2N9YB

Structure of the integrin alphaiib-beta3(a711p) transmembrane complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
GESPKCPDILVVLLSVMGAILLIGLAPLLIWKLLITIHDRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structural and thermodynamic basis of proline-induced transmembrane complex stabilization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/cell adhesion
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2015-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2n9yB00
2RMZA 3L75D 5KKZB 3GW6A 3PHLA 1P84D 3L73D 1KB9D 2QJYB 1PP9D 1NTKD 3H1KD 3TF5A 1NU1D 2KS1A 2K9JB 1PPJD 1L0LD 2IBZD 3H1HD 3KHUA 1BGYD 2YIUB 3GG2A 4RJTA 1SQXD 1SQQD 3PRJA 4D6TD 4U3FD 2QJKB 1SQBD 4EDFA 3CWBD 2BCCD 2Y0EA 2FYNB 2FYUD 3TGUD 3VMAA 4A7PA 1BE3D 1L0ND 3H1LD 2QG4A 2JWAA 3L70D 1NTMD 3BCCD 3L71D 3L74D 2Y0DA 3CXHD 4PD4D 1NTZD 2KNCB 2RN0A 1BCCD 2A06D 2O3JA 3L72D 3PTZA 2L91A 3TDKA 3CX5D 5KLIB 1SQVD 3PLNA 1EZVD 5KLVD 3FWLA 2Q3EA 1KYOD 1SQPD 2QJPB 5TJHA 3H1JD 2N9YB 3H1ID 2Y0CA 3ITKA 1ZRTD
chains in the Genus database with same CATH superfamily
1Z56A 2KS1B 3G71P 2WTYA 2N9BA 1NTKD 1VQOP 1U7MA 5KAIE 1U7JA 3TF5A 1NKNA 2E75D 2IDBA 3VMXA 3H32B 5CCHC 1PGQA 2H43A 3A0BE 5B66E 3GG2A 4DZOA 1L0LJ 1SQXD 4YXWH 1KN7A 2JDIH 1L0NG 1J1EB 1G1JA 3PRJA 1FZAA 1OVVA 1ZR2A 1RF1A 4H0LC 2ZYAA 2WSFJ 1GD2E 1RF0C 3U1CA 5GTHH 2FYUD 4N78D 4WY4B 1URQD 4I6MC 4A7PA 2HODA 1PPJE 2Q1KA 1E79H 4H44B 1GDTA 1SFCA 2QEXP 4GOFA 1JNMA 3NTNA 2R32A 2IZ0A 1NTMK 2C9LY 1S2EA 4GOEA 5CHXA 3LW5J 4JPZB 3FWNA 1GL2C 1GW4A 5KKZC 2ZVOB 5APTA 5KJ7A 1KYOD 1H88A 1DEEG 2CPBA 3D70A 3L71J 4UB8E 3V2RA 2M3EA 1PPJG 2ZJSE 3BRTB 1L4AD 3VOPA 2Q7CA 3HE5A 2O01J 1LT9A 5CMZA 4K35A 2YXQB 4C46A 2ITAA 1Q82Q 3GF3A 2OYIC 1VL2A 2KIKA 2NPSC 3KPEA 3SWYA 3MGNA 1JY3N 1RF1B 2E76C 2R3CA 1RY3A 3Q5RA 3H1HJ 2H89C 2POHA 1BGYJ 1HUCA 1HGZA 2FBWC 3EFGA 4LC1A 1SQQJ 2HODB 1SQBD 2WSEJ 5CCHD 3D6YA 3USSA 1SFCB 1IFNA 4I2LC 3OJAB 2Y9ZA 3NFQA 1L0LE 4MN4C 1GTWA 4H0LD 5APVA 2IZ1A 4OH8B 2GM4A 4PJ0H 3L70J 2MJZA 1FZGA 1Q2NA 4OWFA 3IN6A 3L74J 1NTZD 4HH2A 2JJLA 5B5EE 4PD4E 3MZWB 3TDKA 1URQA 1BE3J 4N6JA 1T2KD 3CI9A 2K1AA 2HYNA 3RGUA 4HB1A 2ZT9B 1S5LE 3V4QA 2JKVA 1RE4C 2N9YB 3GHGA 1VDFA 1IO4A 3HE5B 3RBXA 1LT9B 3V6IA 1L0LG 4WBAA 2IYPA 2FFDA 1GL2D 2KZJA 4QMAA 1N2DC 3H1KD 1J1EC 3A7OA 1NTKJ 1P84I 2AEJA 3IR9A 4AQRD 1R8EA 4O9BA 4WY4C 1PGJA 3Q5PA 1X22A 1KYOI 1FAVA 1IFIA 1SQXJ 1L4AA 3C8VA 4H44C 1MZ9A 3KDPB 2FYNB 3RK2B 5BU8B 1PP9J 1M1JA 3K5BA 2E76D 1QX8A 2YKQA 1RQUA 4Y28J 3TGUE 2FYUJ 2AXCA 3OAKA 1Q86Q 1OIPA 1BGYE 1N86A 1OWAA 1SQQE 1URQB 2Q3IA 3S4RA 1IFMA 2O3JA 3PTZA 3B71A 1PFIA 1FDOA 2A06E 3M9BA 5AVVB 3V2NA 3GHGB 3L70E 4BWNA 3V5BA 3VTPC 3HD7A 3AEFC 2ZFCA 2FFDB 2WWWA 3Q1MA 3TGUG 2YXRB 3ITKA 5M1BA 1YTZT 3H1HG 1RF1C 1BGYG 3CCSP 3CCVP 1SQQG 1R5LA 2DW3A 2B89A 2XZRA 1VQKP 1LNQA 1L4AB 2A06G 1SFCC 1M1JB 1CZQA 1ZRTE 1VQ9P 3L70G 4U7JA 2Y0EA 1NTKE 3RBZA 3FX0A 5H2FH 1SQBJ 4C7NA 1VQ6P 2ZXXA 2G3AA 4WY4D 3I5CA 5EFWB 2WSCJ 1BSHA 4H44D 5KJ7C 1JEKA 1A02J 1K9MQ 2E5YA 