2NBTA

Neuronal bungarotoxin, nmr, 10 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
66
structure length
66
Chain Sequence
RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL BUNGAROTOXIN
publication title Solution structure of neuronal bungarotoxin determined by two-dimensional NMR spectroscopy: calculation of tertiary structure using systematic homologous model building, dynamical simulated annealing, and restrained molecular dynamics.
pubmed doi rcsb
molecule tags Toxin
total genus 3
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2nbtA00
2VLWA 1IDGA 2PJYC 2UWRA 2JVEA 2OFSA 2FD6U 1FF4A 1LX5B 3KFDI 4BDTB 1BXPA 1JE9A 1FSCA 1LSIA 5DZ5A 1ERAA 1KU6B 1KC4A 2PJYB 3U74U 3BT1U 1FRAA 1M9ZA 1I02A 2CDXA 2GOOB 2X8BB 1REWC 1CDSA 2CRSA 2UX2A 1CDQA 1KBSA 2N99A 2I9BE 1W6BA 1VB0A 3NDSA 2J8BA 2MUOA 2MUPA 1CVOA 1NTXA 2BTXA 1NXBA 4P7UA 1KL8A 1CB9A 3NEQA 2K3GA 2H8UA 1TXAA 4DO8A 1ONJA 1NTNA 1MR6A 1IJCA 1RGJA 4XJJA 1FFJA 1ERGA 2GOOC 5IMTD 2LA1A 6EBXA 1CDTA 1QKEA 1RL5A 1QM7A 2NBTA 2CCXA 4FAOC 1CCQA 2QJBC 1PLOA 1KS6A 1NYUA 1QKDA 2CTXA 1CDRA 1MAHF 2MJ4A 1KBAA 4FAOE 4ZQYA 1B41B 1HC9A 3U73U 2CRTA 1HAAA 2QJ9C 1NEAA 3PLCA 1ZADA 1IK8A 1F8UB 1XT3A 4LFTA 2MFAA 3VTSA 2ABXA 4OM5A 2H7ZA 4AEAA 5DU1A 4UY2C 1KFHA 3BT2U 4OM4A 1IKCA 2MJ0A 2ERAA 1TGXA 3LAQU 4RUDA 3EVSC 2JQPA 4IYEA 1NORA 1CTXA 1IDIA 1TFSA 1IDLA 1F94A 2H5FA 2HLRA 2BHIA 3FEVA 4QTIU 4BIKB 1S4YA 1CHVS 2LCRA 3NH7A 2MHYA 1LJZA 2H62D 1ES7B 1IQ9A 2QC1A 2HLQA 1KTZB 1G6MA 1JGKA 2L03A 1IDHA 2H64C 1H0JA 1TXBA 1HC9B 1BTEA 1CXNA 1CXOA 5IMYC 1CODA 3KFDE 3EBXA 4HQPF 1LXHA 1CRFA 1ABTA 1KBTA 2H64B 2H7ZB 2MJYA 1FSSB 1JBDA 1UG4A 1HOYA 1YWHA 5DO6A 1FASA 3ERAA 3HH7A 3QB4B 1HAJA 1KXIA 1DRSA 1NYSA 1L4WA 1CREA 2H62C 1V6PA 1COEA 4EY8B 1LXGA 5EBXA 2L5SA 2QJAC
chains in the Genus database with same CATH superfamily
