2NBVA

Solution structure of the rpn13 pru domain engaging the hplic2 ubl domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
KYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2nbvA00
2NBVA 2KR0A 2R2YA 2Z59A 5IRSA 2Z4DA
chains in the Genus database with same CATH superfamily
3BINA 2LULA 2UZSA 5LOPB 5KCVA 1GC6A 2Y8FA 4PQ0A 2P0FA 2W2XC 2D9YA 2MDXA 2KIGA 3PVUA 3GYPA 1X11A 3QIJA 5C5BB 3TW1A 4Z2NA 2V76A 1U5GA 1TJ6A 2DTCA 3OANA 2W2XD 1WG7A 4DIXA 4EKUA 4L6EA 3PVLA 3SUZA 1MK9B 4DX8A 3GYOA 2ELBA 1NU2A 2GCJA 2M14A 2R2YA 1BTNA 2D11A 2LOXA 2DHJA 1Q67A 1W1HA 2RRFA 5DH9B 2DYNA 1U5FA 1Z87A 2YS3A 3CXBB 3VIAA 3NWDA 2D9WA 2J59M 4ZRIA 4B6HA 4NY0A 2DKQA 1BAKA 2FJUB 1NTYA 2OQBA 5C79A 1DDVA 4HAYB 1EVHA 3U7DA 5DHAB 3TVVA 1H10A 5HE2A 2I5CA 3FEHA 1PMSA 1OQNA 2IYBA 2OTXA 4GMXB 5JLJB 4ZRKA 3LJUX 2E2XA 1V61A 2YVCA 3ULCA 4K2OA 1UNQA 2GJYA 2RNRB 3FVCA 2YT0A 5LONB 5KQ4A 2Z14A 3ML4A 2YT1A 5CLLB 5JP4A 2DHKA 2YT2A 4K2PA 3D8DA 5LG4B 2AL6A 4OSNA 4MK0A 5JHGA 2UZRA 1SHCA 2K2UA 2UVMA 1EGXA 1B55A 4WJ7A 1FB8A 1FGZA 1OMWA 4TYZA 1KZ7A 1MI1A 1P6SA 2D9ZA 5C6RA 2LOZA 2YRYA 3NSUA 1MKEA 3HQCA 3T06A 2Z4DA 4CYEA 3KRWA 4XWXA 2DKPA 3ZVRA 2W2WA 1FHOA 4F7UP 2EMTA 5C5BA 5HE0A 2DLWA 2RUKB 2N0YA 3MPXA 1OY2A 1WGUA 1ZVRA 2YF0A 1UPRA 4TKNA 5L81A 4EMOA 4Z2MB 5DHFB 2XQNM 1XD4A 4DX90 5D3XA 4CSQA 1MK7B 2EJ8A 4MT7A 2KUQA 1LW3A 1U29A 2EMSA 1V88A 2Y7BA 1NTVA 3SNHA 4QJ3B 3ZDTA 1FGYA 5I2MA 1RJ2A 5IRSA 1FOEA 3KSYA 4DXAB 4KHBA 2K8EA 1V5MA 2MWNB 2Q13A 4EJNA 3A98B 2DX5A 4CHMA 3FSSA 3KRXA 1WJMA 4A6FB 3ULBA 3WYFB 1U5EA 5D27A 1LB1A 3AJ4A 4IAPA 3NWFA 4HHVA 4KVGB 1V5PA 2AEHA 2VKIA 1AQCA 5GOWB 5D3YA 2RVBB 2H7EA 3O96A 2Z0PA 3DXEA 2NMBA 2PZ1A 4A6KA 2I1JA 4A5KA 4HSIA 4KAXB 4GZUA 5DIFB 2J0MA 2RSGA 1UNRA 4F7GA 3QBVB 4L1RA 2Z13A 4A6HA 4YL8A 2LKOA 4HAVB 4IFSA 4ZRJA 2RLOA 2ELAA 3AU5A 2VRWB 1WJ1A 4GXBA 3MDBC 1XR0B 5HE1A 4YONA 4IOYX 3UZTA 1TQZA 1SGHA 3PSCA 1IRSA 3CIKA 3HK0A 4BBKA 