2NABA

Nizp1-c2hr zinc finger structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
41
structure length
41
Chain Sequence
GAMEVQTSQKSYVCPNCGKIFRWRVNFIRHLRSRREQKPHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 496
publication title Structural basis for PHDVC5HCHNSD1-C2HRNizp1 interaction: implications for Sotos syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 8
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2015-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2nabA01
2EPUA 4IJDA 3EPKA 1A1LA 2EE8A 1G2FC 3UK3C 2YTJA 2JP9A 2CSHA 2EPPA 1X6EA 2EM5A 2DGCA 2EPAA 2EM9A 2EOIA 2WBSA 2EMWA 5KL7A 2EMKA 4WSGA 5KL3A 4R2RA 3EPLA 2LVHA 2EOZA 2VRDA 1LLMC 2A25A 2EJ4A 1RMDA 2EOYA 2EORA 2MDGA 4R2DA 2LT7A 1A1IA 1A1FA 4R2CA 2ENCA 4F6MA 2EOSA 2EM2A 2ADRA 2EOXA 2EMLA 2DLQA 1G2DC 2EMIA 2EPXA 2HGHA 1UN6B 2EM0A 4M9VC 2YTGA 2YSPA 2EOEA 3EPHA 2GLIA 5KL5A 2YTFA 2YTDA 2DLKA 2ELZA 1X3CA 1A1KA 4IS1C 2RSIA 2M9AA 1UBDC 2EN2A 3VHTB 2JPAA 2EPCA 5KL6A 1X6HA 2ENAA 2DRPA 2BB8A 2EMCA 1X6FA 2EL4A 2EOOA 2EP3A 2EN8A 1A1JA 1BBOA 1ZR9A 4R2EA 2DMIA 2LO3A 2WCC3 2YRMA 1P47A 2GHFA 2YU8A 2EMXA 2RPCA 2EPZA 2EM6A 4R2AA 2YTOA 4F2JC 2YTQA 1X5WA 1TF6A 2WBTA 2EQ1A 1DGCA 2EN1A 2MKDA 2LV2A 2EOQA 1NCSA 2EN4A 4R2QA 2EOMA 2I13A 2YSOA 1Z1BA 2EMBA 2EM8A 3MHHC 4FK5C 2YRHA 1ZAAC 2ENHA 3M99B 1YUIA 4F6NA 2ELYA 2R1FA 2WBUA 3EPJA 2EMFA 1JK2A 4R2SA 2EMAA 2EPRA 1WJPA 2YTEA 1KJKA 1TN9A 1A1HA 2E72A 1TF3A 2EMYA 2J7JA 1JK1A 2EN6A 1B69A 2PRTA 2EN3A 2YTIA 2LCEA 1A1GA 2NABA 2MKNA 2EL5A 2EM4A 2EL6A 2EMGA 1F2IG 1BB8A 2YTPA 4R2PA 2CTDA 2EM3A 2EMZA 5KL2A 2EQ0A 1YSAC 2EM7A 1MEYC 2EOHA 1AAYA 2CT1A 2EOJA 1YUJA 5KL4A 2YTNA 2EOFA 3MHSC 2YRKA 4X9JA 1ZU1A 4GZNC 2EN7A 2D9HA 2YU5A 2EMHA 2EQ3A
chains in the Genus database with same CATH superfamily
