2NABA

Nizp1-c2hr zinc finger structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
41
structure length
41
Chain Sequence
GAMEVQTSQKSYVCPNCGKIFRWRVNFIRHLRSRREQKPHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for PHDVC5HCHNSD1-C2HRNizp1 interaction: implications for Sotos syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Zinc finger protein 496
total genus 8
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2015-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2nabA01
1WJPA 1X6HA 2YRHA 2EPZA 2ELZA 2YTNA 3M99B 2ENAA 2M9AA 5KL7A 2EN7A 2EN8A 2MKDA 2MKNA 2EPPA 2CSHA 1UN6B 1Z1BA 2EMAA 2JPAA 2WCC3 2EJ4A 2EN6A 2YSOA 2YTOA 2EOIA 2EPRA 2LVHA 1MEYC 4WSGA 2YTQA 3EPLA 4X9JA 2EP3A 1JK2A 2YTDA 4F2JC 4F6MA 5KL3A 3EPHA 2VRDA 2EMZA 2MDGA 2RPCA 2DRPA 2ADRA 1YUIA 1A1LA 3EPJA 2LCEA 5KL4A 2EM4A 1JK1A 2ENCA 1AAYA 1ZAAC 2YTPA 1G2DC 2GHFA 1YUJA 2HGHA 4IS1C 2WBSA 4R2QA 2PRTA 2ENHA 1A1FA 4FK5C 1X6FA 5KL2A 2EOZA 2EM5A 3VHTB 4R2DA 2EMHA 2YTFA 2EM7A 2EMGA 2EMWA 2EOMA 2EOOA 1A1KA 2EL5A 5KL5A 2LT7A 2EPXA 2EMYA 2YRKA 2YU8A 1B69A 2CTDA 1DGCA 2LO3A 2EL4A 2DLQA 4R2EA 2CT1A 2GLIA 2EMXA 4R2CA 2EMFA 1KJKA 2YTIA 3MHSC 1A1IA 2DLKA 1TN9A 2I13A 2EM0A 2EOEA 3UK3C 4GZNC 2E72A 2YSPA 2EM6A 1A1HA 2A25A 2ELYA 2EM8A 2YTGA 1P47A 2EQ3A 1TF3A 2BB8A 2EOQA 1F2IG 1TF6A 2YTEA 1YSAC 2WBTA 1ZU1A 2EPUA 3MHHC 1G2FC 2YU5A 2EL6A 2EMKA 2EOJA 2RSIA 2R1FA 2EN3A 2EMBA 2EM9A 2EPCA 2DGCA 2EN4A 1X6EA 2EN2A 1X5WA 2J7JA 3EPKA 1BB8A 2EN1A 4R2RA 2EOSA 2DMIA 1NCSA 4R2AA 4R2SA 1LLMC 2EMIA 2EPAA 2EE8A 1RMDA 2WBUA 1BBOA 2EMLA 2EQ0A 2EMCA 1ZR9A 1A1GA 2EOXA 1X3CA 4F6NA 2EQ1A 2LV2A 1UBDC 4M9VC 4IJDA 2YRMA 2EM2A 1A1JA 2YTJA 2NABA 2EOHA 2EM3A 2JP9A 5KL6A 4R2PA 2D9HA 2EORA 2EOFA 2EOYA
chains in the Genus database with same CATH superfamily
