2NBVA

Solution structure of the rpn13 pru domain engaging the hplic2 ubl domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
KYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
total genus 26
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.70 Mainly Beta Roll PH-domain like PH-domain like 2nbvA00
2R2YA 2Z59A 5IRSA 2KR0A 2NBVA 2Z4DA
chains in the Genus database with same CATH superfamily
1U5GA 2N0YA 2COFA 2GCJA 2DHKA 3HSAA 2K00A 2UVMA 4GN1A 1EGXA 3HW2B 2LG1A 1NTVA 2GJYA 2D4QA 4ZRIA 1MK9B 1X1FA 4HB4B 1KI1B 2D9YA 2UZSA 3ZVRA 2MKRA 4OT1A 2MFQA 2Y7BA 5KQ1A 1UNRA 1EF1A 1K5GB 2R2YA 3SV1A 1V61A 5JHGA 5HE0A 2OQBA 3N7CA 4B6HA 2ELAA 1NTYA 5CLLB 2MWNB 2DLWA 2EJ8A 1OY2A 5J3YA 2EMTA 5DHFB 3QBVB 2IYBA 2K8EA 4EJNA 3NWFA 1PFJA 3LJUX 4A6KA 1DROA 2Z0QA 1MI1A 5GOWB 3PVWA 5C79A 4HB3B 2CRFA 2LULA 2KIEA 2Z0OA 4HDQA 2M14A 4DIXA 1T77A 3SO6A 2GUMA 4HDOA 4HAVB 3SUZA 3KRXA 1I2HA 4ZRKA 1WGQA 4DBBA 4K17A 1NI2A 2KCJA 4EKUA 4IAPA 3TVVA 1BTKA 1QQGA 5CLQB 4NY0A 2R09A 2K49A 2RVBB 2J0JA 2Z14A 4P7IA 4K2PA 1MIXA 2COCA 1B55A 2QKLA 5JLJB 1W1HA 1DBHA 2ZKMX 3P6AA 4TKNA 3DCXA 1SGHA 2OTXA 1FHWA 5HE1A 2JP2A 2VSZA 1M7EA 5KQ4A 2I1KA 3U8ZA 5C6RA 2LOZA 3U7DA 1UPQA 3FEHA 3PEGA 4A6FB 2Q13A 4BBKA 1BTNA 1LB1A 2DYQA 1WGUA 1DDVA 2D10A 1V89A 4PQ0A 3PVUA 4Z2MB 1IRSA 2KIGA 1TJ6A 1J19A 2KR0A 1ISNA 2Y8FA 4MK0A 1BAKA 5IRSA 2YT0A 1P3RA 3KY9A 1FB8A 2N23A 2D9WA 1H4RA 1PLSA 2RRFA 4QJ3B 5J3TA 2X18A 2W2XD 2DHIA 4L1RA 3TFMA 2DKQA 4TYZA 1MK7B 5JHHA 3O96A 3PG7A 2IFSA 3OHMB 4K2OA 2J0MA 3NSUA 2P0DA 2KUPA 1WJMA 3RCPA 3AU5A 2YS5A 2YT1A 1W1DA 3CXBB 5DIFB 2VKIA 3WYFB 5FI0A 1EVHA 2ELBA 5C16A 3M1IB 4CYEA 4DX8A 4C0AA 2DX1A 2D2QA 4GNKB 1SHCA 3DXDA 4GMVA 1Y19B 3GYPA 4GZUA 3ODWA 2RLOA 2DHJA 5L81A 1U29A 2P0HA 4KHAA 1ZYIA 1P6SA 4Z2NA 4GXBA 2DX5A 3DXCA 4F7UP 5JP4A 2V76A 3D8DA 4NSWA 2VRWB 4EMOA 1BWNA 3PSCA 3HIEA 4A5KA 4HATB 4MY6A 3UZTA 4GMXB 2RUKB 4HAXB 2J59M 1U27A 4KAXB 5C5BA 4HSIA 4A6FA 4L6EA 