2H36X 3RMPA 2LUPB 2JXPA 1A1LA 2HC5A 1N33E 3UK3C 1GQEA 2EPMX 4BBYA 2DGCA 2LMZA 3OTOE 2MC5A 2M7QA 1O0WA 4F9BB 5KL3A 4R2RA 4LFBE 1HNWE 4O24A 2VRDA 1PJTA 1LLMC 2A25A 2WZOA 4LU9A 1RMDA 2EOYA 2DIXA 4F6MA 2EM2A 2RTXA 2MC6A 2EMIA 4P78A 2EM0A 3EPHA 2YSPA 3BGHA 2EZ6A 3IWCA 3LMLA 1UBDC 2EN2A 1YPNA 5CFFE 1AH5A 1X6HA 2E1MA 4X62E 4JI2E 4DUZE 2EMCA 3ADGA 3T1HE 4LF8E 2LJUA 2EP3A 4MLVA 2LJHA 2E5LE 4BS9A 1QNTA 2EN8A 2EPLX 2YRMA 2N3GA 4O4KA 4LFAE 1X49A 1N32E 2L2MA 4BHCA 2YTOA 4F2JC 5A6JA 3C6KA 2MKDA 3HPSA 3KZZA 1BBGA 4JI1E 2I13A 1PJSA 2YSOA 4DR6E 2L3CA 2R76A 2EM8A 2ODRD 2B7TA 4O43A 4BC7A 4LF6E 2LTSA 4DV2E 2UUBE 2ELYA 3VK6A 2WBUA 1X48A 2EMFA 2EPNA 4R2SA 4DUYE 3IWBA 2ODRC 3C4TA 2E72A 4M2ZA 1JK1A 3AUZA 3VYXA 4YY3E 1B69A 2PRTA 2YTIA 4KHPE 4LFCE 4GKJE 4JI7E 4R03A 1F2IG 3THNA 2JVAA 4X64E 2FV4B 2EMZA 4ZYEA 2Q8UA 2EOHA 4BCAA 4ZYGA 3BF2A 5A6AA 2EOJA 2K7IA 1PKPA 2YRKA 1N3GA 4M30A 2VQFE 4Q28A 2D9HA 4BMJA 4F9CB 1DI2A 3MSWA 1SR9A 2M1SA 2KHXA 2UXBE 5F3WA 2JP9A 4KWYA 4WXDA 1T39A 1YFHA 2EPAA 2EOIA 2WBSA 4JI6E 2EPKX 2EMKA 4WSGA 3J81C 4M0VA 2N8XA 2EJ4A 2EORA 2JR1A 2DMYA 1A1IA 1A1FA 1WHNA 1STUA 2L6MA 1G2DC 2HGHA 3KZYA 4M9VC 2M4IA 2GLIA 5KL5A 4LF4E 2YTFA 5BR8E 2DLKA 1WHQA 1X3CA 5A69A 2M9AA 4RHBB 5AASA 2L33A 2ENAA 1EKZA 2DRPA 5AE2A 3F6HA 4YHHE 2MDRA 3ADLA 2N3HA 2UUAE 1I94E 2NUEA 1A1JA 1ZR9A 2DMIA 1P47A 1XMOE 2NUFA 2EMXA 2RPCA 2EPZA 4R2AA 2YTQA 1X5WA 1DGCA 2JWOA 2EN4A 2EOMA 2V86A 4DKKA 2KOUA 2EMBA 1T4LB 2L3JA 4O5GA 3C6MA 4K0KE 4LTYA 2LE2A 1EH8A 3J7AG 4RH8A 2EPRA 3THOB 1QU6A 1WJPA 5AC5A 5A6KA 1TN9A 5IWAE 1L4SA 2GPIA 1J5EE 4WSPA 1HNZE 4NXNE 1YYWA 5AE3A 2EN6A 2I9IA 4DR3E 2FTXB 2LCEA 3K6QA 1T38A 4LF9E 3HTXA 4WYQB 2L8TA 2YTPA 2CTDA 4JI4E 5KL2A 2EM7A 1MEYC 2JY9A 2CT1A 1YUJA 2EOFA 1X47A 4LF7E 4WXCA 2V83A 1KYQA 3ADJA 2EMHA 1J26A 4WPYA 2EPUA 4JI0E 4GEQB 4JI5E 4KZSA 4OOGC 1IBKE 2CSHA 2L2NA 5LLQA 2DSYA 4NZVA 4DMIA 4DR7E 2EPPA 1X6EA 1WXRA 1PDAA 1PJQA 5KL7A 2YT4A 3T1YE 2RQLA 1XNRE 2MDGA 2LT7A 4R2DA 4JI3E 1SFEA 4R2CA 2ENCA 2EOSA 5LL6R 5IT9C 2EOXA 4DV3E 2EMLA 4NHRA 1GZ6A 2EPXA 2B3TB 1T4NA 2B7VA 3P1XA 4B3RE 1FJGE 4OX9E 2YTDA 1A1KA 2F4VE 3VHTB 3F6GA 4BHBA 1EH7A 2EOOA 4N4RB 2UUCE 4JV5E 5TSEA 1BBOA 1IBME 2LUQA 3ZOQB 2GHFA 2YU8A 1MGTA 