2V88A 1YPNA 2EPZA 2ENAA 2L33A 5KL7A 2EN7A 2MKDA 2UUAE 2EPPA 3THOB 2N3HA 2EPLX 1NEIA 2VF1A 3DF6A 3IWCA 2YTOA 2EOIA 1BBGA 1T38A 4ZYGA 2LVHA 1YYWA 5AC4A 1RQ0A 4GEQB 1JK2A 2RQLA 2EMZA 2RPCA 4P78A 3EPJA 2EPOA 2EM4A 2HGHA 4F9AB 4WYQB 1A1FA 4DUYE 2LJHA 1KYQA 3QG5C 1X6FA 5KL2A 3P1XA 3VHTB 4M2ZA 2YTFA 4B3SE 4F54A 2EPMX 3VK6A 2CTDA 2EOYA 4NXME 2B9DA 2CT1A 2GLIA 2F8BA 1XNRE 2L2NA 1XNQE 4LF7E 2B7TA 4O43A 2HHHE 3T1HE 1HNZE 2I13A 2N8XA 2EOEA 2NUEA 3F6GA 1FJGE 3L00A 2V8QB 4LFBE 4LFAE 2WBTA 4HEIA 4MLVA 3MHHC 3HPZA 1T39A 1FKAE 1I94E 3JU0A 2RSIA 2EM9A 2DGCA 1X6EA 1PJTA 2NUFA 2LTRA 2RTXA 2J7JA 3EPKA 1BB8A 4JI7E 2CPNA 4F9BB 3VYXA 4WXDA 2RS7A 4R2SA 4WFTA 2EMCA 5CFFE 3ZOQB 1A1GA 2M1SA 1J5EE 1WRJA 2LTSA 2E1MA 2EM2A 3MSWA 1HR0E 3KZZA 5LMNE 1EH7A 2EOHA 1ZBTA 5KL6A 5A69A 2JY9A 2EORA 4GKKE 2FTXB 5LLQA 2ELZA 3M99B 2M9AA 2DMYA 5ADZA 2HJJA 3ADLA 4KWYA 2VQFE 1YZ9A 2EJ4A 3BGHA 4B3TE 2I9IA 3IWBA 2EPRA 1N33E 1EH8A 2YT4A 4KHPE 4O5GA 4X9JA 2EP3A 2YTDA 4JI4E 4RHBB 4OOGC 5KL3A 5IWAE 2DRPA 1YUIA 2L6MA 1IBLE 1EH6A 2LCEA 4X64E 2ENCA 1QNTA 3C4BA 1YUJA 4DR5E 4O4KA 2WBSA 1J26A 1YYKA 3C6KA 1O0WA 4FK5C 5T6JA 1GTKA 4LF4E 4DR7E 1UHZA 4NHRA 5LMUE 2KOUA 2EM7A 2LUPB 2EL5A 4WXCA 4DV7E 3AUZA 4Q28A 2LO3A 2EL4A 2DLQA 4LFCE 3J81C 1N36E 1DI2A 4DR2E 4TUGA 1TN9A 1WHNA 3C6MA 2WZOA 3AV0A 4DMIA 5BR8E 3UK3C 1HNWE 4Q35B 5A2QC 1IBKE 5FLXC 2ELYA 2EM8A 1XMQE 2EQ3A 4BS9A 2BB8A 2EOQA 1TF6A 2YTEA 1STUA 4L8NA 4HTGA 4BC9A 2EMKA 1X49A 2V86A 4M30A 2R1FA 4LTYA 2B3TB 5A6AA 2EPCA 1QU6A 4TUIA 2EN2A 1X5WA 2YZTA 2EN1A 4R2RA 4O24A 2FV4B 1NCSA 4R2AA 1PJQA 2EPAA 2EE8A 1RMDA 4MLQA 2L2MA 2EOXA 4F6NA 4DR4E 1PDAA 2E5LE 2UXDE 5A6BD 4M9VC 2YRMA 4ZYHA 1UILA 2EPKX 2JP9A 3C4TA 5DNYA 2D9HA 2R76A 2ODRC 4BHBA 1WJPA 1X6HA 2YRHA 4JI2E 3THNA 1SFEA 2ODRD 4ZYEA 4JV5E 3BF2A 2FGGA 2MKNA 1T4NA 4DR6E 2DSYA 2JXPA 2LBSB 1Z1BA 1UN6B 2EMAA 2RS6A 2JVAA 2WCC3 2UXCE 2JYAA 3BBGA 2JR1A 2EN6A 2YSOA 4BBYA 1WXRA 2N3GA 5A6JA 4WSGA 2YTQA 3EQ1A 4R03A 3EPLA 1MEYC 3EPHA 2KONA 2MDGA 5AASA 1XMOE 3ADGA 2ADRA 3DJWA 4X8WA 3TQMA 1A1LA 4F9CB 2EPNA 2Q8UA 3HQ1A 1YFHA 2G7HA 2HC5A 1AAYA 2V87A 2YTPA 2GHFA 4JI8E 3HPSA 2ENHA 4AQYE 4X66E 3J80C 2EM5A 2NA2A 2UU9E 4R2DA 3RMPA 2EMHA 1L4SA 2UUBE 2EMGA 2EMWA 1N34E 