2I5FA 3U8ZA 3F5RA 4GPTB 2MKRA 1BTKA 4QXAB 4HAZB 1ZM0A 4HB4B 1ZSQA 5D3WA 2COCA 2ZKMX 1M7EA 5CLQB 4HAXB 2P0DA 2BCJA 1J0WA 2ADZA 2CAYA 4HAUB 3KZ1A 1XKEA 2DFKA 3IVFA 1V89A 4H8SA 3NW8A 1DBHA 2NZ8B 2FJLA 2GUMA 2P0HA 2D9VA 2GS0A 2D10A 4NSWA 5D3VA 3TCAA 4GN1A 1FAOA 2D2QA 3A58A 5C16A 4HDOA 4HB3B 3HW2B 2DX1A 2YSZA 3X23A 5HE3A 1FHWA 5EFXA 2ROVA 3PEGA 2KUPA 2RGNB 5FI1A 2HTHB 4A6FA 3P6AA 1QC6A 2CY4A 4HB2B 4HB0B 3DXCA 2Z0QA 1N3HA 1T77A 3SV1A 1PFJA 3ODWA 4K81A 1ZC4B 1DROA 1NI2A 2CRFA 1K5DB 1I2HA 2D4QA 3F0WA 1X05A 2K49A 3U12A 2YS5A 5J3TA 2KCJA 5J3YA 3DXDA 4GOUA 1ZC3B 3A8PA 4KHOA 1W1GA 3PP2A 3SYXA 4P7IA 2L1CA 1DYNA 4D6WA 1J19A 2MFQA 1XX0A 2K00A 2CODA 5FI0A 3TFMA 4WSFA 2J0KA 2L2IA 2GCLA 1U2BA 4MY6A 3OHMB 4HAWB 1MIZB 2DHIA 1WI1A 3V5WA 3ODXA 3N7CA 3D8EA 1DDMA 1U5DA 2ROZB 1QQGA 2JP2A 2P8VA 1XODA 1FHXA 4PNKA 1X1FA 1ZYIA 4KHBB 5KQ1A 1X1GA 1X86A 4CHJA 3QWMA 1GC7A 1UEFA 3ODOA 3P7ZA 2ZPYA 1GG3A 1P3RA 3WA0A 5JHHA 2IFSA 3SO6A 1MIXA 2LYDA 1PLSA 4QJ5B 1V5UA 1ISNA 2VSZA 3HSAA 2KR0A 3B77A 2Y8GA 2KIEA 2DA0A 1KI1B 1EAZA 1XCGA 1UPQA 4GMVA 4GNKB 1AWEA 2DN6A 1KZGA 1E5WA 4QJ4B 4C0AA 2G35A 3G9WA 1P5TA 2COAA 2NBVA 3FM8C 3D8FA 4KHAA 1WVHA 2J0JA 4D0NB 1BWNA 4WVFB 1UNPA 3VOQA 2QKLA 1EF1A 2H7DA 2YS1A 2M38A 1DDWA 4K17A 2CY5A 3HIEA 3KY9A 1U27A 3M1IB 1MPHA 1RRPB 2KGXB 2K2JA 2I1KA 2EC1A 1H4RA 3RCPA 2Z0OA 3AU4A 2X18A 3PVWA 3A8QA 1W1DA 1I7AA 4F7HA 1WGQA 4OT1A 2R09A 2N23A 1TXDA 3DCXA 3PG7A 1Y19B 5DI9B 2HE7A 5M4YB 1MAIA 2LG1A 3NWAA 5I2SA 2QKMA 1K5GB 2R0DA 1M7RA 2COFA 2Z59A 3PZDA 1Y5OA 4Y94A 4DBBA 2DYQA 3TO1A 5J3QA 4HATB 4HDQA 2D9XA 3BJIA
chains in the Genus database with same CATH topology
2NBVA 3NW8A 2K49A 2Z14A 3U12A 4Z2MB 2FJUB 4KHAA 2GUMA 2Z13A 4L1RA 3GYOA 4OT1A 4GOUA 4QJ5B 4CSQA 4QXAB 2GCJA 4KHOA 5M4YB 4PQ0A 2KR0A 2KUQA 2R2YA 3NWFA 4IFSA 2YT2A 3TVVA 3NWAA 2KIEA 2ZKMX 2Z4DA 3HIEA 4D6WA 5LG4B 5I2SA 3A58A 4QJ3B 1ZYIA 4KHBB 4GNKB 4OSNA 2KIGA 5I2MA 2Z59A 5IRSA 3GYPA 2RRFA 3TO1A 3TW1A 4Z2NA 4QJ4B 4KHBA 2GCLA 2K8EA 3OHMB 4IOYX 4HSIA 3FSSA 3FVCA 3NWDA 4DIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBV A;  2KR0 A;  2R2Y A;  2Z59 A;  5IRS A;  2Z4D A; 
