  3APF A;  2GBK A;  1YJI A;  1L7Y A;  1SF0 A;  4M8M A;  1RFK A;  4BZA A;  2SEB D;  1WY8 A;  3L13 A;  2L05 A;  1L0X B;  3UQB A;  3AV8 A;  3PT2 B;  2LJ5 A;  4WQM A;  1C9F A;  4DK5 A;  1F0Z A;  2FAZ A;  2L52 A;  2LGI A;  4P1C C;  1WWT A;  3MC0 B;  3PZD A;  3CWI A;  2NBU A;  2EKE C;  2XK5 A;  4I6P A;  1AWD A;  4WAA A;  2FCS A;  3AE5 B;  4KSK C;  3WAP A;  1F2R I;  1E8X A;  4BKG A;  5IP4 D;  2WXI A;  4WJO A;  1K51 A;  1NYQ A;  1P1A A;  2KN5 A;  2OOB B;  1I35 A;  3L17 A;  2WP9 B;  3QAR A;  3H7P A;  4FJZ A;  3K9P B;  3B0A A;  4A6Q A;  2KMM A;  4AP4 C;  2GBJ A;  2KDE B;  2K3U A;  2TSS A;  5BO4 B;  1XD3 B;  2XN9 C;  3EFC A;  4W9I A;  1XCQ L;  2PMV A;  3DHG C;  2HTH A;  2LRW A;  4RCO A;  4EUT A;  1IP9 A;  2LRU A;  3A9J A;  3QX1 A;  2MQJ A;  3LDZ E;  2BYT A;  3QIJ A;  2JVC A;  3CMM B;  2KWD A;  3C19 A;  4DHJ D;  4TQ0 A;  1SJH D;  5L83 A;  4US8 A;  1HE8 A;  1NEK B;  1WZ0 A;  3B2G A;  4KZ0 A;  4PYZ A;  2Y3A A;  2KO3 A;  1L4D B;  3W9C B;  4K1R B;  3ZTD A;  4RGN A;  4YWG G;  4AUQ C;  2PKO A;  3KYC D;  4MH8 A;  3HM3 A;  3P42 A;  4CO7 A;  1SJE D;  1A70 A;  3EGR A;  3B2F A;  1CJE A;  4K3B A;  1WE6 A;  1WGH A;  1L2N A;  4LJP B;  5GMV A;  3HIZ A;  4WWN A;  2ZEQ A;  3HVD A;  2JZZ A;  5AZH A;  2D3G A;  5BYR A;  2MLB A;  2FE8 A;  4LNI A;  3CSF A;  4PK1 A;  1FFU A;  2REX A;  3OJ3 A;  1P0R A;  3JSV A;  5AZF A;  2KWV B;  1E5W A;  2KQS A;  1EO6 A;  3NZ3 A;  3RZF A;  2Y5C A;  5D3I B;  1VCB A;  4GXB A;  3H8H A;  3DQV A;  4ASW C;  3AEF B;  1KLV A;  2C7H A;  3V61 A;  3Q2A C;  3UF8 A;  1Y8R C;  2DEN B;  4H2A A;  1WFY A;  3QCA A;  1XLO A;  5LXI B;  3AE1 B;  3UIO B;  2KVR A;  3NOB A;  3KQ4 A;  4C7Z A;  3PRE A;  3QAQ A;  3DBL I;  2IZV B;  3RN9 C;  2ZCC A;  4FXC A;  2IBI B;  1PUT A;  2X38 A;  3AH7 A;  1WGG A;  4MGK E;  1JWB D;  2GRI A;  1LFD A;  2MRP A;  1FXT B;  2RDB C;  3VTU A;  3AE2 B;  3CF6 E;  1FRD A;  1TY0 A;  4YT0 B;  3PV1 A;  3MHZ A;  5G5H A;  4B0E A;  1WR1 A;  4L2Y A;  3RUL A;  3ZJU A;  1YQ3 B;  1NVI D;  4IC7 B;  4DHJ B;  1KH0 A;  1T5X D;  3TUO A;  2JF5 A;  1V5T A;  2I1J A;  2EEL A;  2RGF A;  4RF0 A;  3TJP A;  3BVZ A;  3KLS X;  1EF5 A;  2ZCB A;  5LXH A;  2N1W A;  2K0P A;  2CR5 A;  2KAC A;  2FIF A;  2KAJ A;  2FCM