2L92A 3HPZA 3J80C 3J7Yp 4DV5E 4JYAE 4MLQA 4DV7E 5IV8B 1HR0E 1RC7A 1TF6A 2WBTA 2EN1A 4B3ME 1HNXE 2FGGA 3JAMC 3L00A 4DV6E 2HJJA 3MHHC 1ZBTA 1ZAAC 2L2KB 4L5NC 4DV1E 4F6NA 4I8OA 3BBGA 1JK2A 2YPNA 4GKKE 1IQSA 3TQMA 2EMAA 2V89A 2YTEA 2G7HA 2JOBA 2BBGA 3BIDA 4X8WA 2F8BA 2IHR1 3JU0A 2J7JA 5A6BD 1GTKA 2EN3A 2RSMA 4B3TE 2NABA 4JI8E 2MKNA 2EM4A 1IBLE 4R2PA 5A2QC 2EM3A 1N34E 4X65E 2EQ0A 3IWDA 1ZBQA 1N36E 3KWRA 2NUGA 4DR4E 2V88A 1AAYA 5KL4A 3MHSC 4ZYHA 4P7DA 4J8ZA 4HTGA 2EN7A 2YU5A 2EQ3A 2LRSA 2YZTA 4IJDA 3EPKA 2K4VA 2EE8A 1G2FC 2YTJA 1IQOA 1DQ3A 4WFTA 3ADIA 2EM5A 2EM9A 4WX9A 2EMWA 2VF1A 3DF6A 3H09A 4DR2E 3EPLA 2LVHA 2EOZA 2UXCE 1IMUA 3QG5C 5FLXC 2UXDE 2EWLA 2ADRA 1XMQE 2DLQA 1UN6B 1YZ9A 2RS7A 2YTGA 2EOEA 2RS6A 5A6BA 3DJWA 2ELZA 2YWQA 4BC9A 4IS1C 2RSIA 5T6JA 2JPAA 2EPCA 5KL6A 1YYKA 2DB2A 1RQ0A 4ZYDA 2BB8A 1X6FA 2EL4A 2V8QB 2JYAA 4X66E 4Q35B 2JOXA 1EH6A 4R2EA 2LO3A 2WCC3 2EPOA 3EQ1A 4TUIA 1T4OA 4HEIA 2EM6A 4DR1E 5DNYA 4B3SE 1WRJA 2CPNA 3HQ1A 2EQ1A 4L8NA 2UU9E 2LV2A 2EOQA 1NCSA 4R2QA 4LF5E 4DV4E 4NXME 1UILA 4DR5E 1Z1BA 5ADZA 3HXLA 4FK5C 2YRHA 5LMUE 2ENHA 3M99B 1YYOA 4DV0E 4F54A 1YUIA 2R1FA 4F9AB 3EPJA 1FKAE 5AE1A 2VE7C 1KJKA 2LBSB 2V85A 3LLHA 1A1HA 2VQEE 1TF3A 2KONA 2EMYA 3VYYA 2NA2A 2ZM6E 1XNQE 1A1GA 2EL5A 1NEIA 2EMGA 2EL6A 3JTZA 1BB8A 5IXMB 1UHZA 1YSAC 2B9DA 5LMNE 2V87A 4TUGA 3FIGA 4AQYE 3OMLA 2YTNA 4R8OA 4X9JA 1ZU1A 4GZNC 2HHHE 5AC4A 2LTRA 3AV0A 3ECRA 3C4BA
chains in the Genus database with same CATH topology
2EPUA 4IJDA 3EPKA 1A1LA 2EE8A 1G2FC 3UK3C 2YTJA 2JP9A 2CSHA 2EPPA 1X6EA 2EM5A 2DGCA 2EPAA 2EM9A 2EOIA 2WBSA 2EMWA 5KL7A 2EMKA 4WSGA 5KL3A 4R2RA 3EPLA 2LVHA 2EOZA 2VRDA 1LLMC 2A25A 2EJ4A 1RMDA 2EOYA 2EORA 2MDGA 4R2DA 2LT7A 1A1IA 1A1FA 4R2CA 2ENCA 4F6MA 2EOSA 2EM2A 2ADRA 2EOXA 2EMLA 2DLQA 1G2DC 2EMIA 2EPXA 2HGHA 1UN6B 2EM0A 4M9VC 2YTGA 2YSPA 2EOEA 3EPHA 2GLIA 5KL5A 2YTFA 2YTDA 2DLKA 2ELZA 1X3CA 1A1KA 4IS1C 2RSIA 2M9AA 1UBDC 2EN2A 3VHTB 2JPAA 2EPCA 5KL6A 1X6HA 2ENAA 2DRPA 2BB8A 2EMCA 1X6FA 