2EOOA 1A1KA 2LT7A 3K6QA 5KL5A 2EPXA 2EMYA 2BBGA 2YRKA 2YU8A 3J7AG 2VE7C 2M4IA 3HTXA 4B3RE 2IHR1 4WX9A 2JWOA 4R2CA 4R8OA 2DB2A 3IWDA 2YPNA 3MHSC 1A1IA 2DIXA 4JYAE 2DLKA 2LE2A 1AH5A 2EM0A 3BIDA 4JI6E 5AE2A 2E72A 5A6BA 1A1HA 3HXLA 2A25A 2YTGA 4M0VA 1P47A 1TF3A 1F2IG 2MC6A 1YSAC 2LMZA 2LRSA 5AE1A 5F3WA 2EPUA 4X62E 4KZSA 2EL6A 4DV3E 3ADIA 4BHCA 3OTOE 2L2KB 3F6HA 1IQSA 2K4VA 2EN3A 2EMBA 2K7IA 2EOSA 2DMIA 4WSPA 1PKPA 4RH8A 2VQEE 1BBOA 1IMUA 2EMLA 4BC7A 4JI3E 2NUGA 3FIGA 4B3ME 1X3CA 5A6KA 4DR3E 2EQ1A 2UXBE 4DV6E 2V85A 2YWQA 1UBDC 4IJDA 3H09A 4JI0E 5TSEA 1GQEA 2YTJA 2NABA 2EM3A 4I8OA 2LJUA 4DV4E 2JOXA 3LLHA 1WHQA 2EOFA 1X47A 2YTNA 4DKKA 2EN8A 4J8ZA 2GPIA 4LF9E 1IQOA 4JI1E 2CSHA 1GZ6A 2JPAA 2ZM6E 3ADJA 1EKZA 2KHXA 2RSMA 4F2JC 4F6MA 3T1YE 2VRDA 1X48A 4NZVA 4DV1E 3ECRA 5KL4A 1MGTA 1JK1A 1ZAAC 3J7Yp 1G2DC 4IS1C 4NXNE 5AE3A 1IBME 5IV8B 4R2QA 2PRTA 4LU9A 2L3CA 2EOZA 2MDRA 4BCAA 2F4VE 2L92A 2UUCE 2EOMA 4GKJE 1B69A 1SR9A 4WPYA 4LF5E 1DGCA 4R2EA 3JTZA 3LMLA 4DV5E 2EMXA 1T4OA 4ZYDA 4DV2E 2V89A 2EMFA 5LL6R 1KJKA 2EWLA 2YTIA 5IT9C 1RC7A 2MC5A 2L3JA 4GZNC 3VYYA 3JAMC 2YSPA 4YHHE 2EM6A 4K0KE 1YYOA 4OX9E 4YY3E 2H36X 1ZU1A 1G2FC 2YU5A 4N4RB 5IXMB 4DUZE 2EOJA 5AC5A 2EN4A 2B7VA 4DV0E 1DQ3A 1HNXE 3KWRA 4JI5E 1T4LB 4LF8E 4P7DA 3KZYA 1LLMC 2EMIA 2WBUA 4BMJA 2EQ0A 1ZR9A 2L8TA 4X65E 4LF6E 2M7QA 1N32E 1ZBQA 2LV2A 1PJSA 2JOBA 2LUQA 4DR1E 1A1JA 1N3GA 4R2PA 3OMLA 2V83A 2EZ6A 4L5NC
chains in the Genus database with same CATH topology
1WJPA 1X6HA 2YRHA 2EPZA 2ELZA 2YTNA 3M99B 2ENAA 2M9AA 5KL7A 2EN7A 2EN8A 2MKDA 2MKNA 2EPPA 2CSHA 1UN6B 1Z1BA 2EMAA 2JPAA 2WCC3 2EJ4A 2EN6A 2YSOA 2YTOA 2EOIA 2EPRA 2LVHA 1MEYC 4WSGA 2YTQA 3EPLA 4X9JA 2EP3A 1JK2A 2YTDA 4F2JC 4F6MA 5KL3A 3EPHA 2VRDA 2EMZA 2MDGA 2RPCA 2DRPA 2ADRA 1YUIA 1A1LA 3EPJA 2LCEA 5KL4A 2EM4A 1JK1A 2ENCA 1AAYA 1ZAAC 2YTPA 1G2DC 2GHFA 1YUJA 2HGHA 4IS1C 2WBSA 4R2QA 2PRTA 2ENHA 1A1FA 4FK5C 1X6FA 5KL2A 2EOZA 2EM5A 3VHTB 4R2DA 2EMHA 2YTFA 2EM7A 2EMGA 2EMWA 2EOMA 2EOOA 1A1KA 