2NABA

Nizp1-c2hr zinc finger structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
41
structure length
41
Chain Sequence
GAMEVQTSQKSYVCPNCGKIFRWRVNFIRHLRSRREQKPHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for PHDVC5HCHNSD1-C2HRNizp1 interaction: implications for Sotos syndrome.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Zinc finger protein 496
total genus 8
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2015-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2nabA01
2J7JA 2MKDA 2ELYA 4GZNC 2EMIA 2EOHA 2RSIA 1TF3A 4IJDA 2WCC3 2PRTA 4M9VC 2ENHA 5KL4A 2HGHA 2YRHA 1DGCA 2EN8A 5KL3A 2ELZA 2EOQA 3M99B 1ZAAC 4F6MA 2ENCA 2EMWA 1Z1BA 2LCEA 2EQ1A 4F6NA 3VHTB 2YTPA 1MEYC 4R2RA 2EOJA 2CSHA 2YRKA 2BB8A 2EPUA 3EPJA 1P47A 5KL7A 2EN7A 1A1GA 1KJKA 1X6HA 5KL2A 1YUIA 1A1FA 1A1HA 2EQ3A 2EPZA 2EN4A 1JK2A 2EOEA 2VRDA 1TF6A 3EPHA 2EOMA 2YTFA 3MHHC 2EMAA 2EN6A 2RPCA 2LVHA 4F2JC 2YRMA 2CTDA 2EP3A 2EPPA 1BBOA 1BB8A 2EM7A 2EMHA 2EOYA 1F2IG 1ZR9A 4R2PA 2EOZA 1YSAC 2YTNA 2YTQA 1UN6B 2JP9A 2YTIA 1X6FA 2EE8A 2EMKA 2EMFA 4X9JA 2WBSA 2EPRA 2EJ4A 2YU8A 2EMZA 2EM9A 2ENAA 4IS1C 2EM4A 1G2FC 2MDGA 2EOIA 2EM3A 1X5WA 1G2DC 2EN3A 2EM6A 4R2AA 2EOXA 2EM8A 4R2CA 2DRPA 2MKNA 2EOSA 2YTJA 4R2QA 2EL6A 2YSPA 2WBUA 2GLIA 4R2DA 2EMBA 1AAYA 1WJPA 4R2EA 2EN2A 1B69A 1TN9A 1UBDC 2EMLA 2D9HA 2EL4A 2EM5A 2A25A 2CT1A 2EM0A 2LV2A 2EMXA 1A1IA 2EPXA 4WSGA 2EM2A 2EN1A 2JPAA 1A1LA 2EMYA 1NCSA 1X6EA 2EL5A 2LO3A 2YTEA 2LT7A 2I13A 2DMIA 2EOFA 4R2SA 1A1KA 5KL6A 2E72A 2EOOA 3EPLA 1A1JA 2YTGA 5KL5A 2EPCA 1X3CA 2DLQA 2EQ0A 4FK5C 1ZU1A 2EMCA 2YU5A 3MHSC 2EPAA 2GHFA 3UK3C 1LLMC 2YTDA 1YUJA 2NABA 2EORA 2ADRA 3EPKA 2M9AA 2YTOA 1JK1A 2YSOA 2R1FA 2WBTA 1RMDA 2DLKA 2EMGA 2DGCA
chains in the Genus database with same CATH superfamily