1DDMA 1GC7A 3AJ4A 1I7AA 2DFKA 3A8QA 4PNKA 5HE2A 3X23A 4YL8A 4A6HA 2DKPA 5KCVA 3U12A 1FGZA 1RRPB 2DYNA 3A98B 4HB0B 3TO1A 2XQNM 4WSFA 4ZRJA 2I5FA 2P0FA 3KRWA 1E5WA 2ROVA 4DXAB 3ULCA 1U5DA 4HAZB 1XODA 2YSZA 2D9XA 5D3WA 5EFXA 1XCGA 5DH9B 3BJIA 3KZ1A 4YONA 2NMBA 1RJ2A 2DN6A 1EAZA 2I5CA 1DYNA 3D8EA 1U5EA 1OQNA 2D9ZA 2Y8GA 2AEHA 4KHOA 4WVFB 4F7GA 4H8SA 1TXDA 2LYDA 1X1GA 3PZDA 3TCAA 2D11A 4QXAB 5M4YB 4QJ4B 1X11A 2LOXA 2HTHB 2CY4A 2RGNB 1WI1A 1XD4A 2Z13A 2L2IA 1DDWA 1KZ7A 2KGXB 4GPTB 4IOYX 3WA0A 2DA0A 3NW8A 1GG3A 1ZC4B 1QC6A 1Z87A 4WJ7A 3ML4A 1ZC3B 2I1JA 5LG4B 3OANA 1X05A 1MPHA 1WVHA 3MPXA 5D3YA 1WJ1A 5D3VA 3A58A 2UZRA 4IFSA 4HB2B 3G9WA 1Q67A 1M7RA 2GS0A 3SYXA 1TQZA 1X86A 2CY5A 5D27A 3VIAA 1KZGA 2CAYA 1V88A 1XX0A 4CSQA 1GC6A 4HHVA 1XR0B 3MDBC 5LOPB 2LKOA 5I2MA 2K2JA 2MDXA 2ROZB 3B77A 5DI9B 1ZM0A 3QWMA 2H7EA 2KUQA 2H7DA 4K81A 3A8PA 4MT7A 4KHBA 2CODA 3ODOA 1FHOA 2YRYA 3ULBA 1FHXA 3PVLA 2G35A 2YF0A 5HE3A 4KVGB 4CHJA 2E2XA 3QIJA 3FM8C 2R0DA 1J0WA 4HAYB 1NU2A 5D3XA 4CHMA 3F5RA 1UPRA 4GOUA 3HK0A 1ZSQA 2Z59A 1ZVRA 4XWXA 2HE7A 3AU4A 2P8VA 1WG7A 2YT2A 1U2BA 2W2XC 1MAIA 4OSNA 1V5PA 5C5BB 5I2SA 2YS3A 2YS1A 1FGYA 2Z4DA 3FVCA 1MKEA 3BINA 2COAA 3DXEA 2W2WA 4HAWB 2L1CA 2FJUB 1W1GA 3ODXA 5LONB 1V5MA 1XKEA 1K5DB 2RSGA 2AL6A 1U5FA 1AQCA 3P7ZA 4KHBB 3D8FA 4F7HA 1N3HA 1FOEA 2FJLA 3F0WA 2ZPYA 3FSSA 4HAUB 4Y94A 2QKMA 1H10A 2BCJA 2EC1A 4D6WA 3NWAA 3GYOA 5J3QA 1AWEA 1LW3A 4QJ5B 5DHAB 3SNHA 2K2UA 4D0NB 3ZDTA 2ADZA 1Y5OA 1FAOA 5FI1A 2PZ1A 3HQCA 3IVFA 1OMWA 3PP2A 2Z0PA 3T06A 3VOQA 2M38A 1UEFA 1V5UA 1UNQA 2NBVA 4DX90 2YVCA 1P5TA 1MIZB 2D9VA 3NWDA 2DTCA 2EMSA 3V5WA 1UNPA 2J0KA 2NZ8B 3TW1A 1PMSA 3CIKA 2RNRB 3KSYA 2GCLA
chains in the Genus database with same CATH topology
