2NCMA

Neural cell adhesion molecule, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
RVLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of the first domain of neural cell adhesion molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords NEURAL CELL ADHESION MOLECULE
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ncmA00
4ISVA 1YYML 1UH2A 4OT1H 1N2RB 3G5VB 5IR1B 1S3KL 1IC4H 4JJ5A 4UDTB 3VXTA 2VZ1A 4IRSB 4PRID 3T0EC 2VUYA 4KDTA 4Z77B 4DGIH 3ZDZE 4ZSOB 1FE8H 3MRPB 1JPSH 4PJAF 4U3XA 3TA3A 2EYSA 5M7QA 4X98A 4DFIA 5I18H 1ES0B 3JTTA 1G7LB 4W4NA 4LVOC 1CG9B 1F11B 1L0QA 2GCYB 4R9HA 5DLMH 1TVDA 4I0PD 5CCKH 1BD2A 4LKXA 1JBJA 4A6YL 1JGVL 5DD6A 5FO9A 4GJTB 1J1OL 1FPTH 5DI8B 3L3DA 1NC2D 3M1BA 1YQ2A 2B0SH 1RHHB 4ZUUB 4HZLA 4Y16D 3WFEL 4PIRF 3VD3A 3EOTL 4NWUL 1YA5A 3O0RL 4YHIA 4NUJB 4KKCC 3P4OB 5F7WC 5INCB 3D85A 3TJEH 3UTOA 3QDHA 4OV5B 3QQ9D 2UYLB 5ISZE 3G04A 3RDTB 3UAJD 3ULVH 1TJGH 2ERJB 4TUJA 4U31A 3DSNA 5KANI 5L0QB 4ZS6C 3LQMA 4TRPL 4BSVA 5F44A 4L29A 4XRCA 2XYCA 3MGOA 2MFNA 4OD2A 1T2JA 4X0KA 3VRJB 3L3DB 4WWKD 4LAQH 4OGAC 5LQBH 1AXIB 3FHQA 2J8UE 3K8KA 2V2XA 3VDBA 3QUYA 1ZLWK 3MV9D 1G7HA 5DF0A 4NUJA 4KRLB 4MCZB 3DVNB 5ANMA 1BWWA 5J6HA 4FFWC 4JDVA 4OQTH 4DKAA 4HIXL 3ES6A 3UTSA 3ZKMD 2R8SL 2B4CC 3ZE0E 4P46C 43C9A 1Q1JH 4E5XA 3BZDA 4JRYB 2OLDA 4URTB 2CXKA 3CDCA 4M6NL 1NLDL 4XC3H 1SYVA 1U8MB 1MFCH 3LRSB 2AQ2A 5DJ0B 3BPCB 1DUYB 3DO3A 3BP7B 2YD6A 2H3NB 3QXDA 5C0JB 4I3RL 4NZJA 3O3EB 4I3GA 3QG6B 5JOFA 2VQTA 35C8H 5EB9A 2QQKH 2JLLA 3QIWD 5KS9A 1T7VA 3C2AL 5JHDA 1FNEA 4WFEE 1MUJA 1Z9LA 3LKNA 5KANG 1UGNA 3RGVC 1UZ8B 4KZEH 2NXZD 3OJ2C 4JGMA 1UYWL 4LFHD 4DVRL 3VXUA 2QR0B 4X99B 3ABZA 1MRFL 3FQRA 5FGRA 2C1OA 3V8OA 1GPOL 1Q94B 2HMIC 4HKJA 4PLOB 5DJYA 3QDJE 4PLKC 1CDIA 4MJ5A 5JUEH 5DJ0A 4ZPTA 5E4EB 4Z7NF 1XR9A 2RFXA 4PUBH 4F8QA 3U46B 5T33L 4KUCD 5DK3A 