2NABA

Nizp1-c2hr zinc finger structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
41
structure length
41
Chain Sequence
b'GAMEVQTSQKSYVCPNCGKIFRWRVNFIRHLRSRREQKPHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 496
publication title Structural basis for PHDVC5HCHNSD1-C2HRNizp1 interaction: implications for Sotos syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 8
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2015-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2nabA01
2D9HA 4R2DA 2GLIA 2EM9A 1ZR9A 2YTPA 2DMIA 4M9VC 4R2QA 2YTIA 2EMCA 1A1JA 1G2DC 2RPCA 1TN9A 1RMDA 4F6MA 2EPUA 2YTJA 1G2FC 1ZU1A 1A1IA 4WSGA 3UK3C 2GHFA 2JP9A 2CTDA 1B69A 2YU8A 4R2AA 1ZAAC 1X6FA 2YTNA 1A1KA 2EM8A 2EPXA 2ENHA 1UN6B 2EN6A 3M99B 2YTDA 2EPZA 2EPCA 2EQ0A 2EOEA 1X5WA 2J7JA 2EMZA 2DGCA 2EMLA 4IJDA 2E72A 1NCSA 2EMFA 2EOXA 2EMIA 1LLMC 1TF6A 2EN3A 1BB8A 1KJKA 2EM6A 2ELYA 4R2RA 2LV2A 2WCC3 3EPLA 2EOSA 2A25A 2EMYA 2RSIA 5KL2A 1YSAC 2YRHA 2YTFA 2EN8A 2EOZA 2EMAA 2CSHA 1X6HA 2ELZA 4FK5C 4F6NA 1X6EA 2YU5A 3MHHC 3EPJA 2EMKA 4R2EA 2DLKA 2EP3A 2YTGA 2EM0A 5KL6A 1JK2A 2EM4A 2EMHA 2LO3A 2EMGA 2LVHA 2NABA 2R1FA 2EOYA 2YTOA 2M9AA 5KL5A 2LCEA 2EQ1A 1P47A 2EMXA 2EM7A 2EN1A 2YSOA 2EL5A 4F2JC 2YRKA 2CT1A 2EMWA 2MKDA 3EPKA 1JK1A 1A1GA 2DRPA 4X9JA 2EM3A 2EORA 2BB8A 2ENAA 2EOMA 2VRDA 2WBSA 2EOFA 2EOOA 4IS1C 1UBDC 2EN7A 2EOIA 2PRTA 1A1HA 1A1LA 1A1FA 1YUJA 2EQ3A 2EMBA 2EPAA 2MDGA 2EM2A 4R2SA 1F2IG 1MEYC 1AAYA 1WJPA 2EJ4A 1X3CA 1DGCA 3MHSC 2EM5A 5KL4A 2WBUA 2YSPA 1Z1BA 2DLQA 5KL7A 2EOJA 1YUIA 2LT7A 2EN4A 2WBTA 2YTEA 2YRMA 1TF3A 2HGHA 2EL6A 2EPPA 5KL3A 2MKNA 2EPRA 2I13A 1BBOA 4R2PA 2ENCA 4R2CA 2ADRA 2YTQA 2EOQA 2EN2A 3VHTB 4GZNC 2JPAA 2EE8A 3EPHA 2EL4A 2EOHA
chains in the Genus database with same CATH superfamily