2R2YA 4IOYX 2KIEA 2RRFA 2Z14A 5I2MA 4QJ5B 4QJ3B 3NW8A 2GCJA 2FJUB 3NWAA 4KHOA 4L1RA 4DIXA 3U12A 2GUMA 2KUQA 3HIEA 4GOUA 4GNKB 5LG4B 3TO1A 3NWDA 2Z59A 4KHBA 2ZKMX 4PQ0A 3OHMB 4KHBB 3GYPA 3A58A 4QXAB 5M4YB 4QJ4B 4Z2MB 4CSQA 3FSSA 2KIGA 2K8EA 2YT2A 4IFSA 3TVVA 2KR0A 3NWFA 3TW1A 3FVCA 4HSIA 4OSNA 4KHAA 5I2SA 2Z13A 1ZYIA 4OT1A 5IRSA 4D6WA 2GCLA 4Z2NA 2K49A 2NBVA 3GYOA 2Z4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2Y A;  2Z59 A;  5IRS A;  2KR0 A;  2NBV A;  2Z4D A; 
#chains in the Genus database with same CATH topology
 1U5G A;  2N0Y A;  2COF A;  2GCJ A;  2DHK A;  3HSA A;  2K00 A;  2UVM A;  4GN1 A;  1EGX A;  3HW2 B;  2LG1 A;  1NTV A;  2GJY A;  2D4Q A;  4ZRI A;  1MK9 B;  1X1F A;  4HB4 B;  1KI1 B;  2D9Y A;  2UZS A;  3ZVR A;  2MKR A;  4OT1 A;  2MFQ A;  2Y7B A;  5KQ1 A;  1UNR A;  1EF1 A;  1K5G B;  2R2Y A;  3SV1 A;  1V61 A;  5JHG A;  5HE0 A;  2OQB A;  3N7C A;  4B6H A;  2ELA A;  1NTY A;  5CLL B;  2MWN B;  2DLW A;  2EJ8 A;  1OY2 A;  5J3Y A;  2EMT A;  5DHF B;  3QBV B;  2IYB A;  2K8E A;  4EJN A;  3NWF A;  1PFJ A;  3LJU X;  4A6K A;  1DRO A;  2Z0Q A;  1MI1 A;  5GOW B;  3PVW A;  5C79 A;  4HB3 B;  2CRF A;  2LUL A;  2KIE A;  2Z0O A;  4HDQ A;  2M14 A;  4DIX A;  1T77 A;  3SO6 A;  2GUM A;  4HDO A;  4HAV B;  3SUZ A;  3KRX A;  1I2H A;  4ZRK A;  1WGQ A;  4DBB A;  4K17 A;  1NI2 A;  2KCJ A;  4EKU A;  4IAP A;  3TVV A;  1BTK A;  1QQG A;  5CLQ B;  4NY0 A;  2R09 A;  2K49 A;  2RVB B;  2J0J A;  2Z14 A;  4P7I A;  4K2P A;  1MIX A;  2COC A;  1B55 A;  2QKL A;  5JLJ B;  1W1H A;  1DBH A;  2ZKM X;  3P6A A;  4TKN A;  3DCX A;  1SGH A;  2OTX A;  1FHW A;  5HE1 A;  2JP2 A;  2VSZ A;  1M7E A;  5KQ4 A;  2I1K A;  3U8Z A;  5C6R A;  2LOZ A;  3U7D A;  1UPQ A;  3FEH A;  3PEG A;  4A6F B;  2Q13 A;  4BBK A;  1BTN A;  1LB1 A;  2DYQ A;  1WGU A;  1DDV A;  2D10 A;  1V89 A;  4PQ0 A;  3PVU A;  4Z2M B;  1IRS A;  2KIG A;  1TJ6 A;  1J19 A;  2KR0 A;  1ISN A;  2Y8F A;  4MK0 A;  1BAK A;  5IRS A;  2YT0 A;  1P3R A;  3KY9 A;  1FB8 A;  2N23 A;  2D9W A;  1H4R A;  1PLS A;  2RRF A;  4QJ3 B;  5J3T A;  2X18 A;  2W2X D;  2DHI A;  4L1R A;  3TFM A;  2DKQ A;  4TYZ A;  1MK7 B;  5JHH A;  3O96 A;  3PG7 