2NBVA

Solution structure of the rpn13 pru domain engaging the hplic2 ubl domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
b'KYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2nbvA00
2KR0A 2Z59A 2R2YA 5IRSA 2NBVA 2Z4DA
chains in the Genus database with same CATH superfamily
4K2OA 3HSAA 2W2XC 1X11A 1W1HA 2DHKA 2P0FA 4DX8A 3O96A 5I2MA 1LB1A 3BINA 2KIGA 4WSFA 1XCGA 2H7DA 3FSSA 1X05A 2R0DA 4EMOA 1P6SA 2NBVA 2X18A 4HDOA 3V5WA 4QJ4B 3U12A 2FJUB 2D9YA 1U2BA 3PZDA 3TFMA 5J3YA 5JP4A 1UNQA 2CY5A 2DTCA 1J19A 1GG3A 1U5EA 1MKEA 4Z2MB 1RRPB 3GYPA 4F7GA 1E5WA 4TKNA 2IFSA 1QC6A 3ULCA 1OMWA 2KIEA 4CHJA 4F7HA 5GOWB 2DN6A 2DKQA 1PFJA 3FEHA 1WJMA 4HAVB 5FI0A 2N23A 1N3HA 1UNRA 5D3WA 2KUQA 4K81A 1AWEA 2RRFA 2AEHA 1XODA 2YT1A 3RCPA 3KY9A 1Z87A 2J59M 3NWFA 2W2XD 2ZPYA 4GN1A 2DKPA 2EC1A 5LONB 1AQCA 3NWDA 4HAZB 4GNKB 4QJ5B 4TYZA 1ISNA 2DYNA 4GMVA 3ZDTA 2Z13A 4K2PA 2DA0A 3HQCA 3PVUA 1EGXA 1H10A 3MPXA 1X1GA 4C0AA 5DH9B 2DHIA 2K2UA 2RUKB 2Z0QA 5D3YA 5D3VA 1XR0B 3TCAA 5D3XA 4HATB 3A8QA 2I1JA 1MIXA 4IFSA 2COCA 1TJ6A 1WVHA 4HAXB 3NWAA 1DYNA 2D9ZA 2J0KA 2QKLA 3UZTA 1W1GA 2W2WA 1DDWA 3PG7A 4H8SA 3FVCA 1EF1A 1UPRA 5C5BA 1FGZA 3WYFB 4KAXB 2YS3A 4IAPA 1U5FA 2YS1A 3P7ZA 2J0MA 2D9WA 5C6RA 1FB8A 1U27A 5KQ4A 4DXAB 3ZVRA 3TVVA 3HW2B 4OSNA 4CYEA 3X23A 5DHFB 2ROVA 4BBKA 2UZRA 2R2YA 5M4YB 5LG4B 3F0WA 2OTXA 2IYBA 3SNHA 4L1RA 2D4QA 2ADZA 1BTKA 3D8EA 5C5BB 2L2IA 5DI9B 4GPTB 1XX0A 1PMSA 3T06A 2Z59A 5D27A 2P8VA 4XWXA 5LOPB 2OQBA 3G9WA 5JHHA 2AL6A 4HDQA 2I5CA 1BWNA 3DXCA 5IRSA 3PEGA 1X1FA 2R09A 2J0JA 1FAOA 4A6KA 4HB2B 1T77A 2GS0A 4MK0A 1I2HA 1NI2A 2M14A 4HAYB 2M38A 3U7DA 2EMTA 2QKMA 4KHAA 1P3RA 1U5GA 2RSGA 2K00A 1V5PA 2I5FA 2LG1A 2RVBB 4HSIA 2NMBA 3QIJA 4ZRIA 4KHBA 2ZKMX 3HIEA 5J3TA 3M1IB 1K5GB 4QXAB 3KZ1A 3DXEA 5KQ1A 2V76A 1V5MA 4ZRKA 1I7AA 3WA0A 3N7CA 1IRSA 2YT0A 5KCVA 4CSQA 1P5TA 4PNKA 4DBBA 3VIAA 4YONA 1QQGA 2D10A 1KI1B 1XKEA 2VRWB 2YS5A 