2D9HA 5LMUE 2GLIA 4O43A 2JXPA 1XNQE 2M1SA 2EMCA 1PKPA 4F6MA 2EPUA 2V89A 4P7DA 2YTJA 1G2FC 4JI8E 2EPKX 2FTXB 2BBGA 2LRSA 2G7HA 4DV0E 2YTNA 1NEIA 2N8XA 3ADJA 2EPXA 2JOBA 5AE2A 4JI6E 1GTKA 5AC4A 2EPCA 4DUYE 2HHHE 2EOEA 1EKZA 4DR2E 2DGCA 1NCSA 2YT4A 2EOXA 1TF6A 2KHXA 3H09A 2EN3A 5A69A 1KJKA 2DIXA 3THNA 2LV2A 4X66E 3JU0A 2WCC3 2EOSA 1WRJA 2A25A 1I94E 2EN8A 2EOZA 2EPLX 3VYYA 2FV4B 2ELZA 2UUCE 4DV6E 4R2EA 2I9IA 2EP3A 2EM0A 1JK2A 2K7IA 4ZYHA 2LO3A 2EMGA 4LFBE 1X47A 1YYOA 4DUZE 2LCEA 1J26A 1P47A 2EN1A 5IWAE 2V86A 1XMQE 2ODRC 4NZVA 4LF9E 3ADGA 1T4LB 2JR1A 5AE3A 5A2QC 4X62E 5LL6R 1YUJA 2EMBA 2MDGA 2EM2A 2JOXA 4JI5E 4KZSA 1MEYC 1AAYA 1WJPA 2KONA 1X3CA 5IV8B 2WBUA 4DV4E 1ZBQA 1Z1BA 2DLQA 3ECRA 4ZYGA 2CPNA 2EPNA 1YUIA 2B7VA 5IT9C 5KL3A 2MKNA 3OTOE 4DR6E 4ZYDA 2ENCA 4YHHE 2EZ6A 3OMLA 2EN2A 3DJWA 4JI3E 4WSPA 4WXDA 1DQ3A 2Q8UA 2L33A 2EOHA 2YZTA 2HJJA 4I8OA 2ZM6E 3BGHA 4BBYA 4DV5E 2EM9A 2EWLA 3AV0A 1ZR9A 2YTPA 2DMIA 4M9VC 3C6KA 4R2QA 3IWBA 2RQLA 2YTIA 2RPCA 1TN9A 1RMDA 2ODRD 4TUIA 2RS6A 4BMJA 2RTXA 1ZU1A 2VQEE 1FJGE 2V87A 3UK3C 2JP9A 2YU8A 4JI7E 4MLVA 4LF4E 2LTSA 3J7AG 1X6FA 5AC5A 2VF1A 2L6MA 1YPNA 2EPOA 2EN6A 3M99B 3BIDA 4L5NC 2EQ0A 3KZYA 2J7JA 2EMZA 2EMLA 2EMFA 1LLMC 1N3GA 2F8BA 2ELYA 4R2RA 2YRHA 1AH5A 2LTRA 3T1HE 2EMAA 5AE1A 4HEIA 5IXMB 4K0KE 2K4VA 3JTZA 2UXDE 4FK5C 5LLQA 4F6NA 2YU5A 2IHR1 5A6KA 4JV5E 1YYWA 4BHCA 4B3RE 2YTGA 2UU9E 4KWYA 2R1FA 4LF6E 2M9AA 1HNXE 1PJSA 2EMXA 1N33E 1A1IA 2UUBE 2EMWA 2MKDA 1T4OA 3HXLA 1A1GA 2YPNA 4M0VA 4RH8A 1STUA 1WHQA 2EM3A 3AUZA 3LMLA 1X49A 5FLXC 2EOMA 4NXNE 2VRDA 2EOFA 4OX9E 2EN7A 2VE7C 2PRTA 1A1FA 4LF8E 2EPAA 2M4IA 4R2SA 4DV2E 4Q35B 2R76A 2YSPA 3C4TA 1YFHA 2DMYA 2JYAA 2RS7A 2H36X 4JI1E 2L2MA 3EQ1A 3JAMC 4DKKA 4LFCE 1TF3A 5CFFE 1EH7A 2GPIA 4DR1E 1T39A 2L2KB 2MC6A 2EOQA 3J81C 4DMIA 3EPHA 2EL4A 3DF6A 4DR5E 4BS9A 3J80C 3P1XA 3THOB 2B9DA 2JWOA 4DR7E 1QNTA 1HR0E 1G2DC 4OOGC 2KOUA 4O5GA 4WPYA 1YYKA 2GHFA 2N3HA 3ADIA 4R03A 2CTDA 1B69A 4X64E 3J7Yp 3QG5C 2VQFE 4B3TE 4F9CB 1A1KA 4O4KA 2LBSB 4HTGA 2EPZA 5TSEA 5A6AA 2L92A 4IJDA 2V85A 2UXCE 1BB8A 2EM6A 1EH6A 3BBGA 4AQYE 4WFTA 4BHBA 2RSIA 3C6MA 5KL2A 1MGTA 3L00A 4M30A 4O24A 3IWDA 2LJUA 1X6EA 1N34E 3VYXA 2DLKA 2V83A 5A6BA 