3S9OA 3JCUH 4PD4D 1JO5A 2HLOA 2ZXEB 2ZT9C 5E79H 4N78E 1FC2C 1HH0A 1XTCC 1LT9C 3HD7B 3KZIE 2UWJE 1IK7A 1KMIZ 4CPGA 1NTKG 2W27A 1N7LA 2M5AA 2Y0CA 1T8ZA 3AEBC 4UB6E 4EOTA 2RMZA 2V7QH 4BXLA 4ASWA 1SQXG 1P84E 2O1KA 1GW3A 4GODA 1K05A 1VQMP 3HRNA 2FYNC 3RK2C 1KYOE 1WT6A 2QIWA 4C7NB 1JY2P 1IFJA 4NPEA 4M3LA 5APUA 3CWBD 2BCCD 4C7RA 2O01N 1KQSO 3TGUD 3CD6P 4GIFA 1Q7YQ 1URQC 1SFCD 5L8RJ 1NKZB 4WVZA 1L0NK 3VP8A 2AXTH 2WT7A 2KLUA 2BEZF 3GHGC 1SQBE 2W83C 2A06D 5CBOA 2XDJA 3O6QA 2FFDC 1YYCA 1W5CE 1FE6A 1HWTC 2M5AB 5GTHE 1H89A 2AEMA 3PP5A 3FWLA 5DJTB 3HUSA 2R5BA 3CC4P 2VRSA 2ZT9D 3H1JD 2PFXA 3L75D 1NTZE 4AYCA 1Q90D 1MFZA 1YIJP 2QJYB 1L4AC 5AVZB 1NGMB 3L73E 1M1JC 3GLMA 5BVZA 3A2AA 1SQBG 2FXPA 3AEEC 1NU1E 1HTLC 4XFJA 1M1KQ 4AUWA 1OZHA 2I1JA 2K9JA 2E42A 3Q2YA 2Z5HA 1VQ5P 3VYIA 4U3FD 2PRRA 2YO2A 3E7KA 1FOSE 3H1KE 3VMAA 3RK2D 4HJGH 2WZ7A 4I7ZB 1EDKA 4TT3H 5KAFH 5AW1B 3L4FA 1NTZG 2WT7B 4GKGA 3L73G 1KQFB 3HD7C 1EQ7A 1VQ4P 2Y0DA 3O6QB 1YQ3C 2XKMA 1AFOA 1NU1G 5AVYB 1KB9H 1ZW0A 3CX5H 3R2PA 5KTBA 3CCRP 2OGUA 3HUSB 1Q81Q 4DT0A 2KNCA 5APXA 1T2KC 3CMAP 5KLVD 3OA7A 2M8RA 3H1KG 5AVWB 3U59A 3L37A 1PZQA 2WPRA 3B4SA 2BASA 1X8YA 1P84D 5AVUB 1YBKA 1SQPK 3H25A 1JCCA 4H13D 3AE5C 3EWKA 2K9JB 3E1IA 3Q3DA 1T3UA 1KQLA 2H7HA 1HJBA 3SSUA 1L0LK 3JSVC 3TYYA 1LGHB 5KAIH 2PAJA 2BCCJ 1GZLA 3TGUJ 1IC2A 1M57D 2PGDA 5B66H 3P8CD 2B88A 4EI2A 1NVOA 3L36A 3AE6C 3BCCD 4ZNCA 1USDA 3M9QA 1HJ0A 2Z4EA 2KNCB 1M56D 3BVHA 2M3BA 3CLQA 1XTGB 2AEFA 2ZVNB 3CX5D 2XNDH 1G2CA 1NO4A 1S1CX 3HD7D 4K3AA 1LTAC 1YQ4C 3P8MC 3B5NA 2QJYC 3V2QA 2OYHA 1E5WA 4YPCA 1W2EA 2P58A 1BDCA 2Q5UA 3L73D 1AQ5A 1EDIA 3L75J 3TK1A 3M91A 1NU1D 5DJUB 2K37A 2P7JA 3U1AA 2W90A 1QL2A 2YNYA 3KHUA 3CCLP 2I8DA 3BRVB 4I7ZC 3WMM0 2C0WA 3RL0D 1NAFA 4OGQB 2FKWB 3WUVA 1SQQK 1EDJA 4L73A 5AW2B 2RKLA 1N73A 3G6EP 2KOGA 5C39A 3A3YB 3A0HH 1LTIC 3HUSC 1FJPA 2P2UA 1HF9A 3CWBE 2BCCE 1G2CB 3L72D 2V4HA 3B5NB 1ZV8A 2OYHB 1OVRA 3W68A 1N7SB 3G3ZA 3M9HA 4EIJA 1HBWA 1Y47A 3WUUA 2J58A 2WSFH 2R5DA 2A45H 3CCJP 1OW7A 5KLVJ 1NOHA 4IFFA 1BDDA 1EZVI 4JYCA 3AEDC 3CCQP 5GTIE 1CI6A 5B5EH 2KSJA 3JCUE 2OTLP 3C1LA 2ZYGA 1LP1B 5E79E 3V2PA 3CX5I 3CWBG 2YKPA 1K8AQ 2BCCG 3P32A 4B86A 5APQA 2CPSA 1WRGA 1A02F 2O1JA 1LTTC 3LIEA 3H1JE 1QL1A 1GK6A 3CXHH 4H13B 3L75E 2L5GB 2WPSA 4EDFA 3LW5H 1K04A 1MUUA 4KJMA 1N73B 1J2JB 1SQXK 1X79B 2C0XA 1ZN5A 1QEXA 1EXIA 1FU1A 4JQ0D 2IFNA 4IL6X 2FYUK 2FYZA 1NTMD 2D2CD 4GT1A 5AVXB 1TU3F 4U3FE 2OARA 4JF7A 2B87A 1PIXA 1VPCA 4IFDK 3H1JG 1PGOA 3WU2H 2QRXA 1KILA 3AE7C 3L75G 2OTKE 1ZP0C 1JTHA 1AQTA 3KXDA 1CI6B 1CW5A 3CC2P 1QVFO 1IJDB 1NTZJ 1JY2N 1SLQA 1EC5A 2JP3A 3SFDC 2KXPB 3TNUA 4RO0A 3L73J 1ZMEC 4U3FG 5KLVE 4OGQC 1NU1J 2Q9IA 5CCGD 1SQVK 2IYOA 4D6TD 1JY3O 4R4LA 3VN0A 3FXEA 4OVNF 3G9RA 1JOCA 3AE2C 3MIWA 1M8OB 1KD1Q 3H1KJ 2XU6A 3MUDA 1FJKA 1SQBK 2WMMA 3RL0B 2N1TA 2OYOA 3B5NC 1RE3A 3L71D 2B87B 4W80A 5TISE 2ZYDA 2OYHC 3HE4A 1N7SC 5KLVG 1KILB 3IAOA 1BCCD 1IFPA 1JTHB 4JBZA 1R5SA 1UIIA 1KQGB 4KT0J 4W7ZA 3PLNA 3P8CE 1EZVE 3BCCE 2R3SA 4IFMA 2Y9YA 1HGVA 