2VLWA 1IDGA 2PJYC 2UWRA 2JVEA 2OFSA 2FD6U 1FF4A 1LX5B 3KFDI 4BDTB 1BXPA 1JE9A 1FSCA 1LSIA 5DZ5A 1ERAA 1KU6B 1KC4A 2PJYB 3U74U 3BT1U 1FRAA 1M9ZA 1I02A 2CDXA 2GOOB 2X8BB 1REWC 1CDSA 2CRSA 2UX2A 1CDQA 1KBSA 2N99A 2I9BE 1W6BA 1VB0A 3NDSA 2J8BA 2MUOA 2MUPA 1CVOA 1NTXA 2BTXA 1NXBA 4P7UA 1KL8A 1CB9A 3NEQA 2K3GA 2H8UA 1TXAA 4DO8A 1ONJA 1NTNA 1MR6A 1IJCA 1RGJA 4XJJA 1FFJA 1ERGA 2GOOC 5IMTD 2LA1A 6EBXA 1CDTA 1QKEA 1RL5A 1QM7A 2NBTA 2CCXA 4FAOC 1CCQA 2QJBC 1PLOA 1KS6A 1NYUA 1QKDA 2CTXA 1CDRA 1MAHF 2MJ4A 1KBAA 4FAOE 4ZQYA 1B41B 1HC9A 3U73U 2CRTA 1HAAA 2QJ9C 1NEAA 3PLCA 1ZADA 1IK8A 1F8UB 1XT3A 4LFTA 2MFAA 3VTSA 2ABXA 4OM5A 2H7ZA 4AEAA 5DU1A 4UY2C 1KFHA 4KSNA 3BT2U 4OM4A 1IKCA 2MJ0A 2ERAA 1TGXA 3LAQU 4RUDA 3EVSC 2JQPA 4IYEA 1NORA 1CTXA 1IDIA 1TFSA 1IDLA 1F94A 2H5FA 2HLRA 2BHIA 3FEVA 4QTIU 4BIKB 1S4YA 1CHVS 2LCRA 3NH7A 2MHYA 1LJZA 2H62D 1ES7B 1IQ9A 2QC1A 2HLQA 1KTZB 1G6MA 1JGKA 2L03A 1IDHA 2H64C 1H0JA 1TXBA 1HC9B 1BTEA 1CXNA 1CXOA 5IMYC 1CODA 3KFDE 3EBXA 4HQPF 1LXHA 1CRFA 1ABTA 1KBTA 2H64B 2H7ZB 2MJYA 1FSSB 1JBDA 1UG4A 1HOYA 1YWHA 5DO6A 1FASA 3ERAA 3HH7A 3QB4B 1HAJA 1KXIA 1DRSA 1NYSA 1L4WA 1CREA 2H62C 1V6PA 1COEA 4EY8B 1LXGA 5EBXA 2L5SA 2QJAC
chains in the Genus database with same CATH topology
2VLWA 1IDGA 2PJYC 2UWRA 2JVEA 2OFSA 2FD6U 1FF4A 1LX5B 3KFDI 4BDTB 1BXPA 1JE9A 1FSCA 1LSIA 5DZ5A 1ERAA 1KU6B 1KC4A 2PJYB 3U74U 3BT1U 1FRAA 1M9ZA 1I02A 2CDXA 2GOOB 2X8BB 1REWC 1CDSA 2CRSA 2UX2A 1CDQA 1KBSA 2N99A 2I9BE 1W6BA 1VB0A 3NDSA 2J8BA 2MUOA 2MUPA 1CVOA 1NTXA 2BTXA 1NXBA 4P7UA 1KL8A 1CB9A 3NEQA 2K3GA 2H8UA 1TXAA 4DO8A 1ONJA 1NTNA 1MR6A 1IJCA 1RGJA 4XJJA 1FFJA 1ERGA 2GOOC 5IMTD 2LA1A 6EBXA 1CDTA 1QKEA 1RL5A 1QM7A 2NBTA 2CCXA 4FAOC 1CCQA 2QJBC 1PLOA 1KS6A 1NYUA 1QKDA 2CTXA 1CDRA 1MAHF 2MJ4A 1KBAA 4FAOE 4ZQYA 1B41B 1HC9A 3U73U 2CRTA 1HAAA 2QJ9C 1NEAA 3PLCA 1ZADA 1IK8A 1F8UB 1XT3A 4LFTA 2MFAA 3VTSA 2ABXA 4OM5A 2H7ZA 4AEAA 5DU1A 4UY2C 1KFHA 4KSNA 3BT2U 4OM4A 1IKCA 2MJ0A 2ERAA 1TGXA 3LAQU 4RUDA 3EVSC 2JQPA 4IYEA 1NORA 1CTXA 1IDIA 1TFSA 1IDLA 1F94A 2H5FA 2HLRA 2BHIA 3FEVA 4QTIU 4BIKB 1S4YA 1CHVS 2LCRA 3NH7A 2MHYA 1LJZA 