3BF2A 3TQMA 2LUQA 4DR4E 2EMHA 4F9AB 2LUPB 2E5LE 3LLHA 2LVHA 2EOYA 1IMUA 5KL5A 2L3CA 2DRPA 2YRKA 2CT1A 2LE2A 4B3ME 3KZZA 1PJQA 4X9JA 2F4VE 3T1YE 4GEQB 2BB8A 1BBGA 3HPZA 1T4NA 3F6GA 4F54A 4WX9A 1GZ6A 2V88A 2WBSA 1XNRE 5ADZA 2EPMX 4IS1C 3RMPA 2NA2A 4BC7A 4GKKE 2EQ3A 4BC9A 4R8OA 4MLQA 2FGGA 1L4SA 3MSWA 4LTYA 3ADLA 2EM5A 2N3GA 5DNYA 4JI2E 5A6BD 5KL7A 2EOJA 1N36E 4JI0E 2YRMA 1IQSA 2EL6A 2EPPA 2NUFA 1PJTA 1EH8A 3HQ1A 4R2CA 1N32E 3VHTB 4X8WA 2EE8A 5A6JA 3C4BA 5LMNE 1IBME 3F6HA 4R2DA 3VK6A 4N4RB 2HC5A 4DV7E 1A1JA 1X48A 4KHPE 3IWCA 4M2ZA 2UXBE 4WSGA 3FIGA 5T6JA 4R2AA 1ZAAC 4LU9A 5F3WA 4LF5E 2EM8A 1SR9A 2ENHA 3ZOQB 1UN6B 5AASA 2YTDA 3K6QA 1X5WA 3HPSA 4NHRA 2LJHA 2YWQA 2E72A 1WXRA 1FKAE 2UUAE 1PDAA 2EMIA 5BR8E 3EPLA 2EMYA 4DV3E 1YSAC 2YTFA 3HTXA 1X6HA 2CSHA 2V8QB 4DR3E 4L8NA 3MHHC 3EPJA 4JI4E 2JY9A 2B7TA 2EMKA 4TUGA 2EM4A 1YZ9A 1SFEA 2RSMA 4YY3E 2NABA 2YTOA 2EQ1A 2JVAA 2EM7A 1O0WA 2YSOA 2EL5A 4F2JC 4J8ZA 3EPKA 1JK1A 1XMOE 1QU6A 1ZBTA 1IQOA 2EORA 1DI2A 4B3SE 2ENAA 2M7QA 4Q28A 1T38A 2WZOA 1IBLE 4LFAE 2EOOA 1WHNA 2DSYA 1UBDC 2EOIA 1A1HA 4BCAA 1A1LA 2NUEA 2DB2A 4DV1E 1F2IG 2EJ4A 1DGCA 2NUGA 3MHSC 4RHBB 5KL4A 1UHZA 4P78A 2MC5A 2MDRA 1J5EE 2LT7A 2EN4A 2WBTA 2YTEA 4WXCA 2HGHA 1RC7A 2B3TB 2E1MA 4GKJE 2EPRA 2LMZA 4JYAE 2I13A 2L8TA 1BBOA 4R2PA 2L3JA 1GQEA 4WYQB 2ADRA 1UILA 4NXME 2YTQA 4F9BB 4LF7E 4X65E 1RQ0A 4GZNC 2JPAA 1KYQA 4ZYEA 1IBKE 2L2NA 1HNZE 3KWRA 1HNWE 5KL6A
chains in the Genus database with same CATH topology
2D9HA 4R2DA 2GLIA 2EM9A 1ZR9A 2YTPA 2DMIA 4M9VC 4R2QA 2YTIA 2EMCA 1A1JA 1G2DC 2RPCA 1TN9A 1RMDA 4F6MA 2EPUA 2YTJA 1G2FC 1ZU1A 1A1IA 4WSGA 3UK3C 2GHFA 2JP9A 2CTDA 1B69A 2YU8A 4R2AA 1ZAAC 1X6FA 2YTNA 1A1KA 2EM8A 2EPXA 2ENHA 1UN6B 2EN6A 3M99B 2YTDA 2EPZA 2EPCA 2EQ0A 2EOEA 1X5WA 2J7JA 2EMZA 2DGCA 2EMLA 4IJDA 2E72A 1NCSA 2EMFA 2EOXA 2EMIA 1LLMC 1TF6A 2EN3A 1BB8A 1KJKA 2EM6A 2ELYA 4R2RA 2LV2A 2WCC3 3EPLA 2EOSA 2A25A 2EMYA 2RSIA 5KL2A 1YSAC 2YRHA 2YTFA 2EN8A 2EOZA 2EMAA 2CSHA 1X6HA 2ELZA 4FK5C 