2NBVA

Solution structure of the rpn13 pru domain engaging the hplic2 ubl domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
KYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
total genus 26
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2nbvA00
2NBVA 2Z4DA 2R2YA 2Z59A 2KR0A 5IRSA
chains in the Genus database with same CATH superfamily
2NBVA 2PZ1A 4HB2B 3SNHA 5C79A 2ELBA 5GOWB 2DHJA 3HIEA 2LULA 3ULCA 2RSGA 4A6FB 2L2IA 3NWDA 3IVFA 2MDXA 3PVWA 1UPRA 2D9WA 4GOUA 4L1RA 1U5GA 1I2HA 4MY6A 3U8ZA 3KY9A 2MKRA 4DX90 2LKOA 1X1GA 1X86A 3HSAA 1WJ1A 5C6RA 4B6HA 2R09A 5M4YB 2KIGA 5CLLB 1K5GB 3TW1A 4DX8A 3U12A 5LOPB 2Y8FA 2EMTA 4A5KA 3BINA 3PZDA 5JHHA 5KCVA 4K81A 4PQ0A 1KI1B 1XD4A 1QQGA 2HE7A 2QKMA 4K2OA 4DIXA 2COFA 4KHBB 3RCPA 1U29A 2P0FA 1U5DA 2COCA 3PP2A 2YS1A 2H7DA 3QIJA 2Z59A 2D9YA 2I1KA 5EFXA 3DXCA 1EVHA 1M7RA 1DDWA 2YS3A 3HW2B 1MIZB 3G9WA 3PG7A 2YRYA 3V5WA 2VSZA 2J0MA 1DBHA 1W1HA 2E2XA 3X23A 1X1FA 2JP2A 2M14A 2Y7BA 3VIAA 3M1IB 4IFSA 3UZTA 3KZ1A 3TCAA 3BJIA 2DKPA 2YF0A 2RNRB 5J3TA 2DLWA 1MAIA 4HB0B 3PEGA 1KZGA 3P7ZA 3SYXA 4QJ4B 4GZUA 3WYFB 5D3YA 4HDOA 2LYDA 2DKQA 3KRWA 3NWAA 3TO1A 3FVCA 2ROVA 1ZSQA 2VKIA 2CRFA 4TKNA 1MK7B 2KIEA 4KVGB 4D6WA 2LOXA 1EGXA 1ZC4B 2CY4A 4GXBA 1OMWA 5DH9B 1W1GA 1XODA 4HAUB 2K2JA 2NMBA 2Z0OA 2UVMA 3NSUA 5I2MA 4QXAB 1N3HA 5L81A 3A58A 4HB4B 1U2BA 1ISNA 1Z87A 5J3YA 3FEHA 1AQCA 1H4RA 1E5WA 4K2PA 1RRPB 1QC6A 2DHIA 3KSYA 4MK0A 3FM8C 1PLSA 1WG7A 4OSNA 4C0AA 2DFKA 2UZRA 1Y5OA 3QWMA 4GPTB 4CHMA 2DX5A 3SUZA 1AWEA 2YT1A 1GC6A 4GMXB 5C16A 1FGZA 4D0NB 1Y19B 4K17A 2YVCA 2D2QA 4H8SA 1PFJA 2CY5A 4HATB 5JHGA 4WSFA 3PVLA 2DTCA 4Z2MB 2EC1A 4ZRIA 2D11A 4F7HA 3ODWA 4IAPA 3O96A 5HE3A 3ODXA 5C5BB 4F7GA 1BTKA 4EJNA 5DHFB 4OT1A 1BAKA 1XCGA 3D8DA 5D3WA 1WI1A 4QJ5B 1ZVRA 2K00A 4GNKB 4DBBA 2I5FA 3P6AA 5HE2A 1U5EA 2DN6A 2J59M 1UNQA 2DYNA 2RVBB 2D4QA 3T06A 1BTNA 1V5MA 2YSZA 2KR0A 1EAZA 4ZRKA 2K49A 2J0JA 3A98B 2HTHB 