3THNA 2ELYA 5IV8B 4RHBB 2B7VA 2LBSB 2ENHA 1WRJA 2YRHA 2EN8A 2LMZA 3M99B 5LL6R 3F6HA 4F6MA 4KZSA 5DNYA 4O43A 4R2RA 2EOJA 4NHRA 5IT9C 2BB8A 2EPUA 2EPOA 3BF2A 5BR8E 4WXCA 3DJWA 2V88A 2EQ3A 4JI7E 2EOEA 2FGGA 2UU9E 4JI6E 2KHXA 5A6KA 2EN6A 4LTYA 2YRMA 2DMYA 2EP3A 4DUYE 4JI2E 1YPNA 2EMHA 4O24A 5AE2A 2EOYA 3ADLA 1ZR9A 4R2PA 2L3CA 4KWYA 5CFFE 1XNQE 1YSAC 4DR6E 2L2NA 2UXDE 2YTIA 1IBKE 4KHPE 2VQFE 5LMUE 2JOBA 5FLXC 1PJQA 2YU8A 4LF7E 2YWQA 4IS1C 2MDGA 3MSWA 2EM3A 1X5WA 3IWDA 2EN3A 4BCAA 1G2DC 4OOGC 4R2AA 4R2CA 2MKNA 1DQ3A 3C6MA 3JAMC 2LUPB 2WBUA 3BGHA 3HPSA 1YYWA 4X8WA 4R2DA 2EMBA 2L3JA 3ADGA 2EN2A 3DF6A 2EMLA 1T4OA 2EL4A 2LV2A 4DR5E 1A1IA 2N3HA 2EPXA 2G7HA 4F9CB 2EN1A 1HNXE 1A1LA 2UXBE 2LO3A 2N8XA 2LT7A 3VYXA 3ADIA 1A1KA 4M0VA 2EOOA 1EH7A 5KL5A 3OTOE 4WPYA 1SFEA 4DR7E 1X3CA 4X64E 2V83A 4WX9A 3JU0A 1LLMC 2JVAA 4P7DA 1YUJA 4DR2E 3THOB 2L2MA 2Q8UA 3C4TA 2YTOA 2FTXB 2YSOA 1JK1A 4JV5E 2WBTA 1IBLE 2LJUA 1BBGA 5KL7A 3HPZA 4X62E 2DGCA 2J7JA 4GZNC 1ZBTA 4DV7E 1T4NA 4IJDA 2WCC3 4M9VC 4J8ZA 5KL4A 2HGHA 1EKZA 5KL3A 4DR3E 3OMLA 2ELZA 4JYAE 4LF5E 2B3TB 3HQ1A 2UUCE 2ENCA 4HTGA 4L5NC 1Z1BA 2LCEA 2RQLA 2YPNA 4M2ZA 3ECRA 3VHTB 1MEYC 4B3RE 4DKKA 5A6JA 1N36E 1MGTA 3EPJA 1KJKA 2EN7A 2LUQA 4ZYDA 1HNWE 1YUIA 4B3TE 3AV0A 2K4VA 4F9AB 2VRDA 3EPHA 2YTFA 2EMAA 1X48A 2RPCA 4BC9A 1GTKA 1YYKA 5T6JA 2EM7A 1XMQE 2KONA 4DR1E 4BHCA 4ZYEA 4O5GA 4DV0E 2EMKA 2EPLX 4X9JA 2EPRA 4BS9A 2HHHE 1N3GA 3P1XA 2EM4A 4GKKE 2EOIA 2LRSA 2EM8A 3AUZA 2FV4B 2GPIA 2NUGA 4LFBE 2EL6A 3JTZA 1T38A 1T39A 4P78A 1I94E 2GLIA 4BMJA 1AAYA 4R2EA 1EH8A 1B69A 2L92A 4LF8E 1UBDC 1L4SA 1IQSA 2D9HA 2EM5A 2CT1A 2EM0A 2NA2A 5A6BD 2DB2A 4BHBA 1RC7A 2F4VE 2JR1A 4WSGA 4DMIA 1QU6A 2JPAA 1GQEA 1X6EA 2DMIA 2EOFA 5KL6A 3C6KA 4JI3E 4NZVA 4X65E 2VF1A 3VYYA 1ZU1A 2YU5A 2EPKX 1N34E 4F9BB 4M30A 2NABA 4AQYE 3J80C 3EPKA 4GKJE 4R8OA 2E1MA 2MKDA 4DR4E 2EOHA 2RSIA 2PRTA 3KWRA 1WXRA 2DSYA 1DGCA 4ZYGA 3VK6A 3HTXA 2B7TA 1YFHA 3C4BA 1GZ6A 2EMWA 2EQ1A 4F6NA 1KYQA 4BC7A 1SR9A 2YTPA 2NUFA 2JXPA 2N3GA 1P47A 1A1GA 2EWLA 3J7AG 1X6HA 2F8BA 5KL2A 1EH6A 1A1FA 1HR0E 1A1HA 2EN4A 2L6MA 1JK2A 4OX9E 2LJHA 5A6BA 1UILA 2EOMA 2HC5A 1YYOA 1FJGE 3MHHC 5AE1A 2LVHA 3LMLA 2JOXA 1XNRE 1BBOA 3H09A 1WHNA 