2FO4A 3MRGA 3FJTA 4MGXA 3ARRA 3QWOA 3BGAA 4OGYH 3HB3D 2UY6A 3A6BH 5HVGB 5BJTA 3NMEA 5ITBL 2KDGA 3K4AA 4HCRH 1QO3A 2VWEC 4Z18A 2WBJD 2I60L 1CDHA 1S9YB 4AL8L 4XP4L 3AAZA 2XV6B 5FYJD 5FECB 3QUKA 5KVMC 4OD2B 4AH2A 3F8UB 1GH7A 4R6UA 5HHXL 5F97E 1YPZB 3VMPA 2AXGA 4H8WL 4LRNL 2DBLH 4TQEH 2EKSB 5GGTH 4FN0A 1YMHA 4PJ5E 1A9BB 1KEML 1CLYL 2JCCA 2WIIB 3NGBC 3GSWB 4L4VA 1JGUL 3KXFB 3L6FA 4U3HA 5EA0H 1NC2A 2W07A 2V7HB 4EIGB 4XNUL 3R8BB 1ZGLB 1EDQA 4JPVH 1ADQH 2R23B 3RVXC 5D2LE 4L3EB 1NAML 3BD3A 1G0DA 1TIUA 1GVIA 3V5KB 3LS4L 1JN6B 4JFYA 4WCYL 4MDIB 1E28A 3VWKB 1LO0H 3V0VA 4Z8FH 4HKZA 4L4TA 5FO7A 4C55A 5IVXA 5HDQH 4C83B 2A1WL 3CUPB 2YUXA 3RIAK 3U7WL 4FTVD 3TCLA 4X4XA 5F1NB 1XGUA 3S36L 4DGIL 2ZSWA 3HLAB 4C56D 3RWHB 1F4AA 2CH8A 4LCCC 4OLWL 1DTUA 5F7UA 1X5LA 1JYNA 1ZGLA 4F33A 3DXAB 5IBLC 1AR2A 2BX5A 3UTTE 2Z8WC 1KPVB 1XGRB 4G8GE 4OFYA 5DHYB 1GJIA 1MVFA 1AJ7H 5AUMB 3V79C 3RVUC 1FSKB 3KYKH 1AKJD 4KQ3H 4PJXA 2OZ4H 1IM9B 1M7IA 3GIVB 3V7AG 1FVCA 3QAZC 5C07A 3UJIL 4JLRA 4XCNA 1PSKH 4ONFH 2H8PB 2Z35A 3EOTH 3KYNA 4NWUH 4I4WA 5D6DA 4KTEL 3BP7A 4MX7B 4QGYA 4AEFA 1QOKA 1CICD 3MUGB 3MCLL 4OM1L 5AWNL 1N3NA 3MRFB 1NSNH 3QNXB 1XEDA 4QRRA 4X4YB 4AEIH 1YEJH 2P5ED 3MACH 4S11A 1L9MA 1NBVL 3U7YL 1XF1A 1SMOA 3IXTB 2XICA 1LE5B 3GBNL 4Y19B 3QXVA 5DJ2B 7FABL 2ESVE 4LDOB 2Q7YB 5CEXA 2EEDA 3GDBA 3CPLB 5FYJH 2Y4SA 3MV7D 2F19L 4MD5B 4HAFA 3EFDL 2F5BH 1MY7A 1FH5H 3S88H 1FO0A 1NFDA 4NQCD 2HYMA 2Q1EA 3OAYH 3P30H 5KTEL 2FJFA 3MLRH 3KYOB 1RZIA 4Y4FA 1FGNH 1I9JL 2NMSA 4XP6L 3CFKB 1D6VH 3IAGC 3K74B 4WGWB 3DVFA 4MNQE 4XNYH 1NH6A 3TBSA 3UTZB 2ADGA 2OTWB 2ZCLH 4MAUH 5FO7B 4JPKH 3MRNA 3MOAH 3VWJA 4CN1A 4I8DA 1P6AB 1WIUA 1YEDB 1RUQH 5ICXB 1SYVB 1U8MA 4QCIA 1P7QB 2R1WA 2RQ8A 3D39D 2VC2L 1EPFA 1FNLA 3OKLA 3T2OA 4Q6IC 2CRIA 4HGMA 4CW1A 3VG9C 4YXHL 2HT3D 5JW4M 5E03A 4XAKD 1NCBH 1G7HB 2Q20A 3U6RA 