3F5RA 3N7CA 1ZM0A 5D3XA 1UEFA 1V88A 2G35A 1UPQA 1UNPA 4MT7A 1V5UA 4CYEA 3AJ4A 1T77A 4GN1A 2FJLA 1V89A 4NSWA 5LONB 1GG3A 3ZVRA 1J0WA 4CSQA 2V76A 4BBKA 3ML4A 1MPHA 1NTVA 1NTYA 2Z4DA 4XWXA 4A6FA 3PVUA 4F7UP 2DYQA 5JLJB 1ZC3B 2ELAA 2DX1A 1W1DA 2KUPA 2IYBA 4QJ3B 2Z0PA 2N0YA 4A6HA 4PNKA 1V5PA 4TYZA 2RLOA 2KUQA 2K8EA 2GS0A 4YONA 1DDVA 5KQ1A 1NI2A 3TFMA 1DDMA 2DA0A 1TXDA 3CXBB 1TJ6A 3QBVB 4KHOA 3ULBA 2GCLA 1XR0B 5DHAB 2MFQA 2MWNB 1FOEA 2ZPYA 2OQBA 1OQNA 4L6EA 3SV1A 1MI1A 5I2SA 2Z13A 1P3RA 3FSSA 4Z2NA 3DXDA 1XX0A 5LG4B 1X05A 2R2YA 2NZ8B 1LW3A 1IRSA 1Q67A 4A6KA 3AU4A 1MKEA 2P0DA 1FHOA 3D8FA 5IRSA 3DXEA 2ADZA 3NWFA 4GMVA 2YS5A 1TQZA 1DYNA 1MK9B 2YT2A 1XKEA 2BCJA 5HE1A 2D10A 2J0KA 2N23A 3NW8A 4HAYB 5CLQB 4KHBA 3A8QA 5D3VA 3ODOA 4HAVB 2H7EA 3OANA 2LG1A 5HE0A 3SO6A 5DI9B 5C5BA 2M38A 2GJYA 4WJ7A 4YL8A 4KHAA 2ROZB 1WJMA 2LOZA 2Y8GA 1P5TA 1KZ7A 4HB3B 3HK0A 2Z14A 2Q13A 2W2WA 2VRWB 4KAXB 3MPXA 3MDBC 1GC7A 3GYOA 4HHVA 5FI1A 2CODA 1WGUA 4ZRJA 1B55A 2FJUB 3D8EA 1FB8A 4HAZB 2OTXA 1M7EA 1SGHA 2RRFA 1MIXA 1BWNA 1J19A 2X18A 3TVVA 4WVFB 2CAYA 2K2UA 3GYPA 4HSIA 2P8VA 2I5CA 2Z0QA 1RJ2A 2P0HA 2DHKA 1FAOA 1H10A 3KRXA 5KQ4A 1FHWA 3OHMB 1K5DB 3CIKA 1SHCA 2KGXB 2YT0A 1V61A 3U7DA 2L1CA 1FGYA 4P7IA 2UZSA 1LB1A 2COAA 2ZKMX 4EKUA 1PMSA 2IFSA 2W2XD 5JP4A 2GUMA 1U27A 4IOYX 3A8PA 3WA0A 5DIFB 2RUKB 2EJ8A 2EMSA 2R0DA 5D27A 3PSCA 1U5FA 4DXAB 4CHJA 2AEHA 1UNRA 4NY0A 5FI0A 1EF1A 2D9XA 2I1JA 1P6SA 1I7AA 2XQNM 2D9ZA 4HDQA 1ZYIA 4HAXB 3B77A 4HAWB 3F0WA 2AL6A 2D9VA 5J3QA 1NU2A 3HQCA 1OY2A 3DCXA 2GCJA 2QKLA 1WGQA 1X11A 3VOQA 1FHXA 4EMOA 2KCJA 3AU5A 4Y94A 1WVHA 1DROA 2RGNB 3ZDTA 3LJUX 2W2XC
chains in the Genus database with same CATH topology
