2NAZA

The solution nmr structure of the c-terminal effector domain of bfmr from acinetobacter baumannii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
EDEVAQRIEFDDLVIDNGGRSVTLNGELVDFTSAEYDLLWLLASNAGRILSREDIFERLRGIEYDGQDRSIDVRISRIRPKIGDDPENPKRIKTVRSKGYLFVKETNGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the biofilm-controlling response regulator BfmR from Acinetobacter baumannii reveals details of its DNA-binding mechanism.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transcription regulator
molecule keywords Transcriptional regulatory protein RstA
total genus 32
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nazA00
3IKVA 3GX4X 1G3TA 4L9JA 1KU3A 3NQOA 2FF4A 4LB6B 4BQAA 3M7GA 1OYYA 3S2WA 4L0ZB 5L3FA 1LDKB 3QPHA 2DQRA 3EDPA 4M6YA 2IJLA 4U0VA 1YFHA 1J59A 4N9IA 3RPUA 1LVAA 2D45A 2CO5A 2AS5F 3V7SA 4MTDA 5D6FA 2RC4A 1O57A 3N97A 2RV8A 3R0JA 3GUDA 2H27A 3W6KB 1ZRCA 4HX8A 1UCRA 3P9IA 4MEYF 1KU9A 4IRHA 3GFJA 1P6RA 3HTUA 3LQQA 2KIFA 2Z9OA 1V3FA 1QPMA 1UHMA 3T8TA 2PMUA 3E5QA 4Z2YA 1USSA 2PG4A 2MD5A 2EFQA 3MQ0A 5L3DA 4AIHA 4GXOA 4HLYA 2LDUA 5DV5A 3WE2A 5FFXA 2MH2A 4I98B 3V4GA 4MHGA 1KQ9A 2MLKA 3DP7A 3F3XA 2O3FA 4KA4A 5K1YA 1O7LA 3W6JB 3HOTA 2QLZA 3RTRA 1QZZA 2XV4S 4JBAA 2Y75A 2HTSA 2FBKA 1F1ZA 1S29A 4LMYA 2FMLA 4PDKA 2XKOA 2CG4A 1IUYA 3PFIA 4EJWA 5LEJA 1U3EM 4CXFA 3R60A 1ZREA 1G3YA 5BPIA 3VOEA 1FSHA 3BPVA 1S7AA 3QP5A 5DYMA 4IHTA 2EV5A 3QP6A 2QM3A 1R7JA 2UXXA 1I1GA 2QBYA 4LG0A 1WKMA 1ZGJA 5HDGA 3RIRA 5HLGA 2IW5A 5DCMA 4FT8A 2F5DA 5CVVA 4EGZA 3ZN0A 4XLNF 2DT5A 3K1MA 1XDSA 4GO1A 3F72A 3CUQA 3P9KA 4MEXF 1IAWA 4CHUA 5CJ9A 2LKPA 3E6MA 2XGXA 5FLXZ 2QQ9A 4UV8A 4CO8A 1BI1A 2K4JA 2M45A 3L7WA 4R8HA 4EM2A 2A5YB 1JE8A 4EJTA 1AWCA 3GXOA 1W7PD 4IF4A 4R1HA 3T0YA 4BYYA 1MKMA 3RKYA 2Q2EA 1F9NA 4OU0A 3JTHA 2NNNA 5E20A 5CLSA 3F8BA 4UHTA 2EK5A 5FO5A 4IRIA 1Z05A 2ESHA 3WTYC 4EMSA 4L18B 5CVUA 1E2XA 2DFIA 4AIJA 1I1SA 2RDPA 4U0WA 3K1NA 1IN8A 2L54A 3TDZC 4Q4ZF 3BJAA 1HXDA 3MEXA 4PZJA 3DQVC 2ISZA 2OQGA 3U1DA 3E3VA 4G9YA 1VTNC 1SD4A 3HTSB 3IWFA 2OBPA 3C1DA 1FPQA 3GFLA 2VT2A 2FNAA 2FA5A 3KLNA 1QGPA 4HW0A 1XMKA 2UXNA 5E8GA 1MJ9A 2EB7A 2V1XA 3CTAA 5HS9A 1B59A 4Y15A 3M9AA 1G4DA 4OIOF 3SQNA 1LDDA 4D0PA 3FMQA 2P7CB 5J8FA 3MFKA 3KP3A 4LG0B 3M1EA 1IW7F 4L5JA 5LEKA 1ZLJA 1PDNC 1RIOH 1QBJA 1YLFA 1MDMB 4KFCA 3R0AA 2FBIA 2VC0A 3JAMK 4HYEA 4MNUA 1YS7A 2HEOA 4K2EA 4I0BA 2RNJA 2DTRA 3O2PE 5LLQA 5KVRA 4A6EA 3QPTA 2XKPA 1P4XA 3GZ6A 2FQ3A 3ZMTA 1HW2A 4YIFA 4G7ZF 1R5GA 2RN7A 5D6EA 5JVTA 4O5VA 3G73A 1OYWA 3I54A 4HF1A 3WTUC 4E70A 2GZWA 4M9ZA 4H0EA 1GHCA 4U0YA 2F5EA 1FZPB 2HZTA 4YFKF 3FF5A 3H3UA 4RAZA 4HQEA 1G3SA 4I09A 1HKTA 1FBSA 1R23A 3QOPA 3TGNA 2OAZA 3F8FA 2ZMEA 1RUNA 5F6FA 4LLNA 1IXSB 2CQKA 4KIGA 2ZBKA 3QAHA 3V8JA 4AVPA 4RGSA 4MQ9F 4A0ZA 2EA2A 1YS6A 1R00A 4UUVA 2GXGA 4BHBA 3FM3A 3TQNA 1HQCA 4KYWA 3BPXA 1ONVA 2EFWA 4HLXA 2A07F 4L9TA 2FOKA 4HOBA 3L9FA 4Y13A 1JXSA 3BROA 3QU3A 2OZUA 3EYYA 2QENA 5LGNA 3HHHA 2C6YA 1DDNA 2IA1A 4HF0A 3HYIA 3IC7A 3HRMA 2MH9A 2BBYA 2EJRA 1K79A 4RGRA 3IRRA 1ZLKA 2ZKZA 1XGNA 1YG2A 2Z3YA 4XLPF 5D5XB 1K78A 4EVIA 5F64A 4OOIA 4I2OA 2L4AA 2OA4A 1SMYF 1P4AA 4KMUX 3DF8A 4O3MA 3HRUA 1LJ9A 3ROUA 2FBHA 1B6AA 5D8LB 5FD5A 1LEBA 1UHWA 4OIRF 5A2QZ 4WXCA 1P4WA 2IPQX 3EETA 4UXNA 1CF7A 4OMYA 1T0FA 2DBBA 4Q5SF 2F2EA 5L3EA 3F23A 5BMZA 4L0YB 1B9MA 4OMZA 1LNWA 1Z91A 3IRQA 5D4RA 4UVAA 4Q47A 2IA2A 3TOAA 2EFNA 5L3GA 2ADUA 5FB2A 2G9WA 3KLOA 4ENMA 4Q48A 1FP1D 4M71A 2EFOA 2Y0MA 2ISYA 2STTA 6PAXA 1O3SA 3I0TA 2M30A 4AD9A 5LHHA 4ON0A 2CSOA 4BH9A 5D5WB 1W5TA 2JT1A 5CVIA 4RAYA 3FHZA 1WWXA 5J8CA 1G3WA 5HDKA 2K86A 4WF2A 1YW7A 4B8XA 4EJOA 4I01A 4BNCA 5HDNA 1O3TA 1HBXG 2CW0F 4DQ2A 2FSWA 5A2QK 1KQ0A 3VFZA 2V79A 1BOAA 4RGUA 3RI4A 3ML6A 1TQIA 1J5YA 3J80K 1LDJA 4U7DA 1WRJA 5EEHA 1ZARA 2B0LA 2D1HA 2J5OA 1W7PA 3I59B 1QQIA 4R79A 4MGRA 2DPUA 3LQRA 5DUKA 4WXDA 3CLOA 3MAJA 4KN7X 3K9TA 1JHFA 3BJOA 3C18A 3FXUA 1E17A 3HOSA 3IWZA 4IVNA 1CF7B 4ZYDA 1FYKA 5LHGA 1XSVA 3MZHA 4LLGF 4QLCU 2ACJA 3RJPA 2K4BA 3TOBA 2H09A 4CGZA 3EUHA 1RI7A 5K5RA 4S04A 4UNOA 2XRNA 4A12A 1I27A 5CYVA 5LHIA 3K2ZA 3F21A 5FD6A 1L0OC 3FX3A 5DCMB 2JTVA 2H6CA 3KFWX 3T8RA 2QYOA 1ZH5A 1BM9A 1HW5A 3DV8A 5BOXA 1YYVA 1BBYA 2QVOA 5FLXK 5HOOA 1T38A 4WCGA 3NEUA 1S8NA 2XAHA 2EV0A 1YW9A 2X0LA 1P2FA 3M8FA 5J6XA 2P5LC 3LAPA 4WXHA 3ZMZA 2L3DA 2R3SA 1I6XA 1KYZA 1ODDA 4PCQA 5E17F 3M8EA 5JI6A 2UZKA 2QQAA 3ZMDA 1KU2A 1GXPA 2JZYA 1MJBA 1S7OA 3L00A 3BWGA 2XUBA 3RYPA 1H0MA 3SHFA 3BJ6A 3TO7A 4JQFA 2W24A 5H6RA 4KICA 2WV0A 1XB4A 1FC3A 1U8RA 1I5ZA 3WTXC 2PJPA 3G3ZA 2HKOA 4QWQA 2PN6A 1Y0UA 1QZYA 1KQ8A 1K78B 3KP6A 3HRTA 1F4KA 1EH6A 1J2XA 2IP2A 3I53A 4CDGA 2GIVA 3Q5FA 2E1CA 1IN4A 2RQPA 3RYRA 2PBIA 4RB0A 3WTTC 4P5OA 3FXQA 1O3QA 4G8XA 4G6QA 4MQVA 1J9IA 1FYMA 5LBQA 1SAXA 1HW1A 3RDIA 3GVAA 4HA8A 2ZFWA 1XMAA 2F5CA 2DO7A 2W57A 3WG9A 1W7PB 3ABUA 3I59A 4KNYA 2NNYA 2Y48A 4ENKA 4HQMA 2ZCWA 1R5HA 2YR2A 4LGWA 2ZNZA 5E1XA 3U2RA 3GYHX 5F1RA 1KYWA 4GCVA 3KP4A 3Q9SA 1CGPA 1T6SA 2FRHA 3P9CA 3ZP5A 3H92A 5JR3A 1B9NA 2Z33A 1KGSA 3MWMA 1SD7A 3CO6C 5DEQA 3KEOA 1STZA 4ASNA 3MCZA 2XIGA 1MJAA 1ON1A 4HX7A 1WSUA 3LFKA 1L3LA 1OR7A 3V8LA 3GEZA 1A04A 3H3ZA 1ZGAA 3DPLC 3V8KA 3WTWC 1ULYA 2VC1A 4KMFA 1SFUA 1FSEA 2HGCA 3DPTA 4A0XA 1G6NA 1T2KA 1YTYA 1DUXC 2K02A 3GFMA 2WC2A 3ECHA 4ZH4F 2R7FA 1DP7P 4EJVA 2L4MA 2X4HA 4CZZA 1SFXA 3NRVA 1IRFA 5LRRA 2M87A 1FWZA 4N9HA 3VEPA 1SMTA 4L9NA 5LGUA 1IN5A 2PFBA 3C3WA 4KN4X 4XRFA 2VBZA 4WK8F 5ICGA 5LGTA 3KCCA 4BXUA 2P5VA 3ERED 1BI0A 1BN5A 3WGIA 3FXRA 1U78A 1LB2A 2GXBA 1FY7A 1OMIA 1REPC 3LA2A 2W85A 1J7KA 2VODA 4BHCA 2QWWA 4ESFA 3E6CC 4LK0F 4RB1A 3HSRA 5L3BA 2DLLA 2P6SA 3LWFA 3GF2A 1BI2A 1C0WA 3SZTA 3WU0A 1T39A 3GW2A 1EV7A 2PMHA 3KETA 5EEGA 2STWA 1FOKA 1XGOA 5DD8A 1Z9CA 1GXQA 2MBFA 3R4KA 4N0BA 3QU6A 3DXJF 4G94A 2GAUA 3F6VA 2WWYA 2KIUA 5ILSA 2CYYA 2DK8A 4HX4A 4U7BA 2GWRA 4A5NA 5AIPA 1IN6A 2HKXA 2P6TA 3JAMZ 1V4RA 1FBUA 1AOYA 2DQLA 4ZYGA 2DAOA 2GA2A 3WGGA 2E7WA 2HFHA 2H6BA 3MZYA 2YX7A 3FMSA 1XCVA 2XROA 2P8TA 3O3KA 1ZG1A 4RS8A 1FBQA 2CGPA 2VBWA 1D5VA 2NRAC 4YFNF 2HDCA 3ISPA 4IPAA 1FP2A 5ED4A 3F8CA 2V1DA 2HR3A 1QO0D 1XN7A 1DPRA 3P7NA 1EH8A 4KIBA 2W25A 1SFEA 4XBFA 1D3YA 5D5UB 2K27A 5HS8A 4YFXF 3OOPA 3K0LA 1IF1A 3J81Z 1UB9A 2BGCA 2VXZA 3C7JA 2O03A 5BQTA 4EJUA 1RZ4A 1W5SA 2E7XA 3HSEA 2A3SA 4O6JA 2M8EA 5K5OA 3WTVC 1Z6RA 3OV8A 2O8XA 1BI3A 3HHGA 1TQMA 3LSTA 2HYFA 2FMYA 4EQQA 1IXRC 3F8MA 1KA8A 1U2WA 4BAYA 2LF7A 2RGVA 3TDUC 4GYGA 5E8IA 2MLGA 3E97A 1XGSA 1USTA 1K7AA 1R1TA 3KP5A 1TQPA 5JHUA 2VOPA 3KZYA 3E6DA 4JK1X 2JPCA 1J75A 2V1UA 2VN2A 2KIMA 2H94A 2A6HF 2V6CA 1FNNA 5E1ZB 5HLIA 1HSJA 3JSOA 2YU3A 3E5UA 2KJBA 4NQWA 3ULQB 3K1PA 1D8KA 3DFGA 4B09A 1H9TA 3U9GA 4Y17A 3J81K 2KJCA 3KP2A 3FMRA 1KU7A 4EGYA 5BPDA 5ICEA 2FE3A 1IZ1A 2DI3A 3ABTA 3ELKA 3CUQC 2PLYA 5AIQA 2XAQA 3HIFA 4OIQF 3BP8A 2VT3A 3L2CA 1SD6A 4IHSA 1ZRFA 4MTEA 3DKWA 3ZPLA 4I0AA 3PQJA 3B02A 2OQRA 1YQAA 4ENJA 4P9UA 4NB5A 3LAJA 1O3RA 2G7HA 1IN7A 2A61A 1W4MA 1R22A 1ZYRF 2KKOA 1MZBA 2HWVA 1XCBA 1DPUA 1XSXA 4HDUA 2CFXA 2MC3A 1B1BA 2UWMA 4EV0A 1YO5C 5FGMA 5DCFA 3FWEA 4S05A 3T5XA 4HV5A 5DD4A 4DNCA 1R1VA 2Q8KA 1HKQA 1TW2A 1NHAA 2E1NA 1WQ2A 2FEZA 2ZXJA 3F8NA 2L02A 5LRSA 2D2WA 1Q1HA 3AAFA 2Z5UA 1ZN2A 4NHJA 4A5MA 4ZZLA 2YX4A 4KUMA 2ELHA 3GZ5A 1Z7UA 3I71A 3KEQA 4YG2F 2LNBA 3D0SA 4IXAA 3LA3A 3EYIA 1B4AA 4UVBA 3FZVA 1PP7U 1OYIA 5DUIA 4WWCA 3TO9A 5L3CA 2IA0A 4M6XA 1TNTA 4ETSA 3JTGA 4KT5C 1FT9A 2R7DA 1D8JA 2FNPA 2HOEA 3I5UA 2J5PA 2BYVE 4XSXF 1ZRDA 3BY6A 4PGHA 2WTEA 4WX9A 4U88A 2PEXA 4CICA 5E1WA 1RUOA 1ZHFA 3Q9VA 5TJJA 5TRDA 3WGHA 2QUFA 4ENNA 1PUEE 5ICCA 3FM5A 3WU1B 4M73A 3SZPA 2JRTA 4ESBA 5CVJA 2GA1A 3I58A 4A2UA 2O0YA 3QRFF 2ZO4A 2HTJA 5HLHA 4IRGA 5HS7A 1UFMA 1H9GA 3T1BA 3L09A 4P55A 3SXYA 3F22A 4G6DA 1P92A 2ZNYA 3ECOA 1MDMA 3I4PA 4M72A 2XAFA 4IJAA 4LD5A 1T98A 4ZZDA 2VBYA 4HBLA 1LEAA 1JHHA 1IRGA 2FU4A 4KIFA 3DEUA 3CJNA 5FFZA 2DW4A 1TW3A 1BJAA 1K6OA 3IL2A 4A6DA 4LJZF 1GVJA 2AXLA 2EWNA 4G7OF 1S3JA 4M74A 4HDVA 2XHKA 3HUGA 2OZ6A 2TDXA 4TV7A 5ERIA 4FX4A 2EV6A 4HZFA 1XSDA 2L01A 5KK1A 3J80Z 1TNSA 2BE5F 2VE9A 2G7UA 2HS5A 1JGSA 4LLLA 5BS6A 1ON2A 2VBXA 4HF2A 1LQ1A 3B73A 2W84A 4ZYEA 1XD7A 2VE8A 5H20A 4EM0B 4ESJA 2LF8A 2QZ8A 4GGGA 4RB2C 2XVCA 3KZZA 2ESNA 2JSCA 4ZYHA 1HSTA 5CVRA 4HV6A 4OINF 4F7ZA 5D4SA 4L5IA 1ZG5A 3E5XA 2DU9A 2GQQA 1X3UA 4LB5A 2M1BA 2F5FA 5IT3A 4OIPF 4P9FA 5ILVA 3CDHA 3TO6A 3E6BA 2HYGD 2IVMA 2QQBA 3N4MA 2P4WA 1O7FA 4XSZF 2M5WA 3ZMUA 1FLIA 1BIBA 2NS0A 5K5QA 2O61A 1R58A 5ILUA 1XGMA 2Q0OA 1R1UA 4G7HF 3GO5A 3KP7A 4AIKA 2A69F 4EM1A 3ZMSA 5HVQC 2JPBA 3GFIA 2FXAA 3LA7A 2KRFA 2PI0A 5IT9Z 2RVCA 1J0RA 3KE2A 2VONA 4HAMA 3EQLF 2LSOA 2ZMEB 1TLHB 5H6QA 4GYIA 5D5VB 4I7HA 2A6EF 2CWEA 3V7RA 2MA3A 2OD5A 1RNLA 1TTYA 3ZMVA 2IT0A 3REOA 2ETHA 1WI9A 3WODF 2NYXA 1U6GA 2COMA 2A68F 3JSPA 1SD5A 3GLXA 3IKTA 3WE3A 2YSRA 5DDGA 3O6BB 4RGXA 4PGGA 3R6SA 4RB3C 3D5LA 1XDUA 1BC7C 2VOOA 1ZG3A 4A0YA 1Z1DA 3R61A 3BZ6A 2HQNA 1EH7A 4FHTA 3CUQB 1U5TA 3ZQ7A 3HRSA 3JW4A 1MD0A 2ZJ2A 4M9XA 4UV9A 3WTSC 5AONA 2O6GE 2XAGA 2P7VB 4L9VA 3RKXA 5D8KB 4UVCA 2DPDA 3CUOA 3BOQA 4BHPA 1OPCA 3RPQA 1Z6TA 2XASA 2IRFG 4LFUA 2OU2A 5JFRA 2EA4A 3COAC 4YIIA 2BEOA 5E18F 2K7LA 1BC8C 1R36A 1QNTA 3IHUA 4CYDA 2QBYB 3PQKA 2EFPA 1ZAOA 3SFZA 3VODA 1U5TB 3HSFA 2NAZA 3V7CA 2XAJA 1FX7A 1FYLA 3BDDA 2DK5A 2HQRA 3WTZA 5IT9K 3GWZA 2P5KA 3RKWA 4KDPA 1TBXA 4I02A 2BV6A 4P96A 4FX0A 1F5TA 1HKSA 1PP8F 4AWXB 3F6OA 3VB2A 3K69A 2Z99A 4LK1F 3I64A 3J7AO 3ZN1A 1IXCA 3CO7C 3TKYA 2YPRA 1S6LA 1MGTA 2D1VA 4M9SA 1YW8A 2RKHA 5ICFA 1BIAA 1OKRA 1YIOA 2PQ8A 1U5TC 2V9VA
chains in the Genus database with same CATH superfamily
2X6OA 3IKVA 3GX4X 1JGGA 1G3TA 4L9JA 1ZK8A 1KU3A 2QSGX 5J47A 3NQOA 2FF4A 4LB6B 4BQAA 1R4MB 4KT6A 2B7EA 3M7GA 3OYDA 3CCJI 1OYYA 3EUHC 2JK3A 3FKJA 3S2WA 1X1BA 1IV6A 4L0ZB 2EZIA 5L3FA 4QTRA 2MFZA 5GTHC 1LDKB 2DMPA 2DQRA 3H5AA 3QPHA 3EDPA 1VQPI 4M6YA 2W7NA 2IJLA 4U0VA 1YFHA 4E7HA 1J59A 4N9IA 4J01A 3PUFA 3RPUA 1LVAA 2V26A 3HOXJ 2EPFA 2D45A 2CO5A 4B47A 1D1AA 2AS5F 3V7SA 1IDZA 4YIRX 4MTDA 2X6XA 1ZTRA 2GXAA 5D6FA 4QPOA 2RC4A 1QHHD 1O57A 4QSHA 3N97A 2RV8A 1OCCH 2L0KA 2R5YB 2HDWA 1OLTA 3R0JA 3OYNA 3GUDA 2OUMA 2H27A 3W6KB 3HPHA 5GAEJ 5J1YA 1ZRCA 3OS1A 4HX8A 1UCRA 3P9IA 3GTQJ 4MEYF 1KU9A 3BQZA 1VQ6I 3BR5A 3GFJA 4IRHA 1P6RA 1NK3P 3ESWB 2KHMA 3TP3A 2Y9ZA 2P81A 1F36A 4RAGA 2O9LA 1Y1VJ 1I39A 3HTUA 3LQQA 2CS3A 2BY1A 2KIFA 2Z9OA 1V3FA 1SC7A 1QPMA 3BR0A 1UHMA 3T8TA 2R7SA 3FXKA 2PMUA 3E5QA 4Z2YA 1USSA 2VKEA 2PG4A 2MD5A 2EFQA 3MQ0A 3OYGA 5DTDA 2OC6A 3GTOJ 3LL7A 4Z6YA 3JR9A 5L3DA 2NS7A 4AIHA 4GXOA 2KDZA 3S3MA 4HLYA 2LDUA 3OYMA 5DV5A 3FBIB 1I3AA 2DA5A 2MH2A 5FFXA 4I98B 3V4GA 3WE2A 4MHGA 1KQ9A 2MLKA 3DP7A 3F3XA 2O3FA 1UG2A 5K1YA 4KA4A 1O7LA 3W6JB 4W1UA 3HOTA 2QLZA 3RTRA 2VPRA 2E1MC 2XGCA 3VWBA 1UZCA 3CJTB 1NG6A 1QZZA 2XV4S 4M3FA 2BXYA 4JBAA 1Z21A 1FIPA 2Y75A 2HTSA 2FBKA 1MSFC 2WAQN 1F1ZA 2IS1A 1S29A 4LMYA 3H9JA 2FMLA 4PDKA 5CKTA 3UNGC 4D7MA 3DKXA 3CCLI 3LSRA 1WJCA 1TWCJ 2XKOA 5FROA 2CG4A 1IUYA 3PFIA 4EJWA 2E60A 2Z2SB 3BCAA 5LEJA 1U3EM 4XK4A 2GLOA 5B5EC 4E7SA 3H9QA 3DU5A 4CXFA 3R60A 3ZCOA 1ZREA 1G3YA 1K83J 5BPIA 3VOEA 3CCVI 1FSHA 3BPVA 1S7AA 3GTGJ 3QP5A 1V5FA 5DYMA 2GIZA 1VQ9I 4IHTA 4HG2A 3VYUB 5JLXA 2EV5A 4CCKA 3FHNA 3QP6A 1ZQ3P 4OAZA 1XPXA 3HPGA 2QKMB 2QM3A 1FEXA 1R7JA 2UXXA 1I1GA 3W2WA 4C2UA 2QBYA 4LG0A 2BW3A 3OYIA 1WKMA 1ZGJA 5HDGA 2L7MP 4IHYA 3RIRA 1TL8A 5HLGA 2IW5A 3PSFA 5DCMA 4D1QA 4FT8A 2F5DA 3LFUA 3SEZA 5B66C 4IHWA 5CVVA 4EGZA 3ZN0A 4XLNF 2DT5A 3K1MA 1XDSA 3LNQA 2QSHX 1HA8A 3OYCA 1K61A 4EATA 4GO1A 1E3OC 3F72A 3CUQA 2M2EA 3LOCA 3P9KA 2RAEA 2ZSHB 4MEXF 2CQQA 2XPUA 1IAWA 5CJ9A 2Q2EB 2CV1A 4CHUA 