4F6NA 1X6EA 2YU5A 3MHHC 3EPJA 2EMKA 4R2EA 2DLKA 2EP3A 2YTGA 2EM0A 5KL6A 1JK2A 2EM4A 2EMHA 2LO3A 2EMGA 2LVHA 2NABA 2R1FA 2EOYA 2YTOA 2M9AA 5KL5A 2LCEA 2EQ1A 1P47A 2EMXA 2EM7A 2EN1A 2YSOA 2EL5A 4F2JC 2YRKA 2CT1A 2EMWA 2MKDA 3EPKA 1JK1A 1A1GA 2DRPA 4X9JA 2EM3A 2EORA 2BB8A 2ENAA 2EOMA 2VRDA 2WBSA 2EOFA 2EOOA 4IS1C 1UBDC 2EN7A 2EOIA 2PRTA 1A1HA 1A1LA 1A1FA 1YUJA 2EQ3A 2EMBA 2EPAA 2MDGA 2EM2A 4R2SA 1F2IG 1MEYC 1AAYA 1WJPA 2EJ4A 1X3CA 1DGCA 3MHSC 2EM5A 5KL4A 2WBUA 2YSPA 1Z1BA 2DLQA 5KL7A 2EOJA 1YUIA 2LT7A 2EN4A 2WBTA 2YTEA 2YRMA 1TF3A 2HGHA 2EL6A 2EPPA 5KL3A 2MKNA 2EPRA 2I13A 1BBOA 4R2PA 2ENCA 4R2CA 2ADRA 2YTQA 2EOQA 2EN2A 3VHTB 4GZNC 2JPAA 2EE8A 3EPHA 2EL4A 2EOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9H A;  4R2D A;  2GLI A;  2EM9 A;  1ZR9 A;  2YTP A;  2DMI A;  4M9V C;  4R2Q A;  2YTI A;  2EMC A;  1A1J A;  1G2D C;  2RPC A;  1TN9 A;  1RMD A;  4F6M A;  2EPU A;  2YTJ A;  1G2F C;  1ZU1 A;  1A1I A;  4WSG A;  3UK3 C;  2GHF A;  2JP9 A;  2CTD A;  1B69 A;  2YU8 A;  4R2A A;  1ZAA C;  1X6F A;  2YTN A;  1A1K A;  2EM8 A;  2EPX A;  2ENH A;  1UN6 B;  2EN6 A;  3M99 B;  2YTD A;  2EPZ A;  2EPC A;  2EQ0 A;  2EOE A;  1X5W A;  2J7J A;  2EMZ A;  2DGC A;  2EML A;  4IJD A;  2E72 A;  1NCS A;  2EMF A;  2EOX A;  2EMI A;  1LLM C;  1TF6 A;  2EN3 A;  1BB8 A;  1KJK A;  2EM6 A;  2ELY A;  4R2R A;  2LV2 A;  2WCC 3;  3EPL A;  2EOS A;  2A25 A;  2EMY A;  2RSI A;  5KL2 A;  1YSA C;  2YRH A;  2YTF A;  2EN8 A;  2EOZ A;  2EMA A;  2CSH A;  1X6H A;  2ELZ A;  4FK5 C;  4F6N A;  1X6E A;  2YU5 A;  3MHH C;  3EPJ A;  2EMK A;  4R2E A;  2DLK A;  2EP3 A;  2YTG A;  2EM0 A;  5KL6 A;  1JK2 A;  2EM4 A;  2EMH A;  2LO3 A;  2EMG A;  2LVH A;  2NAB A;  2R1F A;  2EOY A;  2YTO A;  2M9A A;  5KL5 A;  2LCE A;  2EQ1 A;  1P47 A;  2EMX A;  2EM7 A;  2EN1 A;  2YSO A;  2EL5 A;  4F2J C;  2YRK A;  2CT1 A;  2EMW A;  2MKD A;  3EPK A;  1JK1 A;  1A1G A;  2DRP A;  4X9J A;  2EM3 A;  2EOR A;  2BB8 A;  2ENA A;  2EOM A;  2VRD A;  2WBS A;  2EOF A;  2EOO A;  