2GUMA 2NBVA 4QJ5B 5I2SA 4QJ3B 2KIEA 4IOYX 2Z13A 4KHBB 4GNKB 2Z14A 1ZYIA 4IFSA 3FSSA 4D6WA 3NW8A 4Z2NA 4KHBA 2KUQA 2K8EA 5LG4B 4Z2MB 3HIEA 2R2YA 3OHMB 2Z59A 5M4YB 2KIGA 3GYOA 4OSNA 2GCJA 3TW1A 4QJ4B 4CSQA 2FJUB 3U12A 3NWDA 4KHAA 4KHOA 2KR0A 2GCLA 4QXAB 5I2MA 5IRSA 2RRFA 2Z4DA 3NWFA 4L1RA 4GOUA 3A58A 2ZKMX 2K49A 3NWAA 3TVVA 3TO1A 4OT1A 4PQ0A 3FVCA 2YT2A 3GYPA 4HSIA 4DIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBV A;  2Z4D A;  2R2Y A;  2Z59 A;  2KR0 A;  5IRS A; 
#chains in the Genus database with same CATH topology
 2NBV A;  2PZ1 A;  4HB2 B;  3SNH A;  5C79 A;  2ELB A;  5GOW B;  2DHJ A;  3HIE A;  2LUL A;  3ULC A;  2RSG A;  4A6F B;  2L2I A;  3NWD A;  3IVF A;  2MDX A;  3PVW A;  1UPR A;  2D9W A;  4GOU A;  4L1R A;  1U5G A;  1I2H A;  4MY6 A;  3U8Z A;  3KY9 A;  2MKR A;  4DX9 0;  2LKO A;  1X1G A;  1X86 A;  3HSA A;  1WJ1 A;  5C6R A;  4B6H A;  2R09 A;  5M4Y B;  2KIG A;  5CLL B;  1K5G B;  3TW1 A;  4DX8 A;  3U12 A;  5LOP B;  2Y8F A;  2EMT A;  4A5K A;  3BIN A;  3PZD A;  5JHH A;  5KCV A;  4K81 A;  4PQ0 A;  1KI1 B;  1XD4 A;  1QQG A;  2HE7 A;  2QKM A;  4K2O A;  4DIX A;  2COF A;  4KHB B;  3RCP A;  1U29 A;  2P0F A;  1U5D A;  2COC A;  3PP2 A;  2YS1 A;  2H7D A;  3QIJ A;  2Z59 A;  2D9Y A;  2I1K A;  5EFX A;  3DXC A;  1EVH A;  1M7R A;  1DDW A;  2YS3 A;  3HW2 B;  1MIZ B;  3G9W A;  3PG7 A;  2YRY A;  3V5W A;  2VSZ A;  2J0M A;  1DBH A;  1W1H A;  2E2X A;  3X23 A;  1X1F A;  2JP2 A;  2M14 A;  2Y7B A;  3VIA A;  3M1I B;  4IFS A;  3UZT A;  3KZ1 A;  3TCA A;  3BJI A;  2DKP A;  2YF0 A;  2RNR B;  5J3T A;  2DLW A;  1MAI A;  4HB0 B;  3PEG A;  1KZG A;  3P7Z A;  3SYX A;  4QJ4 B;  4GZU A;  3WYF B;  5D3Y A;  4HDO A;  2LYD A;  2DKQ A;  3KRW A;  3NWA A;  3TO1 A;  3FVC A;  2ROV A;  1ZSQ A;  2VKI A;  2CRF A;  4TKN A;  1MK7 B;  2KIE A;  4KVG B;  4D6W A;  2LOX A;  1EGX A;  1ZC4 B;  2CY4 A;  4GXB A;  1OMW A;  5DH9 B;  1W1G A;  1XOD A;  4HAU B;  2K2J A;  2NMB A;  2Z0O A;  2UVM A;  3NSU A;  5I2M A;  4QXA B;  1N3H A;  5L81 A;  3A58 A;  4HB4 B;  1U2B A;  1ISN A;  1Z87 A;  5J3Y A;  3FEH A;  1AQC A;  1H4R A;  1E5W A;  4K2P A;  1RRP B;  1QC6 A;  2DHI A;  3KSY A;  4MK0 A;  3FM8 C;  1PLS A;  1WG7 