2P0HA 1DROA 1LW3A 1ZYIA 2GUMA 3D8FA 4Y94A 1J0WA 1MIZB 1WG7A 4WJ7A 1Q67A 4HAUB 3AU5A 1WJ1A 3F5RA 2D11A 2D9VA 2EMSA 1ZSQA 3ODXA 4KHBB 4MY6A 4HHVA 3D8DA 5FI1A 2DX1A 1SGHA 5JHGA 3FM8C 1UEFA 4WVFB 1B55A 4GXBA 1M7RA 2I1KA 4Z2NA 3U8ZA 3NW8A 2RNRB 3PVWA 5L81A 1U5DA 5JLJB 2Q13A 5DIFB 4P7IA 3KRXA 2ELBA 4EKUA 1V89A 2LOZA 2VKIA 5HE0A 2JP2A 2Z4DA 2BCJA 2DFKA 2GCLA 3DCXA 4DIXA 2COAA 2D9XA 3CXBB 2CODA 3LJUX 3IVFA 3A98B 5C79A 2LULA 4GMXB 1V88A 1U29A 4K17A 2P0DA 1RJ2A 1BAKA 1ZC4B 2D2QA 3SO6A 2MWNB 2PZ1A 3QWMA 4NSWA 4YL8A 1W1DA 1UNPA 2MFQA 2UVMA 4HB0B 3PSCA 2RGNB 3P6AA 3TW1A 5EFXA 2HE7A 5CLLB 3NSUA 3OHMB 2ELAA 1FHXA 3SUZA 4A6HA 1WGQA 2DLWA 2YT2A 2Y8FA 3AU4A 3ODOA 4HB3B 2Z14A 3HK0A 2LKOA 4D0NB 4HB4B 5I2SA 3KRWA 2GJYA 2DHJA 4ZRJA 1GC6A 2CY4A 1FHWA 3SV1A 1EVHA 5C16A 3QBVB 5CLQB 4EJNA 3OANA 1KZGA 2Y7BA 3PP2A 1MI1A 5HE2A 3ML4A 4A5KA 2N0YA 1FGYA 2LYDA 3ODWA 3MDBC 4GZUA 3KSYA 5HE1A 2XQNM 2GCJA 1UPQA 1X86A 2MKRA 2Z0OA 4PQ0A 4F7UP 3A8PA 4NY0A 3B77A 2KGXB 2Y8GA 4GOUA 1TQZA 2E2XA 4IOYX 2NZ8B 3CIKA 2Z0PA 4DX90 3A58A 1ZM0A 1EAZA 1PLSA 4CHMA 1NTVA 2YVCA 1H4RA 1OQNA 2YF0A 1MAIA 1DDVA 2FJLA 5DHAB 2YSZA 3BJIA 1MK7B 5HE3A 4L6EA 3SYXA 4B6HA 2K2JA 1OY2A 1FHOA 1ZC3B 1Y5OA 4KVGB 3VOQA 1NTYA 2VSZA 2HTHB 1ZVRA 2LOXA 4KHOA 2H7EA 1MK9B 3GYOA 2EJ8A 4D6WA 1FOEA 4QJ3B 4A6FA 2KCJA 2DX5A 3PVLA 3AJ4A 2ROZB 1Y19B 1KZ7A 2RLOA 1MPHA 1WI1A 1M7EA 2K8EA 2KR0A 2KUPA 1TXDA 4HAWB 4OT1A 3TO1A 1K5DB 2DYQA 1XD4A 4MT7A 1DBHA 1V61A 1V5UA 2L1CA 2MDXA 1DDMA 2YRYA 2K49A 1BTNA 2CRFA 2G35A 1WGUA 3DXDA 4A6FB 2UZSA 2COFA 2CAYA 5J3QA 1GC7A 3ULBA 1NU2A 1SHCA
chains in the Genus database with same CATH topology
3TO1A 2Z14A 2RRFA 3GYOA 4QXAB 4D6WA 5I2SA 4Z2MB 3NWFA 4QJ3B 4KHAA 5I2MA 4IFSA 2GCJA 3GYPA 4KHBB 4CSQA 2Z59A 3NWAA 4PQ0A 5IRSA 2KIGA 3NWDA 3TVVA 2Z4DA 2GCLA 2KIEA 4DIXA 4GNKB 3TW1A 4QJ5B 4OSNA 3FVCA 3FSSA 2K49A 1ZYIA 2NBVA 2GUMA 2K8EA 4GOUA 4HSIA 4QJ4B 2R2YA 3U12A 2FJUB 2KR0A 3OHMB 4Z2NA 4KHBA 2ZKMX 3HIEA 5LG4B 5M4YB 2Z13A 4IOYX 2YT2A 3NW8A 4OT1A 4L1RA 3A58A 2KUQA 4KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR0 A;  2Z59 A;  2R2Y A;  5IRS A;  2NBV A;  2Z4D A; 