3H1ID 3M06A 5AVSB 1IZNB 1NH4A 5AW9B 3TNUB 1JB0J 1X9VA 4BRYA 2FXOA 4R4MA 1M7LA 1GMJA 3D6ZA 5CJ4A 4WWIA 1T3JA 3CX5E 2FXMA 4H13C 5K5GB 1LWUA 3G4SP 2J59M 1USEA 2OQQA 1N73C 3NMDA 2YIUB 2CK3H 2GUSA 3SWFA 1G1IA 4UB6H 3VMYA 4DOJA 2QJKB 1S9KE 4L76A 2HG5D 4IOIH 2A45I 1KFMA 4OGQD 1EZVG 1QLED 3BCCG 4TLFA 3I56P 2N1TB 2WPVB 1BE3D 1S3JA 3R4YA 4W7YA 1MFTA 3H1LD 1L0NE 3HE4B 1GK4A 1FZCA 4NPDA 2HR3A 5CCGA 3KYQA 1H0TA 2KSEA 4IL6H 3TSIA 1FZEA 2KUBA 1J1DB 2QM8A 1NTMJ 4ZKUA 2WQYC 2GA1A 4ZKPA 2GUVA 2E43A 3O8ZA 3CXHI 1KILE 2D2CB 3B5ND 3ZDMA 3VP9A 4PV1B 1N7SD 2W6JH 1IFDA 1VF5B 3T97A 4BRYB 1LTJA 5AW6B 5TJHA 5AVTB 3I55P 3FXDA 2P1JA 3PHLA 1PGPA 2NRGA 1FS0E 1LWUB 2G8YA 3L72E 1PP9D 1W2BO 1FDMA 2WSCH 1AVYA 2LXBA 3VMZA 1JM0A 3CC7P 1WMKA 2IBZD 3S1KA 4XE5B 1VQ8P 3V4WA 4RJTA 2C9NY 1GU5A 4PJ0E 4WB4A 3AE3C 1MV8A 2WITA 3MP7B 1YI2P 2KB7P 4L74A 3RL0C 4D6TJ 2Z5IA 2JEEA 5AW3B 1S5LX 1FZCB 1JMMA 2PP6A 3QH9A 1H0TB 2IPPA 1KILC 1ZLLA 3P7KA 3L72G 1T6AA 3SWKA 1D7MA 3AEAC 1AV1A 1JMBA 5CBNA 3CWBJ 3EFFK 1S72P 1Y8AA 1U57A 1EXJA 1KZUB 1YITP 1BCCJ 3T97B 3A0BH 5KLIB 1LTJB 3N4XA 1SQVD 1EZVD 1JY2O 3JC22 1NTME 1EDLA 2E5TA 2RH0A 1KTMA 1SQPE 3A0HE 2WSSH 2LR2A 3AEGC 2JWDA 2B9BA 4ZMDA 3H1IJ 2K3RA 1NHLA 1KB9D 2YIUC 3CCEP 1HVVA 2H88C 1SS1A 3MUDC 2QJKC 2FY8A 1N7SA 3CL3D 3H1JJ 2N1TC 5AW8B 1S9KD 1X0TA 1RE3C 2KP8A 3AE4C 3IFMA 3M0DA 1NTMG 1OW6A 1KFNA 1L0ND 1SQPG 2V7QJ 1J1DC 3AECC 3QWOC 2QVAA 1LP1A 3RK3B 1JY3P 2W8ZA 2QG4A 1YJWP 1OVUA 4UB8H 2E74B 3H1LJ 2QSIA 2IBZI 2LXCB 4D6TE 2D2CC 4U3FJ 1PL5A 4PV1C 2RN0A 1VF5C 4L75A 3CXHE 1DIPA 1KILD 2W6AA 1NAYA 3M0AA 5AW4B 5APSA 2A45G 3NXSA 1SVFA 1LWUC 2QJPB 3L71E 4RESB 1OX3A 4DCKA 1N8RQ 4YTPC 5APYA 1BCCE 1VQPP 1Y9BA 1H8AA 1ZXGA 2E75B 5AVRB 5H2FE 4D6TG 2NPSD 1SP4A 1DX7A 1PPJD 4Y99B 3WU2E 1LTGC 1CSBA 3MTUE 3OW2O 1KORA 1YJ9P 2YO3A 2W6BA 2SPZA 1FZCC 3H1HE 3H1IE 5CCGC 4PD4H 4ASVA 2XNXA 4RKUJ 3L71G 2IFMA 1KB9I 5CJ0A 5CCHA 2N1TD 1NTKK 1S5LH 3F89A 4GDOA 1BCCG 2R44A 3C9IA 1VQNP 2QA4P 3RK3E 1JCDA 1IK9A 1NWQA 1RF0A 1RH5B 5KLIC 1LTJC 2P10A 3N7NA 3L74E 3PJSK 3WUTA 5AW5B 1AJYA 1BE3E 3H1IG 1QVGO 3A5TA 3H1LE 1S4XA 2ZAEB 2Q3EA 4LLHA 3AE1C 4PV1D 1SQVJ 1SQPD 2O01H 1FBMA 1VF5D 4JYBA 3IF4A 3BCCJ 3RL0g 2KLVA 5AW0B 1UIXA 5KLVK 1FOSF 3GW6A 3HTKA 2IX7C 3AE9C 2HFED 4NPFX 1GL2A 1KC8Q 3D71A 3L74G 1L0LD 1LT1A 2M0BA 1FZFA 2OTJP 2WSEH 1BE3G 3H1LG 2AXTE 1M90Q 1SQXE 4DJGA 3RK3C 1AA0A 1FDIA 5GTIH 3CMEP 1DH3A 2E74C 1PP9E 2QM7A 5APWA 2Q6QA 2OYIA 2HPCA 2NPSA 2FYUE 4H0LB 3LIDA 2IBZE 1YJNP 1L0NJ 4HYTB 2WPQA 4Z1MH 3II6A 1LTBC 1DEBA 3CXHD 1OW8A 1OFCX 2JR8A 1QGKB 2QJPC 4N3YB 3CPWO 1OMIA 1GU4A 2KZIA 1YHQP 2MKVA 3MD0A 3CCMP 3Q5SA 1PP9G 5BU5A 1L2PA 2E75C 5AVQB 3HTKB 3CCUP 2LKMA 2QE7H 2FYUG 4Y99C 2IBZG 1GL2B 3SFEC 5KKZB 4IL6E 3L72J 3M0DC 1DD3A 3GMAA 1NTZK 1OXZA 2KS1A 1SQVE 2NZ2A 1RHZB 1DD4A 5KAFE 4EYYQ 1VQLP 4KHXA 3H6PA 3H1HD 1RE4A 1BGYD 3W67A 3H32A 1SQQD 1NU1K 2YMYA 4LGDE 3L35A 3BATA 2OYIB 2KI7B 2HPCB 2NPSB 2K9YA 3E1RA 2KYVA 3BASA 1LJ2A 1KB9E 1YTZI 3AE8C 1VQ7P 3ABVC 2E76B 3KZIH 2JO1A 2WVRA 2YKOA 1NYHA 4XA4A 3EQ2A 1BSNA 4YXDC 2YMKA 1NJIQ 3PH0A 2JWAA 1AVOA 3L70D 1LTSC 4WY4A 3RK3D 3KQGA 5KJ7D 2H8PD 3FGAD 2E74D 2KK7A 1KV4A 3GF7A 3L74D 2I1KA 1MKMA 1SQVG 1P84H 2BEQD 1RQVA 2P67A 3MHVA 1K73Q 2L91A 1JUNA 4HKZH 2J5UA 2K88A 4PD4I 1KYOH 3B8EB 1ZR4A 1FZBA 4I1LA 3F5HA 1ZOYC 5AW7B 5TISH 2XV5A 1PV3A 1SQPJ 3UIAA 1ZRTD