2EL4A 2EOOA 2EP3A 2EN8A 1A1JA 1BBOA 1ZR9A 4R2EA 2DMIA 2LO3A 2WCC3 2YRMA 1P47A 2GHFA 2YU8A 2EMXA 2RPCA 2EPZA 2EM6A 4R2AA 2YTOA 4F2JC 2YTQA 1X5WA 1TF6A 2WBTA 2EQ1A 1DGCA 2EN1A 2MKDA 2LV2A 2EOQA 1NCSA 2EN4A 4R2QA 2EOMA 2I13A 2YSOA 1Z1BA 2EMBA 2EM8A 3MHHC 4FK5C 2YRHA 1ZAAC 2ENHA 3M99B 1YUIA 4F6NA 2ELYA 2R1FA 2WBUA 3EPJA 2EMFA 1JK2A 4R2SA 2EMAA 2EPRA 1WJPA 2YTEA 1KJKA 1TN9A 1A1HA 2E72A 1TF3A 2EMYA 2J7JA 1JK1A 2EN6A 1B69A 2PRTA 2EN3A 2YTIA 2LCEA 1A1GA 2NABA 2MKNA 2EL5A 2EM4A 2EL6A 2EMGA 1F2IG 1BB8A 2YTPA 4R2PA 2CTDA 2EM3A 2EMZA 5KL2A 2EQ0A 1YSAC 2EM7A 1MEYC 2EOHA 1AAYA 2CT1A 2EOJA 1YUJA 5KL4A 2YTNA 2EOFA 3MHSC 2YRKA 4X9JA 1ZU1A 4GZNC 2EN7A 2D9HA 2YU5A 2EMHA 2EQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPU A;  4IJD A;  3EPK A;  1A1L A;  2EE8 A;  1G2F C;  3UK3 C;  2YTJ A;  2JP9 A;  2CSH A;  2EPP A;  1X6E A;  2EM5 A;  2DGC A;  2EPA A;  2EM9 A;  2EOI A;  2WBS A;  2EMW A;  5KL7 A;  2EMK A;  4WSG A;  5KL3 A;  4R2R A;  3EPL A;  2LVH A;  2EOZ A;  2VRD A;  1LLM C;  2A25 A;  2EJ4 A;  1RMD A;  2EOY A;  2EOR A;  2MDG A;  4R2D A;  2LT7 A;  1A1I A;  1A1F A;  4R2C A;  2ENC A;  4F6M A;  2EOS A;  2EM2 A;  2ADR A;  2EOX A;  2EML A;  2DLQ A;  1G2D C;  2EMI A;  2EPX A;  2HGH A;  1UN6 B;  2EM0 A;  4M9V C;  2YTG A;  2YSP A;  2EOE A;  3EPH A;  2GLI A;  5KL5 A;  2YTF A;  2YTD A;  2DLK A;  2ELZ A;  1X3C A;  1A1K A;  4IS1 C;  2RSI A;  2M9A A;  1UBD C;  2EN2 A;  3VHT B;  2JPA A;  2EPC A;  5KL6 A;  1X6H A;  2ENA A;  2DRP A;  2BB8 A;  2EMC A;  1X6F A;  2EL4 A;  2EOO A;  2EP3 A;  2EN8 A;  1A1J A;  1BBO A;  1ZR9 A;  4R2E A;  2DMI A;  2LO3 A;  2WCC 3;  2YRM A;  1P47 A;  2GHF A;  2YU8 A;  2EMX A;  2RPC A;  2EPZ A;  2EM6 A;  4R2A A;  2YTO A;  4F2J C;  2YTQ A;  1X5W A;  1TF6 A;  2WBT A;  2EQ1 A;  1DGC A;  2EN1 A;  2MKD A;  2LV2 A;  2EOQ A;  1NCS A;  2EN4 A;  4R2Q A;  2EOM A;  2I13 A;  2YSO A;  1Z1B A;  2EMB A;  2EM8 A;  3MHH C;  4FK5 C;  2YRH A;  1ZAA C;  2ENH A;  3M99 B;  1YUI A;  4F6N A;  2ELY A;  2R1F A;  