#chains in the Genus database with same CATH topology
 4K2O A;  3HSA A;  2W2X C;  1X11 A;  1W1H A;  2DHK A;  2P0F A;  4DX8 A;  3O96 A;  5I2M A;  1LB1 A;  3BIN A;  2KIG A;  4WSF A;  1XCG A;  2H7D A;  3FSS A;  1X05 A;  2R0D A;  4EMO A;  1P6S A;  2NBV A;  2X18 A;  4HDO A;  3V5W A;  4QJ4 B;  3U12 A;  2FJU B;  2D9Y A;  1U2B A;  3PZD A;  3TFM A;  5J3Y A;  5JP4 A;  1UNQ A;  2CY5 A;  2DTC A;  1J19 A;  1GG3 A;  1U5E A;  1MKE A;  4Z2M B;  1RRP B;  3GYP A;  4F7G A;  1E5W A;  4TKN A;  2IFS A;  1QC6 A;  3ULC A;  1OMW A;  2KIE A;  4CHJ A;  4F7H A;  5GOW B;  2DN6 A;  2DKQ A;  1PFJ A;  3FEH A;  1WJM A;  4HAV B;  5FI0 A;  2N23 A;  1N3H A;  1UNR A;  5D3W A;  2KUQ A;  4K81 A;  1AWE A;  2RRF A;  2AEH A;  1XOD A;  2YT1 A;  3RCP A;  3KY9 A;  1Z87 A;  2J59 M;  3NWF A;  2W2X D;  2ZPY A;  4GN1 A;  2DKP A;  2EC1 A;  5LON B;  1AQC A;  3NWD A;  4HAZ B;  4GNK B;  4QJ5 B;  4TYZ A;  1ISN A;  2DYN A;  4GMV A;  3ZDT A;  2Z13 A;  4K2P A;  2DA0 A;  3HQC A;  3PVU A;  1EGX A;  1H10 A;  3MPX A;  1X1G A;  4C0A A;  5DH9 B;  2DHI A;  2K2U A;  2RUK B;  2Z0Q A;  5D3Y A;  5D3V A;  1XR0 B;  3TCA A;  5D3X A;  4HAT B;  3A8Q A;  2I1J A;  1MIX A;  4IFS A;  2COC A;  1TJ6 A;  1WVH A;  4HAX B;  3NWA A;  1DYN A;  2D9Z A;  2J0K A;  2QKL A;  3UZT A;  1W1G A;  2W2W A;  1DDW A;  3PG7 A;  4H8S A;  3FVC A;  1EF1 A;  1UPR A;  5C5B A;  1FGZ A;  3WYF B;  4KAX B;  2YS3 A;  4IAP A;  1U5F A;  2YS1 A;  3P7Z A;  2J0M A;  2D9W A;  5C6R A;  1FB8 A;  1U27 A;  5KQ4 A;  4DXA B;  3ZVR A;  3TVV A;  3HW2 B;  4OSN A;  4CYE A;  3X23 A;  5DHF B;  2ROV A;  4BBK A;  2UZR A;  2R2Y A;  5M4Y B;  5LG4 B;  3F0W A;  2OTX A;  2IYB A;  3SNH A;  4L1R A;  2D4Q A;  2ADZ A;  1BTK A;  3D8E A;  5C5B