A;  4AJW A;  4MH0 E;  2MEK A;  4RGM A;  2GBN A;  5DPT A;  2MH7 A;  2KFK A;  1C4P A;  4YTP B;  2M0A A;  1JWS D;  4IM3 A;  2RPV A;  4LJO B;  4KSL C;  3DBS A;  1VRA B;  1HA5 A;  3NJT A;  3ENE A;  3I3T B;  1TS3 A;  3RYT A;  2NBW B;  3PLU A;  4NY0 A;  1I7H A;  1RWS A;  2IGD A;  4F8C B;  3NZS A;  2N7E A;  4KZC A;  2KMA A;  4ZRJ A;  4KGT A;  2KJH B;  1S3S G;  5KHO A;  2BS3 B;  3AE9 B;  4MJS B;  3MC8 A;  2BKR B;  4NJ7 A;  3W5U B;  3W1S A;  2JY6 A;  4BVU C;  2HJ1 A;  2K6Q A;  1DOY A;  2QSD A;  4K81 A;  4TV3 A;  3T3N A;  4GIV A;  1YJJ A;  2IO2 B;  1E8Y A;  1EUV B;  2ZPY A;  2H88 B;  3V6E B;  1HTO A;  3I63 C;  3PZ7 A;  4ARI A;  1WR6 E;  5JXV A;  3W2D A;  2IND C;  4GN1 A;  2MW5 A;  3T9L A;  3DHH C;  1WJN A;  2WXN A;  3Q6B A;  4EZL A;  3RNA C;  3EEC A;  1V6E A;  5AUI A;  4NJC A;  1SXT A;  4MDK E;  4N58 A;  5JHB A;  2D3C A;  3Q8C A;  4RNA A;  1WXM A;  2AYO B;  2KWU B;  3BYY B;  3WAM A;  1V1P B;  5L95 C;  3KUZ A;  2DZJ A;  5C3J B;  1L0Y B;  2WYQ A;  1B1Z A;  5I4D A;  1FIQ A;  2BF8 B;  1JCK B;  2BT6 A;  3R2I A;  4C56 C;  1FRR A;  3IBE A;  2JT4 B;  1T3Q A;  2MA9 B;  2J52 A;  4JWU C;  5G5G A;  1MG8 A;  1WJU A;  2JU6 X;  4S17 A;  2GBR A;  2PLP A;  4RGT A;  2MX2 A;  4W9D A;  1WM2 A;  4IWO A;  5J17 A;  4JPS A;  2QIL A;  3RZW C;  2VZK D;  4XZ4 A;  4KKJ A;  3UIN B;  5IKC M;  2ZVO A;  2O6V D;  3AB5 A;  2QDF A;  2V9H A;  3X23 A;  3PRM B;  3W5V B;  3V3X A;  4A20 A;  1D6E C;  5JH5 C;  2K8H A;  4EKU A;  1GG3 A;  1V1P A;  4A3O A;  4NAM A;  2KXJ A;  1D5M C;  4MM3 A;  1ET6 A;  1FCL A;  2WXQ A;  1P3Q U;  1TS2 A;  4XX5 A;  2JRH A;  3T8M A;  4B95 A;  1WGR A;  1OEY J;  4ANX A;  4F1S A;  4BAX A;  1DYQ A;  1VZ8 A;  5MPO A;  3WAO A;  3Q8A A;  4IM2 A;  1AN8 A;  1Y56 A;  2ZNV C;  3OG5 A;  3JVZ X;  3VFK A;  3B1L X;  4UDU C;  5FR6 A;  1JRO A;  3P2B A;  3U2S C;  2WU2 B;  5G2N A;  2MBE A;  4B9K A;  1K8R B;  3PRZ A;  4A90 A;  3PVL A;  3PO0 A;  1P98 A;  2K9X A;  2N1V A;  4ZDV A;  3DVN U;  3V62 A;  3NS8 A;  3FIL A;  4K3C A;  1I4H A;  1NBF C;  1UWX A;  4RFB A;  5D6J B;  1K53 A;  4QAY A;  4RF1 A;  5DPW A;  2MCN B;  3RNB C;  3TSS A;  4HPL B;  2WQY B;  1ZGU B;  2IYD B;  1QZE A;  5IAA C;  1VZ6 A;  1TYG B;  5GXG B;  3DDC B;  1IGD A;  4TKN