chains in the Genus database with same CATH topology
2RMZA 3L75D 5KKZB 3GW6A 3PHLA 1P84D 3L73D 1KB9D 2QJYB 1PP9D 1NTKD 3H1KD 3TF5A 1NU1D 2KS1A 2K9JB 1PPJD 1L0LD 2IBZD 3H1HD 3KHUA 1BGYD 2YIUB 3GG2A 4RJTA 1SQXD 1SQQD 3PRJA 4D6TD 4U3FD 2QJKB 1SQBD 4EDFA 3CWBD 2BCCD 2Y0EA 2FYNB 2FYUD 3TGUD 3VMAA 4A7PA 1BE3D 1L0ND 3H1LD 2QG4A 2JWAA 3L70D 1NTMD 3BCCD 3L71D 3L74D 2Y0DA 3CXHD 4PD4D 1NTZD 2KNCB 2RN0A 1BCCD 2A06D 2O3JA 3L72D 3PTZA 2L91A 3TDKA 3CX5D 5KLIB 1SQVD 3PLNA 1EZVD 5KLVD 3FWLA 2Q3EA 1KYOD 1SQPD 2QJPB 5TJHA 3H1JD 2N9YB 3H1ID 2Y0CA 3ITKA 1ZRTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMZ A;  3L75 D;  5KKZ B;  3GW6 A;  3PHL A;  1P84 D;  3L73 D;  1KB9 D;  2QJY B;  1PP9 D;  1NTK D;  3H1K D;  3TF5 A;  1NU1 D;  2KS1 A;  2K9J B;  1PPJ D;  1L0L D;  2IBZ D;  3H1H D;  3KHU A;  1BGY D;  2YIU B;  3GG2 A;  4RJT A;  1SQX D;  1SQQ D;  3PRJ A;  4D6T D;  4U3F D;  2QJK B;  1SQB D;  4EDF A;  3CWB D;  2BCC D;  2Y0E A;  2FYN B;  2FYU D;  3TGU D;  3VMA A;  4A7P A;  1BE3 D;  1L0N D;  3H1L D;  2QG4 A;  2JWA A;  3L70 D;  1NTM D;  3BCC D;  3L71 D;  3L74 D;  2Y0D A;  3CXH D;  4PD4 D;  1NTZ D;  2KNC B;  2RN0 A;  1BCC D;  2A06 D;  2O3J A;  3L72 D;  3PTZ A;  2L91 A;  3TDK A;  3CX5 D;  5KLI B;  1SQV D;  3PLN A;  1EZV D;  5KLV D;  3FWL A;  2Q3E A;  1KYO D;  1SQP D;  2QJP B;  5TJH A;  3H1J D;  2N9Y B;  3H1I D;  2Y0C A;  3ITK A;  1ZRT D; 
#chains in the Genus database with same CATH topology
 1Z56 A;  2KS1 B;  3G71 P;  2WTY A;  2N9B A;  1NTK D;  1VQO P;  1U7M A;  5KAI E;  1U7J A;  3TF5 A;  1NKN A;  2E75 D;  2IDB A;  3VMX A;  3H32 B;  5CCH C;  1PGQ A;  2H43 A;  3A0B E;  5B66 E;  3GG2 A;  4DZO A;  1L0L J;  1SQX D;  4YXW H;  1KN7 A;  2JDI H;  1L0N G;  1J1E B;  1G1J A;  3PRJ A;  1FZA A;  1OVV A;  1ZR2 A;  1RF1 A;  4H0L C;  2ZYA A;  2WSF J;  1GD2 E;  1RF0 C;  3U1C A;  5GTH H;  2FYU D;  4N78 D;  4WY4 B;  1URQ D;  4I6M C;  4A7P A;  2HOD A;  1PPJ E;  2Q1K A;  1E79 H;  4H44 B;  1GDT A;  1SFC A;  2QEX P;  4GOF A;  1JNM A;  3NTN A;  2R32 A;  2IZ0 A;  1NTM K;  2C9L Y;  1S2E A;  4GOE A;  5CHX A;  3LW5 J;  4JPZ B;  3FWN A;  1GL2 C;  1GW4 A;  5KKZ C;  2ZVO B;  5APT A;  5KJ7 A;  1KYO D;  1H88 A;  1DEE G;  2CPB A;  3D70 A;  3L71 J;  4UB8 E;  3V2R A;  2M3E A;  1PPJ G;  2ZJS E;  3BRT B;  1L4A D;  3VOP A;  2Q7C A;  3HE5 A;  2O01 J;  1LT9 A;  5CMZ A;  4K35 A;  2YXQ B;  4C46 A;  2ITA A;  1Q82 Q;  3GF3 A;  2OYI C;  1VL2 A;  2KIK A;  2NPS C;  3KPE A;  3SWY A;  3MGN A;  1JY3 N;  1RF1 B;  2E76 C;  2R3C A;  1RY3 A;  3Q5R A;  3H1H J;  2H89 C;  2POH A;  1BGY J;  1HUC A;  1HGZ A;  2FBW C;  3EFG A;  4LC1 A;  1SQQ J;  2HOD B;  1SQB D;  2WSE J;  5CCH D;  3D6Y A;  3USS A;  1SFC