2EL5A 5KL5A 2LT7A 2EPXA 2EMYA 2YRKA 2YU8A 1B69A 2CTDA 1DGCA 2LO3A 2EL4A 2DLQA 4R2EA 2CT1A 2GLIA 2EMXA 4R2CA 2EMFA 1KJKA 2YTIA 3MHSC 1A1IA 2DLKA 1TN9A 2I13A 2EM0A 2EOEA 3UK3C 4GZNC 2E72A 2YSPA 2EM6A 1A1HA 2A25A 2ELYA 2EM8A 2YTGA 1P47A 2EQ3A 1TF3A 2BB8A 2EOQA 1F2IG 1TF6A 2YTEA 1YSAC 2WBTA 1ZU1A 2EPUA 3MHHC 1G2FC 2YU5A 2EL6A 2EMKA 2EOJA 2RSIA 2R1FA 2EN3A 2EMBA 2EM9A 2EPCA 2DGCA 2EN4A 1X6EA 2EN2A 1X5WA 2J7JA 3EPKA 1BB8A 2EN1A 4R2RA 2EOSA 2DMIA 1NCSA 4R2AA 4R2SA 1LLMC 2EMIA 2EPAA 2EE8A 1RMDA 2WBUA 1BBOA 2EMLA 2EQ0A 2EMCA 1ZR9A 1A1GA 2EOXA 1X3CA 4F6NA 2EQ1A 2LV2A 1UBDC 4M9VC 4IJDA 2YRMA 2EM2A 1A1JA 2YTJA 2NABA 2EOHA 2EM3A 2JP9A 5KL6A 4R2PA 2D9HA 2EORA 2EOFA 2EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJP A;  1X6H A;  2YRH A;  2EPZ A;  2ELZ A;  2YTN A;  3M99 B;  2ENA A;  2M9A A;  5KL7 A;  2EN7 A;  2EN8 A;  2MKD A;  2MKN A;  2EPP A;  2CSH A;  1UN6 B;  1Z1B A;  2EMA A;  2JPA A;  2WCC 3;  2EJ4 A;  2EN6 A;  2YSO A;  2YTO A;  2EOI A;  2EPR A;  2LVH A;  1MEY C;  4WSG A;  2YTQ A;  3EPL A;  4X9J A;  2EP3 A;  1JK2 A;  2YTD A;  4F2J C;  4F6M A;  5KL3 A;  3EPH A;  2VRD A;  2EMZ A;  2MDG A;  2RPC A;  2DRP A;  2ADR A;  1YUI A;  1A1L A;  3EPJ A;  2LCE A;  5KL4 A;  2EM4 A;  1JK1 A;  2ENC A;  1AAY A;  1ZAA C;  2YTP A;  1G2D C;  2GHF A;  1YUJ A;  2HGH A;  4IS1 C;  2WBS A;  4R2Q A;  2PRT A;  2ENH A;  1A1F A;  4FK5 C;  1X6F A;  5KL2 A;  2EOZ A;  2EM5 A;  3VHT B;  4R2D A;  2EMH A;  2YTF A;  2EM7 A;  2EMG A;  2EMW A;  2EOM A;  2EOO A;  1A1K A;  2EL5 A;  5KL5 A;  2LT7 A;  2EPX A;  2EMY A;  2YRK A;  2YU8 A;  1B69 A;  2CTD A;  1DGC A;  2LO3 A;  2EL4 A;  2DLQ A;  4R2E A;  2CT1 A;  2GLI A;  2EMX A;  4R2C A;  2EMF A;  1KJK A;  2YTI A;  3MHS C;  1A1I A;  2DLK A;  1TN9 A;  2I13 A;  2EM0 A;  2EOE A;  3UK3 C;  4GZN C;  2E72 A;  2YSP A;  2EM6 A;  1A1H A;  2A25 A;  2ELY A;  2EM8 A;  2YTG A;  1P47 A;  2EQ3 A;  1TF3 A;  2BB8 A;  2EOQ A;  1F2I G;  1TF6 A;  2YTE A;  1YSA C;  2WBT A;  1ZU1 A;  2EPU A;  3MHH C;  1G2F