2WBU A;  3EPJ A;  2EMF A;  1JK2 A;  4R2S A;  2EMA A;  2EPR A;  1WJP A;  2YTE A;  1KJK A;  1TN9 A;  1A1H A;  2E72 A;  1TF3 A;  2EMY A;  2J7J A;  1JK1 A;  2EN6 A;  1B69 A;  2PRT A;  2EN3 A;  2YTI A;  2LCE A;  1A1G A;  2NAB A;  2MKN A;  2EL5 A;  2EM4 A;  2EL6 A;  2EMG A;  1F2I G;  1BB8 A;  2YTP A;  4R2P A;  2CTD A;  2EM3 A;  2EMZ A;  5KL2 A;  2EQ0 A;  1YSA C;  2EM7 A;  1MEY C;  2EOH A;  1AAY A;  2CT1 A;  2EOJ A;  1YUJ A;  5KL4 A;  2YTN A;  2EOF A;  3MHS C;  2YRK A;  4X9J A;  1ZU1 A;  4GZN C;  2EN7 A;  2D9H A;  2YU5 A;  2EMH A;  2EQ3 A; 
#chains in the Genus database with same CATH topology
 2H36 X;  3RMP A;  2LUP B;  2JXP A;  1A1L A;  2HC5 A;  1N33 E;  3UK3 C;  1GQE A;  2EPM X;  4BBY A;  2DGC A;  2LMZ A;  3OTO E;  2MC5 A;  2M7Q A;  1O0W A;  4F9B B;  5KL3 A;  4R2R A;  4LFB E;  1HNW E;  4O24 A;  2VRD A;  1PJT A;  1LLM C;  2A25 A;  2WZO A;  4LU9 A;  1RMD A;  2EOY A;  2DIX A;  4F6M A;  2EM2 A;  2RTX A;  2MC6 A;  2EMI A;  4P78 A;  2EM0 A;  3EPH A;  2YSP A;  3BGH A;  2EZ6 A;  3IWC A;  3LML A;  1UBD C;  2EN2 A;  1YPN A;  5CFF E;  1AH5 A;  1X6H A;  2E1M A;  4X62 E;  4JI2 E;  4DUZ E;  2EMC A;  3ADG A;  3T1H E;  4LF8 E;  2LJU A;  2EP3 A;  4MLV A;  2LJH A;  2E5L E;  4BS9 A;  1QNT A;  2EN8 A;  2EPL X;  2YRM A;  2N3G A;  4O4K A;  4LFA E;  1X49 A;  1N32 E;  2L2M A;  4BHC A;  2YTO A;  4F2J C;  5A6J A;  3C6K A;  2MKD A;  3HPS A;  3KZZ A;  1BBG A;  4JI1 E;  2I13 A;  1PJS A;  2YSO A;  4DR6 E;  2L3C A;  2R76 A;  2EM8 A;  2ODR D;  2B7T A;  4O43 A;  4BC7 A;  4LF6 E;  2LTS A;  4DV2 E;  2UUB E;  2ELY A;  3VK6 A;  2WBU A;  1X48 A;  2EMF A;  2EPN A;  4R2S A;  4DUY E;  3IWB A;  2ODR C;  3C4T A;  2E72 A;  4M2Z A;  1JK1 A;  3AUZ A;  3VYX A;  4YY3 E;  1B69 A;  2PRT A;  2YTI A;  4KHP E;  4LFC E;  4GKJ E;  4JI7 E;  4R03 A;  1F2I G;  3THN A;  2JVA A;  4X64 E;  2FV4 B;  2EMZ A;  4ZYE A;  2Q8U A;  2EOH A;  4BCA A;  4ZYG A;  3BF2 A;  5A6A A;  2EOJ A;  2K7I A;  1PKP A;  2YRK A;  1N3G A;  4M30 A;  2VQF E;  4Q28 A;  2D9H A;  