4IS1 C;  1UBD C;  2EN7 A;  2EOI A;  2PRT A;  1A1H A;  1A1L A;  1A1F A;  1YUJ A;  2EQ3 A;  2EMB A;  2EPA A;  2MDG A;  2EM2 A;  4R2S A;  1F2I G;  1MEY C;  1AAY A;  1WJP A;  2EJ4 A;  1X3C A;  1DGC A;  3MHS C;  2EM5 A;  5KL4 A;  2WBU A;  2YSP A;  1Z1B A;  2DLQ A;  5KL7 A;  2EOJ A;  1YUI A;  2LT7 A;  2EN4 A;  2WBT A;  2YTE A;  2YRM A;  1TF3 A;  2HGH A;  2EL6 A;  2EPP A;  5KL3 A;  2MKN A;  2EPR A;  2I13 A;  1BBO A;  4R2P A;  2ENC A;  4R2C A;  2ADR A;  2YTQ A;  2EOQ A;  2EN2 A;  3VHT B;  4GZN C;  2JPA A;  2EE8 A;  3EPH A;  2EL4 A;  2EOH A; 
#chains in the Genus database with same CATH topology
 2D9H A;  5LMU E;  2GLI A;  4O43 A;  2JXP A;  1XNQ E;  2M1S A;  2EMC A;  1PKP A;  4F6M A;  2EPU A;  2V89 A;  4P7D A;  2YTJ A;  1G2F C;  4JI8 E;  2EPK X;  2FTX B;  2BBG A;  2LRS A;  2G7H A;  4DV0 E;  2YTN A;  1NEI A;  2N8X A;  3ADJ A;  2EPX A;  2JOB A;  5AE2 A;  4JI6 E;  1GTK A;  5AC4 A;  2EPC A;  4DUY E;  2HHH E;  2EOE A;  1EKZ A;  4DR2 E;  2DGC A;  1NCS A;  2YT4 A;  2EOX A;  1TF6 A;  2KHX A;  3H09 A;  2EN3 A;  5A69 A;  1KJK A;  2DIX A;  3THN A;  2LV2 A;  4X66 E;  3JU0 A;  2WCC 3;  2EOS A;  1WRJ A;  2A25 A;  1I94 E;  2EN8 A;  2EOZ A;  2EPL X;  3VYY A;  2FV4 B;  2ELZ A;  2UUC E;  4DV6 E;  4R2E A;  2I9I A;  2EP3 A;  2EM0 A;  1JK2 A;  2K7I A;  4ZYH A;  2LO3 A;  2EMG A;  4LFB E;  1X47 A;  1YYO A;  4DUZ E;  2LCE A;  1J26 A;  1P47 A;  2EN1 A;  5IWA E;  2V86 A;  1XMQ E;  2ODR C;  4NZV A;  4LF9 E;  3ADG A;  1T4L B;  2JR1 A;  5AE3 A;  5A2Q C;  4X62 E;  5LL6 R;  1YUJ A;  2EMB A;  2MDG A;  2EM2 A;  2JOX A;  4JI5 E;  4KZS A;  1MEY C;  1AAY A;  1WJP A;  2KON A;  1X3C A;  5IV8 B;  2WBU A;  4DV4 E;  1ZBQ A;  1Z1B A;  2DLQ A;  3ECR A;  4ZYG A;  2CPN A;  2EPN A;  1YUI A;  2B7V A;  5IT9 C;  5KL3 A;  2MKN A;  3OTO E;  4DR6 E;  4ZYD A;  2ENC A;  4YHH E;  2EZ6 A;  3OML A;  2EN2 A;  3DJW A;  4JI3 E;  4WSP A;  4WXD A;  1DQ3 A;  2Q8U A;  2L33 A;  2EOH A;  2YZT A;  2HJJ A;  4I8O A;  2ZM6 E;  3BGH A;  4BBY A;  4DV5 E;  2EM9 