C;  2YU5 A;  2EL6 A;  2EMK A;  2EOJ A;  2RSI A;  2R1F A;  2EN3 A;  2EMB A;  2EM9 A;  2EPC A;  2DGC A;  2EN4 A;  1X6E A;  2EN2 A;  1X5W A;  2J7J A;  3EPK A;  1BB8 A;  2EN1 A;  4R2R A;  2EOS A;  2DMI A;  1NCS A;  4R2A A;  4R2S A;  1LLM C;  2EMI A;  2EPA A;  2EE8 A;  1RMD A;  2WBU A;  1BBO A;  2EML A;  2EQ0 A;  2EMC A;  1ZR9 A;  1A1G A;  2EOX A;  1X3C A;  4F6N A;  2EQ1 A;  2LV2 A;  1UBD C;  4M9V C;  4IJD A;  2YRM A;  2EM2 A;  1A1J A;  2YTJ A;  2NAB A;  2EOH A;  2EM3 A;  2JP9 A;  5KL6 A;  4R2P A;  2D9H A;  2EOR A;  2EOF A;  2EOY A; 
#chains in the Genus database with same CATH topology
 2V88 A;  1YPN A;  2EPZ A;  2ENA A;  2L33 A;  5KL7 A;  2EN7 A;  2MKD A;  2UUA E;  2EPP A;  3THO B;  2N3H A;  2EPL X;  1NEI A;  2VF1 A;  3DF6 A;  3IWC A;  2YTO A;  2EOI A;  1BBG A;  1T38 A;  4ZYG A;  2LVH A;  1YYW A;  5AC4 A;  1RQ0 A;  4GEQ B;  1JK2 A;  2RQL A;  2EMZ A;  2RPC A;  4P78 A;  3EPJ A;  2EPO A;  2EM4 A;  2HGH A;  4F9A B;  4WYQ B;  1A1F A;  4DUY E;  2LJH A;  1KYQ A;  3QG5 C;  1X6F A;  5KL2 A;  3P1X A;  3VHT B;  4M2Z A;  2YTF A;  4B3S E;  4F54 A;  2EPM X;  3VK6 A;  2CTD A;  2EOY A;  4NXM E;  2B9D A;  2CT1 A;  2GLI A;  2F8B A;  1XNR E;  2L2N A;  1XNQ E;  4LF7 E;  2B7T A;  4O43 A;  2HHH E;  3T1H E;  1HNZ E;  2I13 A;  2N8X A;  2EOE A;  2NUE A;  3F6G A;  1FJG E;  3L00 A;  2V8Q B;  4LFB E;  4LFA E;  2WBT A;  4HEI A;  4MLV A;  3MHH C;  3HPZ A;  1T39 A;  1FKA E;  1I94 E;  3JU0 A;  2RSI A;  2EM9 A;  2DGC A;  1X6E A;  1PJT A;  2NUF A;  2LTR A;  2RTX A;  2J7J A;  3EPK A;  1BB8 A;  4JI7 E;  2CPN A;  4F9B B;  3VYX A;  4WXD A;  2RS7 A;  4R2S A;  4WFT A;  2EMC A;  5CFF E;  3ZOQ B;  1A1G A;  2M1S A;  1J5E E;  1WRJ A;  2LTS A;  2E1M A;  2EM2 A;  3MSW A;  1HR0 E;  3KZZ A;  5LMN E;  1EH7 A;  2EOH A;  1ZBT A;  5KL6 A;  5A69 A;  2JY9 A;  2EOR A;  4GKK E;  2FTX B;  5LLQ A;  2ELZ A;  3M99 B;  2M9A A;  2DMY A;  5ADZ A;  2HJJ A;  3ADL A;  4KWY A;  2VQF E;  1YZ9 A;  2EJ4 A;  3BGH A;  4B3T E;  2I9I A;  3IWB A;  2EPR A;  