B;  2L2I A;  5DI9 B;  4GPT B;  1XX0 A;  1PMS A;  3T06 A;  2Z59 A;  5D27 A;  2P8V A;  4XWX A;  5LOP B;  2OQB A;  3G9W A;  5JHH A;  2AL6 A;  4HDQ A;  2I5C A;  1BWN A;  3DXC A;  5IRS A;  3PEG A;  1X1F A;  2R09 A;  2J0J A;  1FAO A;  4A6K A;  4HB2 B;  1T77 A;  2GS0 A;  4MK0 A;  1I2H A;  1NI2 A;  2M14 A;  4HAY B;  2M38 A;  3U7D A;  2EMT A;  2QKM A;  4KHA A;  1P3R A;  1U5G A;  2RSG A;  2K00 A;  1V5P A;  2I5F A;  2LG1 A;  2RVB B;  4HSI A;  2NMB A;  3QIJ A;  4ZRI A;  4KHB A;  2ZKM X;  3HIE A;  5J3T A;  3M1I B;  1K5G B;  4QXA B;  3KZ1 A;  3DXE A;  5KQ1 A;  2V76 A;  1V5M A;  4ZRK A;  1I7A A;  3WA0 A;  3N7C A;  1IRS A;  2YT0 A;  5KCV A;  4CSQ A;  1P5T A;  4PNK A;  4DBB A;  3VIA A;  4YON A;  1QQG A;  2D10 A;  1KI1 B;  1XKE A;  2VRW B;  2YS5 A;  2P0H A;  1DRO A;  1LW3 A;  1ZYI A;  2GUM A;  3D8F A;  4Y94 A;  1J0W A;  1MIZ B;  1WG7 A;  4WJ7 A;  1Q67 A;  4HAU B;  3AU5 A;  1WJ1 A;  3F5R A;  2D11 A;  2D9V A;  2EMS A;  1ZSQ A;  3ODX A;  4KHB B;  4MY6 A;  4HHV A;  3D8D A;  5FI1 A;  2DX1 A;  1SGH A;  5JHG A;  3FM8 C;  1UEF A;  4WVF B;  1B55 A;  4GXB A;  1M7R A;  2I1K A;  4Z2N A;  3U8Z A;  3NW8 A;  2RNR B;  3PVW A;  5L81 A;  1U5D A;  5JLJ B;  2Q13 A;  5DIF B;  4P7I A;  3KRX A;  2ELB A;  4EKU A;  1V89 A;  2LOZ A;  2VKI A;  5HE0 A;  2JP2 A;  2Z4D A;  2BCJ A;  2DFK A;  2GCL A;  3DCX A;  4DIX A;  2COA A;  2D9X A;  3CXB B;  2COD A;  3LJU X;  3IVF A;  3A98 B;  5C79 A;  2LUL A;  4GMX B;  1V88 A;  1U29 A;  4K17 A;  2P0D A;  1RJ2 A;  1BAK A;  1ZC4 B;  2D2Q A;  3SO6 A;  2MWN B;  2PZ1 A;  3QWM A;  4NSW A;  4YL8 A;  1W1D A;  1UNP A;  2MFQ A;  2UVM A;  4HB0 B;  3PSC A;  2RGN B;  3P6A A;  3TW1 A;  5EFX A;  2HE7 A;  5CLL B;  3NSU A;  3OHM B;  2ELA A;  1FHX A;  3SUZ A;  4A6H A;  1WGQ A;  2DLW A;  2YT2 A;  2Y8F A;  3AU4 A;  3ODO A;  4HB3 B;  2Z14 A;  3HK0 A;  2LKO A;  4D0N B;  4HB4 B;  5I2S A;  3KRW A;  2GJY A;  2DHJ A;  4ZRJ A;  1GC6 A;  2CY4 