A;  3RMK C;  4NAW B;  2W55 A;  2LGX A;  2UU7 A;  1JQ4 A;  5H92 C;  2WXH A;  4JIO U;  1WRD B;  2WXP A;  4NJ6 A;  4HDO A;  4NQL B;  4RM8 A;  3SHQ A;  4EOY A;  2D3B A;  1PGA A;  1M4V A;  1Z2M A;  3CIR B;  1XCT L;  2PW9 A;  2HD5 B;  3S2A A;  1TZO A;  1F77 A;  2VZK B;  3VUY A;  3EFU A;  4GDL A;  4OZB A;  4HDQ A;  1YMH E;  2KQ7 A;  4TMA B;  5DCN A;  2IY1 B;  3I9V 1;  4YXD B;  2BYV E;  3DHI C;  1TS4 A;  4HPM B;  5IO9 A;  4M02 A;  2HJ8 A;  1IGC A;  4II3 B;  4P16 A;  4E71 A;  4ZOH C;  4OVV A;  3NY5 A;  2HTM E;  4BBN C;  3NRZ A;  4IM0 A;  1GC7 A;  2DNF A;  2QIE B;  2A5U A;  1IBX A;  1NDD A;  3AEA B;  1FNV A;  1JRU A;  3M3J A;  2QCZ A;  1WXA A;  2EMT A;  1BXT A;  4HRS A;  3IHP C;  5BMG A;  2Z8L A;  1C77 A;  4MEM A;  2LVP A;  1V5O A;  1WH3 A;  3OAW A;  4EZK A;  3PZ8 A;  3PHX B;  2HDE A;  4A8X C;  1J19 A;  5CHF A;  3QHT A;  1I4R A;  1TT5 B;  1WXQ A;  3Q3O C;  5TSS A;  2L0T A;  1I42 A;  2VH2 A;  2W82 A;  1VZ7 A;  1SIF A;  1QIL A;  1N5W A;  4CHK A;  1OQR A;  2C7M B;  4IOI E;  3RNE C;  3GE8 C;  1VJK A;  3RNF C;  2CU1 A;  4S0R A;  3U52 E;  3WIM A;  2SAK A;  2OJW A;  5BYS A;  1WMH A;  3Q8E A;  1UGM A;  5C2T B;  4YSZ B;  2IGG A;  2E3T A;  4W9F A;  3P4S B;  4GU2 A;  2L3Z A;  3NS1 A;  1UWM A;  5LNK 1;  3P4Q B;  3A1Q B;  2KFJ A;  3AU4 A;  2GBM A;  4MSQ B;  1C76 A;  5HHD G;  4AOF A;  1D5Z C;  3MJ5 A;  4HPP A;  4ANU A;  2KKC A;  4FJV B;  4J6I A;  4JE3 B;  2LGY A;  2OED A;  5EE0 A;  2J0J A;  3SU8 X;  4FN2 A;  3AE6 B;  2W3R A;  2EMS A;  4A3P A;  2DZI A;  1RLF A;  2DAF A;  3PPA A;  2V3S A;  5E6J A;  2LUE A;  2KLG A;  1FPY A;  4N9F 4;  4WIP A;  1T0S C;  4ZYN A;  3DOW A;  2A4Z A;  2DHZ A;  1Q0W B;  1TBE A;  2J42 A;  4PT5 A;  4R3D A;  4WJN A;  1WXS A;  3RUI B;  4LNK A;  4HJK A;  1X1M A;  2KMC A;  2BS2 B;  1SGH A;  2K8B A;  3FAH A;  4TUU A;  3ABV B;  4DQO C;  3P63 A;  2WXM A;  2MBH A;  4KDL B;  4GLS C;  1KTK A;  5IN7 A;  1OTR B;  3D32 A;  4XGA B;  5CHW A;  3ZDT A;  2LWP A;  4RH6 A;  4JL9 A;  2DBY A;  1I4G A;  2MJD A;  1B9R A;  2LAS A;  2LXA A;  1V81 A;  4XWT A;  2KC1 A;  3ZNZ B;  1N61 A;  4IW0 A;  3TEX A;  1VD2 A;  4PS8 A;  4KV2 A;  1A5R A;  1T0Y A;  2PEA A;  1SIJ A;  2KWC A;  3ZVV A;  2C9W B;  1QOB A;  2LD9 A;  2X8X X;  2DYM A;  2WXR A;  1ZDX A;  2ZJD A;  3A4S C;  3ZRF A;  2BW2 A;  3WA0 A;  3ZNG C;  2MHJ A;  3VXW A;  1ZDV A;  4B6W A;  3TL5 A;  1NI3 A;  3KH0 A;  2W9N A;  1WF9 A;  2M4N A;  2O2V B;  2CJO A;  2MP2 B; 