2VPLA 3ASNH 3E0JB 4PJNA 1Z7LA 2LKPA 3E6MA 2HI3A 2XGXA 5GPAA 5IYDJ 4CYCB 5FLXZ 1JT0A 2QQ9A 4UV8A 4CO8A 1BI1A 2K4JA 1AKHA 2W82A 4S0HB 4BEHA 5IPAA 4Y52J 1CQTA 4C3JJ 2M45A 3L7WA 4R8HA 4LG3A 4EM2A 2A5YB 1JE8A 2ZXHA 4RA2A 3LSJA 1AWCA 4EJTA 3GXOA 2OCEA 1W7PD 4IF4A 4R1HA 4QPQA 2R5ZA 3T0YA 4BYYA 1MKMA 3JRFA 2KT0A 2LR8A 4E6KG 2CUEA 3K4CA 1FIAA 4J19A 3RKYA 2Q2EA 1F9NA 3GTLJ 2O8KA 3JTHA 2NNNA 3QPSA 4OU0A 5E20A 3CMMA 5H2FC 5CLSA 4XMYA 1MNMC 3F8BA 4LOCA 2PX9A 2K3FA 3L1PA 1Z3YA 3CMEI 4UHTA 3BLYA 1EKEA 2EK5A 5FO5A 2CQXA 1QVTA 2HZDA 4IRIA 1Z05A 1LUJB 2ESHA 3WTYC 4EMSA 4L18B 5CVUA 2P0WA 2VQHA 1E2XA 1R9TJ 4F55A 2DFIA 4AIJA 1I1SA 3IH2A 2RDPA 1VQLI 1OCPA 4U0WA 5EYRA 3M8JA 3K1NA 1IN8A 3H0GJ 2L54A 4I76A 3TDZC 4BS9A 4Q4ZF 3BJAA 1HXDA 3MEXA 4PZJA 2N8GA 3DQVC 5HODA 5FKLA 2ISZA 2OQGA 3U1DA 3E3VA 1ETQA 4G9YA 1VTNC 1SD4A 3HTSB 1IRXA 3JRIA 3IWFA 2OBPA 2W4SA 3GTJJ 2LLKA 3C1DA 1MBKA 1FPQA 1MW7A 3TMOA 1K4SA 3GFLA 1X2NA 2VT2A 2FNAA 2JRMA 2FA5A 2WB1N 2LRDA 3KLNA 1QGPA 4HW0A 1XMKA 2UXNA 5E8GA 1YRNB 4A93J 1MJ9A 2EB7A 1X19A 2V1XA 2DMTA 2LFBA 2X9DA 1Y39A 2CJJA 2Z1DA 3CTAA 3K2AA 2XPWA 4IX7A 2L9RA 1B59A 5HS9A 4Y15A 3M9AA 1JJ8C 1G4DA 3DWLE 4RLFA 3CC4I 2V6EA 4OIOF 3H5NA 3SQNA 1LDDA 4D0PA 3ABLH 1Y8QB 3FMQA 1QHGA 2K9MA 2CU7A 2P7CB 5J8FA 1BJZA 4CCNA 3ZQIA 3MFKA 3KP3A 4LG0B 3M1EA 1IW7F 4L5JA 4XQFA 1ZLJA 5LEKA 1RIOH 1PDNC 1QBJA 4N4NB 1YLFA 2KRHA 2VKHA 3G4SI 1MDMB 4KFCA 3R0AA 2F4OB 1JUMA 2FBIA 3BTIA 5F0CA 3ZQLA 3BQYA 1V54H 2VC0A 2QKLB 3JAMK 4HYEA 2R5ZB 1T8IA 4MNUA 1YS7A 2HEOA 1ENHA 2DN0A 4K2EA 2M8GX 4I0BA 5FKNA 2RNJA 2DTRA 3O2PE 2UV1A 4HPQA 5LLQA 3CMAI 1D0XA 5KVRA 4A6EA 4B4CA 3QPTA 5CQEA 3ZGKA 3K4NA 1IGNA 4C9YA 2XKPA 1P4XA 3GZ6A 2FQ3A 3PNYA 3ZMTA 2DTZA 1GV5A 3W3CA 1HW2A 2JMWA 4NC6A 4YIFA 3OSGA 4G7ZF 1S7EA 1R5GA 3QOEA 2X48A 1EA3A 2RN7A 2DFFA 5D6EA 3PNVA 3W2AA 2E1OA 4AYBN 5JVTA 2H1LA 4M3DA 2DA1A 4O5VA 3G73A 1OYWA 2AO9A 5EEAA 3I54A 1GDTA 4HF1A 3WTUC 3WU2C 2NXNB 4AVZA 4E70A 2GZWA 3FDYA 4M9ZA 4H0EA 1S72I 4U0YA 2F5EA 1GHCA 3I9V2 1MBJA 1DP3A 1FZPB 3K4LA 1O4XA 2JVHA 2HZTA 4XKBA 3RQ4A 5KHDA 1HF0A 4F91B 2EILH 3GZNB 4YFKF 3FF5A 3H3UA 3F9KA 4RAZA 2GBYA 4U87A 4BBSJ 4N4OB 4HQEA 2JA5J 3J7AY 2X1CA 1F43A 1G3SA 4M3BA 3AG3H 3OYFA 2L9SA 4I09A 4F3QA 1HKTA 1FBSA 1R23A 3QOPA 4FE4A 2BY3A 3TGNA 2K9LA 3EPZA 2OAZA 3F8FA 2ZMEA 1RUNA 1VF9A 1JKRC 2ZJQF 5F6FA 3DPUA 4LLNA 1IXSB 3RZDJ 4II3A 4RAFA 4ANJA 2CQKA 2CV0A 4KIGA 1S5LC 1LKXA 4BUPA 2YU9J 1G2HA 2ZBKA 3OS2A 2X85A 3QAHA 4DZJA 1G59A 4BY7J 1JT6A 3V8JA 2HVQA 3CCRI 2VI6A 4JX6A 1VQ8I 4AVPA 4RGSA 4MQ9F 4A0ZA 3TW7A 2CW8A 2EA2A 1YS6A 1R00A 5F1JA 4UUVA 2GXGA 4CZCA 3S15J 4BHBA 5LFAA 3FM3A 2R7WA 2VKVA 3TQNA 1HQCA 1MNEA 3BPXA 4KYWA 1D0ZA 1ONVA 3JRBA 3HOUJ 2QA4I 2EFWA 4PFOA 4HLXA 3ABMH 1S9HA 2VJIA 2HQAA 2XSJC 2A07F 3JRCA 4L9TA 5E3MA 3CC7I 2FOKA 5EG0B 4HOBA 5GTIC 3L9FA 4Y13A 4NBQA 1FOWA 2D5VA 1X1CA 1JXSA 1QA6A 4XRMA 2EZHA 1PJRA 3JRHA 3RQIA 3BROA 2F4IA 3QU3A 2OZUA 3EYYA 2QENA 4CUGA 2XGDA 3HHHA 5LGNA 3CCSI 1X2MA 1R4NB 2BHYA 2C6YA 4BEHB 1DDNA 1GVDA 2IA1A 2V1NA 4HF0A 3HYIA 3IC7A 3HRMA 3QYBA 2K9QA 3FBNB 5F0FA 2MH9A 2BBYA 2EJRA 1K79A 4RGRA 1ACIA 3K70C 2WBMA 2JA6J 2BW3B 1DU0A 3HOVJ 5DM6F 3S93A 3IRRA 1W0TA 1ZLKA 2I10A 2FX0A 3FXJA 2ZKZA 1WJEA 3Q0UA 4ZTJA 3KYDB 1XGNA 3ZOBA 2QF7A 1YG2A 2Z3YA 1X3ZB 3AG4H 5D5XB 4XLPF 1K78A 4JP0A 2OF7A 4EVIA 4IOAF 3HL2A 5F64A 3ASOH 4OOIA 2HDDA 4I2OA 2L4AA 2OA4A 2R7QA 1BL0A 1SMYF 2LD5A 2AXTC 1P4AA 2DT6A 4KMUX 5EG0A 4NC7A 3DF8A 2PJRA 3AFHA 3DBLB 4O3MA 2ZJRF 3MZ8A 3HRUA 1RKWA 1LJ9A 3HDDA 3ROUA 2FBHA 1B6AA 1WJFA 5D8LB 5FD5A 4UUSA 1YJWI 5HNHA 1LEBA 1UHWA 2BVMA 3O8GA 4OIRF 3M1CA 5A2QZ 4WXCA 1P4WA 2O7OA 2XAUA 2IPQX 2VL8A 3EETA 4UXNA 3VDXA 1CF7A 4ABZA 4OMYA 1GLNA 1T0FA 1SEUA 2Y2ZA 2BY0A 2GOXB 4BXFA 2DBBA 4Q5SF 4FQGA 2F2EA 5L3EA 2E34A 2DA7A 3F23A 5BMZA 5F27A 2ZSIB 4L0YB 4BACA 2KRCA 1N25A 4E7KA 1B9MA 3B6CA 3KPHA 5B1BH 1NTCA 4OMZA 1QU3A 1LNWA 2HXOA 1U8BA 1Z91A 3IRQA 3CZ6A 5D4RA 4UVAA 5EZGA 1SANA 2IA2A 4Q47A 3TOAA 2EFNA 5L3GA 4CYCA 2ADUA 4I99C 4A3DJ 3NWSA 2G9WA 5FB2A 3NWTA 1ZR2A 3KLOA 1H8AC 4ENMA 5C44J 2HU9A 4Q48A 1FP1D 2L5QA 4M71A 1UELB 2EFOA 1LFBA 2Y0MA 2R7RA 1D1BA 3M4OJ 2ISYA 2STTA 6PAXA 2CQNA 1O3SA 1RRJA 3I0TA 2M30A 4AD9A 5LHHA 4ON0A 2IS4A 2CSOA 1ITYA 2BHZA 2L9NA 2VUMJ 3Q0VA 1PVEA 4BH9A 1IV8A 5D5WB 2K9SA 1B8IB 1W5TA 2JT1A 5CVIA 4RAYA 3HG9A 3FHZA 4BDZA 1WWXA 5J8CA 1G3WA 5HDKA 2K86A 4WF2A 3K4KA 1YW7A 4NC8A 4B8XA 2XF6A 2V4JC 4EJOA 4I01A 4E7LA 3HGGA 2BY2A 3D1NI 4BNCA 2XPVA 5HDNA 1O3TA 1ETXA 3F0CA 2LY2A 2EZKA 3DTKA 1HBXG 2R7XA 2CW0F 4DQ2A 2KLOA 1A36A 1VFCA 2KP6A 1ZKGA 2K5CA 2FSWA 5A2QK 1KQ0A 1Y8RB 3VFZA 4BJ5C 2V79A 4LIUA 1UAAA 1BOAA 4XLHA 4RGUA 3OYLA 3A01A 3K4MA 3RI4A 3ML6A 1TQIA 2IXSA 1J5YA 2WY7Q 3J80K 2ECBA 4PJMA 5M5XJ 1LDJA 4U7DA 3CF2A 1WRJA 3A2KA 2CV2A 1RESA 5LD2C 5EEHA 1ZARA 2B0LA 2D1HA 2J5OA 1Y1WJ 4EEFG 1W7PA 3I59B 1QQIA 1WJ5A 2DJIA 4R79A 4MGRA 2DPUA 4A3GJ 2XGEA 5J1RA 1JJ6C 1AU7A 2FD5A 3LQRA 5DUKA 4WXDA 1FOYA 3CLOA 3MAJA 4KN7X 3QYFA 3K9TA 2VJ4A 2QCOA 1JHFA 3BJOA 3C18A 3FXUA 2NVTJ 1VNDA 3DLLF 2HOSA 1E17A 2HOTA 3HOSA 3N05A 2ME0A 1JUSA 1DU6A 3IWZA 4G6TB 4IVNA 4PSWA 1CF7B 4ZYDA 1OCRH 1FYKA 1ZR4A 2L7KA 2L2OA 1IRZA 5LHGA 1XSVA 1TWGJ 3MZHA 4LLGF 1FMVA 3ZQCA 4QLCU 1YHQI 3CC2I 2ACJA 3RJPA 2K4BA 2EBIA 3TOBA 3SYTA 5B3SH 2H09A 4XL9A 4CGZA 3EUHA 1RI7A 3RCOA 3NARA 5K5RA 1MMNA 5IP6A 4S04A 2ELJA 4UNOA 2XRNA 4A12A 1EF4A 2DYRH 3HOYJ 1I27A 1TWHJ 5CYVA 3MKZA 1P7JA 3RKQA 5LHIA 2YS9A 3K2ZA 4GRIA 5GADJ 4M6VA 3F21A 1YX3A 5FD6A 2HPMA 3FXMA 1L0OC 2KQRA 4UY8I 3HOWJ 5E3OA 2CRGA 2KZGA 3FX3A 5DCMB 4BXXJ 4BDYA 2JTVA 2H6CA 2V7FA 3KFWX 3T8RA 2QYOA 1ZH5A 3OIQA 4IHVA 1BM9A 1HC8A 1HW5A 3PNTA 4MFDA 5FRNA 3CCYA 3DV8A 3C2HA 4YEJA 5BNGA 2NOJB 4AM3A 3A0BC 5BOXA 4XKCA 1YYVA 1I6HJ 2ZFUA 2HVSA 2Y0SA 1BBYA 2DFEA 2QVOA 5FLXK 5HOOA 4RM3A 2QEXI 1T38A 1QVUA 4WCGA 3NEUA 4UUTA 3I56I 5K7FA 4Y4RA 3OR1C 4A69C 3C2GA 1S8NA 3QPLA 2XAHA 2EV0A 1YW9A 2X0LA 5E79C 1OR7C 3WHBA 4FE7A 4BQQA 1P2FA 2R93J 3M8FA 5J6XA 4XRSG 2P5LC 3OYJA 3LAPA 3BG3A 4WXHA 3PL8A 3ZMZA 1G8XA 1A31A 2L3DA 2M0CA 2R3SA 4E7IA 1I6XA 3S3NA 1KYZA 1ODDA 2LY9A 4NUBA 4PCQA 5E17F 3CCMI 3S2DJ 2M0MA 3M8EA 3GTMJ 5JI6A 2UZKA 3CCQI 2JSPA 3MN2A 4B1RA 2QQAA 3ZMDA 1KU2A 1GXPA 2JZYA 1MJBA 2DJNA 1FTTA 1S7OA 3L00A 3BWGA 3D5RC 3S1RJ 2XUBA 3M3YJ 2PMZN 3RYPA 3G2BA 1H0MA 5J3LA 3SHFA 3BJ6A 3TO7A 4JQFA 4CCJA 1A35A 2LTPA 2W24A 2CW7A 3PM1A 2XDVA 1ORKA 5H6RA 3IAS2 1TT0A 4KICA 1U9NA 2WV0A 4AC0A 1XB4A 3DCFA 4XLCA 1FC3A 5GAHJ 1I5ZA 1U8RA 2XB0X 3WTXC 2PJPA 3G3ZA 4BKXA 1AKHB 2HKOA 4QWQA 2PN6A 1Y0UA 1SVOA 2E36A 4BE0A 1QZYA 1KQ8A 1K78B 3KP6A 2HNHA 3HRTA 1F4KA 5EZHA 1EH6A 5JHFA 1OISA 4F52A 1VQNI 1J2XA 2IP2A 3I53A 1A5JA 4CDGA 2VJJA 2GIVA 1TC3C 1JI8A 3Q5FA 2E1CA 2TRTA 1IN4A 2RQPA 3RYRA 2PBIA 2DOFA 2FQ4A 4RB0A 3CDIA 3WTTC 1OJLA 2LREA 4P5OA 4BGDA 3FXQA 1O3QA 4G8XA 1N75A 4G6QA 2Y31A 4MQVA 1VQMI 1R5ID 1J9IA 3CF5F 4X1EA 3SJMA 3MVPA 1FYMA 3FK7A 2IS6A 5LBQA 1SAXA 3IUOA 1QZEA 1HW1A 3RDIA 3GVAA 4XN0A 4HA8A 2QGUA 1V5EA 2ZFWA 1XMAA 3BR1A 2F5CA 5EJCA 2DO7A 4DW6A 2W57A 3KEYA 3WG9A 4C3IJ 3PO3J 4CSWA 4D5CA 1W7PB 2IGNA 3ABUA 3I59A 4NQWB 4A3MJ 4BL0B 4E7JA 4KNYA 2NNYA 3OYAA 3OIPA 2Y48A 4ENKA 4KISA 2RQQA 2DOAA 4HQMA 2CUZA 2ZCWA 4OAYA 2E2IJ 1R5HA 3K70D 4CA0A 2MG4A 1A6QA 1P7IA 5CQGA 2YR2A 4LGWA 1GT0C 2ZNZA 4BBRJ 5FLMJ 2WY8Q 2OPTA 5E1XA 3U2RA 4XLFA 2HQ5A 5GP9A 3GYHX 1D1CA 1KYWA 5F1RA 1X58A 4GCVA 3KP4A 4V19K 3CQZJ 3O8HA 3Q9SA 1CGPA 2W48A 1U9OA 2V9PA 5HNFA 1T6SA 2FRHA 1Q1VA 3P9CA 2ME6A 2K3PA 2DA6A 3GCMA 3ZP5A 2DOEA 3KX2A 3H92A 5JR3A 3K7AJ 1B9NA 2Z33A 3L2WA 1KGSA 3MWMA 1SD7A 4PK4A 3CO6C 5E3LA 1MIJA 5DEQA 1WCMJ 3AL0C 2FJ1A 3CMYA 1KONA 3KEOA 1STZA 4ASNA 2MYSA 2PMZA 3TW6A 3W6VA 3MCZA 2RREA 3PJRA 3RZOJ 1E0EA 3K4BA 1WFXA 2XIGA 1MJAA 1APLC 1HOMA 5F08A 2E71A 1ETYA 4RLQA 1ON1A 3OR2C 4HX7A 1WSUA 3LFKA 1L3LA 4DOZA 2TCTA 1WH5A 3FXLA 1OR7A 1K6YA 4KJZA 3V8LA 3GEZA 3OY9A 1A04A 1T95A 2ZJPF 3H3ZA 1ZGAA 3DPLC 3V8KA 3WTWC 5E3NA 3LSHA 1ULYA 3BTJA 2VC1A 3EUKL 1W36D 4KMFA 5J4YA 4PJJA 1SFUA 1FSEA 2HGCA 3DPTA 5B1AH 2LKSA 2E2JJ 4A0XA 1G6NA 3G71I 1UMQA 2DODA 2EIJH 1YTYA 1T2KA 1DUXC 2WAEA 2K02A 2KIQA 2VQLA 3GFMA 2WC2A 3ECHA 4MFEA 4ZH4F 1BA5A 2R7FA 1DP7P 4EJVA 3SFIA 2L4MA 2X4HA 4CZZA 2GM4A 1SFXA 3PIPF 1TZLA 5C4JJ 3NRVA 2F48A 4IOCF 1PUFB 1IRFA 3FK6A 1UJ8A 5LRRA 2IAIA 2M87A 2JUCA 1FWZA 2NOGA 2VXDA 4XNFA 4N9HA 1M1EB 3VEPA 1SMTA 2DMNA 4L9NA 2KPMA 5LGUA 1IN5A 2PFBA 3BR2A 3C3WA 4KN4X 4XRFA 2ELKA 2IS2A 2VBZA 2M3AA 4E7ZA 1IUFA 4WK8F 5ICGA 1W36C 2CH0A 5LGTA 3WHCA 2JN6A 3GTPJ 4XORA 1HLVA 2R4GA 1RC9A 2M4GA 4DZPA 3KCCA 3GTKJ 4BXUA 2P5VA 4IZZA 1BW6A 3A03A 3ERED 1BI0A 1BN5A 3WGIA 2FOWA 2R7TA 1BR4A 3FXRA 1U78A 1LB2A 2DDAA 5GPCA 2X6WA 3H5RA 2GXBA 2K40A 1WH7A 3S1NJ 1FY7A 1OMIA 1REPC 2XB5A 1X3WB 2M4KA 3LA2A 2W85A 3CJQB 4LIVA 1J7KA 2XRLA 2YUSA 3NAUA 5FKOA 1JKPC 2VODA 4BHCA 2QWWA 1B72B 4ESFA 1X4OA 3E6CC 2MGQA 4ZDLA 4M3GA 3CD6I 4LK0F 4AIDA 1NG7A 4RB1A 3HSRA 5L3BA 3CJRB 2ID6A 2DLLA 2P6SA 3DKYA 3LWFA 4OWRB 3GF2A 1LVKA 4LITA 3OYKA 1SFOJ 3ERMA 1BI2A 3BR3A 3SZTA 3WU0A 1T39A 3GW2A 1C0WA 4A3BJ 1EV7A 2PMHA 3KETA 5EEGA 5J1UA 2DMQA 4C2MJ 2STWA 3HM5A 1FOKA 1XGOA 3BG9A 5DD8A 1Z9CA 2ZMEC 1R71A 2E1MB 1GXQA 2MBFA 1B72A 1YJNI 3R4KA 4N0BA 1X1AA 1T08B 1AA7A 3QU6A 3HKZN 3DXJF 4G94A 3K4JA 4W97A 3BTLA 1TT5B 2GAUA 1VQ5I 3OYEA 3F6VA 2WWYA 2KIUA 3BG7A 2KFDA 5ILSA 2CYYA 2LP0A 2DK8A 4HX4A 2Y0SN 2KL4A 4U7BA 4HNVA 3PUBA 2E5NA 2GWRA 4A5NA 3TEDA 5AIPA 1MMDA 1IN6A 1RETA 4GDFA 2HKXA 2P6TA 4IKFA 5IP9J 3JAMZ 1ETKA 2E2HJ 1V4RA 1FBUA 1DGWY 4I6ZA 1AOYA 2E5ZA 2DQLA 4ZYGA 1MNDA 2DAOA 2GA2A 3WGGA 3A0HC 1IG7A 2E7WA 2HFHA 2H6BA 3MZYA 2VQCA 1JUPA 2YX7A 3FMSA 3FISA 3AKZA 1N78A 1XCVA 2MD0A 3VYRB 5J40A 4A3LJ 2R7UA 2XROA 2P8TA 2EH3A 2NS8A 3O3KA 4GFBA 4IO9F 4ZDOA 1IC8A 1ZG1A 3PIOF 1QPIA 3GBGA 3JRGA 4RS8A 3P5JA 1FBQA 5CPRB 2CGPA 2VBWA 3IH4A 1D5VA 1DQUA 2Y9YA 2JQ7A 4YFNF 2NRAC 5M3MJ 2HDCA 1TWAJ 3ISPA 4IPAA 4CCLA 1FP2A 5C4XJ 5ED4A 3I4MJ 4XRSA 3F8CA 1TWFJ 3W2VA 2DA3A 2V1DA 2HR3A 1QO0D 4HNTA 2R5YA 1XN7A 5M5YJ 1DPRA 3P7NA 3TP0A 4XIDA 1EH8A 1OFCX 2GOMA 4KIBA 2W25A 1SFEA 3ZQHA 4XBFA 2KISA 1D3YA 4C2TA 1D0YA 5D5UB 2K27A 3S14J 5HS8A 3UKGA 4YFXF 4D5FA 3PFYA 3OOPA 2DMUA 4IL6C 3K0LA 1IF1A 3J81Z 1UB9A 2BGCA 2MC4A 2VXZA 2O03A 3C7JA 5BQTA 2VLAA 4EJUA 1YOVB 1RZ4A 1W5SA 1Y56A 2E7XA 4RBOA 2LVSA 3HSEA 4BJTA 2A3SA 4O6JA 2M8EA 5K5OA 3WTVC 1DGRM 3CLQA 1Z6RA 3H9GA 4P1WA 3OV8A 4JYKA 2O8XA 1MH4A 1BI3A 1MH3A 1XX5A 3HHGA 2Y30A 5EGOA 3BG6A 5C3EJ 1TQMA 3LSTA 2MW8A 2LKXA 2EIMH 5JLWA 2HYFA 1ETVA 2FMYA 4EQQA 3G6EI 2X51A 1IXRC 3F8MA 1HDDC 2VQGA 5IOYA 2I8DA 1KA8A 3LSKA 1U2WA 2LH9A 3E7LA 5TISC 4BAYA 2XC7A 1X4PA 2HOAA 5IY5H 1WHUA 2LF7A 2BOLA 3H3VK 2RGVA 1LPQA 3TDUC 4HSTA 3TL4X 5FJ8J 3HJEA 4GYGA 1D5YA 5E8IA 2MLGA 3E97A 1XGSA 3VSLA 1USTA 1K7AA 1R1TA 1GV2A 3KP5A 1TQPA 5JHUA 4XICA 2O5RA 2VOPA 2Q1ZB 1V5GA 4PSXA 3KZYA 3J7YJ 2JA2A 3E6DA 2JPCA 4JK1X 1J75A 2V1UA 2R7ZJ 2DCEA 2VN2A 2KIMA 1VI0A 2H94A 4V2FA 1IDYA 2A6HF 2XF5A 2V6CA 1FNNA 3S16J 5E1ZB 5HLIA 3OYHA 3DBHB 1HSJA 4UB6C 3JSOA 2YU3A 3E5UA 2KJBA 2LC2A 2WAFA 4NQWA 3ULQB 3K1PA 1D8KA 4ITVA 4DJAA 2CUJA 4UUSB 2A5WA 3DFGA 2NVYJ 4B09A 3U9GA 1H9TA 4BU2A 4Y33A 4Y17A 3J81K 2KJCA 3KP2A 2XSDC 1SVLA 3FMRA 3A01B 1KU7A 4EGYA 4FTHA 3L2UA 5BPDA 1XC5A 1MSEC 2W00A 3U21A 5ICEA 2FE3A 1IZ1A 2DI3A 2VJ5A 2ECCA 4CCOA 2I5UA 1Y0NA 3ABTA 2R7VA 3ELKA 2XF7A 3CUQC 2PLYA 5AIQA 1UG0A 1N77A 2XAQA 3BG5A 1FTZA 1JTYA 3HIFA 4OIQF 1T56A 2X1EA 3BP8A 2VT3A 3L2CA 4E4HA 2LBFA 3ONQA 1SD6A 1MBFA 2UUZA 1ZRFA 1ZELA 4IHSA 1J09A 4BY1J 4MTEA 1H88C 3DKWA 1XMXA 5IYCJ 2B9SA 4BQNA 3GLLA 3ZPLA 3HB9A 4I0AA 3PQJA 3B02A 2OQRA 1YQAA 2V9KA 4ENJA 4P9UA 3MKWB 4NB5A 4AU7A 4PJ0C 3LAJA 1O3RA 2G7HA 1H89C 1IN7A 3PO2J 2A61A 1A6IA 4DYRA 