B;  1IFN A;  4I2L C;  3OJA B;  2Y9Z A;  3NFQ A;  1L0L E;  4MN4 C;  1GTW A;  4H0L D;  5APV A;  2IZ1 A;  4OH8 B;  2GM4 A;  4PJ0 H;  3L70 J;  2MJZ A;  1FZG A;  1Q2N A;  4OWF A;  3IN6 A;  3L74 J;  1NTZ D;  4HH2 A;  2JJL A;  5B5E E;  4PD4 E;  3MZW B;  3TDK A;  1URQ A;  1BE3 J;  4N6J A;  1T2K D;  3CI9 A;  2K1A A;  2HYN A;  3RGU A;  4HB1 A;  2ZT9 B;  1S5L E;  3V4Q A;  2JKV A;  1RE4 C;  2N9Y B;  3GHG A;  1VDF A;  1IO4 A;  3HE5 B;  3RBX A;  1LT9 B;  3V6I A;  1L0L G;  4WBA A;  2IYP A;  2FFD A;  1GL2 D;  2KZJ A;  4QMA A;  1N2D C;  3H1K D;  1J1E C;  3A7O A;  1NTK J;  1P84 I;  2AEJ A;  3IR9 A;  4AQR D;  1R8E A;  4O9B A;  4WY4 C;  1PGJ A;  3Q5P A;  1X22 A;  1KYO I;  1FAV A;  1IFI A;  1SQX J;  1L4A A;  3C8V A;  4H44 C;  1MZ9 A;  3KDP B;  2FYN B;  3RK2 B;  5BU8 B;  1PP9 J;  1M1J A;  3K5B A;  2E76 D;  1QX8 A;  2YKQ A;  1RQU A;  4Y28 J;  3TGU E;  2FYU J;  2AXC A;  3OAK A;  1Q86 Q;  1OIP A;  1BGY E;  1N86 A;  1OWA A;  1SQQ E;  1URQ B;  2Q3I A;  3S4R A;  1IFM A;  2O3J A;  3PTZ A;  3B71 A;  1PFI A;  1FDO A;  2A06 E;  3M9B A;  5AVV B;  3V2N A;  3GHG B;  3L70 E;  4BWN A;  3V5B A;  3VTP C;  3HD7 A;  3AEF C;  2ZFC A;  2FFD B;  2WWW A;  3Q1M A;  3TGU G;  2YXR B;  3ITK A;  5M1B A;  1YTZ T;  3H1H G;  1RF1 C;  1BGY G;  3CCS P;  3CCV P;  1SQQ G;  1R5L A;  2DW3 A;  2B89 A;  2XZR A;  1VQK P;  1LNQ A;  1L4A B;  2A06 G;  1SFC C;  1M1J B;  1CZQ A;  1ZRT E;  1VQ9 P;  3L70 G;  4U7J A;  2Y0E A;  1NTK E;  3RBZ A;  3FX0 A;  5H2F H;  1SQB J;  4C7N A;  1VQ6 P;  2ZXX A;  2G3A A;  4WY4 D;  3I5C A;  5EFW B;  2WSC J;  1BSH A;  4H44 D;  5KJ7 C;  1JEK A;  1A02 J;  1K9M Q;  2E5Y A;  3S9O A;  3JCU H;  4PD4 D;  1JO5 A;  2HLO A;  2ZXE B;  2ZT9 C;  5E79 H;  4N78 E;  1FC2 C;  1HH0 A;  1XTC C;  1LT9 C;  3HD7 B;  3KZI E;  2UWJ E;  1IK7 A;  1KMI Z;  4CPG A;  1NTK G;  2W27 A;  1N7L A;  2M5A A;  2Y0C A;  1T8Z A;  3AEB C;  4UB6 E;  4EOT A;  2RMZ A;  2V7Q H;  4BXL A;  4ASW A;  1SQX G;  1P84 E;  2O1K A;  1GW3 A;  4GOD A;  1K05 A;  1VQM P;  3HRN A;  2FYN C;  3RK2 C;  1KYO E;  1WT6 A;  2QIW A;  4C7N B;  1JY2 P;  1IFJ A;  4NPE A;  4M3L A;  5APU A;  3CWB D;  2BCC D;  4C7R A;  2O01 N;  1KQS O;  3TGU D;  3CD6 P;  4GIF A;  1Q7Y Q;  1URQ C;  1SFC D;  5L8R J;  1NKZ B;  4WVZ A;  1L0N K;  3VP8 A;  2AXT H;  2WT7 A;  2KLU A;  2BEZ F;  3GHG C;  1SQB E;  2W83 C;  2A06 D;  5CBO A;  2XDJ A;  3O6Q A;  2FFD C;  1YYC A;  1W5C E;  1FE6 A;  1HWT C;  2M5A B;  5GTH E;  1H89 A;  2AEM A;  3PP5 A;  3FWL A;  5DJT B;  3HUS A;  2R5B A;  3CC4 P;  2VRS A;  2ZT9 D;  3H1J D;  2PFX A;  3L75 D;  1NTZ E;  4AYC A;  1Q90 D;  1MFZ A;  1YIJ P;  2QJY B;  1L4A C;  5AVZ B;  1NGM B;  3L73 E;  1M1J C;  3GLM A;  5BVZ A;  3A2A A;  1SQB G;  2FXP A;  3AEE C;  1NU1 E;  1HTL C;  4XFJ A;  1M1K Q;  4AUW A;  1OZH A;  2I1J A;  2K9J A;  2E42 A;  3Q2Y A;  2Z5H A;  1VQ5 P;  3VYI A;  4U3F D;  2PRR A;  2YO2 A;  3E7K A;  1FOS E;  3H1K E;  3VMA A;  3RK2 D;  4HJG H;  2WZ7 A;  4I7Z B;  1EDK A;  4TT3 H;  5KAF H;  5AW1 B;  3L4F A;  1NTZ G;  2WT7 