#chains in the Genus database with same CATH homology
 3UGB B;  3TCA A;  4HK2 A;  1S1Q B;  4GIV A;  2KC2 A;  2IO2 B;  1E8Y A;  4WJQ A;  2FUH B;  3SDL C;  1EUV B;  2WDT B;  4BKT A;  2ZPY A;  3V6E B;  3VTV A;  2BYE A;  3A9K B;  3H7P B;  1WR6 E;  2L7R A;  4GDL B;  5C23 A;  4KIK A;  3L54 A;  1V80 A;  2M1M A;  4GN1 A;  4RMA A;  4G3X B;  4ICU A;  3VUW A;  2MW5 A;  3PS6 A;  3T9L A;  1WJN A;  1M94 A;  2KTF A;  3H7S A;  1OQY A;  2CKH B;  2XEW A;  3Q3F A;  2KTR B;  1XQQ A;  4G11 A;  3WAL A;  2I1K A;  3HHM A;  2KLC A;  4DHZ B;  4EZL A;  3U7D A;  3W1S C;  3A9J B;  2K6D B;  5DPR A;  3EEC A;  3MTN B;  3QJZ A;  4PS7 A;  1V6E A;  1UH6 A;  2G45 B;  2G3Q B;  2ZNV B;  4MDK E;  4BBN F;  2J0M A;  3PGE A;  1J0G A;  5JHB A;  2K39 A;  1WXM A;  2AYO B;  2KWU B;  4GDK A;  3WAM A;  5L95 C;  3KUZ A;  4FLH A;  5HKH A;  2HE7 A;  2DZJ A;  3HK0 A;  2V4L A;  3ZDM C;  2BYF A;  3QC8 B;  3L10 B;  5AZG A;  2N9P C;  3R66 C;  4MGZ E;  3VH3 B;  4EEW A;  2WYQ A;  2K8C A;  1WM3 A;  1WX9 A;  2BF8 B;  4F7Z A;  3Q3J A;  4NNJ B;  3UIP B;  1IYF A;  1U4A A;  3U30 A;  1E7V A;  1UD7 A;  2C7N B;  2O2V A;  2YLM A;  2MP2 A;  4HWI B;  4MGY E;  1NI2 A;  2JWZ A;  4G0N B;  5G55 A;  2KDI A;  3PLV A;  4CYE A;  3APC A;  3IBE A;  1F9J A;  2JT4 B;  4WWO A;  2M0X A;  2MA9 B;  4BKS A;  2KD0 A;  3ZKJ C;  3A9K A;  4WQO B;  5AEK B;  4URK A;  2YVC A;  2Z0E B;  2DZK A;  3KVF B;  1MG8 A;  1WJU A;  2BWF A;  4YL8 A;  2N9E B;  5E6P A;  3AXC A;  2IY0 B;  4K7U A;  3ZW3 A;  2GBR A;  1WZ3 A;  1WX7 A;  2NVU I;  2OJR A;  2RPQ A;  2MX2 A;  4W9D A;  3EHV A;  1WM2 A;  2J0K A;  3V60 A;  4IWO A;  1RFA A;  5J17 A;  4W9G A;  1IPG A;  4W9H A;  3RZW C;  4K7W A;  3A1Q A;  1UZX B;  4XZ4 A;  3UIN B;  2ZVO A;  3RD2 A;  2N4F A;  1EF1 A;  2B3A A;  2O6V D;  4P7I A;  3X23 A;  3ZNH B;  2UYZ B;  1LQB A;  3PRM B;  4EZJ A;  4HCN B;  3PRP B;  4A20 A;  3WAN A;  2PE6 B;  2BGF A;  1V86 A;  2LVQ A;  2V1Y A;  5JH5 C;  4GB9 A;  2K8H A;  4EKU A;  1GG3 A;  2ZVN A;  3A33 B;  3JSV B;  2D07 B;  4A3O