2OCCH 4PFPA 1W4MA 1ZGWA 1R22A 3QYEA 1ZYRF 2KKOA 1WVRA 1BOBA 1MZBA 2HWVA 1I3QJ 1XCBA 3HKZA 1DPUA 1XSXA 2ZXIA 1U0JA 4HDUA 1XTAA 2CFXA 2MC3A 1ETOA 1B1BA 3Q3SA 2UWMA 4M3EA 5F0HA 4EV0A 1YO5C 5FGMA 4A3IJ 4YRVA 3L2VA 3D5SC 1MBGA 4F92B 1X1PA 3DTIA 2H8RA 4JX5A 2A05A 5DCFA 3FWEA 3HC7A 4S05A 2VASA 3T5XA 4BE1A 4HV5A 3Q0WA 4DBQA 5DD4A 4DNCA 1R1VA 4HRIA 2Q8KA 1HKQA 3KIOA 4BJ6C 1PYVA 3X2QH 1TW2A 1VQ4I 1NHAA 2E1NA 4PJLA 3JRDA 1WQ2A 2FEZA 2ZXJA 3F8NA 2L02A 5LRSA 2D2WA 1GUUA 2OV7A 1Q1HA 2R92J 1RKTA 3AAFA 3KYLA 3OSFA 5DS9A 2Z5UA 3OIOA 1V55H 1ZN2A 4XKVA 4A5MA 2AQFA 3A02A 4NHJA 1NK2P 2ID3A 4ZYAA 4DYCA 4ZZLA 3B6AA 4X0GA 2YX4A 3G1MA 1Y6IA 3HGYA 2RNGA 2ELHA 4KUMA 3J7ZI 2BVLA 3GZ5A 4JX4A 1Z7UA 1UHSA 3JRAA 3I71A 4ZTFA 2DFHA 3KEQA 4YG2F 1HDPA 2LNBA 3D0SA 4IXAA 1JTXA 3LA3A 2MSYA 2Y69H 3EYIA 1B4AA 4UVBA 2LBFB 2IGOA 3JCUC 1FJLA 3FZVA 3H35A 1BR2A 4BQOA 1PP7U 1R6RA 1OYIA 5DUIA 4WWCA 3TO9A 5L3CA 1OCZH 2IA0A 4B43A 4M6XA 2CQ7A 3DTEA 1X1DA 1TNTA 4ETSA 1RR7A 3MKLA 3VYSB 5FKKA 5FKMA 3CP2A 1FT9A 4KT5C 4C3HJ 3JTGA 2R7DA 1D8JA 2FNPA 3OOUA 1JKOC 2HOEA 3I5UA 2J5PA 2BYVE 4XSXF 3S1MJ 3OMYA 1ZRDA 1E3PA 3BY6A 4PGHA 3BZKA 1LFUP 2WTEA 4WX9A 4U88A 3HEFA 2CMPA 2PEXA 2L7FP 4ZJZA 4CICA 1OCOH 2OJED 2E35A 2JWTA 2WV1A 5E1WA 1RUOA 4ZC3A 1ZHFA 2HVRA 3Q9VA 5TJJA 5TRDA 5M3FJ 3DEWA 3WGHA 3OYBA 2QUFA 4ENNA 1VQOI 1Z77A 2COBA 2LOOA 1PUEE 5ICCA 1RR8C 3FM5A 3WU1B 5FRMA 4M73A 2Z16A 3SZPA 1P9QC 1WGXA 5GAGJ 3M07A 5DM7F 2M9HA 2JRTA 4ESBA 2WB1A 4A3EJ 4B48A 5CVJA 3HBLA 2GA1A 3I58A 4A2UA 2VB6A 4NDLA 2O0YA 3QRFF 2QQ8A 4MIMA 3ZQGA 2ZO4A 4Y3OA 3H0DA 1WZ2A 3QWLA 2HTJA 5HLHA 1W1WE 4IHXA 4IRGA 5HS7A 3K6GA 3FKIJ 2X1DA 2JA8J 1UFMA 2W1OA 1SFKA 3BCBA 1H9GA 3T1BA 3L09A 2IEKA 4P55A 3SXYA 3F22A 4G6DA 1P92A 3MMYB 2ZNYA 3ECOA 4F93B 1MDMA 1T0FC 4CH7A 2EIKH 3I4PA 3HUGB 2IGKA 4HEA2 4M72A 1IO2A 2A6TA 2XAFA 4JOMA 2L7ZA 3GMEA 3KYCB 4IJAA 2PJRB 4LD5A 4MO7A 2KZVA 3AG2H 1T98A 3AL0B 4RM2A 3LSIA 4ZZDA 2VBYA 4HBLA 4PUSA 4XN3A 1LEAA 1JHHA 2F4MB 3IP4B 4IQ4A 1IRGA 2FU4A 4KIFA 3DEUA 4IQJA 1T33A 4II2A 4A3CJ 3CJNA 2VKDA 2DA4A 5FFZA 2DW4A 3C2BA 4A3KJ 1TW3A 1YI2I 1BJAA 5EF6A 3PSIA 2JVGA 2CUFA 3ZRGA 1K6OA 1WJAA 3IL2A 3I55I 1XG1A 2LG4A 4XLAA 3S17J 3DBRB 4A6DA 4LJZF 1GVJA 1MBHA 3FIWA 3A1YA 2AXLA 2BZTA 2ZC2A 4KITB 4L5EA 2M7BA 4B3XA 1E3HA 2EWNA 4G7OF 1S3JA 1Z67A 4M74A 4HDVA 2K9NA 2XHKA 3HUGA 3RPUD 2OZ6A 2TDXA 4TV7A 5ERIA 4FX4A 1FMWA 5EDNA 1POGA 2EV6A 3H1CA 1YE9A 4HZFA 1XSDA 3OWTA 3VPRA 2NVQJ 1RPWA 1BW5A 2L01A 5KK1A 3J80Z 2AHQA 5IP7J 5HLTA 2ZB9A 1LE8B 1TNSA 2DA2A 2BE5F 3OL3A 2VE9A 2G7UA 3L2RA 1Z3XA 3S2HJ 2HS5A 3CCEI 2X6YA 3LSPA 1JGSA 4LLLA 1TP4A 5BS6A 2OTJI 3SEQA 3LSMA 2R7OA 4XR6A 1ON2A 2VBXA 3BR6A 4HF2A 1LQ1A 3B73A 1LFPA 3BC8A 2W84A 1XD7A 3EUAA 2HPIA 4ZYEA 3S1QJ 2VE8A 5H20A 4CCMA 3CESA 2IGMA 4EM0B 1MMSA 4J00A 4ESJA 2LF8A 2QZ8A 3ABKH 2B63J 4GGGA 4RB2C 2XVCA 3KZZA 4DBRA 3QQAA 2DDBA 4HSRA 1QRYA 2ESNA 3CP8A 4MLOA 2JSCA 2KMUA 3A4CA 4YELA 4ZYHA 4A3FJ 1HSTA 1AHDP 5CVRA 5K7HA 4HV6A 4OINF 4F7ZA 5D4SA 1FOXA 9ANTA 4L5IA 4UB8C 1JKQC 1ZG5A 3E5XA 1WJDA 2DT7B 5KAIC 2DU9A 2AQEA 2GQQA 2FUG2 2WAQA 3DLAA 1X3UA 3ZXSA 1YRNA 3SDBA 4LB5A 2K85A 2M1BA 2DYSH 3MD2A 4DGWB 2F5FA 5IT3A 4OIPF 1HCRA 4P9FA 5ILVA 3CDHA 3TO6A 3E6BA 5J4VA 3TBIA 3OS0A 2HYGD 2IVMA 2QQBA 4V2GA 1LE8A 1EJ9A 4X6AJ 3N4MA 2P4WA 2HYJA 1O7FA 4XSZF 2M5WA 3ZMUA 1FLIA 1BIBA 2NS0A 4B3AA 3SZGA 5K5QA 3I4NJ 3ZR8X 2O61A 1R58A 4RMNA 5ILUA 1XGMA 2Q0OA 1R1UA 4G7HF 3GO5A 3KP7A 1KZHA 1XS9A 5F04A 1MMGA 2A69F 2H8WA 4EM1A 3ZMSA 5HVQC 4AIKA 2JPBA 3GFIA 5K7ZA 2EQRA 2FXAA 3LA7A 4A3JJ 2KRFA 2PI0A 5IT9Z 2WA0A 2RVCA 4XM3A 1J0RA 4XLEA 4AYBA 3KE2A 2VONA 4HAMA 3EQLF 3BZCA 4NNJA 1VQ7I 2BXZA 1OQYA 1NH3A 2LSOA 2LYCA 2ZMEB 5KNLA 1OCTC 1TLHB 4QIWN 1ERDA 5H6QA 1ETWA 3V42A 4GYIA 5D5VB 2IBDA 3K10A 4I7HA 2A6EF 2EZLA 3E1SA 4AUXA 2CWEA 3V7RA 2MA3A 2OD5A 4XOTA 4XKWA 1RNLA 2OTLI 1VQKI 1TTYA 4BE2A 5KAFC 2HXIA 3ZMVA 2IT0A 3REOA 2ETHA 4C30A 5JVGF 1WI9A 3WODF 2NYXA 1U6GA 2COMA 3SDGA 2A68F 2L9VA 3AG1H 3WG7H 3U1KA 3JSPA 1SD5A 3BTCA 3GLXA 3IKTA 1MBEA 3WE3A 3S3OA 2YSRA 3HZJA 3LMMA 3OL4A 4B44A 5DDGA 3O6BB 3UR3C 2NVXJ 2ZXWH 3LSGA 2M7AA 4RGXA 4PGGA 4DYQA 3R6SA 4RB3C 4IEJA 2E19A 3QODA 2G0EA 1MMAA 3L2QA 3D5LA 5M5WJ 1XDUA 1BC7C 2R0QC 3IH3A 2VOOA 1SVMA 5KCMA 3CCUI 1ZG3A 4G12A 4A0YA 1PUFA 1Z1DA 3R61A 3IAM2 2H1KA 3BZ6A 4HNUA 2HQNA 1EH7A 4FHTA 1WPKA 1SAUA 3CUQB 3VYTB 3G1LA 1WI3A 1U5TA 3ZQ7A 3HRSA 3JW4A 1MD0A 2ZJ2A 4M9XA 4UV9A 3WTSC 5AONA 2O6GE 2XAGA 4H4KC 2P7VB 4L9VA 3RKXA 2MABA 3G1OA 3I3LA 5D8KB 2JJ7A 4UVCA 2DPDA 3CUOA 3H36A 2DXIA 3BOQA 4BHPA 1OPCA 1Z0XA 3RPQA 2F5VA 2LMDA 5EGOB 1Z6TA 4XONA 2XASA 3HXLA 1YJ9I 2IRFG 1BR1A 4FISA 4LFUA 2OU2A 3ZQFA 4Y7NJ 3S32A 2LY1A 5JFRA 2EA4A 3COAC 2LK2A 4YIIA 2ICWG 4ZDPA 2BEOA 2EINH 5E18F 2K7LA 2JA7J 1IJWC 1BC8C 3RSNA 1YIJI 4D7NA 1R36A 1QNTA 3IHUA 4CYDA 2QBYB 3PQKA 1B8IA 2EFPA 1YX5A 1ZAOA 3FXOA 3IV5A 3SFZA 3VODA 1U5TB 3ZQQA 3DEEA 5FLVA 3HSFA 2KDOA 4FCYA 2M34A 2NAZA 1W0UA 3V7CA 2XAJA 1FX7A 5IOZA 2JUGA 3VSKA 1FYLA 4D9JA 4RDUA 4XOPA 3BDDA 4FASD 1R49A 4FETA 2DK5A 1VZ0A 2VIXA 1YITI 2F6CA 2HQRA 3S8PA 3WTZA 5IT9K 3GWZA 5IYBJ 2P5KA 3RKWA 4KDPA 1TBXA 1W5CC 4I02A 2BV6A 4P96A 4FX0A 1WJBA 1F5TA 1HKSA 3KZIC 3CDLA 2NVUB 3BT9A 4AWXB 3JREA 1PP8F 1K4TA 3F6OA 3VB2A 3HOZJ 3K69A 2Z99A 4LK1F 3DU6A 3I64A 3J7AO 1I50J 5TGTA 3ZN1A 1IXCA 3CO7C 2WADA 2YPRA 3TKYA 1S6LA 1MGTA 2D1VA 4DIQA 4M9SA 2CFOA 1YW8A 2RKHA 5ICFA 1BIAA 1OKRA 1YIOA 2QSFX 2PQ8A 1U5TC 2V9VA 3MKYB
chains in the Genus database with same CATH topology
3IKVA 3GX4X 1G3TA 4L9JA 1KU3A 3NQOA 2FF4A 4LB6B 4BQAA 3M7GA 1OYYA 3S2WA 4L0ZB 5L3FA 1LDKB 3QPHA 2DQRA 3EDPA 4M6YA 2IJLA 4U0VA 1YFHA 1J59A 4N9IA 3RPUA 1LVAA 2D45A 2CO5A 2AS5F 3V7SA 4MTDA 5D6FA 2RC4A 1O57A 3N97A 2RV8A 3R0JA 3GUDA 2H27A 3W6KB 1ZRCA 4HX8A 1UCRA 3P9IA 4MEYF 1KU9A 4IRHA 3GFJA 1P6RA 3HTUA 3LQQA 2KIFA 2Z9OA 1V3FA 1QPMA 1UHMA 3T8TA 2PMUA 3E5QA 4Z2YA 1USSA 2PG4A 2MD5A 2EFQA 3MQ0A 5L3DA 4AIHA 4GXOA 4HLYA 2LDUA 5DV5A 3WE2A 5FFXA 2MH2A 4I98B 3V4GA 4MHGA 1KQ9A 2MLKA 3DP7A 3F3XA 2O3FA 4KA4A 5K1YA 1O7LA 3W6JB 3HOTA 2QLZA 3RTRA 1QZZA 2XV4S 4JBAA 2Y75A 2HTSA 2FBKA 1F1ZA 1S29A 4LMYA 2FMLA 4PDKA 2XKOA 2CG4A 1IUYA 3PFIA 4EJWA 5LEJA 1U3EM 4CXFA 3R60A 1ZREA 1G3YA 5BPIA 3VOEA 1FSHA 3BPVA 1S7AA 3QP5A 5DYMA 4IHTA 2EV5A 3QP6A 2QM3A 1R7JA 2UXXA 1I1GA 2QBYA 4LG0A 1WKMA 1ZGJA 5HDGA 3RIRA 5HLGA 2IW5A 5DCMA 4FT8A 2F5DA 5CVVA 4EGZA 3ZN0A 4XLNF 2DT5A 3K1MA 1XDSA 4GO1A 3F72A 3CUQA 3P9KA 4MEXF 1IAWA 4CHUA 5CJ9A 2LKPA 3E6MA 2XGXA 5FLXZ 2QQ9A 4UV8A 4CO8A 1BI1A 2K4JA 2M45A 3L7WA 4R8HA 4EM2A 2A5YB 1JE8A 4EJTA 1AWCA 3GXOA 1W7PD 4IF4A 4R1HA 3T0YA 4BYYA 1MKMA 3RKYA 2Q2EA 1F9NA 4OU0A 3JTHA 2NNNA 5E20A 5CLSA 3F8BA 4UHTA 2EK5A 5FO5A 4IRIA 1Z05A 2ESHA 3WTYC 4EMSA 4L18B 5CVUA 1E2XA 2DFIA 4AIJA 1I1SA 2RDPA 4U0WA 3K1NA 1IN8A 2L54A 3TDZC 4Q4ZF 3BJAA 1HXDA 3MEXA 4PZJA 3DQVC 2ISZA 2OQGA 3U1DA 3E3VA 4G9YA 1VTNC 1SD4A 3HTSB 3IWFA 2OBPA 3C1DA 1FPQA 3GFLA 2VT2A 2FNAA 2FA5A 3KLNA 1QGPA 4HW0A 1XMKA 2UXNA 5E8GA 1MJ9A 2EB7A 2V1XA 3CTAA 5HS9A 1B59A 4Y15A 3M9AA 1G4DA 4OIOF 3SQNA 1LDDA 4D0PA 3FMQA 2P7CB 5J8FA 3MFKA 3KP3A 4LG0B 3M1EA 1IW7F 4L5JA 5LEKA 1ZLJA 1PDNC 1RIOH 1QBJA 1YLFA 1MDMB 4KFCA 3R0AA 2FBIA 2VC0A 3JAMK 4HYEA 4MNUA 1YS7A 2HEOA 4K2EA 4I0BA 2RNJA 2DTRA 3O2PE 5LLQA 5KVRA 4A6EA 3QPTA 2XKPA 1P4XA 3GZ6A 2FQ3A 3ZMTA 1HW2A 4YIFA 4G7ZF 1R5GA 2RN7A 5D6EA 5JVTA 4O5VA 3G73A 1OYWA 3I54A 4HF1A 3WTUC 4E70A 2GZWA 4M9ZA 4H0EA 1GHCA 4U0YA 2F5EA 1FZPB 2HZTA 4YFKF 3FF5A 3H3UA 4RAZA 4HQEA 1G3SA 4I09A 1HKTA 1FBSA 1R23A 3QOPA 3TGNA 2OAZA 3F8FA 2ZMEA 1RUNA 5F6FA 4LLNA 1IXSB 2CQKA 4KIGA 2ZBKA 3QAHA 3V8JA 4AVPA 4RGSA 4MQ9F 4A0ZA 2EA2A 1YS6A 1R00A 4UUVA 2GXGA 4BHBA 3FM3A 3TQNA 1HQCA 4KYWA 3BPXA 1ONVA 2EFWA 4HLXA 2A07F 4L9TA 2FOKA 4HOBA 3L9FA 4Y13A 1JXSA 3BROA 3QU3A 2OZUA 3EYYA 2QENA 5LGNA 3HHHA 2C6YA 1DDNA 2IA1A 4HF0A 3HYIA 3IC7A 3HRMA 2MH9A 2BBYA 2EJRA 1K79A 4RGRA 3IRRA 1ZLKA 2ZKZA 1XGNA 1YG2A 2Z3YA 4XLPF 5D5XB 1K78A 4EVIA 5F64A 4OOIA 4I2OA 2L4AA 2OA4A 1SMYF 1P4AA 4KMUX 3DF8A 4O3MA 3HRUA 1LJ9A 3ROUA 2FBHA 1B6AA 5D8LB 5FD5A 1LEBA 1UHWA 4OIRF 5A2QZ 4WXCA 1P4WA 2IPQX 3EETA 4UXNA 1CF7A 4OMYA 1T0FA 2DBBA 4Q5SF 2F2EA 5L3EA 3F23A 5BMZA 4L0YB 1B9MA 4OMZA 1LNWA 1Z91A 3IRQA 5D4RA 4UVAA 4Q47A 2IA2A 3TOAA 2EFNA 5L3GA 2ADUA 5FB2A 2G9WA 3KLOA 4ENMA 4Q48A 1FP1D 4M71A 2EFOA 2Y0MA 2ISYA 2STTA 6PAXA 1O3SA 3I0TA 2M30A 4AD9A 5LHHA 4ON0A 2CSOA 4BH9A 5D5WB 1W5TA 2JT1A 5CVIA 4RAYA 3FHZA 1WWXA 5J8CA 1G3WA 5HDKA 2K86A 4WF2A 1YW7A 4B8XA 4EJOA 4I01A 4BNCA 5HDNA 1O3TA 1HBXG 2CW0F 4DQ2A 2FSWA 5A2QK 1KQ0A 3VFZA 2V79A 1BOAA 4RGUA 3RI4A 3ML6A 1TQIA 1J5YA 3J80K 1LDJA 4U7DA 1WRJA 5EEHA 1ZARA 2B0LA 2D1HA 2J5OA 1W7PA 3I59B 1QQIA 4R79A 4MGRA 2DPUA 3LQRA 5DUKA 4WXDA 3CLOA 3MAJA 4KN7X 3K9TA 1JHFA 3BJOA 3C18A 3FXUA 1E17A 3HOSA 3IWZA 4IVNA 1CF7B 4ZYDA 1FYKA 5LHGA 1XSVA 3MZHA 4LLGF 4QLCU 2ACJA 3RJPA 2K4BA 3TOBA 2H09A 4CGZA 3EUHA 1RI7A 5K5RA 4S04A 4UNOA 2XRNA 4A12A 1I27A 5CYVA 5LHIA 3K2ZA 3F21A 5FD6A 1L0OC 3FX3A 5DCMB 2JTVA 2H6CA 3KFWX 3T8RA 2QYOA 1ZH5A 1BM9A 1HW5A 3DV8A 5BOXA 1YYVA 1BBYA 2QVOA 5FLXK 5HOOA 1T38A 4WCGA 3NEUA 1S8NA 2XAHA 2EV0A 1YW9A 2X0LA 1P2FA 3M8FA 5J6XA 2P5LC 3LAPA 4WXHA 3ZMZA 2L3DA 2R3SA 1I6XA 1KYZA 1ODDA 4PCQA 5E17F 3M8EA 5JI6A 2UZKA 2QQAA 3ZMDA 1KU2A 1GXPA 2JZYA 1MJBA 1S7OA 3L00A 3BWGA 2XUBA 3RYPA 1H0MA 3SHFA 3BJ6A 3TO7A 4JQFA 2W24A 5H6RA 4KICA 2WV0A 1XB4A 1FC3A 1U8RA 1I5ZA 3WTXC 2PJPA 3G3ZA 2HKOA 4QWQA 2PN6A 1Y0UA 1QZYA 1KQ8A 1K78B 3KP6A 3HRTA 1F4KA 1EH6A 1J2XA 2IP2A 3I53A 4CDGA 2GIVA 3Q5FA 2E1CA 1IN4A 2RQPA 3RYRA 2PBIA 4RB0A 3WTTC 4P5OA 3FXQA 1O3QA 4G8XA 4G6QA 4MQVA 1J9IA 1FYMA 5LBQA 1SAXA 1HW1A 3RDIA 3GVAA 4HA8A 2ZFWA 1XMAA 2F5CA 2DO7A 2W57A 3WG9A 1W7PB 3ABUA 3I59A 4KNYA 2NNYA 2Y48A 4ENKA 4HQMA 2ZCWA 1R5HA 2YR2A 4LGWA 2ZNZA 5E1XA 3U2RA 3GYHX 5F1RA 1KYWA 4GCVA 3KP4A 3Q9SA 1CGPA 1T6SA 2FRHA 3P9CA 3ZP5A 3H92A 5JR3A 1B9NA 2Z33A 1KGSA 3MWMA 1SD7A 3CO6C 5DEQA 3KEOA 1STZA 4ASNA 3MCZA 2XIGA 1MJAA 1ON1A 4HX7A 1WSUA 3LFKA 1L3LA 1OR7A 3V8LA 3GEZA 1A04A 3H3ZA 1ZGAA 3DPLC 3V8KA 3WTWC 1ULYA 2VC1A 4KMFA 1SFUA 1FSEA 2HGCA 3DPTA 4A0XA 1G6NA 1T2KA 1YTYA 1DUXC 2K02A 3GFMA 2WC2A 3ECHA 4ZH4F 2R7FA 1DP7P 4EJVA 2L4MA 2X4HA 4CZZA 1SFXA 3NRVA 1IRFA 5LRRA 2M87A 1FWZA 4N9HA 3VEPA 1SMTA 4L9NA 5LGUA 1IN5A 2PFBA 3C3WA 4KN4X 4XRFA 2VBZA 4WK8F 5ICGA 5LGTA 3KCCA 4BXUA 2P5VA 3ERED 1BI0A 1BN5A 3WGIA 3FXRA 1U78A 1LB2A 2GXBA 1FY7A 1OMIA 1REPC 3LA2A 2W85A 1J7KA 2VODA 4BHCA 2QWWA 4ESFA 3E6CC 4LK0F 4RB1A 3HSRA 5L3BA 2DLLA 2P6SA 3LWFA 3GF2A 1BI2A 1C0WA 3SZTA 3WU0A 1T39A 3GW2A 1EV7A 2PMHA 3KETA 5EEGA 2STWA 1FOKA 1XGOA 5DD8A 1Z9CA 1GXQA 2MBFA 3R4KA 4N0BA 3QU6A 3DXJF 4G94A 2GAUA 3F6VA 2WWYA 2KIUA 5ILSA 2CYYA 2DK8A 4HX4A 4U7BA 2GWRA 4A5NA 5AIPA 1IN6A 2HKXA 2P6TA 3JAMZ 1V4RA 1FBUA 1AOYA 2DQLA 4ZYGA 2DAOA 2GA2A 3WGGA 2E7WA 2HFHA 2H6BA 3MZYA 2YX7A 3FMSA 1XCVA 2XROA 2P8TA 3O3KA 1ZG1A 4RS8A 1FBQA 2CGPA 2VBWA 1D5VA 2NRAC 4YFNF 2HDCA 3ISPA 4IPAA 1FP2A 5ED4A 3F8CA 2V1DA 2HR3A 1QO0D 1XN7A 1DPRA 3P7NA 1EH8A 4KIBA 2W25A 1SFEA 4XBFA 1D3YA 5D5UB 2K27A 5HS8A 4YFXF 3OOPA 3K0LA 1IF1A 3J81Z 1UB9A 2BGCA 2VXZA 3C7JA 2O03A 5BQTA 4EJUA 1RZ4A 1W5SA 2E7XA 3HSEA 2A3SA 4O6JA 2M8EA 5K5OA 3WTVC 1Z6RA 3OV8A 2O8XA 1BI3A 3HHGA 1TQMA 3LSTA 2HYFA 2FMYA 4EQQA 1IXRC 3F8MA 1KA8A 1U2WA 4BAYA 2LF7A 2RGVA 3TDUC 4GYGA 5E8IA 2MLGA 3E97A 1XGSA 1USTA 1K7AA 1R1TA 3KP5A 1TQPA 5JHUA 2VOPA 3KZYA 3E6DA 4JK1X 2JPCA 1J75A 2V1UA 2VN2A 2KIMA 2H94A 2A6HF 2V6CA 1FNNA 5E1ZB 5HLIA 1HSJA 3JSOA 2YU3A 3E5UA 2KJBA 4NQWA 3ULQB 3K1PA 1D8KA 3DFGA 4B09A 1H9TA 3U9GA 4Y17A 3J81K 2KJCA 3KP2A 3FMRA 1KU7A 4EGYA 5BPDA 5ICEA 2FE3A 1IZ1A 2DI3A 3ABTA 3ELKA 3CUQC 2PLYA 5AIQA 2XAQA 3HIFA 4OIQF 3BP8A 2VT3A 