2H62D 1ES7B 1IQ9A 2QC1A 2HLQA 1KTZB 1G6MA 1JGKA 2L03A 1IDHA 2H64C 1H0JA 1TXBA 1HC9B 1BTEA 1CXNA 1CXOA 5IMYC 1CODA 3KFDE 3EBXA 4HQPF 1LXHA 1CRFA 1ABTA 1KBTA 2H64B 2H7ZB 2MJYA 1FSSB 1JBDA 1UG4A 1HOYA 1YWHA 5DO6A 1FASA 3ERAA 3HH7A 3QB4B 1HAJA 1KXIA 1DRSA 1NYSA 1L4WA 1CREA 2H62C 1V6PA 1COEA 4EY8B 1LXGA 5EBXA 2L5SA 2QJAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLW A;  1IDG A;  2PJY C;  2UWR A;  2JVE A;  2OFS A;  2FD6 U;  1FF4 A;  1LX5 B;  3KFD I;  4BDT B;  1BXP A;  1JE9 A;  1FSC A;  1LSI A;  5DZ5 A;  1ERA A;  1KU6 B;  1KC4 A;  2PJY B;  3U74 U;  3BT1 U;  1FRA A;  1M9Z A;  1I02 A;  2CDX A;  2GOO B;  2X8B B;  1REW C;  1CDS A;  2CRS A;  2UX2 A;  1CDQ A;  1KBS A;  2N99 A;  2I9B E;  1W6B A;  1VB0 A;  3NDS A;  2J8B A;  2MUO A;  2MUP A;  1CVO A;  1NTX A;  2BTX A;  1NXB A;  4P7U A;  1KL8 A;  1CB9 A;  3NEQ A;  2K3G A;  2H8U A;  1TXA A;  4DO8 A;  1ONJ A;  1NTN A;  1MR6 A;  1IJC A;  1RGJ A;  4XJJ A;  1FFJ A;  1ERG A;  2GOO C;  5IMT D;  2LA1 A;  6EBX A;  1CDT A;  1QKE A;  1RL5 A;  1QM7 A;  2NBT A;  2CCX A;  4FAO C;  1CCQ A;  2QJB C;  1PLO A;  1KS6 A;  1NYU A;  1QKD A;  2CTX A;  1CDR A;  1MAH F;  2MJ4 A;  1KBA A;  4FAO E;  4ZQY A;  1B41 B;  1HC9 A;  3U73 U;  2CRT A;  1HAA A;  2QJ9 C;  1NEA A;  3PLC A;  1ZAD A;  1IK8 A;  1F8U B;  1XT3 A;  4LFT A;  2MFA A;  3VTS A;  2ABX A;  4OM5 A;  2H7Z A;  4AEA A;  5DU1 A;  4UY2 C;  1KFH A;  3BT2 U;  4OM4 A;  1IKC A;  2MJ0 A;  2ERA A;  1TGX A;  3LAQ U;  4RUD A;  3EVS C;  2JQP A;  4IYE A;  1NOR A;  1CTX A;  1IDI A;  1TFS A;  1IDL A;  1F94 A;  2H5F A;  2HLR A;  2BHI A;  3FEV A;  4QTI U;  4BIK B;  1S4Y A;  1CHV S;  2LCR A;  3NH7 A;  2MHY A;  1LJZ A;  2H62 D;  1ES7 B;  1IQ9 A;  2QC1 A;  2HLQ A;  1KTZ B;  1G6M A;  1JGK A;  2L03 A;  1IDH A;  2H64 C;  1H0J A;  1TXB A;  1HC9 B;  1BTE A;  1CXN A;  1CXO A;  5IMY C;  1COD A;  3KFD E;  3EBX A;  4HQP F;  1LXH A;  1CRF A;  1ABT A;  1KBT A;  2H64 B;  2H7Z B;  2MJY A;  1FSS B;  1JBD A;  1UG4 A;  1HOY A;  1YWH A;  5DO6 A;  1FAS A;  3ERA A;  3HH7 A;  3QB4 B;  1HAJ A;  1KXI A;  1DRS A;  1NYS A;  1L4W A;  1CRE A;  2H62 C;  1V6P A;  1COE A;  4EY8 B;  1LXG A;  5EBX A;  2L5S A;  2QJA C; 