A;  2KXJ A;  1UBI A;  1GC6 A;  1WMH B;  2D2Q A;  1ISN A;  4OVU A;  1YD8 U;  2KNB A;  4MM3 A;  2O6V A;  4GSW A;  2DZM A;  2QHO A;  2KJR A;  1P3Q U;  3B08 A;  3N3K B;  2JRH A;  4XX5 A;  3T8M A;  2MBB B;  4B95 A;  1WGR A;  4DDI D;  1OEY A;  1E90 A;  1YJ1 A;  1OEY J;  4G50 A;  4ANX A;  4DWF A;  3ZTC A;  4F1S A;  3ML9 A;  3IG3 A;  5D94 A;  3TBL D;  1H8C A;  3ZUN A;  4KDI C;  2C60 A;  2D11 A;  2ASQ A;  4FBJ B;  3WAO A;  1E8Z A;  2NS5 A;  1UBQ A;  4IM2 A;  4FHJ A;  2DAJ A;  2KOX A;  4FJY A;  3R7Q A;  1C1Y B;  3JYU A;  4DXA B;  3MJW A;  4ANW A;  1D3Z A;  2ZNV C;  3APD A;  3DBR I;  3QWZ B;  4MSM B;  3JVZ X;  1TGZ B;  2KAN A;  4PYU A;  3AUL A;  3VFK A;  2JPH A;  2FNJ B;  3B1L X;  4HCP B;  4MGI E;  3VUX A;  5JHA A;  1GUA B;  1SE9 A;  3DVG X;  2FCQ A;  2KK8 A;  5FR6 A;  4HLE A;  4I6L B;  2IO0 B;  3P2B A;  5G2N A;  2PJH A;  2MBE A;  4B9K A;  1K8R B;  4WJP A;  3PRZ A;  5E6N A;  1GNU A;  3PVL A;  1P98 A;  4ZRK A;  2N1V A;  3H1U A;  4ZDV A;  3DVN U;  4DBG A;  3M95 A;  1V2Y A;  3V62 A;  3NS8 A;  2DX5 B;  3APF A;  2GBK A;  4JQW C;  4LDT D;  3TIX A;  3TMP B;  4M8M A;  1L7Y A;  1Q1O A;  1NBF C;  4W9E A;  1WY8 A;  1RAX A;  1XT9 B;  5D6J B;  3X0W A;  3L13 A;  4E3C A;  5DPW A;  2MCN B;  4NQK E;  2L05 A;  2CHX A;  3UQB A;  1G6J A;  1E8W A;  3PT2 B;  4M0W B;  3U8Z A;  2LJ5 A;  4HPL B;  2IO1 B;  4DK5 A;  5E6O A;  3ZNI D;  2FAZ A;  1ZGU B;  2IYD B;  1QZE A;  4WWP A;  3QA8 A;  5IAA C;  3PHW B;  2NBV B;  1TZ1 A;  5J18 A;  1RRB A;  3ZLZ A;  2K1F A;  3DDC B;  3PZD A;  4TKN A;  3ZO5 B;  3ML8 A;  2NBU A;  5LLI A;  4NAW B;  4K7S A;  2AEH A;  1WI0 A;  2AL3 A;  2LGX A;  3L08 A;  2EKE C;  2XK5 A;  3N32 A;  4I6P A;  4JIO U;  4MJS A;  1CMX B;  2KDF B;  1WRD B;  4WAA A;  2FCS A;  4HVB A;  1YQB A;  2G4D B;  2L76 A;  3M63 B;  2R2Q A;  2MBO A;  4NJ6 A;  4BKS D;  4HDO A;  4KSK C;  4NQL B;  3WAP A;  4RM8 A;  2KFK B;  1BT0 A;  3DCG A;  3SHQ A;  1WXV A;  1E8X A;  2NCN A;  4BKG A;  4EOY A;  1Z2M A;  2GMI C;  4WJO A;  3KYD D;  4X57 B;  2HD5 B;  3A4R A;  3R7R A;  3S2A A;  3KUC B;  1P1A A;  1WGD A;  5JZE B;  2KN5 A;  2ZZP B;  3MHS D;  1C3T A;  2OOB B;  4I6N B;  1I35 A;  2Y5B B;  3L17 A;  2R2O A;  3QAR A;  3PTF C;  3H7P A;  3VUY A;  3QQ8 