3L2CA 1SD6A 4IHSA 1ZRFA 4MTEA 3DKWA 3ZPLA 4I0AA 3PQJA 3B02A 2OQRA 1YQAA 4ENJA 4P9UA 4NB5A 3LAJA 1O3RA 2G7HA 1IN7A 2A61A 1W4MA 1R22A 1ZYRF 2KKOA 1MZBA 2HWVA 1XCBA 1DPUA 1XSXA 4HDUA 2CFXA 2MC3A 1B1BA 2UWMA 4EV0A 1YO5C 5FGMA 5DCFA 3FWEA 4S05A 3T5XA 4HV5A 5DD4A 4DNCA 1R1VA 2Q8KA 1HKQA 1TW2A 1NHAA 2E1NA 1WQ2A 2FEZA 2ZXJA 3F8NA 2L02A 5LRSA 2D2WA 1Q1HA 3AAFA 2Z5UA 1ZN2A 4NHJA 4A5MA 4ZZLA 2YX4A 4KUMA 2ELHA 3GZ5A 1Z7UA 3I71A 3KEQA 4YG2F 2LNBA 3D0SA 4IXAA 3LA3A 3EYIA 1B4AA 4UVBA 3FZVA 1PP7U 1OYIA 5DUIA 4WWCA 3TO9A 5L3CA 2IA0A 4M6XA 1TNTA 4ETSA 3JTGA 4KT5C 1FT9A 2R7DA 1D8JA 2FNPA 2HOEA 3I5UA 2J5PA 2BYVE 4XSXF 1ZRDA 3BY6A 4PGHA 2WTEA 4WX9A 4U88A 2PEXA 4CICA 5E1WA 1RUOA 1ZHFA 3Q9VA 5TJJA 5TRDA 3WGHA 2QUFA 4ENNA 1PUEE 5ICCA 3FM5A 3WU1B 4M73A 3SZPA 2JRTA 4ESBA 5CVJA 2GA1A 3I58A 4A2UA 2O0YA 3QRFF 2ZO4A 2HTJA 5HLHA 4IRGA 5HS7A 1UFMA 1H9GA 3T1BA 3L09A 4P55A 3SXYA 3F22A 4G6DA 1P92A 2ZNYA 3ECOA 1MDMA 3I4PA 4M72A 2XAFA 4IJAA 4LD5A 1T98A 4ZZDA 2VBYA 4HBLA 1LEAA 1JHHA 1IRGA 2FU4A 4KIFA 3DEUA 3CJNA 5FFZA 2DW4A 1TW3A 1BJAA 1K6OA 3IL2A 4A6DA 4LJZF 1GVJA 2AXLA 2EWNA 4G7OF 1S3JA 4M74A 4HDVA 2XHKA 3HUGA 2OZ6A 2TDXA 4TV7A 5ERIA 4FX4A 2EV6A 4HZFA 1XSDA 2L01A 5KK1A 3J80Z 1TNSA 2BE5F 2VE9A 2G7UA 2HS5A 1JGSA 4LLLA 5BS6A 1ON2A 2VBXA 4HF2A 1LQ1A 3B73A 2W84A 4ZYEA 1XD7A 2VE8A 5H20A 4EM0B 4ESJA 2LF8A 2QZ8A 4GGGA 4RB2C 2XVCA 3KZZA 2ESNA 2JSCA 4ZYHA 1HSTA 5CVRA 4HV6A 4OINF 4F7ZA 5D4SA 4L5IA 1ZG5A 3E5XA 2DU9A 2GQQA 1X3UA 4LB5A 2M1BA 2F5FA 5IT3A 4OIPF 4P9FA 5ILVA 3CDHA 3TO6A 3E6BA 2HYGD 2IVMA 2QQBA 3N4MA 2P4WA 1O7FA 4XSZF 2M5WA 3ZMUA 1FLIA 1BIBA 2NS0A 5K5QA 2O61A 1R58A 5ILUA 1XGMA 2Q0OA 1R1UA 4G7HF 3GO5A 3KP7A 4AIKA 2A69F 4EM1A 3ZMSA 5HVQC 2JPBA 3GFIA 2FXAA 3LA7A 2KRFA 2PI0A 5IT9Z 2RVCA 1J0RA 3KE2A 2VONA 4HAMA 3EQLF 2LSOA 2ZMEB 1TLHB 5H6QA 4GYIA 5D5VB 4I7HA 2A6EF 2CWEA 3V7RA 2MA3A 2OD5A 1RNLA 1TTYA 3ZMVA 2IT0A 3REOA 2ETHA 1WI9A 3WODF 2NYXA 1U6GA 2COMA 2A68F 3JSPA 1SD5A 3GLXA 3IKTA 3WE3A 2YSRA 5DDGA 3O6BB 4RGXA 4PGGA 3R6SA 4RB3C 3D5LA 1XDUA 1BC7C 2VOOA 1ZG3A 4A0YA 1Z1DA 3R61A 3BZ6A 2HQNA 1EH7A 4FHTA 3CUQB 1U5TA 3ZQ7A 3HRSA 3JW4A 1MD0A 2ZJ2A 4M9XA 4UV9A 3WTSC 5AONA 2O6GE 2XAGA 2P7VB 4L9VA 3RKXA 5D8KB 4UVCA 2DPDA 3CUOA 3BOQA 4BHPA 1OPCA 3RPQA 1Z6TA 2XASA 2IRFG 4LFUA 2OU2A 5JFRA 2EA4A 3COAC 4YIIA 2BEOA 5E18F 2K7LA 1BC8C 1R36A 1QNTA 3IHUA 4CYDA 2QBYB 3PQKA 2EFPA 1ZAOA 3SFZA 3VODA 1U5TB 3HSFA 2NAZA 3V7CA 2XAJA 1FX7A 1FYLA 3BDDA 2DK5A 2HQRA 3WTZA 5IT9K 3GWZA 2P5KA 3RKWA 4KDPA 1TBXA 4I02A 2BV6A 4P96A 4FX0A 1F5TA 1HKSA 1PP8F 4AWXB 3F6OA 3VB2A 3K69A 2Z99A 4LK1F 3I64A 3J7AO 3ZN1A 1IXCA 3CO7C 3TKYA 2YPRA 1S6LA 1MGTA 2D1VA 4M9SA 1YW8A 2RKHA 5ICFA 1BIAA 1OKRA 1YIOA 2PQ8A 1U5TC 2V9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKV A;  3GX4 X;  1G3T A;  4L9J A;  1KU3 A;  3NQO A;  2FF4 A;  4LB6 B;  4BQA A;  3M7G A;  1OYY A;  3S2W A;  4L0Z B;  5L3F A;  1LDK B;  3QPH A;  2DQR A;  3EDP A;  4M6Y A;  2IJL A;  4U0V A;  1YFH A;  1J59 A;  4N9I A;  3RPU A;  1LVA A;  2D45 A;  2CO5 A;  2AS5 F;  3V7S A;  4MTD A;  5D6F A;  2RC4 A;  1O57 A;  3N97 A;  2RV8 A;  3R0J A;  3GUD A;  2H27 A;  3W6K B;  1ZRC A;  4HX8 A;  1UCR A;  3P9I A;  4MEY F;  1KU9 A;  4IRH A;  3GFJ A;  1P6R A;  3HTU A;  3LQQ A;  2KIF A;  2Z9O A;  1V3F A;  1QPM A;  1UHM A;  3T8T A;  2PMU A;  3E5Q A;  4Z2Y A;  1USS A;  2PG4 A;  2MD5 A;  2EFQ A;  3MQ0 A;  5L3D A;  4AIH A;  4GXO A;  4HLY A;  2LDU A;  5DV5 A;  3WE2 A;  5FFX A;  2MH2 A;  4I98 B;  3V4G A;  4MHG A;  1KQ9 A;  2MLK A;  3DP7 A;  3F3X A;  2O3F A;  4KA4 A;  5K1Y A;  1O7L A;  3W6J B;  3HOT A;  2QLZ A;  3RTR A;  1QZZ A;  2XV4 S;  4JBA A;  2Y75 A;  2HTS A;  2FBK A;  1F1Z A;  1S29 A;  4LMY A;  2FML A;  4PDK A;  2XKO A;  2CG4 A;  1IUY A;  3PFI A;  4EJW A;  5LEJ A;  1U3E M;  4CXF A;  3R60 A;  1ZRE A;  1G3Y A;  5BPI A;  3VOE A;  1FSH A;  3BPV A;  1S7A A;  3QP5 A;  5DYM A;  4IHT A;  2EV5 A;  3QP6 A;  2QM3 A;  1R7J A;  2UXX A;  1I1G A;  2QBY A;  4LG0 A;  1WKM A;  1ZGJ A;  5HDG A;  3RIR A;  5HLG A;  2IW5 A;  5DCM A;  4FT8 A;  2F5D A;  5CVV A;  4EGZ A;  3ZN0 A;  4XLN F;  2DT5 A;  3K1M A;  1XDS A;  4GO1 A;  3F72 A;  3CUQ A;  3P9K A;  4MEX F;  1IAW A;  4CHU A;  5CJ9 A;  2LKP A;  3E6M A;  2XGX A;  5FLX Z;  2QQ9 A;  4UV8 A;  4CO8 A;  1BI1 A;  2K4J A;  2M45 A;  3L7W A;  4R8H A;  4EM2 A;  2A5Y B;  1JE8 A;  4EJT A;  1AWC A;  3GXO A;  1W7P D;  4IF4 A;  4R1H A;  3T0Y A;  4BYY A;  1MKM A;  3RKY A;  2Q2E A;  1F9N A;  4OU0 A;  3JTH A;  2NNN A;  5E20 A;  5CLS A;  3F8B A;  4UHT A;  2EK5 A;  5FO5 A;  4IRI A;  1Z05 A;  2ESH A;  3WTY C;  4EMS A;  4L18 B;  5CVU A;  1E2X A;  2DFI A;  4AIJ A;  1I1S A;  2RDP A;  4U0W A;  3K1N A;  1IN8 A;  2L54 A;  3TDZ C;  4Q4Z F;  3BJA A;  1HXD A;  3MEX A;  4PZJ A;  3DQV C;  2ISZ A;  2OQG A;  3U1D A;  3E3V A;  4G9Y A;  1VTN C;  1SD4 A;  3HTS B;  3IWF A;  2OBP A;  3C1D A;  1FPQ A;  3GFL A;  2VT2 A;  2FNA A;  2FA5 A;  3KLN A;  1QGP A;  4HW0 A;  1XMK A;  2UXN A;  5E8G A;  1MJ9 A;  2EB7 A;  2V1X A;  3CTA A;  5HS9 A;  1B59 A;  4Y15 A;  3M9A A;  1G4D A;  4OIO F;  3SQN A;  1LDD A;  4D0P A;  3FMQ A;  2P7C B;  5J8F A;  3MFK A;  3KP3 A;  4LG0 B;  3M1E A;  1IW7 F;  4L5J A;  5LEK A;  1ZLJ A;  1PDN C;  1RIO H;  1QBJ A;  1YLF A;  1MDM B;  4KFC A;  3R0A A;  2FBI A;  2VC0 A;  3JAM K;  4HYE A;  4MNU A;  1YS7 A;  2HEO A;  4K2E A;  4I0B A;  2RNJ A;  2DTR A;  3O2P E;  5LLQ A;  5KVR A;  4A6E A;  3QPT A;  2XKP A;  1P4X A;  3GZ6 A;  2FQ3 A;  3ZMT A;  1HW2 A;  4YIF A;  4G7Z F;  1R5G A;  2RN7 A;  5D6E A;  5JVT A;  4O5V A;  3G73 A;  1OYW A;  3I54 A;  4HF1 A;  3WTU C;  4E70 A;  2GZW A;  4M9Z A;  4H0E A;  1GHC A;  4U0Y A;  2F5E A;  1FZP B;  2HZT A;  4YFK F;  3FF5 A;  3H3U A;  4RAZ A;  4HQE A;  1G3S A;  4I09 A;  1HKT A;  1FBS A;  1R23 A;  3QOP A;  3TGN A;  2OAZ A;  3F8F A;  2ZME A;  1RUN A;  5F6F A;  4LLN A;  1IXS B;  2CQK A;  4KIG A;  2ZBK A;  3QAH A;  3V8J A;  4AVP A;  4RGS A;  4MQ9 F;  4A0Z A;  2EA2 A;  1YS6 A;  1R00 A;  4UUV A;  2GXG A;  4BHB A;  3FM3 A;  3TQN A;  1HQC A;  4KYW A;  3BPX A;  1ONV A;  2EFW A;  4HLX A;  2A07 F;  4L9T A;  2FOK A;  4HOB A;  3L9F A;  4Y13 A;  1JXS A;  3BRO A;  3QU3 A;  2OZU A;  3EYY A;  2QEN A;  5LGN A;  3HHH A;  2C6Y A;  1DDN A;  2IA1 A;  4HF0 A;  3HYI A;  3IC7 A;  3HRM A;  2MH9 A;  2BBY A;  2EJR A;  1K79 A;  4RGR A;  3IRR A;  1ZLK A;  2ZKZ A;  1XGN A;  1YG2 A;  2Z3Y A;  4XLP F;  5D5X B;  1K78 A;  4EVI A;  5F64 A;  4OOI A;  4I2O A;  2L4A A;  2OA4 A;  1SMY F;  1P4A A;  4KMU X;  3DF8 A;  4O3M A;  3HRU A;  1LJ9 A;  3ROU A;  2FBH A;  1B6A A;  5D8L B;  5FD5 A;  1LEB A;  1UHW A;  4OIR F;  5A2Q Z;  4WXC A;  1P4W A;  2IPQ X;  3EET A;  4UXN A;  1CF7 A;  4OMY A;  1T0F A;  2DBB A;  4Q5S F;  2F2E A;  5L3E A;  3F23 A;  5BMZ A;  4L0Y B;  1B9M A;  4OMZ A;  1LNW A;  1Z91 A;  3IRQ A;  5D4R A;  4UVA A;  4Q47 A;  2IA2 A;  3TOA A;  2EFN A;  5L3G A;  2ADU A;  5FB2 A;  2G9W A;  3KLO A;  4ENM A;  4Q48 A;  1FP1 D;  4M71 A;  2EFO A;  2Y0M A;  2ISY A;  2STT A;  6PAX A;  1O3S A;  3I0T A;  2M30 A;  4AD9 A;  5LHH A;  4ON0 A;  2CSO A;  4BH9 A;  5D5W B;  1W5T A;  2JT1 A;  5CVI A;  4RAY A;  3FHZ A;  1WWX A;  5J8C A;  1G3W A;  5HDK A;  2K86 A;  4WF2 A;  1YW7 A;  4B8X A;  4EJO A;  4I01 A;  4BNC A;  5HDN A;  1O3T A;  1HBX G;  2CW0 F;  4DQ2 A;  2FSW A;  5A2Q K;  1KQ0 A;  3VFZ A;  2V79 A;  1BOA A;  4RGU A;  3RI4 A;  3ML6 A;  1TQI A;  1J5Y A;  3J80 K;  1LDJ A;  4U7D A;  1WRJ A;  5EEH A;  1ZAR A;  2B0L A;  2D1H A;  2J5O A;  1W7P A;  3I59 B;  1QQI A;  4R79 A;  4MGR A;  2DPU A;  3LQR A;  5DUK A;  4WXD A;  3CLO A;  3MAJ A;  4KN7 X;  3K9T A;  1JHF A;  3BJO A;  3C18 A;  3FXU A;  1E17 A;  3HOS A;  3IWZ A;  4IVN A;  1CF7 B;  4ZYD A;  1FYK A;  5LHG A;  1XSV A;  3MZH A;  4LLG F;  4QLC U;  2ACJ A;  3RJP A;  2K4B A;  3TOB A;  2H09 A;  4CGZ A;  3EUH A;  1RI7 A;  5K5R A;  4S04 A;  4UNO A;  2XRN A;  4A12 A;  1I27 A;  5CYV A;  5LHI A;  3K2Z A;  3F21 A;  5FD6 A;  1L0O C;  3FX3 A;  5DCM B;  2JTV A;  2H6C A;  3KFW X;  3T8R A;  2QYO A;  1ZH5 A;  1BM9 A;  1HW5 A;  3DV8 A;  5BOX A;  1YYV A;  1BBY A;  2QVO A;  5FLX K;  5HOO A;  1T38 A;  4WCG A;  3NEU A;  1S8N A;  2XAH A;  2EV0 A;  1YW9 A;  2X0L A;  1P2F A;  3M8F A;  5J6X A;  2P5L C;  3LAP A;  4WXH A;  3ZMZ A;  2L3D A;  2R3S A;  1I6X A;  1KYZ A;  1ODD A;  4PCQ A;  5E17 F;  3M8E A;  5JI6 A;  2UZK A;  2QQA A;  3ZMD A;  1KU2 A;  1GXP A;  2JZY A;  1MJB A;  1S7O A;  3L00 A;  3BWG A;  2XUB A;  3RYP A;  1H0M A;  3SHF A;  3BJ6 A;  3TO7 A;  4JQF A;  2W24 A;  5H6R A;  4KIC A;  2WV0 A;  1XB4 A;  1FC3 A;  1U8R A;  1I5Z A;  3WTX C;  2PJP A;  3G3Z A;  2HKO A;  4QWQ A;  2PN6 A;  1Y0U A;  1QZY A;  1KQ8 A;  1K78 B;  3KP6 A;  3HRT A;  1F4K A;  1EH6 A;  1J2X A;  2IP2 A;  3I53 A;  4CDG A;  2GIV A;  3Q5F A;  2E1C A;  1IN4 A;  2RQP A;  3RYR A;  2PBI A;  4RB0 A;  3WTT C;  4P5O A;  3FXQ A;  1O3Q A;  4G8X A;  4G6Q A;  4MQV A;  1J9I A;  1FYM A;  5LBQ A;  1SAX A;  1HW1 A;  3RDI A;  3GVA A;  4HA8 A;  2ZFW A;  1XMA A;  2F5C A;  2DO7 A;  2W57 A;  3WG9 A;  1W7P B;  3ABU A;  3I59 A;  4KNY A;  2NNY A;  2Y48 A;  4ENK A;  4HQM A;  2ZCW A;  1R5H A;  2YR2 A;  4LGW A;  2ZNZ A;  5E1X A;  3U2R A;  3GYH X;  5F1R A;  1KYW A;  4GCV A;  3KP4 A;  3Q9S A;  1CGP A;  1T6S A;  2FRH A;  3P9C A;  3ZP5 A;  3H92 A;  5JR3 A;  1B9N A;  2Z33 A;  1KGS A;  3MWM A;  1SD7 A;  3CO6 C;  5DEQ A;  3KEO A;  1STZ A;  4ASN A;  3MCZ A;  2XIG A;  1MJA A;  1ON1 A;  4HX7 A;  1WSU A;  3LFK A;  1L3L A;  1OR7 A;  3V8L A;  3GEZ A;  1A04 A;  3H3Z A;  1ZGA A;  3DPL C;  3V8K A;  3WTW C;  1ULY A;  2VC1 A;  4KMF A;  1SFU A;  1FSE A;  2HGC A;  3DPT A;  4A0X A;  1G6N A;  1T2K A;  1YTY A;  1DUX C;  2K02 A;  3GFM A;  2WC2 A;  3ECH A;  4ZH4 F;  2R7F A;  1DP7 P;  4EJV A;  2L4M A;  2X4H A;  4CZZ A;  1SFX A;  3NRV A;  1IRF A;  5LRR A;  2M87 A;  1FWZ A;  4N9H A;  3VEP A;  1SMT A;  4L9N A;  5LGU A;  1IN5 A;  2PFB A;  3C3W A;  4KN4 X;  4XRF A;  2VBZ A;  4WK8 F;  5ICG A;  5LGT A;  3KCC A;  4BXU A;  2P5V A;  3ERE D;  1BI0 A;  1BN5 A;  3WGI A;  3FXR A;  1U78 A;  1LB2 A;  2GXB A;  1FY7 A;  1OMI A;  1REP C;  3LA2 A;  2W85 A;  1J7K A;  2VOD A;  4BHC A;  2QWW A;  4ESF A;  3E6C C;  4LK0 F;  4RB1 A;  3HSR A;  5L3B A;  2DLL A;  2P6S A;  3LWF A;  3GF2 A;  1BI2 A;  1C0W A;  3SZT A;  3WU0 A;  1T39 A;  3GW2 A;  1EV7 A;  2PMH A;  3KET A;  5EEG A;  2STW A;  1FOK A;  1XGO A;  5DD8 A;  1Z9C A;  1GXQ A;  2MBF A;  3R4K A;  4N0B A;  3QU6 A;  3DXJ F;  4G94 A;  2GAU A;  3F6V A;  2WWY A;  2KIU A;  5ILS A;  2CYY A;  2DK8 A;  4HX4 A;  4U7B A;  2GWR A;  4A5N A;  5AIP A;  1IN6 A;  2HKX A;  2P6T A;  3JAM Z;  1V4R A;  1FBU A;  1AOY A;  2DQL A;  4ZYG A;  2DAO A;  2GA2 A;  3WGG A;  2E7W A;  2HFH A;  2H6B A;  3MZY A;  2YX7 A;  3FMS A;  1XCV A;  2XRO A;  2P8T A;  3O3K A;  1ZG1 A;  4RS8 A;  1FBQ A;  2CGP A;  2VBW A;  1D5V A;  2NRA C;  4YFN F;  2HDC A;  3ISP A;  4IPA A;  1FP2 A;  5ED4 A;  3F8C A;  2V1D A;  2HR3 A;  1QO0 D;  1XN7 A;  1DPR A;  3P7N A;  1EH8 A;  4KIB A;  2W25 A;  1SFE A;  4XBF A;  1D3Y A;  5D5U B;  2K27 A;  5HS8 A;  4YFX F;  3OOP A;  3K0L A;  1IF1 A;  3J81 Z;  1UB9 A;  2BGC A;  2VXZ A;  3C7J A;  2O03 A;  5BQT A;  4EJU A;  1RZ4 A;  1W5S A;  2E7X A;  3HSE A;  2A3S A;  4O6J A;  2M8E A;  5K5O A;  3WTV C;  1Z6R A;  3OV8 A;  2O8X A;  1BI3 A;  3HHG A;  1TQM A;  3LST A;  2HYF A;  2FMY A;  4EQQ A;  1IXR C;  3F8M A;  1KA8 A;  1U2W A;  4BAY A;  2LF7 A;  2RGV A;  3TDU C;  4GYG A;  5E8I A;  2MLG A;  3E97 A;  1XGS A;  1UST A;  1K7A A;  1R1T A;  3KP5 A;  1TQP A;  5JHU A;  2VOP A;  3KZY A;  3E6D A;  4JK1 X;  2JPC A;  1J75 A;  2V1U A;  2VN2 A;  2KIM A;  2H94 A;  2A6H F;  2V6C A;  