#chains in the Genus database with same CATH topology
 2VLW A;  1IDG A;  2PJY C;  2UWR A;  2JVE A;  2OFS A;  2FD6 U;  1FF4 A;  1LX5 B;  3KFD I;  4BDT B;  1BXP A;  1JE9 A;  1FSC A;  1LSI A;  5DZ5 A;  1ERA A;  1KU6 B;  1KC4 A;  2PJY B;  3U74 U;  3BT1 U;  1FRA A;  1M9Z A;  1I02 A;  2CDX A;  2GOO B;  2X8B B;  1REW C;  1CDS A;  2CRS A;  2UX2 A;  1CDQ A;  1KBS A;  2N99 A;  2I9B E;  1W6B A;  1VB0 A;  3NDS A;  2J8B A;  2MUO A;  2MUP A;  1CVO A;  1NTX A;  2BTX A;  1NXB A;  4P7U A;  1KL8 A;  1CB9 A;  3NEQ A;  2K3G A;  2H8U A;  1TXA A;  4DO8 A;  1ONJ A;  1NTN A;  1MR6 A;  1IJC A;  1RGJ A;  4XJJ A;  1FFJ A;  1ERG A;  2GOO C;  5IMT D;  2LA1 A;  6EBX A;  1CDT A;  1QKE A;  1RL5 A;  1QM7 A;  2NBT A;  2CCX A;  4FAO C;  1CCQ A;  2QJB C;  1PLO A;  1KS6 A;  1NYU A;  1QKD A;  2CTX A;  1CDR A;  1MAH F;  2MJ4 A;  1KBA A;  4FAO E;  4ZQY A;  1B41 B;  1HC9 A;  3U73 U;  2CRT A;  1HAA A;  2QJ9 C;  1NEA A;  3PLC A;  1ZAD A;  1IK8 A;  1F8U B;  1XT3 A;  4LFT A;  2MFA A;  3VTS A;  2ABX A;  4OM5 A;  2H7Z A;  4AEA A;  5DU1 A;  4UY2 C;  1KFH A;  4KSN A;  3BT2 U;  4OM4 A;  1IKC A;  2MJ0 A;  2ERA A;  1TGX A;  3LAQ U;  4RUD A;  3EVS C;  2JQP A;  4IYE A;  1NOR A;  1CTX A;  1IDI A;  1TFS A;  1IDL A;  1F94 A;  2H5F A;  2HLR A;  2BHI A;  3FEV A;  4QTI U;  4BIK B;  1S4Y A;  1CHV S;  2LCR A;  3NH7 A;  2MHY A;  1LJZ A;  2H62 D;  1ES7 B;  1IQ9 A;  2QC1 A;  2HLQ A;  1KTZ B;  1G6M A;  1JGK A;  2L03 A;  1IDH A;  2H64 C;  1H0J A;  1TXB A;  1HC9 B;  1BTE A;  1CXN A;  1CXO A;  5IMY C;  1COD A;  3KFD E;  3EBX A;  4HQP F;  1LXH A;  1CRF A;  1ABT A;  1KBT A;  2H64 B;  2H7Z B;  2MJY A;  1FSS B;  1JBD A;  1UG4 A;  1HOY A;  1YWH A;  5DO6 A;  1FAS A;  3ERA A;  3HH7 A;  3QB4 B;  1HAJ A;  1KXI A;  1DRS A;  1NYS A;  1L4W A;  1CRE A;  2H62 C;  1V6P A;  1COE A;  4EY8 B;  1LXG A;  5EBX A;  2L5S A;  2QJA C; 