3ADJA 1F2IG 2VE7C 1PKPA 1PDAA 4DV1E 2JYAA 2EOZA 2RTXA 4MLVA 4Q28A 3J81C 1X49A 2YTNA 2JP9A 1X6FA 2WBSA 2MC5A 4WYQB 4GEQB 2EMZA 2ENAA 4WSPA 1G2FC 2LTSA 3F6GA 1RQ0A 4TUGA 2EM6A 1T4LB 5A69A 2RS6A 2M7QA 1J26A 2EOSA 3L00A 5AC5A 2LE2A 2YTJA 5A2QC 4R2QA 1XMOE 4K0KE 4BBYA 5ADZA 2YSPA 4JI4E 1PJTA 2R76A 2DIXA 1WJPA 2KOUA 2MDRA 1ZBQA 1TN9A 2V87A 2A25A 4DV4E 4JI8E 4DUZE 1N33E 4LFAE 2EL5A 2YTEA 2YZTA 2I13A 5IWAE 1NEIA 3KZYA 3RMPA 4R2SA 4JI5E 1HNZE 1A1JA 4LU9A 2EPCA 2DLQA 2EQ0A 2EMCA 2ODRC 2EPAA 2GHFA 4TUIA 3BBGA 2YTDA 3J7Yp 4I8OA 5A6AA 4DV3E 2ADRA 2UUAE 4R03A 2ZM6E 4DV6E 5AE3A 3T1YE 4HEIA 1STUA 2I9IA 2NUEA 3FIGA 2EMGA 2B9DA 4MLQA 4ZYHA 2EMIA 1TF3A 4JI1E 1FKAE 3T1HE 1X47A 2EOQA 1J5EE 1ZAAC 1IMUA 5TSEA 4DV2E 1YZ9A 2CPNA 4Q35B 2EPNA 2CSHA 2YRKA 2L2KB 2UUBE 1O0WA 2EPZA 2EZ6A 5IXMB 4LFCE 2M4IA 3HXLA 4RH8A 1TF6A 3IWCA 4YHHE 4NXME 2H36X 1PJSA 2M1SA 5LMNE 4F2JC 2CTDA 4WFTA 2RS7A 2EPPA 2EPMX 3K6QA 4L8NA 3EQ1A 1DI2A 1BB8A 2BBGA 2VQEE 2E5LE 2YTQA 2V89A 1UN6B 4LF4E 3LLHA 2EE8A 2L33A 2K7IA 2EMFA 3KZZA 2EJ4A 4YY3E 2UXCE 4WXDA 2EM9A 3BIDA 1QNTA 2EOXA 2DRPA 3TQMA 2YT4A 2HJJA 5LLQA 1N32E 2V8QB 1UHZA 4X66E 2V85A 2IHR1 1IQOA 4DV5E 5AC4A 4LF9E 2EMXA 2JY9A 2EM2A 2EMYA 1NCSA 2RSMA 4O4KA 3ZOQB 4F54A 1WHQA 1IBME 2JWOA 4NXNE 2E72A 1AH5A 3EPLA 2YTGA 4N4RB 5F3WA 3QG5C 4FK5C 3MHSC 2LTRA 3UK3C 4LF6E 4B3SE 4B3ME 2EORA 2ODRD 2M9AA 2WZOA 2MC6A 3IWBA 2R1FA 2V86A 5AASA 2L8TA 1RMDA 2DLKA 4JI0E
chains in the Genus database with same CATH topology
2J7JA 2MKDA 2ELYA 4GZNC 2EMIA 2EOHA 2RSIA 1TF3A 4IJDA 2WCC3 2PRTA 4M9VC 2ENHA 5KL4A 2HGHA 2YRHA 1DGCA 2EN8A 5KL3A 2ELZA 2EOQA 3M99B 1ZAAC 4F6MA 2ENCA 2EMWA 1Z1BA 2LCEA 2EQ1A 4F6NA 3VHTB 2YTPA 1MEYC 4R2RA 2EOJA 2CSHA 2YRKA 2BB8A 2EPUA 3EPJA 1P47A 5KL7A 2EN7A 1A1GA 1KJKA 1X6HA 5KL2A 1YUIA 1A1FA 1A1HA 2EQ3A 2EPZA 2EN4A 1JK2A 2EOEA 2VRDA 1TF6A 3EPHA 2EOMA 2YTFA 3MHHC 2EMAA 2EN6A 2RPCA 2LVHA 4F2JC 2YRMA 2CTDA 2EP3A 2EPPA 1BBOA 1BB8A 2EM7A 2EMHA 2EOYA 1F2IG 1ZR9A 4R2PA 2EOZA 1YSAC 2YTNA 2YTQA 