A;  4OSN A;  4C0A A;  2DFK A;  2UZR A;  1Y5O A;  3QWM A;  4GPT B;  4CHM A;  2DX5 A;  3SUZ A;  1AWE A;  2YT1 A;  1GC6 A;  4GMX B;  5C16 A;  1FGZ A;  4D0N B;  1Y19 B;  4K17 A;  2YVC A;  2D2Q A;  4H8S A;  1PFJ A;  2CY5 A;  4HAT B;  5JHG A;  4WSF A;  3PVL A;  2DTC A;  4Z2M B;  2EC1 A;  4ZRI A;  2D11 A;  4F7H A;  3ODW A;  4IAP A;  3O96 A;  5HE3 A;  3ODX A;  5C5B B;  4F7G A;  1BTK A;  4EJN A;  5DHF B;  4OT1 A;  1BAK A;  1XCG A;  3D8D A;  5D3W A;  1WI1 A;  4QJ5 B;  1ZVR A;  2K00 A;  4GNK B;  4DBB A;  2I5F A;  3P6A A;  5HE2 A;  1U5E A;  2DN6 A;  2J59 M;  1UNQ A;  2DYN A;  2RVB B;  2D4Q A;  3T06 A;  1BTN A;  1V5M A;  2YSZ A;  2KR0 A;  1EAZ A;  4ZRK A;  2K49 A;  2J0J A;  3A98 B;  2HTH B;  3F5R A;  3N7C A;  1ZM0 A;  5D3X A;  1UEF A;  1V88 A;  2G35 A;  1UPQ A;  1UNP A;  4MT7 A;  1V5U A;  4CYE A;  3AJ4 A;  1T77 A;  4GN1 A;  2FJL A;  1V89 A;  4NSW A;  5LON B;  1GG3 A;  3ZVR A;  1J0W A;  4CSQ A;  2V76 A;  4BBK A;  3ML4 A;  1MPH A;  1NTV A;  1NTY A;  2Z4D A;  4XWX A;  4A6F A;  3PVU A;  4F7U P;  2DYQ A;  5JLJ B;  1ZC3 B;  2ELA A;  2DX1 A;  1W1D A;  2KUP A;  2IYB A;  4QJ3 B;  2Z0P A;  2N0Y A;  4A6H A;  4PNK A;  1V5P A;  4TYZ A;  2RLO A;  2KUQ A;  2K8E A;  2GS0 A;  4YON A;  1DDV A;  5KQ1 A;  1NI2 A;  3TFM A;  1DDM A;  2DA0 A;  1TXD A;  3CXB B;  1TJ6 A;  3QBV B;  4KHO A;  3ULB A;  2GCL A;  1XR0 B;  5DHA B;  2MFQ A;  2MWN B;  1FOE A;  2ZPY A;  2OQB A;  1OQN A;  4L6E A;  3SV1 A;  1MI1 A;  5I2S A;  2Z13 A;  1P3R A;  3FSS A;  4Z2N A;  3DXD A;  1XX0 A;  5LG4 B;  1X05 A;  2R2Y A;  2NZ8 B;  1LW3 A;  1IRS A;  1Q67 A;  4A6K A;  3AU4 A;  1MKE A;  2P0D A;  1FHO A;  3D8F A;  5IRS A;  3DXE A;  2ADZ A;  3NWF A;  4GMV A;  2YS5 A;  1TQZ A;  1DYN A;  1MK9 B;  2YT2 A;  1XKE A;  2BCJ A;  5HE1 A;  2D10 A;  2J0K A;  2N23 A;  3NW8 A;  4HAY B;  5CLQ B;  4KHB A;  3A8Q A;  5D3V A;  3ODO A;  4HAV B;  2H7E A;  3OAN A;  2LG1 A;  5HE0 A;  3SO6 A;  5DI9 B;  5C5B A;  