1N33 E;  1EH8 A;  2YT4 A;  4KHP E;  4O5G A;  4X9J A;  2EP3 A;  2YTD A;  4JI4 E;  4RHB B;  4OOG C;  5KL3 A;  5IWA E;  2DRP A;  1YUI A;  2L6M A;  1IBL E;  1EH6 A;  2LCE A;  4X64 E;  2ENC A;  1QNT A;  3C4B A;  1YUJ A;  4DR5 E;  4O4K A;  2WBS A;  1J26 A;  1YYK A;  3C6K A;  1O0W A;  4FK5 C;  5T6J A;  1GTK A;  4LF4 E;  4DR7 E;  1UHZ A;  4NHR A;  5LMU E;  2KOU A;  2EM7 A;  2LUP B;  2EL5 A;  4WXC A;  4DV7 E;  3AUZ A;  4Q28 A;  2LO3 A;  2EL4 A;  2DLQ A;  4LFC E;  3J81 C;  1N36 E;  1DI2 A;  4DR2 E;  4TUG A;  1TN9 A;  1WHN A;  3C6M A;  2WZO A;  3AV0 A;  4DMI A;  5BR8 E;  3UK3 C;  1HNW E;  4Q35 B;  5A2Q C;  1IBK E;  5FLX C;  2ELY A;  2EM8 A;  1XMQ E;  2EQ3 A;  4BS9 A;  2BB8 A;  2EOQ A;  1TF6 A;  2YTE A;  1STU A;  4L8N A;  4HTG A;  4BC9 A;  2EMK A;  1X49 A;  2V86 A;  4M30 A;  2R1F A;  4LTY A;  2B3T B;  5A6A A;  2EPC A;  1QU6 A;  4TUI A;  2EN2 A;  1X5W A;  2YZT A;  2EN1 A;  4R2R A;  4O24 A;  2FV4 B;  1NCS A;  4R2A A;  1PJQ A;  2EPA A;  2EE8 A;  1RMD A;  4MLQ A;  2L2M A;  2EOX A;  4F6N A;  4DR4 E;  1PDA A;  2E5L E;  2UXD E;  5A6B D;  4M9V C;  2YRM A;  4ZYH A;  1UIL A;  2EPK X;  2JP9 A;  3C4T A;  5DNY A;  2D9H A;  2R76 A;  2ODR C;  4BHB A;  1WJP A;  1X6H A;  2YRH A;  4JI2 E;  3THN A;  1SFE A;  2ODR D;  4ZYE A;  4JV5 E;  3BF2 A;  2FGG A;  2MKN A;  1T4N A;  4DR6 E;  2DSY A;  2JXP A;  2LBS B;  1Z1B A;  1UN6 B;  2EMA A;  2RS6 A;  2JVA A;  2WCC 3;  2UXC E;  2JYA A;  3BBG A;  2JR1 A;  2EN6 A;  2YSO A;  4BBY A;  1WXR A;  2N3G A;  5A6J A;  4WSG A;  2YTQ A;  3EQ1 A;  4R03 A;  3EPL A;  1MEY C;  3EPH A;  2KON A;  2MDG A;  5AAS A;  1XMO E;  3ADG A;  2ADR A;  3DJW A;  4X8W A;  3TQM A;  1A1L A;  4F9C B;  2EPN A;  2Q8U A;  3HQ1 A;  1YFH A;  2G7H A;  2HC5 A;  1AAY A;  2V87 A;  2YTP A;  2GHF A;  4JI8 E;  3HPS A;  2ENH A;  4AQY E;  4X66 E;  3J80 C;  2EM5 A;  2NA2 A;  2UU9 E;  4R2D A;  3RMP A;  2EMH A;  1L4S A;  2UUB E;  2EMG A;  2EMW A;  1N34 E;  2EOO A;  1A1K A;  2LT7 A;  3K6Q A;  5KL5 A;  2EPX A;  2EMY A;  2BBG