5C8JB 4J2XA 4HFWA 5ISZA 3RX5A 4L8DA 3KXFD 1J1XL 2VDOL 3G6DL 1E4JA 3O6FC 1NC4D 2I07A 5E6ID 1EZVY 5BMFL 1L0YA 1A14L 3GMLB 2NR6C 4H20L 1E6OL 2PYED 1YEDA 1OAKH 3LS5L 2P8LA 1DLFL 4PJCB 2YN3A 3I75B 3JZ7A 2I24N 1S9WB 4OZIB 4RGNE 4E0RB 1CBVL 5D2NE 3MRFA 4QRRB 5F3BB 3HUJA 4ZOEA 1PW3A 2CR3A 3LN5A 1MHCA 3CFJB 4ZTPH 4TNWK 1RSFA 4Y19A 4GXUM 1UM5H 4X83A 1LWRA 4EQ3A 1DQML 1IVLA 5FM8A 1QRND 4MD5A 5K9KB 2EO9A 1HH9B 1XGPA 4HXBH 5EO1A 4WFFD 1G1CA 2E7MA 4Z5RA 5EFIB 3VXOB 4X98B 3VA2C 3JTTB 1MCWW 1DANT 2F8OA 3RWEB 1EGJL 3LCYA 4OGZA 5B38G 1HKLL 4JANA 4GKSB 1ETZB 1FZKA 3IDYC 2BCKB 1GIGL 2BP3A 3P9WB 4MWFA 4R4FH 3U0PB 1A2YA 1Q72H 3MR9A 5CKGA 1UJ3A 2X9XA 3UTQA 1U91A 2VAAB 1JWUB 5T3ZD 4G6JL 4LRNH 2OMBA 4PJGA 1DDHA 3DARA 3STZB 3SO3C 5ADPH 4JKPL 1R3IL 4WV1C 4GUPA 1VEMA 5CZKA 5FV2A 5AZEL 3BP4B 4G8GA 3K3QA 1I9IH 1L7TH 4JG0H 1CD1B 4M48L 3IDJB 3B3IA 3QHTC 1E4XH 3HPJB 2J8UB 1CDYA 1DBKH 3G6JA 3BIBX 3BKCH 4LLQB 4MXVE 2G5RA 2IQ9H 4JPWL 4L3ED 5DEZA 5ICYA 4CKVX 1WBZB 3QP3A 2NY3C 4I2XA 4OIBA 4I3SL 2E27L 3LEVL 1DQLH 2JJSC 1ZA3B 1RUPH 2L7JA 1BQSA 3T0EA 3HNSL 1S5IH 4HKZB 1QG3A 5F3BA 2Z92A 3RTQC 5KS9F 3DX8A 4RFEB 4XPAH 3FB6A 4JZOA 5IHZA 1C7SA 4Z7QF 4BQCA 4NPYA 2GJZB 2ZJSH 1UFUA 1MHHB 3AC0A 3O6FB 1QSEB 2OTPA 3HZKB 2XWJB 2DQIL 4YBLC 5ETUB 1NBZA 1IAIM 4HUWB 4XZUB 4LPCA 3IETB 4FQQB 2EH7H 1JGUH 2EDNA 1QBLH 1QLFB 1VADA 1TDQA 2A9NL 2XZAH 1EMTL 3PWUB 4FQJL 4P9HH 2WINB 5EOCL 2VXUH 2EIBA 4P3DA 1WV7T 4OLEA 4OI7A 4LRIC 3CVIL 4JRXD 2R4RH 1A7BA 4I77H 5EUKA 1D6EA 4ZO7A 3MACL 1U8JB 4U1SA 4PJ7B 3EYSL 4IOFC 2JJUA 1FQ9C 5AG9A 3UTQB 2P5EA 4O51A 1RZGA 4OJFL 1I75A 5LGHH 1NGZB 4R7NA 1OAZH 4CN6A 2MCG1 3QWOB 1F90L 1OT1A 5D1QB 4PJXE 3Q6GL 1EHXA 4RISL 1S8DB 2EYSB 2HFGL 2ARJA 2EZ0C 3EDDA 3REWB 1OHQA 1U8QB 2X1XR 2BOCB 3LKOB 3MPCA 2VISA 4RX4D 2APVA 5GRVL 1D3CA 4JM2D 3IDJA 3RTQA 2C3HA 3DUUB 1FGNL 5HHMB 5I1JH 43CAA 