B;  3EFU A;  4GDL A;  4FJZ A;  5J2R A;  3K9P B;  2N9X A;  1AAR A;  4HDQ A;  2KX3 A;  3B0A A;  2KQ7 A;  2LI5 A;  3DVN V;  4ICV A;  5DCN A;  2K25 A;  4AP4 C;  2GBJ A;  2KDE B;  4KVG B;  3QK0 A;  4LCD E;  5BO4 B;  2IY1 B;  1WE7 A;  1XD3 B;  2BYV E;  2KX0 A;  1WJ4 A;  4BFR A;  2KTR A;  4W9I A;  3VH4 B;  4HPM B;  2LVO A;  2HTH A;  2LRW A;  2WX1 A;  2HJ8 A;  2KHW B;  4EUT A;  1UEL A;  1IP9 A;  2LRU A;  3A9J A;  4W9K A;  4II3 B;  1E7U A;  3QX1 A;  2KZR A;  1ZKH A;  2MQJ A;  3LDZ E;  4E71 A;  3QIJ A;  1R4N I;  2JVC A;  3CMM B;  3VHT C;  4XC2 A;  4OVV A;  3NY5 A;  1YX6 B;  4DHJ D;  2WX0 A;  3RCZ A;  1WX8 A;  4BBN C;  4TQ0 A;  4IM0 A;  1GC7 A;  5CHV C;  5L83 A;  2MBQ A;  2CHW A;  1HE8 A;  5C1Z A;  2A5U A;  3NZU A;  2BWE S;  3K9O B;  4IG7 B;  1KJT A;  1WZ0 A;  4KZ0 A;  4PYZ A;  1NDD A;  2KO3 A;  1JRU A;  4K1R B;  5DPS A;  3ZTD A;  2D10 A;  3M3J A;  2L8J A;  1WXA A;  4KIK B;  2EMT A;  4PS3 A;  4AUQ C;  3KYC D;  3AI5 A;  3IHP C;  3V6C B;  3HM3 A;  3ZIM A;  4CO7 A;  5D2M B;  1WJ6 A;  2CS4 A;  4IWP A;  1WE6 A;  1WGH A;  1L2N A;  4MEM A;  3VQI A;  2LVP A;  1V5O A;  4LJP B;  2RD0 A;  5GMV A;  1WH3 A;  3HIZ A;  3OAW A;  4EZK A;  4W9L A;  4ZRI A;  4WWN A;  2ZEQ A;  3PHX B;  4RM9 A;  2JUO A;  2JZZ A;  2C5L C;  1J19 A;  2JZ3 B;  3QHT A;  5CHF A;  3M62 B;  4LDT B;  2N7D A;  5AZH A;  2D3G A;  2MLB A;  3HM6 X;  2L0T A;  1I42 A;  3KUD B;  4DHZ E;  2LGD A;  1SIF A;  3CSF A;  3NHE B;  1H4R A;  4CHK A;  2C7M B;  3BIN A;  3OLM D;  5KHQ A;  2REX A;  3CST A;  3OJ3 A;  5EDS A;  4IWQ A;  1P0R A;  2CU1 A;  2PE9 A;  1KM7 A;  2J7Q B;  1PQS A;  3JSV A;  5AZF A;  3WIM A;  2KWV B;  1E5W A;  2G4S A;  1EO6 A;  2KQS A;  3R3M A;  1WMH A;  3RZF A;  4GGQ A;  1VCB A;  4GXB A;  1UGM A;  3C0R B;  4W9J A;  1Z5S B;  4GMV A;  2FID A;  3DQV A;  4ASW C;  3DBH I;  4HXD A;  1KLV A;  2C7H A;  3ALB A;  4EFO A;  3V61 A;  2NPT B;  3ECI A;  3UF8 A;  1Y8R C;  3EC8 A;  2DEN B;  4W9F A;  1KOT A;  4GU2 A;  1WFY A;  2L3Z A;  3QCA A;  1Q5W B;  2DYB A;  5CX3 A;  3LJ3 A;  5LXI B;  3UIO B;  2KVR A;  3A1Q B;  3NOB A;  2KFJ A;  3AU4 A;  3PRE A;  3QAQ A;  2GBM A;  4MSQ B;  3DBL I;  3BY4 B;  2DYO A;  2IZV B;  2NR2 A;  1WIA A;  2ZCC A;  4AOF A;  2IBI B;  2RR9 