B;  4GKG A;  3L73 G;  1KQF B;  3HD7 C;  1EQ7 A;  1VQ4 P;  2Y0D A;  3O6Q B;  1YQ3 C;  2XKM A;  1AFO A;  1NU1 G;  5AVY B;  1KB9 H;  1ZW0 A;  3CX5 H;  3R2P A;  5KTB A;  3CCR P;  2OGU A;  3HUS B;  1Q81 Q;  4DT0 A;  2KNC A;  5APX A;  1T2K C;  3CMA P;  5KLV D;  3OA7 A;  2M8R A;  3H1K G;  5AVW B;  3U59 A;  3L37 A;  1PZQ A;  2WPR A;  3B4S A;  2BAS A;  1X8Y A;  1P84 D;  5AVU B;  1YBK A;  1SQP K;  3H25 A;  1JCC A;  4H13 D;  3AE5 C;  3EWK A;  2K9J B;  3E1I A;  3Q3D A;  1T3U A;  1KQL A;  2H7H A;  1HJB A;  3SSU A;  1L0L K;  3JSV C;  3TYY A;  1LGH B;  5KAI H;  2PAJ A;  2BCC J;  1GZL A;  3TGU J;  1IC2 A;  1M57 D;  2PGD A;  5B66 H;  3P8C D;  2B88 A;  4EI2 A;  1NVO A;  3L36 A;  3AE6 C;  3BCC D;  4ZNC A;  1USD A;  3M9Q A;  1HJ0 A;  2Z4E A;  2KNC B;  1M56 D;  3BVH A;  2M3B A;  3CLQ A;  1XTG B;  2AEF A;  2ZVN B;  3CX5 D;  2XND H;  1G2C A;  1NO4 A;  1S1C X;  3HD7 D;  4K3A A;  1LTA C;  1YQ4 C;  3P8M C;  3B5N A;  2QJY C;  3V2Q A;  2OYH A;  1E5W A;  4YPC A;  1W2E A;  2P58 A;  1BDC A;  2Q5U A;  3L73 D;  1AQ5 A;  1EDI A;  3L75 J;  3TK1 A;  3M91 A;  1NU1 D;  5DJU B;  2K37 A;  2P7J A;  3U1A A;  2W90 A;  1QL2 A;  2YNY A;  3KHU A;  3CCL P;  2I8D A;  3BRV B;  4I7Z C;  3WMM 0;  2C0W A;  3RL0 D;  1NAF A;  4OGQ B;  2FKW B;  3WUV A;  1SQQ K;  1EDJ A;  4L73 A;  5AW2 B;  2RKL A;  1N73 A;  3G6E P;  2KOG A;  5C39 A;  3A3Y B;  3A0H H;  1LTI C;  3HUS C;  1FJP A;  2P2U A;  1HF9 A;  3CWB E;  2BCC E;  1G2C B;  3L72 D;  2V4H A;  3B5N B;  1ZV8 A;  2OYH B;  1OVR A;  3W68 A;  1N7S B;  3G3Z A;  3M9H A;  4EIJ A;  1HBW A;  1Y47 A;  3WUU A;  2J58 A;  2WSF H;  2R5D A;  2A45 H;  3CCJ P;  1OW7 A;  5KLV J;  1NOH A;  4IFF A;  1BDD A;  1EZV I;  4JYC A;  3AED C;  3CCQ P;  5GTI E;  1CI6 A;  5B5E H;  2KSJ A;  3JCU E;  2OTL P;  3C1L A;  2ZYG A;  1LP1 B;  5E79 E;  3V2P A;  3CX5 I;  3CWB G;  2YKP A;  1K8A Q;  2BCC G;  3P32 A;  4B86 A;  5APQ A;  2CPS A;  1WRG A;  1A02 F;  2O1J A;  1LTT C;  3LIE A;  3H1J E;  1QL1 A;  1GK6 A;  3CXH H;  4H13 B;  3L75 E;  2L5G B;  2WPS A;  4EDF A;  3LW5 H;  1K04 A;  1MUU A;  4KJM A;  1N73 B;  1J2J B;  1SQX K;  1X79 B;  2C0X A;  1ZN5 A;  1QEX A;  1EXI A;  1FU1 A;  4JQ0 D;  2IFN A;  4IL6 X;  2FYU K;  2FYZ A;  1NTM D;  2D2C D;  4GT1 A;  5AVX B;  1TU3 F;  4U3F E;  2OAR A;  4JF7 A;  2B87 A;  1PIX A;  1VPC A;  4IFD K;  3H1J G;  1PGO A;  3WU2 H;  2QRX A;  1KIL A;  3AE7 C;  3L75 G;  2OTK E;  1ZP0 C;  1JTH A;  1AQT A;  3KXD A;  1CI6 B;  1CW5 A;  3CC2 P;  1QVF O;  1IJD B;  1NTZ J;  1JY2 N;  1SLQ A;  1EC5 A;  2JP3 A;  3SFD C;  2KXP B;  3TNU A;  4RO0 A;  3L73 J;  1ZME C;  4U3F G;  5KLV E;  4OGQ C;  1NU1 J;  2Q9I A;  5CCG D;  1SQV K;  2IYO A;  4D6T D;  1JY3 O;  4R4L A;  3VN0 A;  3FXE A;  4OVN F;  3G9R A;  1JOC A;  3AE2 C;  3MIW A;  1M8O B;  1KD1 Q;  3H1K J;  2XU6 A;  3MUD A;  1FJK A;  1SQB K;  2WMM A;  3RL0 B;  2N1T A;  2OYO A;  3B5N C;  1RE3 A;  3L71 D;  2B87 B;  4W80 A;  5TIS E;  2ZYD A;  2OYH C;  3HE4 A;  1N7S C;  5KLV G;  1KIL B;  3IAO A;  1BCC D;  1IFP A;  1JTH