1FNN A;  5E1Z B;  5HLI A;  1HSJ A;  3JSO A;  2YU3 A;  3E5U A;  2KJB A;  4NQW A;  3ULQ B;  3K1P A;  1D8K A;  3DFG A;  4B09 A;  1H9T A;  3U9G A;  4Y17 A;  3J81 K;  2KJC A;  3KP2 A;  3FMR A;  1KU7 A;  4EGY A;  5BPD A;  5ICE A;  2FE3 A;  1IZ1 A;  2DI3 A;  3ABT A;  3ELK A;  3CUQ C;  2PLY A;  5AIQ A;  2XAQ A;  3HIF A;  4OIQ F;  3BP8 A;  2VT3 A;  3L2C A;  1SD6 A;  4IHS A;  1ZRF A;  4MTE A;  3DKW A;  3ZPL A;  4I0A A;  3PQJ A;  3B02 A;  2OQR A;  1YQA A;  4ENJ A;  4P9U A;  4NB5 A;  3LAJ A;  1O3R A;  2G7H A;  1IN7 A;  2A61 A;  1W4M A;  1R22 A;  1ZYR F;  2KKO A;  1MZB A;  2HWV A;  1XCB A;  1DPU A;  1XSX A;  4HDU A;  2CFX A;  2MC3 A;  1B1B A;  2UWM A;  4EV0 A;  1YO5 C;  5FGM A;  5DCF A;  3FWE A;  4S05 A;  3T5X A;  4HV5 A;  5DD4 A;  4DNC A;  1R1V A;  2Q8K A;  1HKQ A;  1TW2 A;  1NHA A;  2E1N A;  1WQ2 A;  2FEZ A;  2ZXJ A;  3F8N A;  2L02 A;  5LRS A;  2D2W A;  1Q1H A;  3AAF A;  2Z5U A;  1ZN2 A;  4NHJ A;  4A5M A;  4ZZL A;  2YX4 A;  4KUM A;  2ELH A;  3GZ5 A;  1Z7U A;  3I71 A;  3KEQ A;  4YG2 F;  2LNB A;  3D0S A;  4IXA A;  3LA3 A;  3EYI A;  1B4A A;  4UVB A;  3FZV A;  1PP7 U;  1OYI A;  5DUI A;  4WWC A;  3TO9 A;  5L3C A;  2IA0 A;  4M6X A;  1TNT A;  4ETS A;  3JTG A;  4KT5 C;  1FT9 A;  2R7D A;  1D8J A;  2FNP A;  2HOE A;  3I5U A;  2J5P A;  2BYV E;  4XSX F;  1ZRD A;  3BY6 A;  4PGH A;  2WTE A;  4WX9 A;  4U88 A;  2PEX A;  4CIC A;  5E1W A;  1RUO A;  1ZHF A;  3Q9V A;  5TJJ A;  5TRD A;  3WGH A;  2QUF A;  4ENN A;  1PUE E;  5ICC A;  3FM5 A;  3WU1 B;  4M73 A;  3SZP A;  2JRT A;  4ESB A;  5CVJ A;  2GA1 A;  3I58 A;  4A2U A;  2O0Y A;  3QRF F;  2ZO4 A;  2HTJ A;  5HLH A;  4IRG A;  5HS7 A;  1UFM A;  1H9G A;  3T1B A;  3L09 A;  4P55 A;  3SXY A;  3F22 A;  4G6D A;  1P92 A;  2ZNY A;  3ECO A;  1MDM A;  3I4P A;  4M72 A;  2XAF A;  4IJA A;  4LD5 A;  1T98 A;  4ZZD A;  2VBY A;  4HBL A;  1LEA A;  1JHH A;  1IRG A;  2FU4 A;  4KIF A;  3DEU A;  3CJN A;  5FFZ A;  2DW4 A;  1TW3 A;  1BJA A;  1K6O A;  3IL2 A;  4A6D A;  4LJZ F;  1GVJ A;  2AXL A;  2EWN A;  4G7O F;  1S3J A;  4M74 A;  4HDV A;  2XHK A;  3HUG A;  2OZ6 A;  2TDX A;  4TV7 A;  5ERI A;  4FX4 A;  2EV6 A;  4HZF A;  1XSD A;  2L01 A;  5KK1 A;  3J80 Z;  1TNS A;  2BE5 F;  2VE9 A;  2G7U A;  2HS5 A;  1JGS A;  4LLL A;  5BS6 A;  1ON2 A;  2VBX A;  4HF2 A;  1LQ1 A;  3B73 A;  2W84 A;  4ZYE A;  1XD7 A;  2VE8 A;  5H20 A;  4EM0 B;  4ESJ A;  2LF8 A;  2QZ8 A;  4GGG A;  4RB2 C;  2XVC A;  3KZZ A;  2ESN A;  2JSC A;  4ZYH A;  1HST A;  5CVR A;  4HV6 A;  4OIN F;  4F7Z A;  5D4S A;  4L5I A;  1ZG5 A;  3E5X A;  2DU9 A;  2GQQ A;  1X3U A;  4LB5 A;  2M1B A;  2F5F A;  5IT3 A;  4OIP F;  4P9F A;  5ILV A;  3CDH A;  3TO6 A;  3E6B A;  2HYG D;  2IVM A;  2QQB A;  3N4M A;  2P4W A;  1O7F A;  4XSZ F;  2M5W A;  3ZMU A;  1FLI A;  1BIB A;  2NS0 A;  5K5Q A;  2O61 A;  1R58 A;  5ILU A;  1XGM A;  2Q0O A;  1R1U A;  4G7H F;  3GO5 A;  3KP7 A;  4AIK A;  2A69 F;  4EM1 A;  3ZMS A;  5HVQ C;  2JPB A;  3GFI A;  2FXA A;  3LA7 A;  2KRF A;  2PI0 A;  5IT9 Z;  2RVC A;  1J0R A;  3KE2 A;  2VON A;  4HAM A;  3EQL F;  2LSO A;  2ZME B;  1TLH B;  5H6Q A;  4GYI A;  5D5V B;  4I7H A;  2A6E F;  2CWE A;  3V7R A;  2MA3 A;  2OD5 A;  1RNL A;  1TTY A;  3ZMV A;  2IT0 A;  3REO A;  2ETH A;  1WI9 A;  3WOD F;  2NYX A;  1U6G A;  2COM A;  2A68 F;  3JSP A;  1SD5 A;  3GLX A;  3IKT A;  3WE3 A;  2YSR A;  5DDG A;  3O6B B;  4RGX A;  4PGG A;  3R6S A;  4RB3 C;  3D5L A;  1XDU A;  1BC7 C;  2VOO A;  1ZG3 A;  4A0Y A;  1Z1D A;  3R61 A;  3BZ6 A;  2HQN A;  1EH7 A;  4FHT A;  3CUQ B;  1U5T A;  3ZQ7 A;  3HRS A;  3JW4 A;  1MD0 A;  2ZJ2 A;  4M9X A;  4UV9 A;  3WTS C;  5AON A;  2O6G E;  2XAG A;  2P7V B;  4L9V A;  3RKX A;  5D8K B;  4UVC A;  2DPD A;  3CUO A;  3BOQ A;  4BHP A;  1OPC A;  3RPQ A;  1Z6T A;  2XAS A;  2IRF G;  4LFU A;  2OU2 A;  5JFR A;  2EA4 A;  3COA C;  4YII A;  2BEO A;  5E18 F;  2K7L A;  1BC8 C;  1R36 A;  1QNT A;  3IHU A;  4CYD A;  2QBY B;  3PQK A;  2EFP A;  1ZAO A;  3SFZ A;  3VOD A;  1U5T B;  3HSF A;  2NAZ A;  3V7C A;  2XAJ A;  1FX7 A;  1FYL A;  3BDD A;  2DK5 A;  2HQR A;  3WTZ A;  5IT9 K;  3GWZ A;  2P5K A;  3RKW A;  4KDP A;  1TBX A;  4I02 A;  2BV6 A;  4P96 A;  4FX0 A;  1F5T A;  1HKS A;  1PP8 F;  4AWX B;  3F6O A;  3VB2 A;  3K69 A;  2Z99 A;  4LK1 F;  3I64 A;  3J7A O;  3ZN1 A;  1IXC A;  3CO7 C;  3TKY A;  2YPR A;  1S6L A;  1MGT A;  2D1V A;  4M9S A;  1YW8 A;  2RKH A;  5ICF A;  1BIA A;  1OKR A;  1YIO A;  2PQ8 A;  1U5T C;  2V9V A; 
#chains in the Genus database with same CATH topology
 2X6O A;  3IKV A;  3GX4 X;  1JGG A;  1G3T A;  4L9J A;  1ZK8 A;  1KU3 A;  2QSG X;  5J47 A;  3NQO A;  2FF4 A;  4LB6 B;  4BQA A;  1R4M B;  4KT6 A;  2B7E A;  3M7G A;  3OYD A;  3CCJ I;  1OYY A;  3EUH C;  2JK3 A;  3FKJ A;  3S2W A;  1X1B A;  1IV6 A;  4L0Z B;  2EZI A;  5L3F A;  4QTR A;  2MFZ A;  5GTH C;  1LDK B;  2DMP A;  2DQR A;  3H5A A;  3QPH A;  3EDP A;  1VQP I;  4M6Y A;  2W7N A;  2IJL A;  4U0V A;  1YFH A;  4E7H A;  1J59 A;  4N9I A;  4J01 A;  3PUF A;  3RPU A;  1LVA A;  2V26 A;  3HOX J;  2EPF A;  2D45 A;  2CO5 A;  4B47 A;  1D1A A;  2AS5 F;  3V7S A;  1IDZ A;  4YIR X;  4MTD A;  2X6X A;  1ZTR A;  2GXA A;  5D6F A;  4QPO A;  2RC4 A;  1QHH D;  1O57 A;  4QSH A;  3N97 A;  2RV8 A;  1OCC H;  2L0K A;  2R5Y B;  2HDW A;  1OLT A;  3R0J A;  3OYN A;  3GUD A;  2OUM A;  2H27 A;  3W6K B;  3HPH A;  5GAE J;  5J1Y A;  1ZRC A;  3OS1 A;  4HX8 A;  1UCR A;  3P9I A;  3GTQ J;  4MEY F;  1KU9 A;  3BQZ A;  1VQ6 I;  3BR5 A;  3GFJ A;  4IRH A;  1P6R A;  1NK3 P;  3ESW B;  2KHM A;  3TP3 A;  2Y9Z A;  2P81 A;  1F36 A;  4RAG A;  2O9L A;  1Y1V J;  1I39 A;  3HTU A;  3LQQ A;  2CS3 A;  2BY1 A;  2KIF A;  2Z9O A;  1V3F A;  1SC7 A;  1QPM A;  3BR0 A;  1UHM A;  3T8T A;  2R7S A;  3FXK A;  2PMU A;  3E5Q A;  4Z2Y A;  1USS A;  2VKE A;  2PG4 A;  2MD5 A;  2EFQ A;  3MQ0 A;  3OYG A;  5DTD A;  2OC6 A;  3GTO J;  3LL7 A;  4Z6Y A;  3JR9 A;  5L3D A;  2NS7 A;  4AIH A;  4GXO A;  2KDZ A;  3S3M A;  4HLY A;  2LDU A;  3OYM A;  5DV5 A;  3FBI B;  1I3A A;  2DA5 A;  2MH2 A;  5FFX A;  4I98 B;  3V4G A;  3WE2 A;  4MHG A;  1KQ9 A;  2MLK A;  3DP7 A;  3F3X A;  2O3F A;  1UG2 A;  5K1Y A;  4KA4 A;  1O7L A;  3W6J B;  4W1U A;  3HOT A;  2QLZ A;  3RTR A;  2VPR A;  2E1M C;  2XGC A;  3VWB A;  1UZC A;  3CJT B;  1NG6 A;  1QZZ A;  2XV4 S;  4M3F A;  2BXY A;  4JBA A;  1Z21 A;  1FIP A;  2Y75 A;  2HTS A;  2FBK A;  1MSF C;  2WAQ N;  1F1Z A;  2IS1 A;  1S29 A;  4LMY A;  3H9J A;  2FML A;  4PDK A;  5CKT A;  3UNG C;  4D7M A;  3DKX A;  3CCL I;  3LSR A;  1WJC A;  1TWC J;  2XKO A;  5FRO A;  2CG4 A;  1IUY A;  3PFI A;  4EJW A;  2E60 A;  2Z2S B;  3BCA A;  5LEJ A;  1U3E M;  4XK4 A;  2GLO A;  5B5E C;  4E7S A;  3H9Q A;  3DU5 A;  4CXF A;  3R60 A;  3ZCO A;  1ZRE A;  1G3Y A;  1K83 J;  5BPI A;  3VOE A;  3CCV I;  1FSH A;  3BPV A;  1S7A A;  3GTG J;  3QP5 A;  1V5F A;  5DYM A;  2GIZ A;  1VQ9 I;  4IHT A;  4HG2 A;  3VYU B;  5JLX A;  2EV5 A;  4CCK A;  3FHN A;  3QP6 A;  1ZQ3 P;  4OAZ A;  1XPX A;  3HPG A;  2QKM B;  2QM3 A;  1FEX A;  1R7J A;  2UXX A;  1I1G A;  3W2W A;  4C2U A;  2QBY A;  4LG0 A;  2BW3 A;  3OYI A;  1WKM A;  1ZGJ A;  5HDG A;  2L7M P;  4IHY A;  3RIR A;  1TL8 A;  5HLG A;  2IW5 A;  3PSF A;  5DCM A;  4D1Q A;  4FT8 A;  2F5D A;  3LFU A;  3SEZ A;  5B66 C;  4IHW A;  5CVV A;  4EGZ A;  3ZN0 A;  4XLN F;  2DT5 A;  3K1M A;  1XDS A;  3LNQ A;  2QSH X;  1HA8 A;  3OYC A;  1K61 A;  4EAT A;  4GO1 A;  1E3O C;  3F72 A;  3CUQ A;  2M2E A;  3LOC A;  3P9K A;  2RAE A;  2ZSH B;  4MEX F;  2CQQ A;  2XPU A;  1IAW A;  5CJ9 A;  2Q2E B;  2CV1 A;  4CHU A;  2VPL A;  3ASN H;  3E0J B;  4PJN A;  1Z7L A;  2LKP A;  3E6M A;  2HI3 A;  2XGX A;  5GPA A;  5IYD J;  4CYC B;  5FLX Z;  1JT0 A;  2QQ9 A;  4UV8 A;  4CO8 A;  1BI1 A;  2K4J A;  1AKH A;  2W82 A;  4S0H B;  4BEH A;  5IPA A;  4Y52 J;  1CQT A;  4C3J J;  2M45 A;  3L7W A;  4R8H A;  4LG3 A;  4EM2 A;  2A5Y B;  1JE8 A;  2ZXH A;  4RA2 A;  3LSJ A;  1AWC A;  4EJT A;  3GXO A;  2OCE A;  1W7P D;  4IF4 A;  4R1H A;  4QPQ A;  2R5Z A;  3T0Y A;  4BYY A;  1MKM A;  3JRF A;  2KT0 A;  2LR8 A;  4E6K G;  2CUE A;  3K4C A;  1FIA A;  4J19 A;  3RKY A;  2Q2E A;  1F9N A;  3GTL J;  2O8K A;  3JTH A;  2NNN A;  3QPS A;  4OU0 A;  5E20 A;  3CMM A;  5H2F C;  5CLS A;  4XMY A;  1MNM C;  3F8B A;  4LOC A;  2PX9 A;  2K3F A;  3L1P A;  1Z3Y A;  3CME I;  4UHT A;  3BLY A;  1EKE A;  2EK5 A;  5FO5 A;  2CQX A;  1QVT A;  2HZD A;  4IRI A;  1Z05 A;  1LUJ B;  2ESH A;  3WTY C;  4EMS A;  4L18 B;  5CVU A;  2P0W A;  2VQH A;  1E2X A;  1R9T J;  4F55 A;  2DFI A;  4AIJ A;  1I1S A;  3IH2 A;  2RDP A;  1VQL I;  1OCP A;  4U0W A;  5EYR A;  3M8J A;  3K1N A;  1IN8 A;  3H0G J;  2L54 A;  4I76 A;  3TDZ C;  4BS9 A;  4Q4Z F;  3BJA A;  1HXD A;  3MEX A;  4PZJ A;  2N8G A;  3DQV C;  5HOD A;  5FKL A;  2ISZ A;  2OQG A;  3U1D A;  3E3V A;  1ETQ A;  4G9Y A;  1VTN C;  1SD4 A;  3HTS B;  1IRX A;  3JRI A;  3IWF A;  2OBP A;  2W4S A;  3GTJ J;  2LLK A;  3C1D A;  1MBK A;  1FPQ A;  1MW7 A;  3TMO A;  1K4S A;  3GFL A;  1X2N A;  2VT2 A;  2FNA A;  2JRM A;  2FA5 A;  2WB1 N;  2LRD A;  3KLN A;  1QGP A;  4HW0 A;  1XMK A;  2UXN A;  5E8G A;  1YRN B;  4A93 J;  1MJ9 A;  2EB7 A;  1X19 A;  2V1X A;  2DMT A;  2LFB A;  2X9D A;  1Y39 A;  2CJJ A;  2Z1D A;  3CTA A;  3K2A A;  2XPW A;  4IX7 A;  2L9R A;  1B59 A;  5HS9 A;  4Y15 A;  3M9A A;  1JJ8 C;  1G4D A;  3DWL E;  4RLF A;  3CC4 I;  2V6E A;  4OIO F;  3H5N A;  3SQN A;  1LDD A;  4D0P A;  3ABL H;  1Y8Q B;  3FMQ A;  1QHG A;  2K9M A;  2CU7 A;  2P7C B;  5J8F A;  1BJZ A;  4CCN A;  3ZQI A;  3MFK A;  3KP3 A;  4LG0 B;  3M1E A;  1IW7 F;  4L5J A;  4XQF A;  1ZLJ A;  5LEK A;  1RIO H;  1PDN C;  1QBJ A;  4N4N B;  1YLF A;  2KRH A;  2VKH A;  3G4S I;  1MDM B;  4KFC A;  3R0A A;  2F4O B;  1JUM A;  2FBI A;  3BTI A;  5F0C A;  3ZQL A;  3BQY A;  1V54 H;  2VC0 A;  2QKL B;  3JAM K;  4HYE A;  2R5Z B;  1T8I A;  4MNU A;  1YS7 A;  2HEO A;  1ENH A;  2DN0 A;  4K2E A;  2M8G X;  4I0B A;  5FKN A;  2RNJ A;  2DTR A;  3O2P E;  2UV1 A;  4HPQ A;  5LLQ A;  3CMA I;  1D0X A;  5KVR A;  4A6E A;  4B4C A;  3QPT A;  5CQE A;  3ZGK A;  3K4N A;  1IGN A;  4C9Y A;  2XKP A;  1P4X A;  3GZ6 A;  2FQ3 A;  3PNY A;  3ZMT A;  2DTZ A;  1GV5 A;  3W3C A;  1HW2 A;  2JMW A;  4NC6 A;  4YIF A;  3OSG A;  4G7Z F;  1S7E A;  1R5G A;  3QOE A;  2X48 A;  1EA3 A;  2RN7 A;  2DFF A;  5D6E A;  3PNV A;  3W2A A;  2E1O A;  4AYB N;  5JVT A;  2H1L A;  4M3D A;  2DA1 A;  4O5V A;  3G73 A;  1OYW A;  2AO9 A;  5EEA A;  3I54 A;  1GDT A;  4HF1 A;  3WTU C;  3WU2 C;  2NXN B;  4AVZ A;  4E70 A;  2GZW A;  3FDY A;  4M9Z A;  4H0E A;  1S72 I;  4U0Y A;  2F5E A;  1GHC A;  3I9V 2;  1MBJ A;  1DP3 A;  1FZP B;  3K4L A;  1O4X A;  2JVH A;  2HZT A;  4XKB A;  3RQ4 A;  5KHD A;  1HF0 A;  4F91 B;  2EIL H;  3GZN B;  4YFK F;  3FF5 A;  3H3U A;  3F9K A;  4RAZ A;  2GBY A;  4U87 A;  4BBS J;  4N4O B;  4HQE A;  2JA5 J;  3J7A Y;  2X1C A;  1F43 A;  1G3S A;  4M3B A;  3AG3 H;  3OYF A;  2L9S A;  4I09 A;  4F3Q A;  1HKT A;  1FBS A;  1R23 A;  3QOP A;  4FE4 A;  2BY3 A;  3TGN A;  2K9L A;  3EPZ A;  2OAZ A;  3F8F A;  2ZME A;  1RUN A;  1VF9 A;  1JKR C;  2ZJQ F;  5F6F A;  3DPU A;  4LLN A;  1IXS B;  3RZD J;  4II3 A;  4RAF A;  4ANJ A;  2CQK A;  2CV0 A;  4KIG A;  1S5L C;  1LKX A;  4BUP A;  2YU9 J;  1G2H A;  2ZBK A;  3OS2 A;  2X85 A;  3QAH A;  4DZJ A;  1G59 A;  4BY7 J;  1JT6 A;  3V8J A;  2HVQ A;  3CCR I;  2VI6 A;  4JX6 A;  1VQ8 I;  4AVP A;  4RGS A;  4MQ9 F;  4A0Z A;  3TW7 A;  2CW8 A;  2EA2 A;  1YS6 A;  1R00 A;  5F1J A;  4UUV A;  2GXG A;  4CZC A;  3S15 J;  4BHB A;  5LFA A;  3FM3 A;  2R7W A;  2VKV A;  3TQN A;  1HQC A;  1MNE A;  3BPX A;  4KYW A;  1D0Z A;  1ONV A;  3JRB A;  3HOU J;  2QA4 I;  2EFW A;  4PFO A;  4HLX A;  3ABM H;  