2M38 A;  2GJY A;  4WJ7 A;  4YL8 A;  4KHA A;  2ROZ B;  1WJM A;  2LOZ A;  2Y8G A;  1P5T A;  1KZ7 A;  4HB3 B;  3HK0 A;  2Z14 A;  2Q13 A;  2W2W A;  2VRW B;  4KAX B;  3MPX A;  3MDB C;  1GC7 A;  3GYO A;  4HHV A;  5FI1 A;  2COD A;  1WGU A;  4ZRJ A;  1B55 A;  2FJU B;  3D8E A;  1FB8 A;  4HAZ B;  2OTX A;  1M7E A;  1SGH A;  2RRF A;  1MIX A;  1BWN A;  1J19 A;  2X18 A;  3TVV A;  4WVF B;  2CAY A;  2K2U A;  3GYP A;  4HSI A;  2P8V A;  2I5C A;  2Z0Q A;  1RJ2 A;  2P0H A;  2DHK A;  1FAO A;  1H10 A;  3KRX A;  5KQ4 A;  1FHW A;  3OHM B;  1K5D B;  3CIK A;  1SHC A;  2KGX B;  2YT0 A;  1V61 A;  3U7D A;  2L1C A;  1FGY A;  4P7I A;  2UZS A;  1LB1 A;  2COA A;  2ZKM X;  4EKU A;  1PMS A;  2IFS A;  2W2X D;  5JP4 A;  2GUM A;  1U27 A;  4IOY X;  3A8P A;  3WA0 A;  5DIF B;  2RUK B;  2EJ8 A;  2EMS A;  2R0D A;  5D27 A;  3PSC A;  1U5F A;  4DXA B;  4CHJ A;  2AEH A;  1UNR A;  4NY0 A;  5FI0 A;  1EF1 A;  2D9X A;  2I1J A;  1P6S A;  1I7A A;  2XQN M;  2D9Z A;  4HDQ A;  1ZYI A;  4HAX B;  3B77 A;  4HAW B;  3F0W A;  2AL6 A;  2D9V A;  5J3Q A;  1NU2 A;  3HQC A;  1OY2 A;  3DCX A;  2GCJ A;  2QKL A;  1WGQ A;  1X11 A;  3VOQ A;  1FHX A;  4EMO A;  2KCJ A;  3AU5 A;  4Y94 A;  1WVH A;  1DRO A;  2RGN B;  3ZDT A;  3LJU X;  2W2X C; 
#chains in the Genus database with same CATH homology
 2GUM A;  2NBV A;  4QJ5 B;  5I2S A;  4QJ3 B;  2KIE A;  4IOY X;  2Z13 A;  4KHB B;  4GNK B;  2Z14 A;  1ZYI A;  4IFS A;  3FSS A;  4D6W A;  3NW8 A;  4Z2N A;  4KHB A;  2KUQ A;  2K8E A;  5LG4 B;  4Z2M B;  3HIE A;  2R2Y A;  3OHM B;  2Z59 A;  5M4Y B;  2KIG A;  3GYO A;  4OSN A;  2GCJ A;  3TW1 A;  4QJ4 B;  4CSQ A;  2FJU B;  3U12 A;  3NWD A;  4KHA A;  4KHO A;  2KR0 A;  2GCL A;  4QXA B;  5I2M A;  5IRS A;  2RRF A;  2Z4D A;  3NWF A;  4L1R A;  4GOU A;  3A58 A;  2ZKM X;  2K49 A;  3NWA A;  3TVV A;  3TO1 A;  4OT1 A;  4PQ0 A;  3FVC A;  2YT2 A;  3GYP A;  4HSI A;  4DIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...