#chains in the Genus database with same CATH topology
 3BIN A;  2LUL A;  2UZS A;  5LOP B;  5KCV A;  1GC6 A;  2Y8F A;  4PQ0 A;  2P0F A;  2W2X C;  2D9Y A;  2MDX A;  2KIG A;  3PVU A;  3GYP A;  1X11 A;  3QIJ A;  5C5B B;  3TW1 A;  4Z2N A;  2V76 A;  1U5G A;  1TJ6 A;  2DTC A;  3OAN A;  2W2X D;  1WG7 A;  4DIX A;  4EKU A;  4L6E A;  3PVL A;  3SUZ A;  1MK9 B;  4DX8 A;  3GYO A;  2ELB A;  1NU2 A;  2GCJ A;  2M14 A;  2R2Y A;  1BTN A;  2D11 A;  2LOX A;  2DHJ A;  1Q67 A;  1W1H A;  2RRF A;  5DH9 B;  2DYN A;  1U5F A;  1Z87 A;  2YS3 A;  3CXB B;  3VIA A;  3NWD A;  2D9W A;  2J59 M;  4ZRI A;  4B6H A;  4NY0 A;  2DKQ A;  1BAK A;  2FJU B;  1NTY A;  2OQB A;  5C79 A;  1DDV A;  4HAY B;  1EVH A;  3U7D A;  5DHA B;  3TVV A;  1H10 A;  5HE2 A;  2I5C A;  3FEH A;  1PMS A;  1OQN A;  2IYB A;  2OTX A;  4GMX B;  5JLJ B;  4ZRK A;  3LJU X;  2E2X A;  1V61 A;  2YVC A;  3ULC A;  4K2O A;  1UNQ A;  2GJY A;  2RNR B;  3FVC A;  2YT0 A;  5LON B;  5KQ4 A;  2Z14 A;  3ML4 A;  2YT1 A;  5CLL B;  5JP4 A;  2DHK A;  2YT2 A;  4K2P A;  3D8D A;  5LG4 B;  2AL6 A;  4OSN A;  4MK0 A;  5JHG A;  2UZR A;  1SHC A;  2K2U A;  2UVM A;  1EGX A;  1B55 A;  4WJ7 A;  1FB8 A;  1FGZ A;  1OMW A;  4TYZ A;  1KZ7 A;  1MI1 A;  1P6S A;  2D9Z A;  5C6R A;  2LOZ A;  2YRY A;  3NSU A;  1MKE A;  3HQC A;  3T06 A;  2Z4D A;  4CYE A;  3KRW A;  4XWX A;  2DKP A;  3ZVR A;  2W2W A;  1FHO A;  4F7U P;  2EMT A;  5C5B A;  5HE0 A;  2DLW A;  2RUK B;  2N0Y A;  3MPX A;  1OY2 A;  1WGU A;  1ZVR A;  2YF0 A;  1UPR A;  4TKN A;  5L81 A;  4EMO A;  4Z2M B;  5DHF B;  2XQN M;  1XD4 A;  4DX9 0;  5D3X A;  4CSQ A;  1MK7 B;  2EJ8 A;  4MT7 A;  2KUQ A;  1LW3 A;  1U29 A;  2EMS A;  1V88 A;  2Y7B A;  1NTV A;  3SNH A;  4QJ3 B;  3ZDT