B;  4JBZ A;  1R5S A;  1UII A;  1KQG B;  4KT0 J;  4W7Z A;  3PLN A;  3P8C E;  1EZV E;  3BCC E;  2R3S A;  4IFM A;  2Y9Y A;  1HGV A;  3H1I D;  3M06 A;  5AVS B;  1IZN B;  1NH4 A;  5AW9 B;  3TNU B;  1JB0 J;  1X9V A;  4BRY A;  2FXO A;  4R4M A;  1M7L A;  1GMJ A;  3D6Z A;  5CJ4 A;  4WWI A;  1T3J A;  3CX5 E;  2FXM A;  4H13 C;  5K5G B;  1LWU A;  3G4S P;  2J59 M;  1USE A;  2OQQ A;  1N73 C;  3NMD A;  2YIU B;  2CK3 H;  2GUS A;  3SWF A;  1G1I A;  4UB6 H;  3VMY A;  4DOJ A;  2QJK B;  1S9K E;  4L76 A;  2HG5 D;  4IOI H;  2A45 I;  1KFM A;  4OGQ D;  1EZV G;  1QLE D;  3BCC G;  4TLF A;  3I56 P;  2N1T B;  2WPV B;  1BE3 D;  1S3J A;  3R4Y A;  4W7Y A;  1MFT A;  3H1L D;  1L0N E;  3HE4 B;  1GK4 A;  1FZC A;  4NPD A;  2HR3 A;  5CCG A;  3KYQ A;  1H0T A;  2KSE A;  4IL6 H;  3TSI A;  1FZE A;  2KUB A;  1J1D B;  2QM8 A;  1NTM J;  4ZKU A;  2WQY C;  2GA1 A;  4ZKP A;  2GUV A;  2E43 A;  3O8Z A;  3CXH I;  1KIL E;  2D2C B;  3B5N D;  3ZDM A;  3VP9 A;  4PV1 B;  1N7S D;  2W6J H;  1IFD A;  1VF5 B;  3T97 A;  4BRY B;  1LTJ A;  5AW6 B;  5TJH A;  5AVT B;  3I55 P;  3FXD A;  2P1J A;  3PHL A;  1PGP A;  2NRG A;  1FS0 E;  1LWU B;  2G8Y A;  3L72 E;  1PP9 D;  1W2B O;  1FDM A;  2WSC H;  1AVY A;  2LXB A;  3VMZ A;  1JM0 A;  3CC7 P;  1WMK A;  2IBZ D;  3S1K A;  4XE5 B;  1VQ8 P;  3V4W A;  4RJT A;  2C9N Y;  1GU5 A;  4PJ0 E;  4WB4 A;  3AE3 C;  1MV8 A;  2WIT A;  3MP7 B;  1YI2 P;  2KB7 P;  4L74 A;  3RL0 C;  4D6T J;  2Z5I A;  2JEE A;  5AW3 B;  1S5L X;  1FZC B;  1JMM A;  2PP6 A;  3QH9 A;  1H0T B;  2IPP A;  1KIL C;  1ZLL A;  3P7K A;  3L72 G;  1T6A A;  3SWK A;  1D7M A;  3AEA C;  1AV1 A;  1JMB A;  5CBN A;  3CWB J;  3EFF K;  1S72 P;  1Y8A A;  1U57 A;  1EXJ A;  1KZU B;  1YIT P;  1BCC J;  3T97 B;  3A0B H;  5KLI B;  1LTJ B;  3N4X A;  1SQV D;  1EZV D;  1JY2 O;  3JC2 2;  1NTM E;  1EDL A;  2E5T A;  2RH0 A;  1KTM A;  1SQP E;  3A0H E;  2WSS H;  2LR2 A;  3AEG C;  2JWD A;  2B9B A;  4ZMD A;  3H1I J;  2K3R A;  1NHL A;  1KB9 D;  2YIU C;  3CCE P;  1HVV A;  2H88 C;  1SS1 A;  3MUD C;  2QJK C;  2FY8 A;  1N7S A;  3CL3 D;  3H1J J;  2N1T C;  5AW8 B;  1S9K D;  1X0T A;  1RE3 C;  2KP8 A;  3AE4 C;  3IFM A;  3M0D A;  1NTM G;  1OW6 A;  1KFN A;  1L0N D;  1SQP G;  2V7Q J;  1J1D C;  3AEC C;  3QWO C;  2QVA A;  1LP1 A;  3RK3 B;  1JY3 P;  2W8Z A;  2QG4 A;  1YJW P;  1OVU A;  4UB8 H;  2E74 B;  3H1L J;  2QSI A;  2IBZ I;  2LXC B;  4D6T E;  2D2C C;  4U3F J;  1PL5 A;  4PV1 C;  2RN0 A;  1VF5 C;  4L75 A;  3CXH E;  1DIP A;  1KIL D;  2W6A A;  1NAY A;  3M0A A;  5AW4 B;  5APS A;  2A45 G;  3NXS A;  1SVF A;  1LWU C;  2QJP B;  3L71 E;  4RES B;  1OX3 A;  4DCK A;  1N8R Q;  4YTP C;  5APY A;  1BCC E;  1VQP P;  1Y9B A;  1H8A A;  1ZXG A;  2E75 B;  5AVR B;  5H2F E;  4D6T G;  2NPS D;  1SP4 A;  1DX7 A;  1PPJ D;  4Y99 B;  3WU2 E;  1LTG C;  1CSB A;  3MTU E;  3OW2 O;  1KOR A;  1YJ9 P;  2YO3 A;  2W6B A;  2SPZ A;  1FZC C;  3H1H E;  3H1I E;  5CCG C;  4PD4 H;  4ASV A;  2XNX A;  4RKU J;  3L71 G;  2IFM A;  1KB9 I;  5CJ0 A;  5CCH A;  2N1T D;  1NTK K;  1S5L