1UN6B 2JP9A 2YTIA 1X6FA 2EE8A 2EMKA 2EMFA 4X9JA 2WBSA 2EPRA 2EJ4A 2YU8A 2EMZA 2EM9A 2ENAA 4IS1C 2EM4A 1G2FC 2MDGA 2EOIA 2EM3A 1X5WA 1G2DC 2EN3A 2EM6A 4R2AA 2EOXA 2EM8A 4R2CA 2DRPA 2MKNA 2EOSA 2YTJA 4R2QA 2EL6A 2YSPA 2WBUA 2GLIA 4R2DA 2EMBA 1AAYA 1WJPA 4R2EA 2EN2A 1B69A 1TN9A 1UBDC 2EMLA 2D9HA 2EL4A 2EM5A 2A25A 2CT1A 2EM0A 2LV2A 2EMXA 1A1IA 2EPXA 4WSGA 2EM2A 2EN1A 2JPAA 1A1LA 2EMYA 1NCSA 1X6EA 2EL5A 2LO3A 2YTEA 2LT7A 2I13A 2DMIA 2EOFA 4R2SA 1A1KA 5KL6A 2E72A 2EOOA 3EPLA 1A1JA 2YTGA 5KL5A 2EPCA 1X3CA 2DLQA 2EQ0A 4FK5C 1ZU1A 2EMCA 2YU5A 3MHSC 2EPAA 2GHFA 3UK3C 1LLMC 2YTDA 1YUJA 2NABA 2EORA 2ADRA 3EPKA 2M9AA 2YTOA 1JK1A 2YSOA 2R1FA 2WBTA 1RMDA 2DLKA 2EMGA 2DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7J A;  2MKD A;  2ELY A;  4GZN C;  2EMI A;  2EOH A;  2RSI A;  1TF3 A;  4IJD A;  2WCC 3;  2PRT A;  4M9V C;  2ENH A;  5KL4 A;  2HGH A;  2YRH A;  1DGC A;  2EN8 A;  5KL3 A;  2ELZ A;  2EOQ A;  3M99 B;  1ZAA C;  4F6M A;  2ENC A;  2EMW A;  1Z1B A;  2LCE A;  2EQ1 A;  4F6N A;  3VHT B;  2YTP A;  1MEY C;  4R2R A;  2EOJ A;  2CSH A;  2YRK A;  2BB8 A;  2EPU A;  3EPJ A;  1P47 A;  5KL7 A;  2EN7 A;  1A1G A;  1KJK A;  1X6H A;  5KL2 A;  1YUI A;  1A1F A;  1A1H A;  2EQ3 A;  2EPZ A;  2EN4 A;  1JK2 A;  2EOE A;  2VRD A;  1TF6 A;  3EPH A;  2EOM A;  2YTF A;  3MHH C;  2EMA A;  2EN6 A;  2RPC A;  2LVH A;  4F2J C;  2YRM A;  2CTD A;  2EP3 A;  2EPP A;  1BBO A;  1BB8 A;  2EM7 A;  2EMH A;  2EOY A;  1F2I G;  1ZR9 A;  4R2P A;  2EOZ A;  1YSA C;  2YTN A;  2YTQ A;  1UN6 B;  2JP9 A;  2YTI A;  1X6F A;  2EE8 A;  2EMK A;  2EMF A;  4X9J A;  2WBS A;  2EPR A;  2EJ4 A;  2YU8 A;  2EMZ A;  2EM9 A;  2ENA A;  4IS1 C;  2EM4 A;  1G2F C;  2MDG A;  2EOI A;  2EM3 A;  1X5W A;  1G2D C;  2EN3 A;  2EM6 A;  4R2A A;  2EOX A;  2EM8 A;  4R2C A;  2DRP A;  2MKN A;  2EOS A;  2YTJ A;  4R2Q A;  2EL6 A;  2YSP A;  2WBU A;  2GLI A;  4R2D A;  2EMB A;  1AAY A;  1WJP A;  4R2E A;  2EN2 A;  1B69 A;  1TN9 A;  1UBD C;  2EML A;  2D9H A;  2EL4 A;  2EM5 A;  