4BMJ A;  4F9C B;  1DI2 A;  3MSW A;  1SR9 A;  2M1S A;  2KHX A;  2UXB E;  5F3W A;  2JP9 A;  4KWY A;  4WXD A;  1T39 A;  1YFH A;  2EPA A;  2EOI A;  2WBS A;  4JI6 E;  2EPK X;  2EMK A;  4WSG A;  3J81 C;  4M0V A;  2N8X A;  2EJ4 A;  2EOR A;  2JR1 A;  2DMY A;  1A1I A;  1A1F A;  1WHN A;  1STU A;  2L6M A;  1G2D C;  2HGH A;  3KZY A;  4M9V C;  2M4I A;  2GLI A;  5KL5 A;  4LF4 E;  2YTF A;  5BR8 E;  2DLK A;  1WHQ A;  1X3C A;  5A69 A;  2M9A A;  4RHB B;  5AAS A;  2L33 A;  2ENA A;  1EKZ A;  2DRP A;  5AE2 A;  3F6H A;  4YHH E;  2MDR A;  3ADL A;  2N3H A;  2UUA E;  1I94 E;  2NUE A;  1A1J A;  1ZR9 A;  2DMI A;  1P47 A;  1XMO E;  2NUF A;  2EMX A;  2RPC A;  2EPZ A;  4R2A A;  2YTQ A;  1X5W A;  1DGC A;  2JWO A;  2EN4 A;  2EOM A;  2V86 A;  4DKK A;  2KOU A;  2EMB A;  1T4L B;  2L3J A;  4O5G A;  3C6M A;  4K0K E;  4LTY A;  2LE2 A;  1EH8 A;  3J7A G;  4RH8 A;  2EPR A;  3THO B;  1QU6 A;  1WJP A;  5AC5 A;  5A6K A;  1TN9 A;  5IWA E;  1L4S A;  2GPI A;  1J5E E;  4WSP A;  1HNZ E;  4NXN E;  1YYW A;  5AE3 A;  2EN6 A;  2I9I A;  4DR3 E;  2FTX B;  2LCE A;  3K6Q A;  1T38 A;  4LF9 E;  3HTX A;  4WYQ B;  2L8T A;  2YTP A;  2CTD A;  4JI4 E;  5KL2 A;  2EM7 A;  1MEY C;  2JY9 A;  2CT1 A;  1YUJ A;  2EOF A;  1X47 A;  4LF7 E;  4WXC A;  2V83 A;  1KYQ A;  3ADJ A;  2EMH A;  1J26 A;  4WPY A;  2EPU A;  4JI0 E;  4GEQ B;  4JI5 E;  4KZS A;  4OOG C;  1IBK E;  2CSH A;  2L2N A;  5LLQ A;  2DSY A;  4NZV A;  4DMI A;  4DR7 E;  2EPP A;  1X6E A;  1WXR A;  1PDA A;  1PJQ A;  5KL7 A;  2YT4 A;  3T1Y E;  2RQL A;  1XNR E;  2MDG A;  2LT7 A;  4R2D A;  4JI3 E;  1SFE A;  4R2C A;  2ENC A;  2EOS A;  5LL6 R;  5IT9 C;  2EOX A;  4DV3 E;  2EML A;  4NHR A;  1GZ6 A;  2EPX A;  2B3T B;  1T4N A;  2B7V A;  3P1X A;  4B3R E;  1FJG E;  4OX9 E;  2YTD A;  1A1K A;  2F4V E;  3VHT B;  3F6G A;  4BHB A;  1EH7 A;  2EOO A;  4N4R B;  2UUC E;  4JV5 E;  5TSE A;  1BBO A;  1IBM E;  2LUQ A;  3ZOQ B;  2GHF A;  2YU8 A;  1MGT A;  2L92 A;  3HPZ A;  3J80 C;  3J7Y p;  4DV5 E;  4JYA E;  4MLQ A;  4DV7 