A;  4FA6 A;  4TQ1 A;  1WGG A;  4ANU A;  2KKC A;  2Z59 B;  4FAD A;  4FJV B;  4J6I A;  3GZN I;  4MGK E;  1LFD A;  2LGY A;  2FCN A;  2MRP A;  2J0J A;  3SU8 X;  1FXT B;  4JGH B;  4FN2 A;  3VTU A;  4ANV A;  2EMS A;  4A3P A;  3CF6 E;  2DZI A;  1YX5 B;  1RLF A;  4MEL A;  2IO3 B;  2DAF A;  2LZ6 A;  3PV1 A;  2O6V B;  1V49 A;  3PPA A;  1WR1 A;  2V3S A;  3RUL A;  2LUE A;  4II2 B;  4NPN A;  2GOW A;  2AWT A;  4IUM B;  1TTN A;  3VDZ A;  3L0W B;  4IC7 B;  4DHJ B;  2KLG A;  2MWS B;  4N9F 4;  4FUL A;  3JW0 X;  2JF5 A;  1V5T A;  2JXX A;  2I1J A;  3DOW A;  4ZYN A;  1LM8 B;  2A4Z A;  2DHZ A;  1Q0W B;  1TBE A;  2LXC A;  2RGF A;  2M17 A;  4WJN A;  1WXS A;  3RUI B;  2KJ6 A;  4HJK A;  2L0F A;  1X1M A;  2KMC A;  3TJP A;  2NPT A;  4JLC A;  3GOE A;  2UWQ A;  2KDB A;  1SGH A;  2K8B A;  4NAW A;  1EF5 A;  2ZCB A;  2CHZ A;  2N1W A;  3OJ4 B;  4TUU A;  5LXH A;  2CR5 A;  3H6N A;  2MBH A;  2FIF A;  4KDL B;  2FCM A;  4AJW A;  4GOC A;  4MH0 E;  1GJZ A;  1OTR B;  1ZW7 A;  2GBN A;  4W9C A;  5DPT A;  2M8S A;  3UQA A;  2KFK A;  3D32 A;  4FHK A;  4DDG D;  2MSE D;  5D7G A;  5CHW A;  3ZDT A;  2LWP A;  2BKF A;  1V9J A;  1P9D U;  1WYW B;  3DPD A;  4JL9 A;  2Z0D B;  3PSE B;  4IM3 A;  2LAS A;  2LXA A;  1V81 A;  3IVF A;  2KC1 A;  3IFW B;  3ZNZ B;  4BOZ B;  3VAW A;  4IW0 A;  4LJO B;  2BPS A;  4KSL C;  3DBS A;  2RSU A;  3DVG Y;  1VD2 A;  4PS8 A;  1OGW A;  3ENE A;  3I3T B;  2XBB C;  4KV2 A;  3RYT A;  1A5R A;  1T0Y A;  2WWZ A;  3W1Y A;  2PEA A;  2VRR B;  2NBW B;  3PLU A;  2JRI B;  2KWC A;  3ZVV A;  2C9W B;  4NY0 A;  2LD9 A;  5TR5 A;  3ZRC A;  2DYM A;  4AJY B;  2ZJD A;  3NZS A;  3ONS A;  4F8C B;  2ZPN A;  3SD5 A;  2N7E A;  3A4S C;  2KMA A;  4KZC A;  5IA7 A;  1J8C A;  2PPH A;  4GDK B;  3O65 B;  4ZRJ A;  5CTR C;  3ZRF A;  1YIW A;  2KJH B;  1S3S G;  3VTW A;  1LXD A;  2XK5 B;  5KHO A;  3VVW B;  3H9D A;  4MJS B;  3WA0 A;  3ZNG C;  4M8N A;  2BKR B;  3N30 A;  4NJ7 A;  3VXW A;  3L16 A;  3RT3 B;  3AU5 A;  3W1S A;  3TL5 A;  4B6W A;  4BOS C;  2JY6 A;  3KW5 B;  3KH0 A;  4BVU C;  1R4M I;  2K6Q A;  4AWJ A;  2W9N A;  1WF9 A;  2AL6 A;  1WGY A;  2L00 B;  4K81 A;  4TV3 A;  2M4N A;  2O2V B;  2MP2 B;  4E74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...