2A25 A;  2CT1 A;  2EM0 A;  2LV2 A;  2EMX A;  1A1I A;  2EPX A;  4WSG A;  2EM2 A;  2EN1 A;  2JPA A;  1A1L A;  2EMY A;  1NCS A;  1X6E A;  2EL5 A;  2LO3 A;  2YTE A;  2LT7 A;  2I13 A;  2DMI A;  2EOF A;  4R2S A;  1A1K A;  5KL6 A;  2E72 A;  2EOO A;  3EPL A;  1A1J A;  2YTG A;  5KL5 A;  2EPC A;  1X3C A;  2DLQ A;  2EQ0 A;  4FK5 C;  1ZU1 A;  2EMC A;  2YU5 A;  3MHS C;  2EPA A;  2GHF A;  3UK3 C;  1LLM C;  2YTD A;  1YUJ A;  2NAB A;  2EOR A;  2ADR A;  3EPK A;  2M9A A;  2YTO A;  1JK1 A;  2YSO A;  2R1F A;  2WBT A;  1RMD A;  2DLK A;  2EMG A;  2DGC A; 
#chains in the Genus database with same CATH topology
 3THN A;  2ELY A;  5IV8 B;  4RHB B;  2B7V A;  2LBS B;  2ENH A;  1WRJ A;  2YRH A;  2EN8 A;  2LMZ A;  3M99 B;  5LL6 R;  3F6H A;  4F6M A;  4KZS A;  5DNY A;  4O43 A;  4R2R A;  2EOJ A;  4NHR A;  5IT9 C;  2BB8 A;  2EPU A;  2EPO A;  3BF2 A;  5BR8 E;  4WXC A;  3DJW A;  2V88 A;  2EQ3 A;  4JI7 E;  2EOE A;  2FGG A;  2UU9 E;  4JI6 E;  2KHX A;  5A6K A;  2EN6 A;  4LTY A;  2YRM A;  2DMY A;  2EP3 A;  4DUY E;  4JI2 E;  1YPN A;  2EMH A;  4O24 A;  5AE2 A;  2EOY A;  3ADL A;  1ZR9 A;  4R2P A;  2L3C A;  4KWY A;  5CFF E;  1XNQ E;  1YSA C;  4DR6 E;  2L2N A;  2UXD E;  2YTI A;  1IBK E;  4KHP E;  2VQF E;  5LMU E;  2JOB A;  5FLX C;  1PJQ A;  2YU8 A;  4LF7 E;  2YWQ A;  4IS1 C;  2MDG A;  3MSW A;  2EM3 A;  1X5W A;  3IWD A;  2EN3 A;  4BCA A;  1G2D C;  4OOG C;  4R2A A;  4R2C A;  2MKN A;  1DQ3 A;  3C6M A;  3JAM C;  2LUP B;  2WBU A;  3BGH A;  3HPS A;  1YYW A;  4X8W A;  4R2D A;  2EMB A;  2L3J A;  3ADG A;  2EN2 A;  3DF6 A;  2EML A;  1T4O A;  2EL4 A;  2LV2 A;  4DR5 E;  1A1I A;  2N3H A;  2EPX A;  2G7H A;  4F9C B;  2EN1 A;  1HNX E;  1A1L A;  2UXB E;  2LO3 A;  2N8X A;  2LT7 A;  3VYX A;  3ADI A;  1A1K A;  4M0V A;  2EOO A;  1EH7 A;  5KL5 A;  3OTO E;  4WPY A;  1SFE A;  4DR7 E;  1X3C A;  4X64 E;  2V83 A;  4WX9 A;  3JU0 A;  1LLM C;  2JVA A;  4P7D A;  1YUJ A;  4DR2 E;  3THO B;  2L2M A;  2Q8U A;  3C4T A;  2YTO A;  2FTX B;  2YSO A;  1JK1 A;  4JV5 