A;  2YRK A;  2YU8 A;  3J7A G;  2VE7 C;  2M4I A;  3HTX A;  4B3R E;  2IHR 1;  4WX9 A;  2JWO A;  4R2C A;  4R8O A;  2DB2 A;  3IWD A;  2YPN A;  3MHS C;  1A1I A;  2DIX A;  4JYA E;  2DLK A;  2LE2 A;  1AH5 A;  2EM0 A;  3BID A;  4JI6 E;  5AE2 A;  2E72 A;  5A6B A;  1A1H A;  3HXL A;  2A25 A;  2YTG A;  4M0V A;  1P47 A;  1TF3 A;  1F2I G;  2MC6 A;  1YSA C;  2LMZ A;  2LRS A;  5AE1 A;  5F3W A;  2EPU A;  4X62 E;  4KZS A;  2EL6 A;  4DV3 E;  3ADI A;  4BHC A;  3OTO E;  2L2K B;  3F6H A;  1IQS A;  2K4V A;  2EN3 A;  2EMB A;  2K7I A;  2EOS A;  2DMI A;  4WSP A;  1PKP A;  4RH8 A;  2VQE E;  1BBO A;  1IMU A;  2EML A;  4BC7 A;  4JI3 E;  2NUG A;  3FIG A;  4B3M E;  1X3C A;  5A6K A;  4DR3 E;  2EQ1 A;  2UXB E;  4DV6 E;  2V85 A;  2YWQ A;  1UBD C;  4IJD A;  3H09 A;  4JI0 E;  5TSE A;  1GQE A;  2YTJ A;  2NAB A;  2EM3 A;  4I8O A;  2LJU A;  4DV4 E;  2JOX A;  3LLH A;  1WHQ A;  2EOF A;  1X47 A;  2YTN A;  4DKK A;  2EN8 A;  4J8Z A;  2GPI A;  4LF9 E;  1IQO A;  4JI1 E;  2CSH A;  1GZ6 A;  2JPA A;  2ZM6 E;  3ADJ A;  1EKZ A;  2KHX A;  2RSM A;  4F2J C;  4F6M A;  3T1Y E;  2VRD A;  1X48 A;  4NZV A;  4DV1 E;  3ECR A;  5KL4 A;  1MGT A;  1JK1 A;  1ZAA C;  3J7Y p;  1G2D C;  4IS1 C;  4NXN E;  5AE3 A;  1IBM E;  5IV8 B;  4R2Q A;  2PRT A;  4LU9 A;  2L3C A;  2EOZ A;  2MDR A;  4BCA A;  2F4V E;  2L92 A;  2UUC E;  2EOM A;  4GKJ E;  1B69 A;  1SR9 A;  4WPY A;  4LF5 E;  1DGC A;  4R2E A;  3JTZ A;  3LML A;  4DV5 E;  2EMX A;  1T4O A;  4ZYD A;  4DV2 E;  2V89 A;  2EMF A;  5LL6 R;  1KJK A;  2EWL A;  2YTI A;  5IT9 C;  1RC7 A;  2MC5 A;  2L3J A;  4GZN C;  3VYY A;  3JAM C;  2YSP A;  4YHH E;  2EM6 A;  4K0K E;  1YYO A;  4OX9 E;  4YY3 E;  2H36 X;  1ZU1 A;  1G2F C;  2YU5 A;  4N4R B;  5IXM B;  4DUZ E;  2EOJ A;  5AC5 A;  2EN4 A;  2B7V A;  4DV0 E;  1DQ3 A;  1HNX E;  3KWR A;  4JI5 E;  1T4L B;  4LF8 E;  4P7D A;  3KZY A;  1LLM C;  2EMI A;  2WBU A;  4BMJ A;  2EQ0 A;  1ZR9 A;  2L8T A;  4X65 E;  4LF6 E;  2M7Q A;  1N32 E;  1ZBQ A;  2LV2 A;  1PJS A;  2JOB A;  2LUQ A;  4DR1 E;  1A1J A;  1N3G A;  4R2P A;  3OML A;  2V83 A;  2EZ6 A;  4L5N C; 