A;  1FGY A;  5I2M A;  1RJ2 A;  5IRS A;  1FOE A;  3KSY A;  4DXA B;  4KHB A;  2K8E A;  1V5M A;  2MWN B;  2Q13 A;  4EJN A;  3A98 B;  2DX5 A;  4CHM A;  3FSS A;  3KRX A;  1WJM A;  4A6F B;  3ULB A;  3WYF B;  1U5E A;  5D27 A;  1LB1 A;  3AJ4 A;  4IAP A;  3NWF A;  4HHV A;  4KVG B;  1V5P A;  2AEH A;  2VKI A;  1AQC A;  5GOW B;  5D3Y A;  2RVB B;  2H7E A;  3O96 A;  2Z0P A;  3DXE A;  2NMB A;  2PZ1 A;  4A6K A;  2I1J A;  4A5K A;  4HSI A;  4KAX B;  4GZU A;  5DIF B;  2J0M A;  2RSG A;  1UNR A;  4F7G A;  3QBV B;  4L1R A;  2Z13 A;  4A6H A;  4YL8 A;  2LKO A;  4HAV B;  4IFS A;  4ZRJ A;  2RLO A;  2ELA A;  3AU5 A;  2VRW B;  1WJ1 A;  4GXB A;  3MDB C;  1XR0 B;  5HE1 A;  4YON A;  4IOY X;  3UZT A;  1TQZ A;  1SGH A;  3PSC A;  1IRS A;  3CIK A;  3HK0 A;  4BBK A;  2I5F A;  3U8Z A;  3F5R A;  4GPT B;  2MKR A;  1BTK A;  4QXA B;  4HAZ B;  1ZM0 A;  4HB4 B;  1ZSQ A;  5D3W A;  2COC A;  2ZKM X;  1M7E A;  5CLQ B;  4HAX B;  2P0D A;  2BCJ A;  1J0W A;  2ADZ A;  2CAY A;  4HAU B;  3KZ1 A;  1XKE A;  2DFK A;  3IVF A;  1V89 A;  4H8S A;  3NW8 A;  1DBH A;  2NZ8 B;  2FJL A;  2GUM A;  2P0H A;  2D9V A;  2GS0 A;  2D10 A;  4NSW A;  5D3V A;  3TCA A;  4GN1 A;  1FAO A;  2D2Q A;  3A58 A;  5C16 A;  4HDO A;  4HB3 B;  3HW2 B;  2DX1 A;  2YSZ A;  3X23 A;  5HE3 A;  1FHW A;  5EFX A;  2ROV A;  3PEG A;  2KUP A;  2RGN B;  5FI1 A;  2HTH B;  4A6F A;  3P6A A;  1QC6 A;  2CY4 A;  4HB2 B;  4HB0 B;  3DXC A;  2Z0Q A;  1N3H A;  1T77 A;  3SV1 A;  1PFJ A;  3ODW A;  4K81 A;  1ZC4 B;  1DRO A;  1NI2 A;  2CRF A;  1K5D B;  1I2H A;  2D4Q A;  3F0W A;  1X05 A;  2K49 A;  3U12 A;  2YS5 A;  5J3T A;  2KCJ A;  5J3Y A;  3DXD A;  4GOU A;  1ZC3 B;  3A8P A;  4KHO A;  1W1G A;  3PP2 A;  3SYX A;  4P7I A;  2L1C A;  1DYN A;  4D6W A;  1J19 A;  2MFQ A;  1XX0 A;  2K00 A;  2COD A;  5FI0 A;  3TFM A;  4WSF A;  2J0K A;  2L2I A;  2GCL A;  1U2B A;  4MY6 A;  3OHM B;  4HAW B;  1MIZ B;  2DHI A;  1WI1 A;  3V5W A;  3ODX