A;  2IFS A;  3OHM B;  4K2O A;  2J0M A;  3NSU A;  2P0D A;  2KUP A;  1WJM A;  3RCP A;  3AU5 A;  2YS5 A;  2YT1 A;  1W1D A;  3CXB B;  5DIF B;  2VKI A;  3WYF B;  5FI0 A;  1EVH A;  2ELB A;  5C16 A;  3M1I B;  4CYE A;  4DX8 A;  4C0A A;  2DX1 A;  2D2Q A;  4GNK B;  1SHC A;  3DXD A;  4GMV A;  1Y19 B;  3GYP A;  4GZU A;  3ODW A;  2RLO A;  2DHJ A;  5L81 A;  1U29 A;  2P0H A;  4KHA A;  1ZYI A;  1P6S A;  4Z2N A;  4GXB A;  2DX5 A;  3DXC A;  4F7U P;  5JP4 A;  2V76 A;  3D8D A;  4NSW A;  2VRW B;  4EMO A;  1BWN A;  3PSC A;  3HIE A;  4A5K A;  4HAT B;  4MY6 A;  3UZT A;  4GMX B;  2RUK B;  4HAX B;  2J59 M;  1U27 A;  4KAX B;  5C5B A;  4HSI A;  4A6F A;  4L6E A;  1DDM A;  1GC7 A;  3AJ4 A;  1I7A A;  2DFK A;  3A8Q A;  4PNK A;  5HE2 A;  3X23 A;  4YL8 A;  4A6H A;  2DKP A;  5KCV A;  3U12 A;  1FGZ A;  1RRP B;  2DYN A;  3A98 B;  4HB0 B;  3TO1 A;  2XQN M;  4WSF A;  4ZRJ A;  2I5F A;  2P0F A;  3KRW A;  1E5W A;  2ROV A;  4DXA B;  3ULC A;  1U5D A;  4HAZ B;  1XOD A;  2YSZ A;  2D9X A;  5D3W A;  5EFX A;  1XCG A;  5DH9 B;  3BJI A;  3KZ1 A;  4YON A;  2NMB A;  1RJ2 A;  2DN6 A;  1EAZ A;  2I5C A;  1DYN A;  3D8E A;  1U5E A;  1OQN A;  2D9Z A;  2Y8G A;  2AEH A;  4KHO A;  4WVF B;  4F7G A;  4H8S A;  1TXD A;  2LYD A;  1X1G A;  3PZD A;  3TCA A;  2D11 A;  4QXA B;  5M4Y B;  4QJ4 B;  1X11 A;  2LOX A;  2HTH B;  2CY4 A;  2RGN B;  1WI1 A;  1XD4 A;  2Z13 A;  2L2I A;  1DDW A;  1KZ7 A;  2KGX B;  4GPT B;  4IOY X;  3WA0 A;  2DA0 A;  3NW8 A;  1GG3 A;  1ZC4 B;  1QC6 A;  1Z87 A;  4WJ7 A;  3ML4 A;  1ZC3 B;  2I1J A;  5LG4 B;  3OAN A;  1X05 A;  1MPH A;  1WVH A;  3MPX A;  5D3Y A;  1WJ1 A;  5D3V A;  3A58 A;  2UZR A;  4IFS A;  4HB2 B;  3G9W A;  1Q67 A;  1M7R A;  2GS0 A;  3SYX A;  1TQZ A;  1X86 A;  2CY5 A;  5D27 A;  3VIA A;  1KZG A;  2CAY A;  1V88 A;  1XX0 A;  4CSQ A;  1GC6 A;  4HHV A;  1XR0 B;  3MDB C;  5LOP B;  2LKO A;  5I2M A;  2K2J A;  2MDX A;  2ROZ B;  3B77 A;  5DI9 B;  1ZM0 A;  3QWM A;  2H7E A;  