H;  3F89 A;  4GDO A;  1BCC G;  2R44 A;  3C9I A;  1VQN P;  2QA4 P;  3RK3 E;  1JCD A;  1IK9 A;  1NWQ A;  1RF0 A;  1RH5 B;  5KLI C;  1LTJ C;  2P10 A;  3N7N A;  3L74 E;  3PJS K;  3WUT A;  5AW5 B;  1AJY A;  1BE3 E;  3H1I G;  1QVG O;  3A5T A;  3H1L E;  1S4X A;  2ZAE B;  2Q3E A;  4LLH A;  3AE1 C;  4PV1 D;  1SQV J;  1SQP D;  2O01 H;  1FBM A;  1VF5 D;  4JYB A;  3IF4 A;  3BCC J;  3RL0 g;  2KLV A;  5AW0 B;  1UIX A;  5KLV K;  1FOS F;  3GW6 A;  3HTK A;  2IX7 C;  3AE9 C;  2HFE D;  4NPF X;  1GL2 A;  1KC8 Q;  3D71 A;  3L74 G;  1L0L D;  1LT1 A;  2M0B A;  1FZF A;  2OTJ P;  2WSE H;  1BE3 G;  3H1L G;  2AXT E;  1M90 Q;  1SQX E;  4DJG A;  3RK3 C;  1AA0 A;  1FDI A;  5GTI H;  3CME P;  1DH3 A;  2E74 C;  1PP9 E;  2QM7 A;  5APW A;  2Q6Q A;  2OYI A;  2HPC A;  2NPS A;  2FYU E;  4H0L B;  3LID A;  2IBZ E;  1YJN P;  1L0N J;  4HYT B;  2WPQ A;  4Z1M H;  3II6 A;  1LTB C;  1DEB A;  3CXH D;  1OW8 A;  1OFC X;  2JR8 A;  1QGK B;  2QJP C;  4N3Y B;  3CPW O;  1OMI A;  1GU4 A;  2KZI A;  1YHQ P;  2MKV A;  3MD0 A;  3CCM P;  3Q5S A;  1PP9 G;  5BU5 A;  1L2P A;  2E75 C;  5AVQ B;  3HTK B;  3CCU P;  2LKM A;  2QE7 H;  2FYU G;  4Y99 C;  2IBZ G;  1GL2 B;  3SFE C;  5KKZ B;  4IL6 E;  3L72 J;  3M0D C;  1DD3 A;  3GMA A;  1NTZ K;  1OXZ A;  2KS1 A;  1SQV E;  2NZ2 A;  1RHZ B;  1DD4 A;  5KAF E;  4EYY Q;  1VQL P;  4KHX A;  3H6P A;  3H1H D;  1RE4 A;  1BGY D;  3W67 A;  3H32 A;  1SQQ D;  1NU1 K;  2YMY A;  4LGD E;  3L35 A;  3BAT A;  2OYI B;  2KI7 B;  2HPC B;  2NPS B;  2K9Y A;  3E1R A;  2KYV A;  3BAS A;  1LJ2 A;  1KB9 E;  1YTZ I;  3AE8 C;  1VQ7 P;  3ABV C;  2E76 B;  3KZI H;  2JO1 A;  2WVR A;  2YKO A;  1NYH A;  4XA4 A;  3EQ2 A;  1BSN A;  4YXD C;  2YMK A;  1NJI Q;  3PH0 A;  2JWA A;  1AVO A;  3L70 D;  1LTS C;  4WY4 A;  3RK3 D;  3KQG A;  5KJ7 D;  2H8P D;  3FGA D;  2E74 D;  2KK7 A;  1KV4 A;  3GF7 A;  3L74 D;  2I1K A;  1MKM A;  1SQV G;  1P84 H;  2BEQ D;  1RQV A;  2P67 A;  3MHV A;  1K73 Q;  2L91 A;  1JUN A;  4HKZ H;  2J5U A;  2K88 A;  4PD4 I;  1KYO H;  3B8E B;  1ZR4 A;  1FZB A;  4I1L A;  3F5H A;  1ZOY C;  5AW7 B;  5TIS H;  2XV5 A;  1PV3 A;  1SQP J;  3UIA A;  1ZRT D; 
#chains in the Genus database with same CATH homology
 2RMZ A;  3L75 D;  5KKZ B;  3GW6 A;  3PHL A;  1P84 D;  3L73 D;  1KB9 D;  2QJY B;  1PP9 D;  1NTK D;  3H1K D;  3TF5 A;  1NU1 D;  2KS1 A;  2K9J B;  1PPJ D;  1L0L D;  2IBZ D;  3H1H D;  3KHU A;  1BGY D;  2YIU B;  3GG2 A;  4RJT A;  1SQX D;  1SQQ D;  3PRJ A;  4D6T D;  4U3F D;  2QJK B;  1SQB D;  4EDF A;  3CWB D;  2BCC D;  2Y0E A;  2FYN B;  2FYU D;  3TGU D;  3VMA A;  4A7P A;  1BE3 D;  1L0N D;  3H1L D;  2QG4 A;  2JWA A;  3L70 D;  1NTM D;  3BCC D;  3L71 D;  3L74 D;  2Y0D A;  3CXH D;  4PD4 D;  1NTZ D;  2KNC B;  2RN0 A;  1BCC D;  2A06 D;  2O3J A;  3L72 D;  3PTZ A;  2L91 A;  3TDK A;  3CX5 D;  5KLI B;  1SQV D;  3PLN A;  1EZV D;  5KLV D;  3FWL A;  2Q3E A;  1KYO D;  1SQP D;  2QJP B;  5TJH A;  3H1J D;  2N9Y B;  3H1I D;  2Y0C A;  3ITK A;  1ZRT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...