1S9H A;  2VJI A;  2HQA A;  2XSJ C;  2A07 F;  3JRC A;  4L9T A;  5E3M A;  3CC7 I;  2FOK A;  5EG0 B;  4HOB A;  5GTI C;  3L9F A;  4Y13 A;  4NBQ A;  1FOW A;  2D5V A;  1X1C A;  1JXS A;  1QA6 A;  4XRM A;  2EZH A;  1PJR A;  3JRH A;  3RQI A;  3BRO A;  2F4I A;  3QU3 A;  2OZU A;  3EYY A;  2QEN A;  4CUG A;  2XGD A;  3HHH A;  5LGN A;  3CCS I;  1X2M A;  1R4N B;  2BHY A;  2C6Y A;  4BEH B;  1DDN A;  1GVD A;  2IA1 A;  2V1N A;  4HF0 A;  3HYI A;  3IC7 A;  3HRM A;  3QYB A;  2K9Q A;  3FBN B;  5F0F A;  2MH9 A;  2BBY A;  2EJR A;  1K79 A;  4RGR A;  1ACI A;  3K70 C;  2WBM A;  2JA6 J;  2BW3 B;  1DU0 A;  3HOV J;  5DM6 F;  3S93 A;  3IRR A;  1W0T A;  1ZLK A;  2I10 A;  2FX0 A;  3FXJ A;  2ZKZ A;  1WJE A;  3Q0U A;  4ZTJ A;  3KYD B;  1XGN A;  3ZOB A;  2QF7 A;  1YG2 A;  2Z3Y A;  1X3Z B;  3AG4 H;  5D5X B;  4XLP F;  1K78 A;  4JP0 A;  2OF7 A;  4EVI A;  4IOA F;  3HL2 A;  5F64 A;  3ASO H;  4OOI A;  2HDD A;  4I2O A;  2L4A A;  2OA4 A;  2R7Q A;  1BL0 A;  1SMY F;  2LD5 A;  2AXT C;  1P4A A;  2DT6 A;  4KMU X;  5EG0 A;  4NC7 A;  3DF8 A;  2PJR A;  3AFH A;  3DBL B;  4O3M A;  2ZJR F;  3MZ8 A;  3HRU A;  1RKW A;  1LJ9 A;  3HDD A;  3ROU A;  2FBH A;  1B6A A;  1WJF A;  5D8L B;  5FD5 A;  4UUS A;  1YJW I;  5HNH A;  1LEB A;  1UHW A;  2BVM A;  3O8G A;  4OIR F;  3M1C A;  5A2Q Z;  4WXC A;  1P4W A;  2O7O A;  2XAU A;  2IPQ X;  2VL8 A;  3EET A;  4UXN A;  3VDX A;  1CF7 A;  4ABZ A;  4OMY A;  1GLN A;  1T0F A;  1SEU A;  2Y2Z A;  2BY0 A;  2GOX B;  4BXF A;  2DBB A;  4Q5S F;  4FQG A;  2F2E A;  5L3E A;  2E34 A;  2DA7 A;  3F23 A;  5BMZ A;  5F27 A;  2ZSI B;  4L0Y B;  4BAC A;  2KRC A;  1N25 A;  4E7K A;  1B9M A;  3B6C A;  3KPH A;  5B1B H;  1NTC A;  4OMZ A;  1QU3 A;  1LNW A;  2HXO A;  1U8B A;  1Z91 A;  3IRQ A;  3CZ6 A;  5D4R A;  4UVA A;  5EZG A;  1SAN A;  2IA2 A;  4Q47 A;  3TOA A;  2EFN A;  5L3G A;  4CYC A;  2ADU A;  4I99 C;  4A3D J;  3NWS A;  2G9W A;  5FB2 A;  3NWT A;  1ZR2 A;  3KLO A;  1H8A C;  4ENM A;  5C44 J;  2HU9 A;  4Q48 A;  1FP1 D;  2L5Q A;  4M71 A;  1UEL B;  2EFO A;  1LFB A;  2Y0M A;  2R7R A;  1D1B A;  3M4O J;  2ISY A;  2STT A;  6PAX A;  2CQN A;  1O3S A;  1RRJ A;  3I0T A;  2M30 A;  4AD9 A;  5LHH A;  4ON0 A;  2IS4 A;  2CSO A;  1ITY A;  2BHZ A;  2L9N A;  2VUM J;  3Q0V A;  1PVE A;  4BH9 A;  1IV8 A;  5D5W B;  2K9S A;  1B8I B;  1W5T A;  2JT1 A;  5CVI A;  4RAY A;  3HG9 A;  3FHZ A;  4BDZ A;  1WWX A;  5J8C A;  1G3W A;  5HDK A;  2K86 A;  4WF2 A;  3K4K A;  1YW7 A;  4NC8 A;  4B8X A;  2XF6 A;  2V4J C;  4EJO A;  4I01 A;  4E7L A;  3HGG A;  2BY2 A;  3D1N I;  4BNC A;  2XPV A;  5HDN A;  1O3T A;  1ETX A;  3F0C A;  2LY2 A;  2EZK A;  3DTK A;  1HBX G;  2R7X A;  2CW0 F;  4DQ2 A;  2KLO A;  1A36 A;  1VFC A;  2KP6 A;  1ZKG A;  2K5C A;  2FSW A;  5A2Q K;  1KQ0 A;  1Y8R B;  3VFZ A;  4BJ5 C;  2V79 A;  4LIU A;  1UAA A;  1BOA A;  4XLH A;  4RGU A;  3OYL A;  3A01 A;  3K4M A;  3RI4 A;  3ML6 A;  1TQI A;  2IXS A;  1J5Y A;  2WY7 Q;  3J80 K;  2ECB A;  4PJM A;  5M5X J;  1LDJ A;  4U7D A;  3CF2 A;  1WRJ A;  3A2K A;  2CV2 A;  1RES A;  5LD2 C;  5EEH A;  1ZAR A;  2B0L A;  2D1H A;  2J5O A;  1Y1W J;  4EEF G;  1W7P A;  3I59 B;  1QQI A;  1WJ5 A;  2DJI A;  4R79 A;  4MGR A;  2DPU A;  4A3G J;  2XGE A;  5J1R A;  1JJ6 C;  1AU7 A;  2FD5 A;  3LQR A;  5DUK A;  4WXD A;  1FOY A;  3CLO A;  3MAJ A;  4KN7 X;  3QYF A;  3K9T A;  2VJ4 A;  2QCO A;  1JHF A;  3BJO A;  3C18 A;  3FXU A;  2NVT J;  1VND A;  3DLL F;  2HOS A;  1E17 A;  2HOT A;  3HOS A;  3N05 A;  2ME0 A;  1JUS A;  1DU6 A;  3IWZ A;  4G6T B;  4IVN A;  4PSW A;  1CF7 B;  4ZYD A;  1OCR H;  1FYK A;  1ZR4 A;  2L7K A;  2L2O A;  1IRZ A;  5LHG A;  1XSV A;  1TWG J;  3MZH A;  4LLG F;  1FMV A;  3ZQC A;  4QLC U;  1YHQ I;  3CC2 I;  2ACJ A;  3RJP A;  2K4B A;  2EBI A;  3TOB A;  3SYT A;  5B3S H;  2H09 A;  4XL9 A;  4CGZ A;  3EUH A;  1RI7 A;  3RCO A;  3NAR A;  5K5R A;  1MMN A;  5IP6 A;  4S04 A;  2ELJ A;  4UNO A;  2XRN A;  4A12 A;  1EF4 A;  2DYR H;  3HOY J;  1I27 A;  1TWH J;  5CYV A;  3MKZ A;  1P7J A;  3RKQ A;  5LHI A;  2YS9 A;  3K2Z A;  4GRI A;  5GAD J;  4M6V A;  3F21 A;  1YX3 A;  5FD6 A;  2HPM A;  3FXM A;  1L0O C;  2KQR A;  4UY8 I;  3HOW J;  5E3O A;  2CRG A;  2KZG A;  3FX3 A;  5DCM B;  4BXX J;  4BDY A;  2JTV A;  2H6C A;  2V7F A;  3KFW X;  3T8R A;  2QYO A;  1ZH5 A;  3OIQ A;  4IHV A;  1BM9 A;  1HC8 A;  1HW5 A;  3PNT A;  4MFD A;  5FRN A;  3CCY A;  3DV8 A;  3C2H A;  4YEJ A;  5BNG A;  2NOJ B;  4AM3 A;  3A0B C;  5BOX A;  4XKC A;  1YYV A;  1I6H J;  2ZFU A;  2HVS A;  2Y0S A;  1BBY A;  2DFE A;  2QVO A;  5FLX K;  5HOO A;  4RM3 A;  2QEX I;  1T38 A;  1QVU A;  4WCG A;  3NEU A;  4UUT A;  3I56 I;  5K7F A;  4Y4R A;  3OR1 C;  4A69 C;  3C2G A;  1S8N A;  3QPL A;  2XAH A;  2EV0 A;  1YW9 A;  2X0L A;  5E79 C;  1OR7 C;  3WHB A;  4FE7 A;  4BQQ A;  1P2F A;  2R93 J;  3M8F A;  5J6X A;  4XRS G;  2P5L C;  3OYJ A;  3LAP A;  3BG3 A;  4WXH A;  3PL8 A;  3ZMZ A;  1G8X A;  1A31 A;  2L3D A;  2M0C A;  2R3S A;  4E7I A;  1I6X A;  3S3N A;  1KYZ A;  1ODD A;  2LY9 A;  4NUB A;  4PCQ A;  5E17 F;  3CCM I;  3S2D J;  2M0M A;  3M8E A;  3GTM J;  5JI6 A;  2UZK A;  3CCQ I;  2JSP A;  3MN2 A;  4B1R A;  2QQA A;  3ZMD A;  1KU2 A;  1GXP A;  2JZY A;  1MJB A;  2DJN A;  1FTT A;  1S7O A;  3L00 A;  3BWG A;  3D5R C;  3S1R J;  2XUB A;  3M3Y J;  2PMZ N;  3RYP A;  3G2B A;  1H0M A;  5J3L A;  3SHF A;  3BJ6 A;  3TO7 A;  4JQF A;  4CCJ A;  1A35 A;  2LTP A;  2W24 A;  2CW7 A;  3PM1 A;  2XDV A;  1ORK A;  5H6R A;  3IAS 2;  1TT0 A;  4KIC A;  1U9N A;  2WV0 A;  4AC0 A;  1XB4 A;  3DCF A;  4XLC A;  1FC3 A;  5GAH J;  1I5Z A;  1U8R A;  2XB0 X;  3WTX C;  2PJP A;  3G3Z A;  4BKX A;  1AKH B;  2HKO A;  4QWQ A;  2PN6 A;  1Y0U A;  1SVO A;  2E36 A;  4BE0 A;  1QZY A;  1KQ8 A;  1K78 B;  3KP6 A;  2HNH A;  3HRT A;  1F4K A;  5EZH A;  1EH6 A;  5JHF A;  1OIS A;  4F52 A;  1VQN I;  1J2X A;  2IP2 A;  3I53 A;  1A5J A;  4CDG A;  2VJJ A;  2GIV A;  1TC3 C;  1JI8 A;  3Q5F A;  2E1C A;  2TRT A;  1IN4 A;  2RQP A;  3RYR A;  2PBI A;  2DOF A;  2FQ4 A;  4RB0 A;  3CDI A;  3WTT C;  1OJL A;  2LRE A;  4P5O A;  4BGD A;  3FXQ A;  1O3Q A;  4G8X A;  1N75 A;  4G6Q A;  2Y31 A;  4MQV A;  1VQM I;  1R5I D;  1J9I A;  3CF5 F;  4X1E A;  3SJM A;  3MVP A;  1FYM A;  3FK7 A;  2IS6 A;  5LBQ A;  1SAX A;  3IUO A;  1QZE A;  1HW1 A;  3RDI A;  3GVA A;  4XN0 A;  4HA8 A;  2QGU A;  1V5E A;  2ZFW A;  1XMA A;  3BR1 A;  2F5C A;  5EJC A;  2DO7 A;  4DW6 A;  2W57 A;  3KEY A;  3WG9 A;  4C3I J;  3PO3 J;  4CSW A;  4D5C A;  1W7P B;  2IGN A;  3ABU A;  3I59 A;  4NQW B;  4A3M J;  4BL0 B;  4E7J A;  4KNY A;  2NNY A;  3OYA A;  3OIP A;  2Y48 A;  4ENK A;  4KIS A;  2RQQ A;  2DOA A;  4HQM A;  2CUZ A;  2ZCW A;  4OAY A;  2E2I J;  1R5H A;  3K70 D;  4CA0 A;  2MG4 A;  1A6Q A;  1P7I A;  5CQG A;  2YR2 A;  4LGW A;  1GT0 C;  2ZNZ A;  4BBR J;  5FLM J;  2WY8 Q;  2OPT A;  5E1X A;  3U2R A;  4XLF A;  2HQ5 A;  5GP9 A;  3GYH X;  1D1C A;  1KYW A;  5F1R A;  1X58 A;  4GCV A;  3KP4 A;  4V19 K;  3CQZ J;  3O8H A;  3Q9S A;  1CGP A;  2W48 A;  1U9O A;  2V9P A;  5HNF A;  1T6S A;  2FRH A;  1Q1V A;  3P9C A;  2ME6 A;  2K3P A;  2DA6 A;  3GCM A;  3ZP5 A;  2DOE A;  3KX2 A;  3H92 A;  5JR3 A;  3K7A J;  1B9N A;  2Z33 A;  3L2W A;  1KGS A;  3MWM A;  1SD7 A;  4PK4 A;  3CO6 C;  5E3L A;  1MIJ A;  5DEQ A;  1WCM J;  3AL0 C;  2FJ1 A;  3CMY A;  1KON A;  3KEO A;  1STZ A;  4ASN A;  2MYS A;  2PMZ A;  3TW6 A;  3W6V A;  3MCZ A;  2RRE A;  3PJR A;  3RZO J;  1E0E A;  3K4B A;  1WFX A;  2XIG A;  1MJA A;  1APL C;  1HOM A;  5F08 A;  2E71 A;  1ETY A;  4RLQ A;  1ON1 A;  3OR2 C;  4HX7 A;  1WSU A;  3LFK A;  1L3L A;  4DOZ A;  2TCT A;  1WH5 A;  3FXL A;  1OR7 A;  1K6Y A;  4KJZ A;  3V8L A;  3GEZ A;  3OY9 A;  1A04 A;  1T95 A;  2ZJP F;  3H3Z A;  1ZGA A;  3DPL C;  3V8K A;  3WTW C;  5E3N A;  3LSH A;  1ULY A;  3BTJ A;  2VC1 A;  3EUK L;  1W36 D;  4KMF A;  5J4Y A;  4PJJ A;  1SFU A;  1FSE A;  2HGC A;  3DPT A;  5B1A H;  2LKS A;  2E2J J;  4A0X A;  1G6N A;  3G71 I;  1UMQ A;  2DOD A;  2EIJ H;  1YTY A;  1T2K A;  1DUX C;  2WAE A;  2K02 A;  2KIQ A;  2VQL A;  3GFM A;  2WC2 A;  3ECH A;  4MFE A;  4ZH4 F;  1BA5 A;  2R7F A;  1DP7 P;  4EJV A;  3SFI A;  2L4M A;  2X4H A;  4CZZ A;  2GM4 A;  1SFX A;  3PIP F;  1TZL A;  5C4J J;  3NRV A;  2F48 A;  4IOC F;  1PUF B;  1IRF A;  3FK6 A;  1UJ8 A;  5LRR A;  2IAI A;  2M87 A;  2JUC A;  1FWZ A;  2NOG A;  2VXD A;  4XNF A;  4N9H A;  1M1E B;  3VEP A;  1SMT A;  2DMN A;  4L9N A;  2KPM A;  5LGU A;  1IN5 A;  2PFB A;  3BR2 A;  3C3W A;  4KN4 X;  4XRF A;  2ELK A;  2IS2 A;  2VBZ A;  2M3A A;  4E7Z A;  1IUF A;  4WK8 F;  5ICG A;  1W36 C;  2CH0 A;  5LGT A;  3WHC A;  2JN6 A;  3GTP J;  4XOR A;  1HLV A;  2R4G A;  1RC9 A;  2M4G A;  4DZP A;  3KCC A;  3GTK J;  4BXU A;  2P5V A;  4IZZ A;  1BW6 A;  3A03 A;  3ERE D;  1BI0 A;  1BN5 A;  3WGI A;  2FOW A;  2R7T A;  1BR4 A;  3FXR A;  1U78 A;  1LB2 A;  2DDA A;  5GPC A;  2X6W A;  3H5R A;  2GXB A;  2K40 A;  1WH7 A;  3S1N J;  1FY7 A;  1OMI A;  1REP C;  2XB5 A;  1X3W B;  2M4K A;  3LA2 A;  2W85 A;  3CJQ B;  4LIV A;  1J7K A;  2XRL A;  2YUS A;  3NAU A;  5FKO A;  1JKP C;  2VOD A;  4BHC A;  2QWW A;  1B72 B;  4ESF A;  1X4O A;  3E6C C;  2MGQ A;  4ZDL A;  4M3G A;  3CD6 I;  4LK0 F;  4AID A;  1NG7 A;  4RB1 A;  3HSR A;  5L3B A;  3CJR B;  2ID6 A;  2DLL A;  2P6S A;  3DKY A;  3LWF A;  4OWR B;  3GF2 A;  1LVK A;  4LIT A;  3OYK A;  1SFO J;  3ERM A;  1BI2 A;  3BR3 A;  3SZT A;  3WU0 A;  1T39 A;  3GW2 A;  1C0W A;  4A3B J;  1EV7 A;  2PMH A;  3KET A;  5EEG A;  5J1U A;  2DMQ A;  4C2M J;  2STW A;  3HM5 A;  1FOK A;  1XGO A;  3BG9 A;  5DD8 A;  1Z9C A;  2ZME C;  1R71 A;  2E1M B;  1GXQ A;  2MBF A;  1B72 A;  1YJN I;  3R4K A;  4N0B A;  1X1A A;  1T08 B;  1AA7 A;  3QU6 A;  3HKZ N;  3DXJ F;  4G94 A;  3K4J A;  4W97 A;  3BTL A;  1TT5 B;  2GAU A;  1VQ5 I;  3OYE A;  3F6V A;  2WWY A;  2KIU A;  3BG7 A;  2KFD A;  5ILS A;  2CYY A;  2LP0 A;  2DK8 A;  4HX4 A;  2Y0S N;  2KL4 A;  4U7B A;  4HNV A;  3PUB A;  2E5N A;  2GWR A;  4A5N A;  3TED A;  5AIP A;  1MMD A;  1IN6 A;  1RET A;  4GDF A;  2HKX A;  2P6T A;  4IKF A;  5IP9 J;  3JAM Z;  1ETK A;  2E2H J;  1V4R A;  1FBU A;  1DGW Y;  4I6Z A;  1AOY A;  2E5Z A;  2DQL A;  4ZYG A;  1MND A;  2DAO A;  2GA2 A;  3WGG A;  3A0H C;  1IG7 A;  2E7W A;  2HFH A;  2H6B A;  3MZY A;  2VQC A;  1JUP A;  2YX7 A;  3FMS A;  3FIS A;  3AKZ A;  1N78 A;  1XCV A;  2MD0 A;  3VYR B;  5J40 A;  4A3L J;  2R7U A;  2XRO A;  2P8T A;  2EH3 A;  2NS8 A;  3O3K A;  4GFB A;  4IO9 F;  4ZDO A;  1IC8 A;  1ZG1 A;  3PIO F;  1QPI A;  3GBG A;  3JRG A;  4RS8 A;  3P5J A;  1FBQ A;  5CPR B;  2CGP A;  2VBW A;  3IH4 A;  1D5V A;  1DQU A;  2Y9Y A;  2JQ7 A;  4YFN F;  2NRA C;  5M3M J;  2HDC A;  1TWA J;  3ISP A;  4IPA A;  4CCL A;  1FP2 A;  5C4X J;  5ED4 A;  3I4M J;  4XRS A;  3F8C A;  1TWF J;  3W2V A;  2DA3 A;  2V1D A;  2HR3 A;  1QO0 D;  4HNT A;  2R5Y A;  1XN7 A;  5M5Y J;  1DPR A;  3P7N A;  3TP0 A;  4XID A;  1EH8 A;  1OFC X;  2GOM A;  4KIB A;  2W25 A;  1SFE A;  3ZQH A;  4XBF A;  2KIS A;  1D3Y A;  4C2T A;  1D0Y A;  5D5U B;  2K27 A;  3S14 J;  5HS8 A;  3UKG A;  4YFX F;  4D5F A;  3PFY A;  3OOP A;  2DMU A;  4IL6 C;  3K0L A;  1IF1 A;  3J81 Z;  1UB9 A;  2BGC A;  2MC4 A;  2VXZ A;  2O03 A;  3C7J A;  5BQT A;  2VLA A;  4EJU A;  1YOV B;  1RZ4 A;  1W5S A;  1Y56 A;  2E7X A;  4RBO A;  2LVS A;  3HSE A;  4BJT A;  2A3S A;  4O6J A;  2M8E A;  5K5O A;  3WTV C;  1DGR M;  3CLQ A;  1Z6R A;  3H9G A;  4P1W A;  3OV8 A;  4JYK A;  2O8X A;  1MH4 A;  1BI3 A;  1MH3 A;  1XX5 A;  3HHG A;  2Y30 A;  5EGO A;  3BG6 A;  5C3E J;  1TQM A;  3LST A;  2MW8 A;  2LKX A;  2EIM H;  5JLW A;  2HYF A;  1ETV A;  2FMY A;  4EQQ A;  3G6E I;  2X51 A;  1IXR C;  3F8M A;  1HDD C;  2VQG A;  5IOY A;  