3QZWB 2R1YB 5FB8B 1MF2L 4Q9QL 4KK5C 3JWNC 3S3PA 2EO1A 1ZTXL 3S34H 2ZJSL 1AHWB 1TNMA 4BQ8A 1QHPA 2E3VA 3HR5A 1S9VA 3CFDA 1IAIH 1V05A 4R3SA 4V1DD 4AT6B 5IGXL 4X80H 5GRXG 2AK4A 3BE1L 4UINH 2DQEH 1Y6KR 4NO0B 2A9NH 3BZ4B 4FFWD 1AFVH 4GAJL 1IGYA 3FCTB 4X6CA 3UTSD 3GSRB 1XIWB 4ODXA 2R56H 3LV3B 5ECJE 3VXUD 1TQBC 4PJFB 5KSBB 5CMAA 3GHBH 4QXGH 2CLRB 5T3ZH 5IMKB 3RPIB 3TT1H 2WBKA 3WLWD 2PUQT 2FEEI 3SOBL 2EDBA 1MCFA 1FL6B 2L4OA 3IAQA 4LBEA 5AAMA 4NKIL 1A6UL 2AK4B 3HPJA 4FQCH 4WWKA 1VA9A 2RR3A 5FA3B 5F8RC 3O45B 3V6ZA 1NGWB 1TZGL 1T5WA 4K7PH 3C5ZB 5JW5A 1G9ML 2MQ0A 4KVCL 2IANA 4HGWB 2VQUA 2WUCH 1RIUL 3O4LB 4NQDB 3L3KB 1J0YA 1U8LA 3GSOB 5GRYA 1HNFA 1F4YH 4MS8D 1J8HE 4KK8D 5JDSA 3OF6D 4UT9L 3HG1E 4UTBL 4DKFL 1CXHA 3PDDA 3KJ4B 4J1UB 4MXQC 5IEHB 2AGJH 4ODBD 4WI9A 3G5XA 2RBLA 4O5LL 1NAMB 2VDKL 1HYSD 4HIHB 3SJVD 4UUJB 3BJ91 3REVB 4BFEA 4GBXD 4YIQA 2FEDD 1NCAH 1G6RH 2K9UA 3IJYB 2W60B 3TBWA 4TULL 4APQB 4MVBD 1GIGH 4IOSD 3IJHA 1QSEE 3CFDB 4R3SB 4AT6A 1CBVH 4V1DA 1VGEL 4PJXF 4F37F 4OZFA 2NLJA 5DJZA 3OXRA 4ZUWA 5MEOA 1F00I 1S9YA 1UACL 4PG9A 1A7RL 3H9HB 3FOLA 3DYPA 5L6YL 4HHAA 3VFUB 5FGBC 2VZOA 2XZQL 3HUJF 5DJDB 3V0AC 1A3LL 2J88L 3F65A 1AH1A 2AI0H 3FHAA 2BOCA 4KVCH 1JPFA 1BMGA 2ZOLA 5IHZB 1A3RH 5I1IL 3CSBA 4ZUVA 3BHBA 4G3YH 4WU7A 1HOCA 4RMSA 4PD4K 2BNUA 4KRNA 3BGMB 3R1GH 3CU7A 3IS0X 2LU3A 4KDVA 1BZ7A 5GGQH 5JTWA 1EO8L 3A6OA 3H9YA 3NCBB 4H88H 4XNZB 5F72S 2CD0A 1MFAL 4JPIB 4GAYB 4X7FC 2HVKA 1UWEL 1ED3B 2Y07H 2OL3A 2DQJL 5A16A 1JRHL 1IGTA 1UZ6F 3MNVA 4U1MB 4KRPD 4YGVA 1KF9B 3IDMA 1GGCH 2PCPB 3KLAA 4RMVA 3PV7A 2QJDA 5DJ8B 4FMFA 5IEHA 1NAMH 3BDBA 4MD0B 3EJJX 3G6JE 2D7OA 3TZVC 3LEXA 2ZCHL 3QEQE 4OCNC 3DV4A 5EU6E 3E6HA 3UJJH 1JL8A 2J8HA 3MRHB 2Y36H 5DTFB 4H26A 4KHXL 3VRIB 3LSOB 1J05A 1KLGB 1SBSL 4LHUD 3EYVB 4G6AC 1Q0XH 5I1KL 3PWUA 2WZPD 1WAAF 3EDFA 2GK0A 4U05A 2R4RL 3LIZH 1KJ3L 2WUBH 1FAKT 5DRZA 4GRLD 5GGVL 3RJDA 1W2KT 3VFTB 3ZT6A 2J2ZA 1AGCA 4NQTA 2NY2D 2NY6D 3HE7B 1UKSA 4ORGB 1MFBH 4LLUA 1RHFA 5DSCA 4MAYD 4OSUL 5F7EL 3QEUB 5KSAC 4XHQA 3V4PL 4LNRA 3QNXA 1KENL 4GMTH 4MQ7A 4G8FA 1TPXB 4TSBL 3TN0B 3O41B 4QHNA 4FABL 1BEYH 2VKWA 4H25B 3RI5F 4PRIA 4IDLA 4P2OA 4UQ2A 4ZNEA 5JDJA 1A6TA 4LSQH 3EJYD 1NANI 5CJQH 4KV5E 4NRYB 2B2XH 2JE8A 2Z8VC 3O0RH 3R8QA 1CT8B 5KG9B 4QRQA 15C8H 1PZ5A 2Z31A 1RZKL 4S1RL 2N56A 1MPAH 4XCEA 1XT5A 1R6VA 2XRAL 5JORA 1FPTL 4PRHD 1L6ZA 1IQWL 3BKML 2NZIA 1R3JA 4F7TA 1ED3A 2VR9A 4TRPH 4P4RA 1TFHA 2X4TB 1CFNB 5C6TH 1W0VA 1C5CL 3BQUB 1G7QB 5C0CE 1HQRB 4H1LA 1GGIL 4HF5H 1UB5B 5EBMA 1DQDL 3DRQB 2NTFA 2UWEA 4UIMB 5DD0L 2R0KL 3VFNA 1JK8A 2YPLE 1SY6L 1U8KA 1G0YR 5JQ6H 5CP3A 3VWJD 5I75C 2XWBB 4XH2A 3AS0A 2V2TB 4YZFE 3QPXH 3C60A 1OWRM 1B2WL 3H9SB 5HGAA 4HXAH 2F8VA 4PJEB 5JORB 4RMWA 5SX4I 3TO4A 4G9FD 4NOBA 1T3FB 5GQBA 1U9KA 4O2EA 2EDYA 1FAIH 1CK0H 1ZTXH 3ME0A 3ULUL 2E9IA 1S9KC 1UEMA 2BHYA 4LPVA 3O3UN 5D7LE 2HH0L 4XZUA 2HT4C 1KCUL 4P23C 1I9EA 4YHKL 4U7KA 4ZTOH 4NQDA 5L2JB 2W9EL 4FFVC 1AXSB 3C60C 1U41A 4RGMC 1JGEB 5BMFH 4DEPB 1DEDA 1TLKA 3OKOB 5SWZB 2CDGA 3TWCH 4O58L 5JO5B 1NGYA 4LEOA 1HNGA 4RGOL 3TNMB 1KJ2A 5CBAA 4P2OB 3TH4T 3BPLB 4PJ7E 2D31B 2LTQC 2VOTA 3QH3B 5T33H 3VMOA 1F6FB 3BFOA 4IRJC 1D5MA 5GSRA 3VGAC 1BQHA 1WWWX 4IOIB 4GBXB 2NCMA 3FB7A 3AB0C 3KAAA 3OJMB 3WE6A 4BSWB 2X05A 5DD5H 5C86A 3FFDA 4XXCA 2JF1A 5JPNB 4OLVL 5C0RL 4PGCB 3SKJL 5JUEL 3KYAA 1RIUH 3MGTA 6FABL 1AQKH 4OV6F 1L9NA 1OB1B 3HZYB 5GRJL 1BFOA 1ZGLP 5SWSA 1KCVL 3HE7A 4KAQL 3SDCA 1QBLL 3AY4C 3BISA 1YNLL 3L95A 5IW3A 4QY8B 1AQDB 3CSGA 3TLRA 2DMCA 4IM8A 4LL9A 2H32H 4OLUL 3QDME 1U91B 2VAAA 2AABL 1K4CB 2LVCA 1VSCA 1F6LL 3MX0A 4TQEL 4IRSC 1DFBH 1KTRL 1F58L 2G60L 1L0XA 4Y5XC 5DJCB 4Q9BA 4AQ1B 5I1EL 4BFBD 2DJSA 2PXYA 2X4PA 3QHFH 4PJAA 1OD9A 3OZ9L 