A;  3N7C A;  3D8E A;  1DDM A;  1U5D A;  2ROZ B;  1QQG A;  2JP2 A;  2P8V A;  1XOD A;  1FHX A;  4PNK A;  1X1F A;  1ZYI A;  4KHB B;  5KQ1 A;  1X1G A;  1X86 A;  4CHJ A;  3QWM A;  1GC7 A;  1UEF A;  3ODO A;  3P7Z A;  2ZPY A;  1GG3 A;  1P3R A;  3WA0 A;  5JHH A;  2IFS A;  3SO6 A;  1MIX A;  2LYD A;  1PLS A;  4QJ5 B;  1V5U A;  1ISN A;  2VSZ A;  3HSA A;  2KR0 A;  3B77 A;  2Y8G A;  2KIE A;  2DA0 A;  1KI1 B;  1EAZ A;  1XCG A;  1UPQ A;  4GMV A;  4GNK B;  1AWE A;  2DN6 A;  1KZG A;  1E5W A;  4QJ4 B;  4C0A A;  2G35 A;  3G9W A;  1P5T A;  2COA A;  2NBV A;  3FM8 C;  3D8F A;  4KHA A;  1WVH A;  2J0J A;  4D0N B;  1BWN A;  4WVF B;  1UNP A;  3VOQ A;  2QKL A;  1EF1 A;  2H7D A;  2YS1 A;  2M38 A;  1DDW A;  4K17 A;  2CY5 A;  3HIE A;  3KY9 A;  1U27 A;  3M1I B;  1MPH A;  1RRP B;  2KGX B;  2K2J A;  2I1K A;  2EC1 A;  1H4R A;  3RCP A;  2Z0O A;  3AU4 A;  2X18 A;  3PVW A;  3A8Q A;  1W1D A;  1I7A A;  4F7H A;  1WGQ A;  4OT1 A;  2R09 A;  2N23 A;  1TXD A;  3DCX A;  3PG7 A;  1Y19 B;  5DI9 B;  2HE7 A;  5M4Y B;  1MAI A;  2LG1 A;  3NWA A;  5I2S A;  2QKM A;  1K5G B;  2R0D A;  1M7R A;  2COF A;  2Z59 A;  3PZD A;  1Y5O A;  4Y94 A;  4DBB A;  2DYQ A;  3TO1 A;  5J3Q A;  4HAT B;  4HDQ A;  2D9X A;  3BJI A; 
#chains in the Genus database with same CATH homology
 2NBV A;  3NW8 A;  2K49 A;  2Z14 A;  3U12 A;  4Z2M B;  2FJU B;  4KHA A;  2GUM A;  2Z13 A;  4L1R A;  3GYO A;  4OT1 A;  4GOU A;  4QJ5 B;  4CSQ A;  4QXA B;  2GCJ A;  4KHO A;  5M4Y B;  4PQ0 A;  2KR0 A;  2KUQ A;  2R2Y A;  3NWF A;  4IFS A;  2YT2 A;  3TVV A;  3NWA A;  2KIE A;  2ZKM X;  2Z4D A;  3HIE A;  4D6W A;  5LG4 B;  5I2S A;  3A58 A;  4QJ3 B;  1ZYI A;  4KHB B;  4GNK B;  4OSN A;  2KIG A;  5I2M A;  2Z59 A;  5IRS A;  3GYP A;  2RRF A;  3TO1 A;  3TW1 A;  4Z2N A;  4QJ4 B;  4KHB A;  2GCL A;  2K8E A;  3OHM B;  4IOY X;  4HSI A;  3FSS A;  3FVC A;  3NWD A;  4DIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...