#chains in the Genus database with same CATH homology
 2VLW A;  1IDG A;  2PJY C;  2UWR A;  2JVE A;  2OFS A;  2FD6 U;  1FF4 A;  1LX5 B;  3KFD I;  4BDT B;  1BXP A;  1JE9 A;  1FSC A;  1LSI A;  5DZ5 A;  1ERA A;  1KU6 B;  1KC4 A;  2PJY B;  3U74 U;  3BT1 U;  1FRA A;  1M9Z A;  1I02 A;  2CDX A;  2GOO B;  2X8B B;  1REW C;  1CDS A;  2CRS A;  2UX2 A;  1CDQ A;  1KBS A;  2N99 A;  2I9B E;  1W6B A;  1VB0 A;  3NDS A;  2J8B A;  2MUO A;  2MUP A;  1CVO A;  1NTX A;  2BTX A;  1NXB A;  4P7U A;  1KL8 A;  1CB9 A;  3NEQ A;  2K3G A;  2H8U A;  1TXA A;  4DO8 A;  1ONJ A;  1NTN A;  1MR6 A;  1IJC A;  1RGJ A;  4XJJ A;  1FFJ A;  1ERG A;  2GOO C;  5IMT D;  2LA1 A;  6EBX A;  1CDT A;  1QKE A;  1RL5 A;  1QM7 A;  2NBT A;  2CCX A;  4FAO C;  1CCQ A;  2QJB C;  1PLO A;  1KS6 A;  1NYU A;  1QKD A;  2CTX A;  1CDR A;  1MAH F;  2MJ4 A;  1KBA A;  4FAO E;  4ZQY A;  1B41 B;  1HC9 A;  3U73 U;  2CRT A;  1HAA A;  2QJ9 C;  1NEA A;  3PLC A;  1ZAD A;  1IK8 A;  1F8U B;  1XT3 A;  4LFT A;  2MFA A;  3VTS A;  2ABX A;  4OM5 A;  2H7Z A;  4AEA A;  5DU1 A;  4UY2 C;  1KFH A;  4KSN A;  3BT2 U;  4OM4 A;  1IKC A;  2MJ0 A;  2ERA A;  1TGX A;  3LAQ U;  4RUD A;  3EVS C;  2JQP A;  4IYE A;  1NOR A;  1CTX A;  1IDI A;  1TFS A;  1IDL A;  1F94 A;  2H5F A;  2HLR A;  2BHI A;  3FEV A;  4QTI U;  4BIK B;  1S4Y A;  1CHV S;  2LCR A;  3NH7 A;  2MHY A;  1LJZ A;  2H62 D;  1ES7 B;  1IQ9 A;  2QC1 A;  2HLQ A;  1KTZ B;  1G6M A;  1JGK A;  2L03 A;  1IDH A;  2H64 C;  1H0J A;  1TXB A;  1HC9 B;  1BTE A;  1CXN A;  1CXO A;  5IMY C;  1COD A;  3KFD E;  3EBX A;  4HQP F;  1LXH A;  1CRF A;  1ABT A;  1KBT A;  2H64 B;  2H7Z B;  2MJY A;  1FSS B;  1JBD A;  1UG4 A;  1HOY A;  1YWH A;  5DO6 A;  1FAS A;  3ERA A;  3HH7 A;  3QB4 B;  1HAJ A;  1KXI A;  1DRS A;  1NYS A;  1L4W A;  1CRE A;  2H62 C;  1V6P A;  1COE A;  4EY8 B;  1LXG A;  5EBX A;  2L5S A;  2QJA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...