E;  2WBT A;  1IBL E;  2LJU A;  1BBG A;  5KL7 A;  3HPZ A;  4X62 E;  2DGC A;  2J7J A;  4GZN C;  1ZBT A;  4DV7 E;  1T4N A;  4IJD A;  2WCC 3;  4M9V C;  4J8Z A;  5KL4 A;  2HGH A;  1EKZ A;  5KL3 A;  4DR3 E;  3OML A;  2ELZ A;  4JYA E;  4LF5 E;  2B3T B;  3HQ1 A;  2UUC E;  2ENC A;  4HTG A;  4L5N C;  1Z1B A;  2LCE A;  2RQL A;  2YPN A;  4M2Z A;  3ECR A;  3VHT B;  1MEY C;  4B3R E;  4DKK A;  5A6J A;  1N36 E;  1MGT A;  3EPJ A;  1KJK A;  2EN7 A;  2LUQ A;  4ZYD A;  1HNW E;  1YUI A;  4B3T E;  3AV0 A;  2K4V A;  4F9A B;  2VRD A;  3EPH A;  2YTF A;  2EMA A;  1X48 A;  2RPC A;  4BC9 A;  1GTK A;  1YYK A;  5T6J A;  2EM7 A;  1XMQ E;  2KON A;  4DR1 E;  4BHC A;  4ZYE A;  4O5G A;  4DV0 E;  2EMK A;  2EPL X;  4X9J A;  2EPR A;  4BS9 A;  2HHH E;  1N3G A;  3P1X A;  2EM4 A;  4GKK E;  2EOI A;  2LRS A;  2EM8 A;  3AUZ A;  2FV4 B;  2GPI A;  2NUG A;  4LFB E;  2EL6 A;  3JTZ A;  1T38 A;  1T39 A;  4P78 A;  1I94 E;  2GLI A;  4BMJ A;  1AAY A;  4R2E A;  1EH8 A;  1B69 A;  2L92 A;  4LF8 E;  1UBD C;  1L4S A;  1IQS A;  2D9H A;  2EM5 A;  2CT1 A;  2EM0 A;  2NA2 A;  5A6B D;  2DB2 A;  4BHB A;  1RC7 A;  2F4V E;  2JR1 A;  4WSG A;  4DMI A;  1QU6 A;  2JPA A;  1GQE A;  1X6E A;  2DMI A;  2EOF A;  5KL6 A;  3C6K A;  4JI3 E;  4NZV A;  4X65 E;  2VF1 A;  3VYY A;  1ZU1 A;  2YU5 A;  2EPK X;  1N34 E;  4F9B B;  4M30 A;  2NAB A;  4AQY E;  3J80 C;  3EPK A;  4GKJ E;  4R8O A;  2E1M A;  2MKD A;  4DR4 E;  2EOH A;  2RSI A;  2PRT A;  3KWR A;  1WXR A;  2DSY A;  1DGC A;  4ZYG A;  3VK6 A;  3HTX A;  2B7T A;  1YFH A;  3C4B A;  1GZ6 A;  2EMW A;  2EQ1 A;  4F6N A;  1KYQ A;  4BC7 A;  1SR9 A;  2YTP A;  2NUF A;  2JXP A;  2N3G A;  1P47 A;  1A1G A;  2EWL A;  3J7A G;  1X6H A;  2F8B A;  5KL2 A;  1EH6 A;  1A1F A;  1HR0 E;  1A1H A;  2EN4 A;  2L6M A;  1JK2 A;  4OX9 E;  2LJH A;  5A6B A;  1UIL A;  2EOM A;  2HC5 A;  1YYO A;  1FJG E;  3MHH C;  5AE1 A;  2LVH A;  3LML A;  2JOX A;  1XNR E;  1BBO A;  3H09 A;  1WHN A;  3ADJ A;  1F2I G;  2VE7 C;  1PKP A;  1PDA A;  4DV1 E;  2JYA A;  2EOZ A;  2RTX A;  4MLV A;  4Q28 A;  3J81 C;  1X49 A;  2YTN A;  2JP9 A;  1X6F A;  2WBS A;  2MC5 A;  4WYQ B;  4GEQ B;  2EMZ A;  2ENA A;  4WSP A;  1G2F C;  2LTS A;  3F6G A;  1RQ0 A;  4TUG A;  2EM6 A;  1T4L B;  5A69 A;  2RS6 A;  2M7Q A;  1J26 A;  2EOS A;  3L00 A;  5AC5 A;  2LE2 A;  2YTJ A;  5A2Q C;  4R2Q A;  1XMO E;  4K0K E;  4BBY A;  5ADZ A;  2YSP A;  4JI4 E;  1PJT A;  2R76 A;  2DIX A;  1WJP A;  2KOU A;  2MDR A;  1ZBQ A;  1TN9 A;  2V87 A;  2A25 A;  4DV4 E;  4JI8 E;  4DUZ E;  1N33 E;  4LFA E;  2EL5 A;  2YTE A;  2YZT A;  2I13 A;  5IWA E;  1NEI A;  3KZY A;  3RMP A;  4R2S A;  4JI5 E;  1HNZ E;  1A1J A;  4LU9 A;  2EPC A;  2DLQ A;  2EQ0 A;  2EMC A;  2ODR C;  2EPA A;  2GHF A;  4TUI A;  3BBG A;  2YTD A;  3J7Y p;  4I8O A;  5A6A A;  4DV3 E;  2ADR A;  2UUA E;  4R03 A;  2ZM6 E;  4DV6 E;  5AE3 A;  3T1Y E;  4HEI A;  1STU A;  2I9I A;  2NUE A;  3FIG A;  2EMG A;  2B9D A;  4MLQ A;  4ZYH A;  2EMI A;  1TF3 A;  4JI1 E;  1FKA E;  3T1H E;  1X47 A;  2EOQ A;  1J5E E;  1ZAA C;  1IMU A;  5TSE A;  4DV2 E;  1YZ9 A;  2CPN A;  4Q35 B;  2EPN A;  2CSH A;  2YRK A;  2L2K B;  2UUB E;  1O0W A;  2EPZ A;  2EZ6 A;  5IXM B;  4LFC E;  2M4I A;  3HXL A;  4RH8 A;  1TF6 A;  3IWC A;  4YHH E;  4NXM E;  2H36 X;  1PJS A;  2M1S A;  5LMN E;  4F2J C;  2CTD A;  4WFT A;  2RS7 A;  2EPP A;  2EPM X;  3K6Q A;  4L8N A;  3EQ1 A;  1DI2 A;  1BB8 A;  2BBG A;  2VQE E;  2E5L E;  2YTQ A;  2V89 A;  1UN6 B;  4LF4 E;  3LLH A;  2EE8 A;  2L33 A;  2K7I A;  2EMF A;  3KZZ A;  2EJ4 A;  4YY3 E;  2UXC E;  4WXD A;  2EM9 A;  3BID A;  1QNT A;  2EOX A;  2DRP A;  3TQM A;  2YT4 A;  2HJJ A;  5LLQ A;  1N32 E;  2V8Q B;  1UHZ A;  4X66 E;  2V85 A;  2IHR 1;  1IQO A;  4DV5 E;  5AC4 A;  4LF9 E;  2EMX A;  2JY9 A;  2EM2 A;  2EMY A;  1NCS A;  2RSM A;  4O4K A;  3ZOQ B;  4F54 A;  1WHQ A;  1IBM E;  2JWO A;  4NXN E;  2E72 A;  1AH5 A;  3EPL A;  2YTG A;  4N4R B;  5F3W A;  3QG5 C;  4FK5 C;  3MHS C;  2LTR A;  3UK3 C;  4LF6 E;  4B3S E;  4B3M E;  2EOR A;  2ODR D;  2M9A A;  2WZO A;  2MC6 A;  3IWB A;  2R1F A;  2V86 A;  5AAS A;  2L8T A;  1RMD A;  2DLK A;  4JI0 E; 