A;  1FHW A;  3SV1 A;  1EVH A;  5C16 A;  3QBV B;  5CLQ B;  4EJN A;  3OAN A;  1KZG A;  2Y7B A;  3PP2 A;  1MI1 A;  5HE2 A;  3ML4 A;  4A5K A;  2N0Y A;  1FGY A;  2LYD A;  3ODW A;  3MDB C;  4GZU A;  3KSY A;  5HE1 A;  2XQN M;  2GCJ A;  1UPQ A;  1X86 A;  2MKR A;  2Z0O A;  4PQ0 A;  4F7U P;  3A8P A;  4NY0 A;  3B77 A;  2KGX B;  2Y8G A;  4GOU A;  1TQZ A;  2E2X A;  4IOY X;  2NZ8 B;  3CIK A;  2Z0P A;  4DX9 0;  3A58 A;  1ZM0 A;  1EAZ A;  1PLS A;  4CHM A;  1NTV A;  2YVC A;  1H4R A;  1OQN A;  2YF0 A;  1MAI A;  1DDV A;  2FJL A;  5DHA B;  2YSZ A;  3BJI A;  1MK7 B;  5HE3 A;  4L6E A;  3SYX A;  4B6H A;  2K2J A;  1OY2 A;  1FHO A;  1ZC3 B;  1Y5O A;  4KVG B;  3VOQ A;  1NTY A;  2VSZ A;  2HTH B;  1ZVR A;  2LOX A;  4KHO A;  2H7E A;  1MK9 B;  3GYO A;  2EJ8 A;  4D6W A;  1FOE A;  4QJ3 B;  4A6F A;  2KCJ A;  2DX5 A;  3PVL A;  3AJ4 A;  2ROZ B;  1Y19 B;  1KZ7 A;  2RLO A;  1MPH A;  1WI1 A;  1M7E A;  2K8E A;  2KR0 A;  2KUP A;  1TXD A;  4HAW B;  4OT1 A;  3TO1 A;  1K5D B;  2DYQ A;  1XD4 A;  4MT7 A;  1DBH A;  1V61 A;  1V5U A;  2L1C A;  2MDX A;  1DDM A;  2YRY A;  2K49 A;  1BTN A;  2CRF A;  2G35 A;  1WGU A;  3DXD A;  4A6F B;  2UZS A;  2COF A;  2CAY A;  5J3Q A;  1GC7 A;  3ULB A;  1NU2 A;  1SHC A; 
#chains in the Genus database with same CATH homology
 3TO1 A;  2Z14 A;  2RRF A;  3GYO A;  4QXA B;  4D6W A;  5I2S A;  4Z2M B;  3NWF A;  4QJ3 B;  4KHA A;  5I2M A;  4IFS A;  2GCJ A;  3GYP A;  4KHB B;  4CSQ A;  2Z59 A;  3NWA A;  4PQ0 A;  5IRS A;  2KIG A;  3NWD A;  3TVV A;  2Z4D A;  2GCL A;  2KIE A;  4DIX A;  4GNK B;  3TW1 A;  4QJ5 B;  4OSN A;  3FVC A;  3FSS A;  2K49 A;  1ZYI A;  2NBV A;  2GUM A;  2K8E A;  4GOU A;  4HSI A;  4QJ4 B;  2R2Y A;  3U12 A;  2FJU B;  2KR0 A;  3OHM B;  4Z2N A;  4KHB A;  2ZKM X;  3HIE A;  5LG4 B;  5M4Y B;  2Z13 A;  4IOY X;  2YT2 A;  3NW8 A;  4OT1 A;  4L1R A;  3A58 A;  2KUQ A;  4KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...