A;  2EWL A;  3AV0 A;  1ZR9 A;  2YTP A;  2DMI A;  4M9V C;  3C6K A;  4R2Q A;  3IWB A;  2RQL A;  2YTI A;  2RPC A;  1TN9 A;  1RMD A;  2ODR D;  4TUI A;  2RS6 A;  4BMJ A;  2RTX A;  1ZU1 A;  2VQE E;  1FJG E;  2V87 A;  3UK3 C;  2JP9 A;  2YU8 A;  4JI7 E;  4MLV A;  4LF4 E;  2LTS A;  3J7A G;  1X6F A;  5AC5 A;  2VF1 A;  2L6M A;  1YPN A;  2EPO A;  2EN6 A;  3M99 B;  3BID A;  4L5N C;  2EQ0 A;  3KZY A;  2J7J A;  2EMZ A;  2EML A;  2EMF A;  1LLM C;  1N3G A;  2F8B A;  2ELY A;  4R2R A;  2YRH A;  1AH5 A;  2LTR A;  3T1H E;  2EMA A;  5AE1 A;  4HEI A;  5IXM B;  4K0K E;  2K4V A;  3JTZ A;  2UXD E;  4FK5 C;  5LLQ A;  4F6N A;  2YU5 A;  2IHR 1;  5A6K A;  4JV5 E;  1YYW A;  4BHC A;  4B3R E;  2YTG A;  2UU9 E;  4KWY A;  2R1F A;  4LF6 E;  2M9A A;  1HNX E;  1PJS A;  2EMX A;  1N33 E;  1A1I A;  2UUB E;  2EMW A;  2MKD A;  1T4O A;  3HXL A;  1A1G A;  2YPN A;  4M0V A;  4RH8 A;  1STU A;  1WHQ A;  2EM3 A;  3AUZ A;  3LML A;  1X49 A;  5FLX C;  2EOM A;  4NXN E;  2VRD A;  2EOF A;  4OX9 E;  2EN7 A;  2VE7 C;  2PRT A;  1A1F A;  4LF8 E;  2EPA A;  2M4I A;  4R2S A;  4DV2 E;  4Q35 B;  2R76 A;  2YSP A;  3C4T A;  1YFH A;  2DMY A;  2JYA A;  2RS7 A;  2H36 X;  4JI1 E;  2L2M A;  3EQ1 A;  3JAM C;  4DKK A;  4LFC E;  1TF3 A;  5CFF E;  1EH7 A;  2GPI A;  4DR1 E;  1T39 A;  2L2K B;  2MC6 A;  2EOQ A;  3J81 C;  4DMI A;  3EPH A;  2EL4 A;  3DF6 A;  4DR5 E;  4BS9 A;  3J80 C;  3P1X A;  3THO B;  2B9D A;  2JWO A;  4DR7 E;  1QNT A;  1HR0 E;  1G2D C;  4OOG C;  2KOU A;  4O5G A;  4WPY A;  1YYK A;  2GHF A;  2N3H A;  3ADI A;  4R03 A;  2CTD A;  1B69 A;  4X64 E;  3J7Y p;  3QG5 C;  2VQF E;  4B3T E;  4F9C B;  1A1K A;  4O4K A;  2LBS B;  4HTG A;  2EPZ A;  5TSE A;  5A6A A;  2L92 A;  4IJD A;  2V85 A;  2UXC E;  1BB8 A;  2EM6 A;  1EH6 A;  3BBG A;  4AQY E;  4WFT A;  4BHB A;  2RSI A;  3C6M A;  5KL2 A;  1MGT A;  3L00 A;  4M30 A;  4O24 A;  3IWD A;  2LJU A;  1X6E A;  1N34 E;  3VYX A;  2DLK A;  2V83 A;  5A6B A;  3BF2 A;  3TQM A;  2LUQ A;  4DR4 E;  2EMH A;  4F9A B;  2LUP B;  2E5L