E;  5IV8 B;  1HR0 E;  1RC7 A;  1TF6 A;  2WBT A;  2EN1 A;  4B3M E;  1HNX E;  2FGG A;  3JAM C;  3L00 A;  4DV6 E;  2HJJ A;  3MHH C;  1ZBT A;  1ZAA C;  2L2K B;  4L5N C;  4DV1 E;  4F6N A;  4I8O A;  3BBG A;  1JK2 A;  2YPN A;  4GKK E;  1IQS A;  3TQM A;  2EMA A;  2V89 A;  2YTE A;  2G7H A;  2JOB A;  2BBG A;  3BID A;  4X8W A;  2F8B A;  2IHR 1;  3JU0 A;  2J7J A;  5A6B D;  1GTK A;  2EN3 A;  2RSM A;  4B3T E;  2NAB A;  4JI8 E;  2MKN A;  2EM4 A;  1IBL E;  4R2P A;  5A2Q C;  2EM3 A;  1N34 E;  4X65 E;  2EQ0 A;  3IWD A;  1ZBQ A;  1N36 E;  3KWR A;  2NUG A;  4DR4 E;  2V88 A;  1AAY A;  5KL4 A;  3MHS C;  4ZYH A;  4P7D A;  4J8Z A;  4HTG A;  2EN7 A;  2YU5 A;  2EQ3 A;  2LRS A;  2YZT A;  4IJD A;  3EPK A;  2K4V A;  2EE8 A;  1G2F C;  2YTJ A;  1IQO A;  1DQ3 A;  4WFT A;  3ADI A;  2EM5 A;  2EM9 A;  4WX9 A;  2EMW A;  2VF1 A;  3DF6 A;  3H09 A;  4DR2 E;  3EPL A;  2LVH A;  2EOZ A;  2UXC E;  1IMU A;  3QG5 C;  5FLX C;  2UXD E;  2EWL A;  2ADR A;  1XMQ E;  2DLQ A;  1UN6 B;  1YZ9 A;  2RS7 A;  2YTG A;  2EOE A;  2RS6 A;  5A6B A;  3DJW A;  2ELZ A;  2YWQ A;  4BC9 A;  4IS1 C;  2RSI A;  5T6J A;  2JPA A;  2EPC A;  5KL6 A;  1YYK A;  2DB2 A;  1RQ0 A;  4ZYD A;  2BB8 A;  1X6F A;  2EL4 A;  2V8Q B;  2JYA A;  4X66 E;  4Q35 B;  2JOX A;  1EH6 A;  4R2E A;  2LO3 A;  2WCC 3;  2EPO A;  3EQ1 A;  4TUI A;  1T4O A;  4HEI A;  2EM6 A;  4DR1 E;  5DNY A;  4B3S E;  1WRJ A;  2CPN A;  3HQ1 A;  2EQ1 A;  4L8N A;  2UU9 E;  2LV2 A;  2EOQ A;  1NCS A;  4R2Q A;  4LF5 E;  4DV4 E;  4NXM E;  1UIL A;  4DR5 E;  1Z1B A;  5ADZ A;  3HXL A;  4FK5 C;  2YRH A;  5LMU E;  2ENH A;  3M99 B;  1YYO A;  4DV0 E;  4F54 A;  1YUI A;  2R1F A;  4F9A B;  3EPJ A;  1FKA E;  5AE1 A;  2VE7 C;  1KJK A;  2LBS B;  2V85 A;  3LLH A;  1A1H A;  2VQE E;  1TF3 A;  2KON A;  2EMY A;  3VYY A;  2NA2 A;  2ZM6 E;  1XNQ E;  1A1G A;  2EL5 A;  1NEI A;  2EMG A;  2EL6 A;  3JTZ A;  1BB8 A;  5IXM B;  1UHZ A;  1YSA C;  2B9D A;  5LMN E;  2V87 A;  4TUG A;  3FIG A;  4AQY E;  3OML A;  2YTN A;  4R8O A;  4X9J A;  1ZU1 A;  4GZN C;  2HHH E;  5AC4 A;  2LTR A;  3AV0 A;  3ECR A;  3C4B A; 