2I8D A;  1KA8 A;  3LSK A;  1U2W A;  2LH9 A;  3E7L A;  5TIS C;  4BAY A;  2XC7 A;  1X4P A;  2HOA A;  5IY5 H;  1WHU A;  2LF7 A;  2BOL A;  3H3V K;  2RGV A;  1LPQ A;  3TDU C;  4HST A;  3TL4 X;  5FJ8 J;  3HJE A;  4GYG A;  1D5Y A;  5E8I A;  2MLG A;  3E97 A;  1XGS A;  3VSL A;  1UST A;  1K7A A;  1R1T A;  1GV2 A;  3KP5 A;  1TQP A;  5JHU A;  4XIC A;  2O5R A;  2VOP A;  2Q1Z B;  1V5G A;  4PSX A;  3KZY A;  3J7Y J;  2JA2 A;  3E6D A;  2JPC A;  4JK1 X;  1J75 A;  2V1U A;  2R7Z J;  2DCE A;  2VN2 A;  2KIM A;  1VI0 A;  2H94 A;  4V2F A;  1IDY A;  2A6H F;  2XF5 A;  2V6C A;  1FNN A;  3S16 J;  5E1Z B;  5HLI A;  3OYH A;  3DBH B;  1HSJ A;  4UB6 C;  3JSO A;  2YU3 A;  3E5U A;  2KJB A;  2LC2 A;  2WAF A;  4NQW A;  3ULQ B;  3K1P A;  1D8K A;  4ITV A;  4DJA A;  2CUJ A;  4UUS B;  2A5W A;  3DFG A;  2NVY J;  4B09 A;  3U9G A;  1H9T A;  4BU2 A;  4Y33 A;  4Y17 A;  3J81 K;  2KJC A;  3KP2 A;  2XSD C;  1SVL A;  3FMR A;  3A01 B;  1KU7 A;  4EGY A;  4FTH A;  3L2U A;  5BPD A;  1XC5 A;  1MSE C;  2W00 A;  3U21 A;  5ICE A;  2FE3 A;  1IZ1 A;  2DI3 A;  2VJ5 A;  2ECC A;  4CCO A;  2I5U A;  1Y0N A;  3ABT A;  2R7V A;  3ELK A;  2XF7 A;  3CUQ C;  2PLY A;  5AIQ A;  1UG0 A;  1N77 A;  2XAQ A;  3BG5 A;  1FTZ A;  1JTY A;  3HIF A;  4OIQ F;  1T56 A;  2X1E A;  3BP8 A;  2VT3 A;  3L2C A;  4E4H A;  2LBF A;  3ONQ A;  1SD6 A;  1MBF A;  2UUZ A;  1ZRF A;  1ZEL A;  4IHS A;  1J09 A;  4BY1 J;  4MTE A;  1H88 C;  3DKW A;  1XMX A;  5IYC J;  2B9S A;  4BQN A;  3GLL A;  3ZPL A;  3HB9 A;  4I0A A;  3PQJ A;  3B02 A;  2OQR A;  1YQA A;  2V9K A;  4ENJ A;  4P9U A;  3MKW B;  4NB5 A;  4AU7 A;  4PJ0 C;  3LAJ A;  1O3R A;  2G7H A;  1H89 C;  1IN7 A;  3PO2 J;  2A61 A;  1A6I A;  4DYR A;  2OCC H;  4PFP A;  1W4M A;  1ZGW A;  1R22 A;  3QYE A;  1ZYR F;  2KKO A;  1WVR A;  1BOB A;  1MZB A;  2HWV A;  1I3Q J;  1XCB A;  3HKZ A;  1DPU A;  1XSX A;  2ZXI A;  1U0J A;  4HDU A;  1XTA A;  2CFX A;  2MC3 A;  1ETO A;  1B1B A;  3Q3S A;  2UWM A;  4M3E A;  5F0H A;  4EV0 A;  1YO5 C;  5FGM A;  4A3I J;  4YRV A;  3L2V A;  3D5S C;  1MBG A;  4F92 B;  1X1P A;  3DTI A;  2H8R A;  4JX5 A;  2A05 A;  5DCF A;  3FWE A;  3HC7 A;  4S05 A;  2VAS A;  3T5X A;  4BE1 A;  4HV5 A;  3Q0W A;  4DBQ A;  5DD4 A;  4DNC A;  1R1V A;  4HRI A;  2Q8K A;  1HKQ A;  3KIO A;  4BJ6 C;  1PYV A;  3X2Q H;  1TW2 A;  1VQ4 I;  1NHA A;  2E1N A;  4PJL A;  3JRD A;  1WQ2 A;  2FEZ A;  2ZXJ A;  3F8N A;  2L02 A;  5LRS A;  2D2W A;  1GUU A;  2OV7 A;  1Q1H A;  2R92 J;  1RKT A;  3AAF A;  3KYL A;  3OSF A;  5DS9 A;  2Z5U A;  3OIO A;  1V55 H;  1ZN2 A;  4XKV A;  4A5M A;  2AQF A;  3A02 A;  4NHJ A;  1NK2 P;  2ID3 A;  4ZYA A;  4DYC A;  4ZZL A;  3B6A A;  4X0G A;  2YX4 A;  3G1M A;  1Y6I A;  3HGY A;  2RNG A;  2ELH A;  4KUM A;  3J7Z I;  2BVL A;  3GZ5 A;  4JX4 A;  1Z7U A;  1UHS A;  3JRA A;  3I71 A;  4ZTF A;  2DFH A;  3KEQ A;  4YG2 F;  1HDP A;  2LNB A;  3D0S A;  4IXA A;  1JTX A;  3LA3 A;  2MSY A;  2Y69 H;  3EYI A;  1B4A A;  4UVB A;  2LBF B;  2IGO A;  3JCU C;  1FJL A;  3FZV A;  3H35 A;  1BR2 A;  4BQO A;  1PP7 U;  1R6R A;  1OYI A;  5DUI A;  4WWC A;  3TO9 A;  5L3C A;  1OCZ H;  2IA0 A;  4B43 A;  4M6X A;  2CQ7 A;  3DTE A;  1X1D A;  1TNT A;  4ETS A;  1RR7 A;  3MKL A;  3VYS B;  5FKK A;  5FKM A;  3CP2 A;  1FT9 A;  4KT5 C;  4C3H J;  3JTG A;  2R7D A;  1D8J A;  2FNP A;  3OOU A;  1JKO C;  2HOE A;  3I5U A;  2J5P A;  2BYV E;  4XSX F;  3S1M J;  3OMY A;  1ZRD A;  1E3P A;  3BY6 A;  4PGH A;  3BZK A;  1LFU P;  2WTE A;  4WX9 A;  4U88 A;  3HEF A;  2CMP A;  2PEX A;  2L7F P;  4ZJZ A;  4CIC A;  1OCO H;  2OJE D;  2E35 A;  2JWT A;  2WV1 A;  5E1W A;  1RUO A;  4ZC3 A;  1ZHF A;  2HVR A;  3Q9V A;  5TJJ A;  5TRD A;  5M3F J;  3DEW A;  3WGH A;  3OYB A;  2QUF A;  4ENN A;  1VQO I;  1Z77 A;  2COB A;  2LOO A;  1PUE E;  5ICC A;  1RR8 C;  3FM5 A;  3WU1 B;  5FRM A;  4M73 A;  2Z16 A;  3SZP A;  1P9Q C;  1WGX A;  5GAG J;  3M07 A;  5DM7 F;  2M9H A;  2JRT A;  4ESB A;  2WB1 A;  4A3E J;  4B48 A;  5CVJ A;  3HBL A;  2GA1 A;  3I58 A;  4A2U A;  2VB6 A;  4NDL A;  2O0Y A;  3QRF F;  2QQ8 A;  4MIM A;  3ZQG A;  2ZO4 A;  4Y3O A;  3H0D A;  1WZ2 A;  3QWL A;  2HTJ A;  5HLH A;  1W1W E;  4IHX A;  4IRG A;  5HS7 A;  3K6G A;  3FKI J;  2X1D A;  2JA8 J;  1UFM A;  2W1O A;  1SFK A;  3BCB A;  1H9G A;  3T1B A;  3L09 A;  2IEK A;  4P55 A;  3SXY A;  3F22 A;  4G6D A;  1P92 A;  3MMY B;  2ZNY A;  3ECO A;  4F93 B;  1MDM A;  1T0F C;  4CH7 A;  2EIK H;  3I4P A;  3HUG B;  2IGK A;  4HEA 2;  4M72 A;  1IO2 A;  2A6T A;  2XAF A;  4JOM A;  2L7Z A;  3GME A;  3KYC B;  4IJA A;  2PJR B;  4LD5 A;  4MO7 A;  2KZV A;  3AG2 H;  1T98 A;  3AL0 B;  4RM2 A;  3LSI A;  4ZZD A;  2VBY A;  4HBL A;  4PUS A;  4XN3 A;  1LEA A;  1JHH A;  2F4M B;  3IP4 B;  4IQ4 A;  1IRG A;  2FU4 A;  4KIF A;  3DEU A;  4IQJ A;  1T33 A;  4II2 A;  4A3C J;  3CJN A;  2VKD A;  2DA4 A;  5FFZ A;  2DW4 A;  3C2B A;  4A3K J;  1TW3 A;  1YI2 I;  1BJA A;  5EF6 A;  3PSI A;  2JVG A;  2CUF A;  3ZRG A;  1K6O A;  1WJA A;  3IL2 A;  3I55 I;  1XG1 A;  2LG4 A;  4XLA A;  3S17 J;  3DBR B;  4A6D A;  4LJZ F;  1GVJ A;  1MBH A;  3FIW A;  3A1Y A;  2AXL A;  2BZT A;  2ZC2 A;  4KIT B;  4L5E A;  2M7B A;  4B3X A;  1E3H A;  2EWN A;  4G7O F;  1S3J A;  1Z67 A;  4M74 A;  4HDV A;  2K9N A;  2XHK A;  3HUG A;  3RPU D;  2OZ6 A;  2TDX A;  4TV7 A;  5ERI A;  4FX4 A;  1FMW A;  5EDN A;  1POG A;  2EV6 A;  3H1C A;  1YE9 A;  4HZF A;  1XSD A;  3OWT A;  3VPR A;  2NVQ J;  1RPW A;  1BW5 A;  2L01 A;  5KK1 A;  3J80 Z;  2AHQ A;  5IP7 J;  5HLT A;  2ZB9 A;  1LE8 B;  1TNS A;  2DA2 A;  2BE5 F;  3OL3 A;  2VE9 A;  2G7U A;  3L2R A;  1Z3X A;  3S2H J;  2HS5 A;  3CCE I;  2X6Y A;  3LSP A;  1JGS A;  4LLL A;  1TP4 A;  5BS6 A;  2OTJ I;  3SEQ A;  3LSM A;  2R7O A;  4XR6 A;  1ON2 A;  2VBX A;  3BR6 A;  4HF2 A;  1LQ1 A;  3B73 A;  1LFP A;  3BC8 A;  2W84 A;  1XD7 A;  3EUA A;  2HPI A;  4ZYE A;  3S1Q J;  2VE8 A;  5H20 A;  4CCM A;  3CES A;  2IGM A;  4EM0 B;  1MMS A;  4J00 A;  4ESJ A;  2LF8 A;  2QZ8 A;  3ABK H;  2B63 J;  4GGG A;  4RB2 C;  2XVC A;  3KZZ A;  4DBR A;  3QQA A;  2DDB A;  4HSR A;  1QRY A;  2ESN A;  3CP8 A;  4MLO A;  2JSC A;  2KMU A;  3A4C A;  4YEL A;  4ZYH A;  4A3F J;  1HST A;  1AHD P;  5CVR A;  5K7H A;  4HV6 A;  4OIN F;  4F7Z A;  5D4S A;  1FOX A;  9ANT A;  4L5I A;  4UB8 C;  1JKQ C;  1ZG5 A;  3E5X A;  1WJD A;  2DT7 B;  5KAI C;  2DU9 A;  2AQE A;  2GQQ A;  2FUG 2;  2WAQ A;  3DLA A;  1X3U A;  3ZXS A;  1YRN A;  3SDB A;  4LB5 A;  2K85 A;  2M1B A;  2DYS H;  3MD2 A;  4DGW B;  2F5F A;  5IT3 A;  4OIP F;  1HCR A;  4P9F A;  5ILV A;  3CDH A;  3TO6 A;  3E6B A;  5J4V A;  3TBI A;  3OS0 A;  2HYG D;  2IVM A;  2QQB A;  4V2G A;  1LE8 A;  1EJ9 A;  4X6A J;  3N4M A;  2P4W A;  2HYJ A;  1O7F A;  4XSZ F;  2M5W A;  3ZMU A;  1FLI A;  1BIB A;  2NS0 A;  4B3A A;  3SZG A;  5K5Q A;  3I4N J;  3ZR8 X;  2O61 A;  1R58 A;  4RMN A;  5ILU A;  1XGM A;  2Q0O A;  1R1U A;  4G7H F;  3GO5 A;  3KP7 A;  1KZH A;  1XS9 A;  5F04 A;  1MMG A;  2A69 F;  2H8W A;  4EM1 A;  3ZMS A;  5HVQ C;  4AIK A;  2JPB A;  3GFI A;  5K7Z A;  2EQR A;  2FXA A;  3LA7 A;  4A3J J;  2KRF A;  2PI0 A;  5IT9 Z;  2WA0 A;  2RVC A;  4XM3 A;  1J0R A;  4XLE A;  4AYB A;  3KE2 A;  2VON A;  4HAM A;  3EQL F;  3BZC A;  4NNJ A;  1VQ7 I;  2BXZ A;  1OQY A;  1NH3 A;  2LSO A;  2LYC A;  2ZME B;  5KNL A;  1OCT C;  1TLH B;  4QIW N;  1ERD A;  5H6Q A;  1ETW A;  3V42 A;  4GYI A;  5D5V B;  2IBD A;  3K10 A;  4I7H A;  2A6E F;  2EZL A;  3E1S A;  4AUX A;  2CWE A;  3V7R A;  2MA3 A;  2OD5 A;  4XOT A;  4XKW A;  1RNL A;  2OTL I;  1VQK I;  1TTY A;  4BE2 A;  5KAF C;  2HXI A;  3ZMV A;  2IT0 A;  3REO A;  2ETH A;  4C30 A;  5JVG F;  1WI9 A;  3WOD F;  2NYX A;  1U6G A;  2COM A;  3SDG A;  2A68 F;  2L9V A;  3AG1 H;  3WG7 H;  3U1K A;  3JSP A;  1SD5 A;  3BTC A;  3GLX A;  3IKT A;  1MBE A;  3WE3 A;  3S3O A;  2YSR A;  3HZJ A;  3LMM A;  3OL4 A;  4B44 A;  5DDG A;  3O6B B;  3UR3 C;  2NVX J;  2ZXW H;  3LSG A;  2M7A A;  4RGX A;  4PGG A;  4DYQ A;  3R6S A;  4RB3 C;  4IEJ A;  2E19 A;  3QOD A;  2G0E A;  1MMA A;  3L2Q A;  3D5L A;  5M5W J;  1XDU A;  1BC7 C;  2R0Q C;  3IH3 A;  2VOO A;  1SVM A;  5KCM A;  3CCU I;  1ZG3 A;  4G12 A;  4A0Y A;  1PUF A;  1Z1D A;  3R61 A;  3IAM 2;  2H1K A;  3BZ6 A;  4HNU A;  2HQN A;  1EH7 A;  4FHT A;  1WPK A;  1SAU A;  3CUQ B;  3VYT B;  3G1L A;  1WI3 A;  1U5T A;  3ZQ7 A;  3HRS A;  3JW4 A;  1MD0 A;  2ZJ2 A;  4M9X A;  4UV9 A;  3WTS C;  5AON A;  2O6G E;  2XAG A;  4H4K C;  2P7V B;  4L9V A;  3RKX A;  2MAB A;  3G1O A;  3I3L A;  5D8K B;  2JJ7 A;  4UVC A;  2DPD A;  3CUO A;  3H36 A;  2DXI A;  3BOQ A;  4BHP A;  1OPC A;  1Z0X A;  3RPQ A;  2F5V A;  2LMD A;  5EGO B;  1Z6T A;  4XON A;  2XAS A;  3HXL A;  1YJ9 I;  2IRF G;  1BR1 A;  4FIS A;  4LFU A;  2OU2 A;  3ZQF A;  4Y7N J;  3S32 A;  2LY1 A;  5JFR A;  2EA4 A;  3COA C;  2LK2 A;  4YII A;  2ICW G;  4ZDP A;  2BEO A;  2EIN H;  5E18 F;  2K7L A;  2JA7 J;  1IJW C;  1BC8 C;  3RSN A;  1YIJ I;  4D7N A;  1R36 A;  1QNT A;  3IHU A;  4CYD A;  2QBY B;  3PQK A;  1B8I A;  2EFP A;  1YX5 A;  1ZAO A;  3FXO A;  3IV5 A;  3SFZ A;  3VOD A;  1U5T B;  3ZQQ A;  3DEE A;  5FLV A;  3HSF A;  2KDO A;  4FCY A;  2M34 A;  2NAZ A;  1W0U A;  3V7C A;  2XAJ A;  1FX7 A;  5IOZ A;  2JUG A;  3VSK A;  1FYL A;  4D9J A;  4RDU A;  4XOP A;  3BDD A;  4FAS D;  1R49 A;  4FET A;  2DK5 A;  1VZ0 A;  2VIX A;  1YIT I;  2F6C A;  2HQR A;  3S8P A;  3WTZ A;  5IT9 K;  3GWZ A;  5IYB J;  2P5K A;  3RKW A;  4KDP A;  1TBX A;  1W5C C;  4I02 A;  2BV6 A;  4P96 A;  4FX0 A;  1WJB A;  1F5T A;  1HKS A;  3KZI C;  3CDL A;  2NVU B;  3BT9 A;  4AWX B;  3JRE A;  1PP8 F;  1K4T A;  3F6O A;  3VB2 A;  3HOZ J;  3K69 A;  2Z99 A;  4LK1 F;  3DU6 A;  3I64 A;  3J7A O;  1I50 J;  5TGT A;  3ZN1 A;  1IXC A;  3CO7 C;  2WAD A;  2YPR A;  3TKY A;  1S6L A;  1MGT A;  2D1V A;  4DIQ A;  4M9S A;  2CFO A;  1YW8 A;  2RKH A;  5ICF A;  1BIA A;  1OKR A;  1YIO A;  2QSF X;  2PQ8 A;  1U5T C;  2V9V A;  3MKY B; 
#chains in the Genus database with same CATH homology