E;  3LLH A;  2LVH A;  2EOY A;  1IMU A;  5KL5 A;  2L3C A;  2DRP A;  2YRK A;  2CT1 A;  2LE2 A;  4B3M E;  3KZZ A;  1PJQ A;  4X9J A;  2F4V E;  3T1Y E;  4GEQ B;  2BB8 A;  1BBG A;  3HPZ A;  1T4N A;  3F6G A;  4F54 A;  4WX9 A;  1GZ6 A;  2V88 A;  2WBS A;  1XNR E;  5ADZ A;  2EPM X;  4IS1 C;  3RMP A;  2NA2 A;  4BC7 A;  4GKK E;  2EQ3 A;  4BC9 A;  4R8O A;  4MLQ A;  2FGG A;  1L4S A;  3MSW A;  4LTY A;  3ADL A;  2EM5 A;  2N3G A;  5DNY A;  4JI2 E;  5A6B D;  5KL7 A;  2EOJ A;  1N36 E;  4JI0 E;  2YRM A;  1IQS A;  2EL6 A;  2EPP A;  2NUF A;  1PJT A;  1EH8 A;  3HQ1 A;  4R2C A;  1N32 E;  3VHT B;  4X8W A;  2EE8 A;  5A6J A;  3C4B A;  5LMN E;  1IBM E;  3F6H A;  4R2D A;  3VK6 A;  4N4R B;  2HC5 A;  4DV7 E;  1A1J A;  1X48 A;  4KHP E;  3IWC A;  4M2Z A;  2UXB E;  4WSG A;  3FIG A;  5T6J A;  4R2A A;  1ZAA C;  4LU9 A;  5F3W A;  4LF5 E;  2EM8 A;  1SR9 A;  2ENH A;  3ZOQ B;  1UN6 B;  5AAS A;  2YTD A;  3K6Q A;  1X5W A;  3HPS A;  4NHR A;  2LJH A;  2YWQ A;  2E72 A;  1WXR A;  1FKA E;  2UUA E;  1PDA A;  2EMI A;  5BR8 E;  3EPL A;  2EMY A;  4DV3 E;  1YSA C;  2YTF A;  3HTX A;  1X6H A;  2CSH A;  2V8Q B;  4DR3 E;  4L8N A;  3MHH C;  3EPJ A;  4JI4 E;  2JY9 A;  2B7T A;  2EMK A;  4TUG A;  2EM4 A;  1YZ9 A;  1SFE A;  2RSM A;  4YY3 E;  2NAB A;  2YTO A;  2EQ1 A;  2JVA A;  2EM7 A;  1O0W A;  2YSO A;  2EL5 A;  4F2J C;  4J8Z A;  3EPK A;  1JK1 A;  1XMO E;  1QU6 A;  1ZBT A;  1IQO A;  2EOR A;  1DI2 A;  4B3S E;  2ENA A;  2M7Q A;  4Q28 A;  1T38 A;  2WZO A;  1IBL E;  4LFA E;  2EOO A;  1WHN A;  2DSY A;  1UBD C;  2EOI A;  1A1H A;  4BCA A;  1A1L A;  2NUE A;  2DB2 A;  4DV1 E;  1F2I G;  2EJ4 A;  1DGC A;  2NUG A;  3MHS C;  4RHB B;  5KL4 A;  1UHZ A;  4P78 A;  2MC5 A;  2MDR A;  1J5E E;  2LT7 A;  2EN4 A;  2WBT A;  2YTE A;  4WXC A;  2HGH A;  1RC7 A;  2B3T B;  2E1M A;  4GKJ E;  2EPR A;  2LMZ A;  4JYA E;  2I13 A;  2L8T A;  1BBO A;  4R2P A;  2L3J A;  1GQE A;  4WYQ B;  2ADR A;  1UIL A;  4NXM E;  2YTQ A;  4F9B B;  4LF7 E;  4X65 E;  1RQ0 A;  4GZN C;  2JPA A;  1KYQ A;  4ZYE A;  1IBK E;  2L2N A;  1HNZ E;  3KWR A;  1HNW E;  5KL6 A; 