#chains in the Genus database with same CATH homology
 2EPU A;  4IJD A;  3EPK A;  1A1L A;  2EE8 A;  1G2F C;  3UK3 C;  2YTJ A;  2JP9 A;  2CSH A;  2EPP A;  1X6E A;  2EM5 A;  2DGC A;  2EPA A;  2EM9 A;  2EOI A;  2WBS A;  2EMW A;  5KL7 A;  2EMK A;  4WSG A;  5KL3 A;  4R2R A;  3EPL A;  2LVH A;  2EOZ A;  2VRD A;  1LLM C;  2A25 A;  2EJ4 A;  1RMD A;  2EOY A;  2EOR A;  2MDG A;  4R2D A;  2LT7 A;  1A1I A;  1A1F A;  4R2C A;  2ENC A;  4F6M A;  2EOS A;  2EM2 A;  2ADR A;  2EOX A;  2EML A;  2DLQ A;  1G2D C;  2EMI A;  2EPX A;  2HGH A;  1UN6 B;  2EM0 A;  4M9V C;  2YTG A;  2YSP A;  2EOE A;  3EPH A;  2GLI A;  5KL5 A;  2YTF A;  2YTD A;  2DLK A;  2ELZ A;  1X3C A;  1A1K A;  4IS1 C;  2RSI A;  2M9A A;  1UBD C;  2EN2 A;  3VHT B;  2JPA A;  2EPC A;  5KL6 A;  1X6H A;  2ENA A;  2DRP A;  2BB8 A;  2EMC A;  1X6F A;  2EL4 A;  2EOO A;  2EP3 A;  2EN8 A;  1A1J A;  1BBO A;  1ZR9 A;  4R2E A;  2DMI A;  2LO3 A;  2WCC 3;  2YRM A;  1P47 A;  2GHF A;  2YU8 A;  2EMX A;  2RPC A;  2EPZ A;  2EM6 A;  4R2A A;  2YTO A;  4F2J C;  2YTQ A;  1X5W A;  1TF6 A;  2WBT A;  2EQ1 A;  1DGC A;  2EN1 A;  2MKD A;  2LV2 A;  2EOQ A;  1NCS A;  2EN4 A;  4R2Q A;  2EOM A;  2I13 A;  2YSO A;  1Z1B A;  2EMB A;  2EM8 A;  3MHH C;  4FK5 C;  2YRH A;  1ZAA C;  2ENH A;  3M99 B;  1YUI A;  4F6N A;  2ELY A;  2R1F A;  2WBU A;  3EPJ A;  2EMF A;  1JK2 A;  4R2S A;  2EMA A;  2EPR A;  1WJP A;  2YTE A;  1KJK A;  1TN9 A;  1A1H A;  2E72 A;  1TF3 A;  2EMY A;  2J7J A;  1JK1 A;  2EN6 A;  1B69 A;  2PRT A;  2EN3 A;  2YTI A;  2LCE A;  1A1G A;  2NAB A;  2MKN A;  2EL5 A;  2EM4 A;  2EL6 A;  2EMG A;  1F2I G;  1BB8 A;  2YTP A;  4R2P A;  2CTD A;  2EM3 A;  2EMZ A;  5KL2 A;  2EQ0 A;  1YSA C;  2EM7 A;  1MEY C;  2EOH A;  1AAY A;  2CT1 A;  2EOJ A;  1YUJ A;  5KL4 A;  2YTN A;  2EOF A;  3MHS C;  2YRK A;  4X9J A;  1ZU1 A;  4GZN C;  2EN7 A;  2D9H A;  2YU5 A;  2EMH A;  2EQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...