 3IKV A;  3GX4 X;  1G3T A;  4L9J A;  1KU3 A;  3NQO A;  2FF4 A;  4LB6 B;  4BQA A;  3M7G A;  1OYY A;  3S2W A;  4L0Z B;  5L3F A;  1LDK B;  3QPH A;  2DQR A;  3EDP A;  4M6Y A;  2IJL A;  4U0V A;  1YFH A;  1J59 A;  4N9I A;  3RPU A;  1LVA A;  2D45 A;  2CO5 A;  2AS5 F;  3V7S A;  4MTD A;  5D6F A;  2RC4 A;  1O57 A;  3N97 A;  2RV8 A;  3R0J A;  3GUD A;  2H27 A;  3W6K B;  1ZRC A;  4HX8 A;  1UCR A;  3P9I A;  4MEY F;  1KU9 A;  4IRH A;  3GFJ A;  1P6R A;  3HTU A;  3LQQ A;  2KIF A;  2Z9O A;  1V3F A;  1QPM A;  1UHM A;  3T8T A;  2PMU A;  3E5Q A;  4Z2Y A;  1USS A;  2PG4 A;  2MD5 A;  2EFQ A;  3MQ0 A;  5L3D A;  4AIH A;  4GXO A;  4HLY A;  2LDU A;  5DV5 A;  3WE2 A;  5FFX A;  2MH2 A;  4I98 B;  3V4G A;  4MHG A;  1KQ9 A;  2MLK A;  3DP7 A;  3F3X A;  2O3F A;  4KA4 A;  5K1Y A;  1O7L A;  3W6J B;  3HOT A;  2QLZ A;  3RTR A;  1QZZ A;  2XV4 S;  4JBA A;  2Y75 A;  2HTS A;  2FBK A;  1F1Z A;  1S29 A;  4LMY A;  2FML A;  4PDK A;  2XKO A;  2CG4 A;  1IUY A;  3PFI A;  4EJW A;  5LEJ A;  1U3E M;  4CXF A;  3R60 A;  1ZRE A;  1G3Y A;  5BPI A;  3VOE A;  1FSH A;  3BPV A;  1S7A A;  3QP5 A;  5DYM A;  4IHT A;  2EV5 A;  3QP6 A;  2QM3 A;  1R7J A;  2UXX A;  1I1G A;  2QBY A;  4LG0 A;  1WKM A;  1ZGJ A;  5HDG A;  3RIR A;  5HLG A;  2IW5 A;  5DCM A;  4FT8 A;  2F5D A;  5CVV A;  4EGZ A;  3ZN0 A;  4XLN F;  2DT5 A;  3K1M A;  1XDS A;  4GO1 A;  3F72 A;  3CUQ A;  3P9K A;  4MEX F;  1IAW A;  4CHU A;  5CJ9 A;  2LKP A;  3E6M A;  2XGX A;  5FLX Z;  2QQ9 A;  4UV8 A;  4CO8 A;  1BI1 A;  2K4J A;  2M45 A;  3L7W A;  4R8H A;  4EM2 A;  2A5Y B;  1JE8 A;  4EJT A;  1AWC A;  3GXO A;  1W7P D;  4IF4 A;  4R1H A;  3T0Y A;  4BYY A;  1MKM A;  3RKY A;  2Q2E A;  1F9N A;  4OU0 A;  3JTH A;  2NNN A;  5E20 A;  5CLS A;  3F8B A;  4UHT A;  2EK5 A;  5FO5 A;  4IRI A;  1Z05 A;  2ESH A;  3WTY C;  4EMS A;  4L18 B;  5CVU A;  1E2X A;  2DFI A;  4AIJ A;  1I1S A;  2RDP A;  4U0W A;  3K1N A;  1IN8 A;  2L54 A;  3TDZ C;  4Q4Z F;  3BJA A;  1HXD A;  3MEX A;  4PZJ A;  3DQV C;  2ISZ A;  2OQG A;  3U1D A;  3E3V A;  4G9Y A;  1VTN C;  1SD4 A;  3HTS B;  3IWF A;  2OBP A;  3C1D A;  1FPQ A;  3GFL A;  2VT2 A;  2FNA A;  2FA5 A;  3KLN A;  1QGP A;  4HW0 A;  1XMK A;  2UXN A;  5E8G A;  1MJ9 A;  2EB7 A;  2V1X A;  3CTA A;  5HS9 A;  1B59 A;  4Y15 A;  3M9A A;  1G4D A;  4OIO F;  3SQN A;  1LDD A;  4D0P A;  3FMQ A;  2P7C B;  5J8F A;  3MFK A;  3KP3 A;  4LG0 B;  3M1E A;  1IW7 F;  4L5J A;  5LEK A;  1ZLJ A;  1PDN C;  1RIO H;  1QBJ A;  1YLF A;  1MDM B;  4KFC A;  3R0A A;  2FBI A;  2VC0 A;  3JAM K;  4HYE A;  4MNU A;  1YS7 A;  2HEO A;  4K2E A;  4I0B A;  2RNJ A;  2DTR A;  3O2P E;  5LLQ A;  5KVR A;  4A6E A;  3QPT A;  2XKP A;  1P4X A;  3GZ6 A;  2FQ3 A;  3ZMT A;  1HW2 A;  4YIF A;  4G7Z F;  1R5G A;  2RN7 A;  5D6E A;  5JVT A;  4O5V A;  3G73 A;  1OYW A;  3I54 A;  4HF1 A;  3WTU C;  4E70 A;  2GZW A;  4M9Z A;  4H0E A;  1GHC A;  4U0Y A;  2F5E A;  1FZP B;  2HZT A;  4YFK F;  3FF5 A;  3H3U A;  4RAZ A;  4HQE A;  1G3S A;  4I09 A;  1HKT A;  1FBS A;  1R23 A;  3QOP A;  3TGN A;  2OAZ A;  3F8F A;  2ZME A;  1RUN A;  5F6F A;  4LLN A;  1IXS B;  2CQK A;  4KIG A;  2ZBK A;  3QAH A;  3V8J A;  4AVP A;  4RGS A;  4MQ9 F;  4A0Z A;  2EA2 A;  1YS6 A;  1R00 A;  4UUV A;  2GXG A;  4BHB A;  3FM3 A;  3TQN A;  1HQC A;  4KYW A;  3BPX A;  1ONV A;  2EFW A;  4HLX A;  2A07 F;  4L9T A;  2FOK A;  4HOB A;  3L9F A;  4Y13 A;  1JXS A;  3BRO A;  3QU3 A;  2OZU A;  3EYY A;  2QEN A;  5LGN A;  3HHH A;  2C6Y A;  1DDN A;  2IA1 A;  4HF0 A;  3HYI A;  3IC7 A;  3HRM A;  2MH9 A;  2BBY A;  2EJR A;  1K79 A;  4RGR A;  3IRR A;  1ZLK A;  2ZKZ A;  1XGN A;  1YG2 A;  2Z3Y A;  4XLP F;  5D5X B;  1K78 A;  4EVI A;  5F64 A;  4OOI A;  4I2O A;  2L4A A;  2OA4 A;  1SMY F;  1P4A A;  4KMU X;  3DF8 A;  4O3M A;  3HRU A;  1LJ9 A;  3ROU A;  2FBH A;  1B6A A;  5D8L B;  5FD5 A;  1LEB A;  1UHW A;  4OIR F;  5A2Q Z;  4WXC A;  1P4W A;  2IPQ X;  3EET A;  4UXN A;  1CF7 A;  4OMY A;  1T0F A;  2DBB A;  4Q5S F;  2F2E A;  5L3E A;  3F23 A;  5BMZ A;  4L0Y B;  1B9M A;  4OMZ A;  1LNW A;  1Z91 A;  3IRQ A;  5D4R A;  4UVA A;  4Q47 A;  2IA2 A;  3TOA A;  2EFN A;  5L3G A;  2ADU A;  5FB2 A;  2G9W A;  3KLO A;  4ENM A;  4Q48 A;  1FP1 D;  4M71 A;  2EFO A;  2Y0M A;  2ISY A;  2STT A;  6PAX A;  1O3S A;  3I0T A;  2M30 A;  4AD9 A;  5LHH A;  4ON0 A;  2CSO A;  4BH9 A;  5D5W B;  1W5T A;  2JT1 A;  5CVI A;  4RAY A;  3FHZ A;  1WWX A;  5J8C A;  1G3W A;  5HDK A;  2K86 A;  4WF2 A;  1YW7 A;  4B8X A;  4EJO A;  4I01 A;  4BNC A;  5HDN A;  1O3T A;  1HBX G;  2CW0 F;  4DQ2 A;  2FSW A;  5A2Q K;  1KQ0 A;  3VFZ A;  2V79 A;  1BOA A;  4RGU A;  3RI4 A;  3ML6 A;  1TQI A;  1J5Y A;  3J80 K;  1LDJ A;  4U7D A;  1WRJ A;  5EEH A;  1ZAR A;  2B0L A;  2D1H A;  2J5O A;  1W7P A;  3I59 B;  1QQI A;  4R79 A;  4MGR A;  2DPU A;  3LQR A;  5DUK A;  4WXD A;  3CLO A;  3MAJ A;  4KN7 X;  3K9T A;  1JHF A;  3BJO A;  3C18 A;  3FXU A;  1E17 A;  3HOS A;  3IWZ A;  4IVN A;  1CF7 B;  4ZYD A;  1FYK A;  5LHG A;  1XSV A;  3MZH A;  4LLG F;  4QLC U;  2ACJ A;  3RJP A;  2K4B A;  3TOB A;  2H09 A;  4CGZ A;  3EUH A;  1RI7 A;  5K5R A;  4S04 A;  4UNO A;  2XRN A;  4A12 A;  1I27 A;  5CYV A;  5LHI A;  3K2Z A;  3F21 A;  5FD6 A;  1L0O C;  3FX3 A;  5DCM B;  2JTV A;  2H6C A;  3KFW X;  3T8R A;  2QYO A;  1ZH5 A;  1BM9 A;  1HW5 A;  3DV8 A;  5BOX A;  1YYV A;  1BBY A;  2QVO A;  5FLX K;  5HOO A;  1T38 A;  4WCG A;  3NEU A;  1S8N A;  2XAH A;  2EV0 A;  1YW9 A;  2X0L A;  1P2F A;  3M8F A;  5J6X A;  2P5L C;  3LAP A;  4WXH A;  3ZMZ A;  2L3D A;  2R3S A;  1I6X A;  1KYZ A;  1ODD A;  4PCQ A;  5E17 F;  3M8E A;  5JI6 A;  2UZK A;  2QQA A;  3ZMD A;  1KU2 A;  1GXP A;  2JZY A;  1MJB A;  1S7O A;  3L00 A;  3BWG A;  2XUB A;  3RYP A;  1H0M A;  3SHF A;  3BJ6 A;  3TO7 A;  4JQF A;  2W24 A;  5H6R A;  4KIC A;  2WV0 A;  1XB4 A;  1FC3 A;  1U8R A;  1I5Z A;  3WTX C;  2PJP A;  3G3Z A;  2HKO A;  4QWQ A;  2PN6 A;  1Y0U A;  1QZY A;  1KQ8 A;  1K78 B;  3KP6 A;  3HRT A;  1F4K A;  1EH6 A;  1J2X A;  2IP2 A;  3I53 A;  4CDG A;  2GIV A;  3Q5F A;  2E1C A;  1IN4 A;  2RQP A;  3RYR A;  2PBI A;  4RB0 A;  3WTT C;  4P5O A;  3FXQ A;  1O3Q A;  4G8X A;  4G6Q A;  4MQV A;  1J9I A;  1FYM A;  5LBQ A;  1SAX A;  1HW1 A;  3RDI A;  3GVA A;  4HA8 A;  2ZFW A;  1XMA A;  2F5C A;  2DO7 A;  2W57 A;  3WG9 A;  1W7P B;  3ABU A;  3I59 A;  4KNY A;  2NNY A;  2Y48 A;  4ENK A;  4HQM A;  2ZCW A;  1R5H A;  2YR2 A;  4LGW A;  2ZNZ A;  5E1X A;  3U2R A;  3GYH X;  5F1R A;  1KYW A;  4GCV A;  3KP4 A;  3Q9S A;  1CGP A;  1T6S A;  2FRH A;  3P9C A;  3ZP5 A;  3H92 A;  5JR3 A;  1B9N A;  2Z33 A;  1KGS A;  3MWM A;  1SD7 A;  3CO6 C;  5DEQ A;  3KEO A;  1STZ A;  4ASN A;  3MCZ A;  2XIG A;  1MJA A;  1ON1 A;  4HX7 A;  1WSU A;  3LFK A;  1L3L A;  1OR7 A;  3V8L A;  3GEZ A;  1A04 A;  3H3Z A;  1ZGA A;  3DPL C;  3V8K A;  3WTW C;  1ULY A;  2VC1 A;  4KMF A;  1SFU A;  1FSE A;  2HGC A;  3DPT A;  4A0X A;  1G6N A;  1T2K A;  1YTY A;  1DUX C;  2K02 A;  3GFM A;  2WC2 A;  3ECH A;  4ZH4 F;  2R7F A;  1DP7 P;  4EJV A;  2L4M A;  2X4H A;  4CZZ A;  1SFX A;  3NRV A;  1IRF A;  5LRR A;  2M87 A;  1FWZ A;  4N9H A;  3VEP A;  1SMT A;  4L9N A;  5LGU A;  1IN5 A;  2PFB A;  3C3W A;  4KN4 X;  4XRF A;  2VBZ A;  4WK8 F;  5ICG A;  5LGT A;  3KCC A;  4BXU A;  2P5V A;  3ERE D;  1BI0 A;  1BN5 A;  3WGI A;  3FXR A;  1U78 A;  1LB2 A;  2GXB A;  1FY7 A;  1OMI A;  1REP C;  3LA2 A;  2W85 A;  1J7K A;  2VOD A;  4BHC A;  2QWW A;  4ESF A;  3E6C C;  4LK0 F;  4RB1 A;  3HSR A;  5L3B A;  2DLL A;  2P6S A;  3LWF A;  3GF2 A;  1BI2 A;  1C0W A;  3SZT A;  3WU0 A;  1T39 A;  3GW2 A;  1EV7 A;  2PMH A;  3KET A;  5EEG A;  2STW A;  1FOK A;  1XGO A;  5DD8 A;  1Z9C A;  1GXQ A;  2MBF A;  3R4K A;  4N0B A;  3QU6 A;  3DXJ F;  4G94 A;  2GAU A;  3F6V A;  2WWY A;  2KIU A;  5ILS A;  2CYY A;  2DK8 A;  4HX4 A;  4U7B A;  2GWR A;  4A5N A;  5AIP A;  1IN6 A;  2HKX A;  2P6T A;  3JAM Z;  1V4R A;  1FBU A;  1AOY A;  2DQL A;  4ZYG A;  2DAO A;  2GA2 A;  3WGG A;  2E7W A;  2HFH A;  2H6B A;  3MZY A;  2YX7 A;  3FMS A;  1XCV A;  2XRO A;  2P8T A;  3O3K A;  1ZG1 A;  4RS8 A;  1FBQ A;  2CGP A;  2VBW A;  1D5V A;  2NRA C;  4YFN F;  2HDC A;  3ISP A;  4IPA A;  1FP2 A;  5ED4 A;  3F8C A;  2V1D A;  2HR3 A;  1QO0 D;  1XN7 A;  1DPR A;  3P7N A;  1EH8 A;  4KIB A;  2W25 A;  1SFE A;  4XBF A;  1D3Y A;  5D5U B;  2K27 A;  5HS8 A;  4YFX F;  3OOP A;  3K0L A;  1IF1 A;  3J81 Z;  1UB9 A;  2BGC A;  2VXZ A;  3C7J A;  2O03 A;  5BQT A;  4EJU A;  1RZ4 A;  1W5S A;  2E7X A;  3HSE A;  2A3S A;  4O6J A;  2M8E A;  5K5O A;  3WTV C;  1Z6R A;  3OV8 A;  2O8X A;  1BI3 A;  3HHG A;  1TQM A;  3LST A;  2HYF A;  2FMY A;  4EQQ A;  1IXR C;  3F8M A;  1KA8 A;  1U2W A;  4BAY A;  2LF7 A;  2RGV A;  3TDU C;  4GYG A;  5E8I A;  2MLG A;  3E97 A;  1XGS A;  1UST A;  1K7A A;  1R1T A;  3KP5 A;  1TQP A;  5JHU A;  2VOP A;  3KZY A;  3E6D A;  4JK1 X;  2JPC A;  1J75 A;  2V1U A;  2VN2 A;  2KIM A;  2H94 A;  2A6H F;  2V6C A;  1FNN A;  5E1Z B;  5HLI A;  1HSJ A;  3JSO A;  2YU3 A;  3E5U A;  2KJB A;  4NQW A;  3ULQ B;  3K1P A;  1D8K A;  3DFG A;  4B09 A;  1H9T A;  3U9G A;  4Y17 A;  3J81 K;  2KJC A;  3KP2 A;  3FMR A;  1KU7 A;  4EGY A;  5BPD A;  5ICE A;  2FE3 A;  1IZ1 A;  2DI3 A;  3ABT A;  3ELK A;  3CUQ C;  2PLY A;  5AIQ A;  2XAQ A;  3HIF A;  4OIQ F;  3BP8 A;  2VT3 A;  3L2C A;  1SD6 A;  4IHS A;  1ZRF A;  4MTE A;  3DKW A;  3ZPL A;  4I0A A;  3PQJ A;  3B02 A;  2OQR A;  1YQA A;  4ENJ A;  4P9U A;  4NB5 A;  3LAJ A;  1O3R A;  2G7H A;  1IN7 A;  2A61 A;  1W4M A;  1R22 A;  1ZYR F;  2KKO A;  1MZB A;  2HWV A;  1XCB A;  1DPU A;  1XSX A;  4HDU A;  2CFX A;  2MC3 A;  1B1B A;  2UWM A;  4EV0 A;  1YO5 C;  5FGM A;  5DCF A;  3FWE A;  4S05 A;  3T5X A;  4HV5 A;  5DD4 A;  4DNC A;  1R1V A;  2Q8K A;  1HKQ A;  1TW2 A;  1NHA A;  2E1N A;  1WQ2 A;  2FEZ A;  2ZXJ A;  3F8N A;  2L02 A;  5LRS A;  2D2W A;  1Q1H A;  3AAF A;  2Z5U A;  1ZN2 A;  4NHJ A;  4A5M A;  4ZZL A;  2YX4 A;  4KUM A;  2ELH A;  3GZ5 A;  1Z7U A;  3I71 A;  3KEQ A;  4YG2 F;  2LNB A;  3D0S A;  4IXA A;  3LA3 A;  3EYI A;  1B4A A;  4UVB A;  3FZV A;  1PP7 U;  1OYI A;  5DUI A;  4WWC A;  3TO9 A;  5L3C A;  2IA0 A;  4M6X A;  1TNT A;  4ETS A;  3JTG A;  4KT5 C;  1FT9 A;  2R7D A;  1D8J A;  2FNP A;  2HOE A;  3I5U A;  2J5P A;  2BYV E;  4XSX F;  1ZRD A;  3BY6 A;  4PGH A;  2WTE A;  4WX9 A;  4U88 A;  2PEX A;  4CIC A;  5E1W A;  1RUO A;  1ZHF A;  3Q9V A;  5TJJ A;  5TRD A;  3WGH A;  2QUF A;  4ENN A;  1PUE E;  5ICC A;  3FM5 A;  3WU1 B;  4M73 A;  3SZP A;  2JRT A;  4ESB A;  5CVJ A;  2GA1 A;  3I58 A;  4A2U A;  2O0Y A;  3QRF F;  2ZO4 A;  2HTJ A;  5HLH A;  4IRG A;  5HS7 A;  1UFM A;  1H9G A;  3T1B A;  3L09 A;  4P55 A;  3SXY A;  3F22 A;  4G6D A;  1P92 A;  2ZNY A;  3ECO A;  1MDM A;  3I4P A;  4M72 A;  2XAF A;  4IJA A;  4LD5 A;  1T98 A;  4ZZD A;  2VBY A;  4HBL A;  1LEA A;  1JHH A;  1IRG A;  2FU4 A;  4KIF A;  3DEU A;  3CJN A;  5FFZ A;  2DW4 A;  1TW3 A;  1BJA A;  1K6O A;  3IL2 A;  4A6D A;  4LJZ F;  1GVJ A;  2AXL A;  2EWN A;  4G7O F;  1S3J A;  4M74 A;  4HDV A;  2XHK A;  3HUG A;  2OZ6 A;  2TDX A;  4TV7 A;  5ERI A;  4FX4 A;  2EV6 A;  4HZF A;  1XSD A;  2L01 A;  5KK1 A;  3J80 Z;  1TNS A;  2BE5 F;  2VE9 A;  2G7U A;  2HS5 A;  1JGS A;  4LLL A;  5BS6 A;  1ON2 A;  2VBX A;  4HF2 A;  1LQ1 A;  3B73 A;  2W84 A;  4ZYE A;  1XD7 A;  2VE8 A;  5H20 A;  4EM0 B;  4ESJ A;  2LF8 A;  2QZ8 A;  4GGG A;  4RB2 C;  2XVC A;  3KZZ A;  2ESN A;  2JSC A;  4ZYH A;  1HST A;  5CVR A;  4HV6 A;  4OIN F;  4F7Z A;  5D4S A;  4L5I A;  1ZG5 A;  3E5X A;  2DU9 A;  2GQQ A;  1X3U A;  4LB5 A;  2M1B A;  2F5F A;  5IT3 A;  4OIP F;  4P9F A;  5ILV A;  3CDH A;  3TO6 A;  3E6B A;  2HYG D;  2IVM A;  2QQB A;  3N4M A;  2P4W A;  1O7F A;  4XSZ F;  2M5W A;  3ZMU A;  1FLI A;  1BIB A;  2NS0 A;  5K5Q A;  2O61 A;  1R58 A;  5ILU A;  1XGM A;  2Q0O A;  1R1U A;  4G7H F;  3GO5 A;  3KP7 A;  4AIK A;  2A69 F;  4EM1 A;  3ZMS A;  5HVQ C;  2JPB A;  3GFI A;  2FXA A;  3LA7 A;  2KRF A;  2PI0 A;  5IT9 Z;  2RVC A;  1J0R A;  3KE2 A;  2VON A;  4HAM A;  3EQL F;  2LSO A;  2ZME B;  1TLH B;  5H6Q A;  4GYI A;  5D5V B;  4I7H A;  2A6E F;  2CWE A;  3V7R A;  2MA3 A;  2OD5 A;  1RNL A;  1TTY A;  3ZMV A;  2IT0 A;  3REO A;  2ETH A;  1WI9 A;  3WOD F;  2NYX A;  1U6G A;  2COM A;  2A68 F;  3JSP A;  1SD5 A;  3GLX A;  3IKT A;  3WE3 A;  2YSR A;  5DDG A;  3O6B B;  4RGX A;  4PGG A;  3R6S A;  4RB3 C;  3D5L A;  1XDU A;  1BC7 C;  2VOO A;  1ZG3 A;  4A0Y A;  1Z1D A;  3R61 A;  3BZ6 A;  2HQN A;  1EH7 A;  4FHT A;  3CUQ B;  1U5T A;  3ZQ7 A;  3HRS A;  3JW4 A;  1MD0 A;  2ZJ2 A;  4M9X A;  4UV9 A;  3WTS C;  5AON A;  2O6G E;  2XAG A;  2P7V B;  4L9V A;  3RKX A;  5D8K B;  4UVC A;  2DPD A;  3CUO A;  3BOQ A;  4BHP A;  1OPC A;  3RPQ A;  1Z6T A;  2XAS A;  2IRF G;  4LFU A;  2OU2 A;  5JFR A;  2EA4 A;  3COA C;  4YII A;  2BEO A;  5E18 F;  2K7L A;  1BC8 C;  1R36 A;  1QNT A;  3IHU A;  4CYD A;  2QBY B;  3PQK A;  2EFP A;  1ZAO A;  3SFZ A;  3VOD A;  1U5T B;  3HSF A;  2NAZ A;  3V7C A;  2XAJ A;  1FX7 A;  1FYL A;  3BDD A;  2DK5 A;  2HQR A;  3WTZ A;  5IT9 K;  3GWZ A;  2P5K A;  3RKW A;  4KDP A;  1TBX A;  4I02 A;  2BV6 A;  4P96 A;  4FX0 A;  1F5T A;  1HKS A;  1PP8 F;  4AWX B;  3F6O A;  3VB2 A;  3K69 A;  2Z99 A;  4LK1 F;  3I64 A;  3J7A O;  3ZN1 A;  1IXC A;  3CO7 C;  3TKY A;  2YPR A;  1S6L A;  1MGT A;  2D1V A;  4M9S A;  1YW8 A;  2RKH A;  5ICF A;  1BIA A;  1OKR A;  1YIO A;  2PQ8 A;  1U5T C;  2V9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...