#chains in the Genus database with same CATH homology
 1WJP A;  1X6H A;  2YRH A;  2EPZ A;  2ELZ A;  2YTN A;  3M99 B;  2ENA A;  2M9A A;  5KL7 A;  2EN7 A;  2EN8 A;  2MKD A;  2MKN A;  2EPP A;  2CSH A;  1UN6 B;  1Z1B A;  2EMA A;  2JPA A;  2WCC 3;  2EJ4 A;  2EN6 A;  2YSO A;  2YTO A;  2EOI A;  2EPR A;  2LVH A;  1MEY C;  4WSG A;  2YTQ A;  3EPL A;  4X9J A;  2EP3 A;  1JK2 A;  2YTD A;  4F2J C;  4F6M A;  5KL3 A;  3EPH A;  2VRD A;  2EMZ A;  2MDG A;  2RPC A;  2DRP A;  2ADR A;  1YUI A;  1A1L A;  3EPJ A;  2LCE A;  5KL4 A;  2EM4 A;  1JK1 A;  2ENC A;  1AAY A;  1ZAA C;  2YTP A;  1G2D C;  2GHF A;  1YUJ A;  2HGH A;  4IS1 C;  2WBS A;  4R2Q A;  2PRT A;  2ENH A;  1A1F A;  4FK5 C;  1X6F A;  5KL2 A;  2EOZ A;  2EM5 A;  3VHT B;  4R2D A;  2EMH A;  2YTF A;  2EM7 A;  2EMG A;  2EMW A;  2EOM A;  2EOO A;  1A1K A;  2EL5 A;  5KL5 A;  2LT7 A;  2EPX A;  2EMY A;  2YRK A;  2YU8 A;  1B69 A;  2CTD A;  1DGC A;  2LO3 A;  2EL4 A;  2DLQ A;  4R2E A;  2CT1 A;  2GLI A;  2EMX A;  4R2C A;  2EMF A;  1KJK A;  2YTI A;  3MHS C;  1A1I A;  2DLK A;  1TN9 A;  2I13 A;  2EM0 A;  2EOE A;  3UK3 C;  4GZN C;  2E72 A;  2YSP A;  2EM6 A;  1A1H A;  2A25 A;  2ELY A;  2EM8 A;  2YTG A;  1P47 A;  2EQ3 A;  1TF3 A;  2BB8 A;  2EOQ A;  1F2I G;  1TF6 A;  2YTE A;  1YSA C;  2WBT A;  1ZU1 A;  2EPU A;  3MHH C;  1G2F C;  2YU5 A;  2EL6 A;  2EMK A;  2EOJ A;  2RSI A;  2R1F A;  2EN3 A;  2EMB A;  2EM9 A;  2EPC A;  2DGC A;  2EN4 A;  1X6E A;  2EN2 A;  1X5W A;  2J7J A;  3EPK A;  1BB8 A;  2EN1 A;  4R2R A;  2EOS A;  2DMI A;  1NCS A;  4R2A A;  4R2S A;  1LLM C;  2EMI A;  2EPA A;  2EE8 A;  1RMD A;  2WBU A;  1BBO A;  2EML A;  2EQ0 A;  2EMC A;  1ZR9 A;  1A1G A;  2EOX A;  1X3C A;  4F6N A;  2EQ1 A;  2LV2 A;  1UBD C;  4M9V C;  4IJD A;  2YRM A;  2EM2 A;  1A1J A;  2YTJ A;  2NAB A;  2EOH A;  2EM3 A;  2JP9 A;  5KL6 A;  4R2P A;  2D9H A;  2EOR A;  2EOF A;  2EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...