#chains in the Genus database with same CATH homology
 2J7J A;  2MKD A;  2ELY A;  4GZN C;  2EMI A;  2EOH A;  2RSI A;  1TF3 A;  4IJD A;  2WCC 3;  2PRT A;  4M9V C;  2ENH A;  5KL4 A;  2HGH A;  2YRH A;  1DGC A;  2EN8 A;  5KL3 A;  2ELZ A;  2EOQ A;  3M99 B;  1ZAA C;  4F6M A;  2ENC A;  2EMW A;  1Z1B A;  2LCE A;  2EQ1 A;  4F6N A;  3VHT B;  2YTP A;  1MEY C;  4R2R A;  2EOJ A;  2CSH A;  2YRK A;  2BB8 A;  2EPU A;  3EPJ A;  1P47 A;  5KL7 A;  2EN7 A;  1A1G A;  1KJK A;  1X6H A;  5KL2 A;  1YUI A;  1A1F A;  1A1H A;  2EQ3 A;  2EPZ A;  2EN4 A;  1JK2 A;  2EOE A;  2VRD A;  1TF6 A;  3EPH A;  2EOM A;  2YTF A;  3MHH C;  2EMA A;  2EN6 A;  2RPC A;  2LVH A;  4F2J C;  2YRM A;  2CTD A;  2EP3 A;  2EPP A;  1BBO A;  1BB8 A;  2EM7 A;  2EMH A;  2EOY A;  1F2I G;  1ZR9 A;  4R2P A;  2EOZ A;  1YSA C;  2YTN A;  2YTQ A;  1UN6 B;  2JP9 A;  2YTI A;  1X6F A;  2EE8 A;  2EMK A;  2EMF A;  4X9J A;  2WBS A;  2EPR A;  2EJ4 A;  2YU8 A;  2EMZ A;  2EM9 A;  2ENA A;  4IS1 C;  2EM4 A;  1G2F C;  2MDG A;  2EOI A;  2EM3 A;  1X5W A;  1G2D C;  2EN3 A;  2EM6 A;  4R2A A;  2EOX A;  2EM8 A;  4R2C A;  2DRP A;  2MKN A;  2EOS A;  2YTJ A;  4R2Q A;  2EL6 A;  2YSP A;  2WBU A;  2GLI A;  4R2D A;  2EMB A;  1AAY A;  1WJP A;  4R2E A;  2EN2 A;  1B69 A;  1TN9 A;  1UBD C;  2EML A;  2D9H A;  2EL4 A;  2EM5 A;  2A25 A;  2CT1 A;  2EM0 A;  2LV2 A;  2EMX A;  1A1I A;  2EPX A;  4WSG A;  2EM2 A;  2EN1 A;  2JPA A;  1A1L A;  2EMY A;  1NCS A;  1X6E A;  2EL5 A;  2LO3 A;  2YTE A;  2LT7 A;  2I13 A;  2DMI A;  2EOF A;  4R2S A;  1A1K A;  5KL6 A;  2E72 A;  2EOO A;  3EPL A;  1A1J A;  2YTG A;  5KL5 A;  2EPC A;  1X3C A;  2DLQ A;  2EQ0 A;  4FK5 C;  1ZU1 A;  2EMC A;  2YU5 A;  3MHS C;  2EPA A;  2GHF A;  3UK3 C;  1LLM C;  2YTD A;  1YUJ A;  2NAB A;  2EOR A;  2ADR A;  3EPK A;  2M9A A;  2YTO A;  1JK1 A;  2YSO A;  2R1F A;  2WBT A;  1RMD A;  2DLK A;  2EMG A;  2DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...