2KUQ A;  2H7D A;  4K81 A;  3A8P A;  4MT7 A;  4KHB A;  2COD A;  3ODO A;  1FHO A;  2YRY A;  3ULB A;  1FHX A;  3PVL A;  2G35 A;  2YF0 A;  5HE3 A;  4KVG B;  4CHJ A;  2E2X A;  3QIJ A;  3FM8 C;  2R0D A;  1J0W A;  4HAY B;  1NU2 A;  5D3X A;  4CHM A;  3F5R A;  1UPR A;  4GOU A;  3HK0 A;  1ZSQ A;  2Z59 A;  1ZVR A;  4XWX A;  2HE7 A;  3AU4 A;  2P8V A;  1WG7 A;  2YT2 A;  1U2B A;  2W2X C;  1MAI A;  4OSN A;  1V5P A;  5C5B B;  5I2S A;  2YS3 A;  2YS1 A;  1FGY A;  2Z4D A;  3FVC A;  1MKE A;  3BIN A;  2COA A;  3DXE A;  2W2W A;  4HAW B;  2L1C A;  2FJU B;  1W1G A;  3ODX A;  5LON B;  1V5M A;  1XKE A;  1K5D B;  2RSG A;  2AL6 A;  1U5F A;  1AQC A;  3P7Z A;  4KHB B;  3D8F A;  4F7H A;  1N3H A;  1FOE A;  2FJL A;  3F0W A;  2ZPY A;  3FSS A;  4HAU B;  4Y94 A;  2QKM A;  1H10 A;  2BCJ A;  2EC1 A;  4D6W A;  3NWA A;  3GYO A;  5J3Q A;  1AWE A;  1LW3 A;  4QJ5 B;  5DHA B;  3SNH A;  2K2U A;  4D0N B;  3ZDT A;  2ADZ A;  1Y5O A;  1FAO A;  5FI1 A;  2PZ1 A;  3HQC A;  3IVF A;  1OMW A;  3PP2 A;  2Z0P A;  3T06 A;  3VOQ A;  2M38 A;  1UEF A;  1V5U A;  1UNQ A;  2NBV A;  4DX9 0;  2YVC A;  1P5T A;  1MIZ B;  2D9V A;  3NWD A;  2DTC A;  2EMS A;  3V5W A;  1UNP A;  2J0K A;  2NZ8 B;  3TW1 A;  1PMS A;  3CIK A;  2RNR B;  3KSY A;  2GCL A; 
#chains in the Genus database with same CATH homology
 2R2Y A;  4IOY X;  2KIE A;  2RRF A;  2Z14 A;  5I2M A;  4QJ5 B;  4QJ3 B;  3NW8 A;  2GCJ A;  2FJU B;  3NWA A;  4KHO A;  4L1R A;  4DIX A;  3U12 A;  2GUM A;  2KUQ A;  3HIE A;  4GOU A;  4GNK B;  5LG4 B;  3TO1 A;  3NWD A;  2Z59 A;  4KHB A;  2ZKM X;  4PQ0 A;  3OHM B;  4KHB B;  3GYP A;  3A58 A;  4QXA B;  5M4Y B;  4QJ4 B;  4Z2M B;  4CSQ A;  3FSS A;  2KIG A;  2K8E A;  2YT2 A;  4IFS A;  3TVV A;  2KR0 A;  3NWF A;  3TW1 A;  3FVC A;  4HSI A;  4OSN A;  4KHA A;  5I2S A;  2Z13 A;  1ZYI A;  4OT1 A;  5IRS A;  4D6W A;  2GCL A;  4Z2N A;  2K49 A;  2NBV A;  3GYO A;  2Z4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...