#chains in the Genus database with same CATH homology
 2D9H A;  4R2D A;  2GLI A;  2EM9 A;  1ZR9 A;  2YTP A;  2DMI A;  4M9V C;  4R2Q A;  2YTI A;  2EMC A;  1A1J A;  1G2D C;  2RPC A;  1TN9 A;  1RMD A;  4F6M A;  2EPU A;  2YTJ A;  1G2F C;  1ZU1 A;  1A1I A;  4WSG A;  3UK3 C;  2GHF A;  2JP9 A;  2CTD A;  1B69 A;  2YU8 A;  4R2A A;  1ZAA C;  1X6F A;  2YTN A;  1A1K A;  2EM8 A;  2EPX A;  2ENH A;  1UN6 B;  2EN6 A;  3M99 B;  2YTD A;  2EPZ A;  2EPC A;  2EQ0 A;  2EOE A;  1X5W A;  2J7J A;  2EMZ A;  2DGC A;  2EML A;  4IJD A;  2E72 A;  1NCS A;  2EMF A;  2EOX A;  2EMI A;  1LLM C;  1TF6 A;  2EN3 A;  1BB8 A;  1KJK A;  2EM6 A;  2ELY A;  4R2R A;  2LV2 A;  2WCC 3;  3EPL A;  2EOS A;  2A25 A;  2EMY A;  2RSI A;  5KL2 A;  1YSA C;  2YRH A;  2YTF A;  2EN8 A;  2EOZ A;  2EMA A;  2CSH A;  1X6H A;  2ELZ A;  4FK5 C;  4F6N A;  1X6E A;  2YU5 A;  3MHH C;  3EPJ A;  2EMK A;  4R2E A;  2DLK A;  2EP3 A;  2YTG A;  2EM0 A;  5KL6 A;  1JK2 A;  2EM4 A;  2EMH A;  2LO3 A;  2EMG A;  2LVH A;  2NAB A;  2R1F A;  2EOY A;  2YTO A;  2M9A A;  5KL5 A;  2LCE A;  2EQ1 A;  1P47 A;  2EMX A;  2EM7 A;  2EN1 A;  2YSO A;  2EL5 A;  4F2J C;  2YRK A;  2CT1 A;  2EMW A;  2MKD A;  3EPK A;  1JK1 A;  1A1G A;  2DRP A;  4X9J A;  2EM3 A;  2EOR A;  2BB8 A;  2ENA A;  2EOM A;  2VRD A;  2WBS A;  2EOF A;  2EOO A;  4IS1 C;  1UBD C;  2EN7 A;  2EOI A;  2PRT A;  1A1H A;  1A1L A;  1A1F A;  1YUJ A;  2EQ3 A;  2EMB A;  2EPA A;  2MDG A;  2EM2 A;  4R2S A;  1F2I G;  1MEY C;  1AAY A;  1WJP A;  2EJ4 A;  1X3C A;  1DGC A;  3MHS C;  2EM5 A;  5KL4 A;  2WBU A;  2YSP A;  1Z1B A;  2DLQ A;  5KL7 A;  2EOJ A;  1YUI A;  2LT7 A;  2EN4 A;  2WBT A;  2YTE A;  2YRM A;  1TF3 A;  2HGH A;  2EL6 A;  2EPP A;  5KL3 A;  2MKN A;  2EPR A;  2I13 A;  1BBO A;  4R2P A;  2ENC A;  4R2C A;  2ADR A;  2YTQ A;  2EOQ A;  2EN2 A;  3VHT B;  4GZN C;  2JPA A;  2EE8 A;  3EPH A;  2EL4 A;  2EOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...