3KJ6H 4OCRL 4PRPE 5BVPH 4LCWB 3SBWC 4IRJB 1YNKL 2ENSA 5LGHL 1MEXL 4YFLF 3BQUC 3FCTA 1D5XA 4HPOH 4X6CB 4XVSL 3PIQB 5GS2D 4JR9L 4GT7A 3BPOB 2Y72A 4OZGE 4U6XB 4N5EC 3CXHK 3GSNB 5E56A 2O61A 2WW8A 3T04D 3RWIA 4ODWA 1JZ5A 4R4BA 5FA3A 1IT9H 1OP5K 3KPSE 4PLKD 4PTTA 3DECA 1MOEA 3KYMA 4F15C 3L9RA 3GSNL 1KTLA 1U6AL 3SE8H 3NCYS 1PBYA 5HYSA 4NN6C 1WBXA 1NGXA 3SDAD 4X0KB 1D5ZA 3C6LD 2CUIA 3W82A 1UC6A 3ZTNH 1HQ4A 3VFSA 3RWIB 3RVXD 5GGSA 5IJKC 5I9QC 4GW4A 5D4QA 3P9LA 4FTVA 1EJOH 2XQYG 1M7DB 3QO1B 5JW4N 1DZBA 3BW9B 3MLUH 5L2KE 1FHGA 3Q5TA 3QQNA 1KC5L 2AEPH 2D7QA 2P8PA 4JRWA 4ORGA 3VG0L 3BRGC 3EYFB 4FQXC 3BIKA 1N5AB 1MI5A 3K46A 3GBNH 2NQCA 3WIHH 4F2MA 4M7KL 3QEQB 5BXFB 1RJCA 4K9EL 5JHDD 2BNRA 3QIUA 4OM0L 1PAMA 2BERA 2XN9D 4OM1H 2HRLA 3I50H 4QRSB 4DKEH 1LO5B 3DI2B 3AY4A 3RDTC 5IW6B 4XBPA 5HHQB 1J86A 4YHNA 4BYHA 4Y5YB 3C6LC 3QFJD 1Z5LA 1DDHB 3STZA 2CK2A 3QZWA 5C0CA 3QIWB 4OZGB 4PB9L 5DS8B 1SJEB 2N4IA 3EO9L 1NQBA 3FO1B 3MLSL 2F58L 3L5XH 3QWRA 4ZNEE 2XY2A 1IEBB 1SVZA 5IK3B 3MJ8B 3SKOB 2PYEB 1J1OH 4F7TB 4MB4A 4LCWE 5IB2A 2ICEA 4YHPB 5CAYB 2FYYA 1H8SA 2P5WD 4ZYKB 5LBSH 3UBXG 5C0BE 1EEUA 2Q76A 4J8RB 5IJKA 3ARZA 5B21A 2UWEB 4UIMA 5DC9B 1FIEA 2EDHA 2QTEA 3BKYL 4PS4H 4LFHG 5FDWA 1RPQA 3MV9B 4TPRH 2P47B 1HXMA 3RY5A 2YUWA 4FS0A 1KFAL 5IWLA 5ITFA 1PKQA 3D39B 4HJJH 1D5ZB 3F58L 5CSGA 3SKUD 1A14H 5AG8A 1H15A 1MCLA 1G7PA 2VB5A 1FIGH 4TNVF 25C8H 2EIDA 1QRNB 4IMLA 3ZHKA 2NY1B 5BZWA 4ZTPL 4BQBA 4AG4H 1C5CH 4PV8B 5HYJE 5CZVH 3GSOA 3RIFF 1HH6A 5FYKH 4IIQA 2YC1B 1WGOA 3BWUC 2DI8A 3MA9H 5JOPE 5D7JD 5GJTH 5IQ9B 2BMKA 4B41A 1TJGL 2ZSVB 4BZ1H 4P9ML 3HZYA 4N5UA 1NDGB 1AO7B 3CUPA 3NH7L 4YHMH 4G9FB 3WS6C 3KPNA 4GXVL 4APQC 1U8JA 3DPBA 3QEUA 5LQBL 1QQDA 4K3DL 2C4FT 2GY5A 4Z95H 2GW5A 3WFBL 1INEH 2ADIB 4U49A 5C70A 5MEQA 2QSCL 3GBLA 3KLDA 4LCYA 3PGCA 1RY7B 1AD0B 4PGEA 3OX8A 3VXMB 5C71A 1BAFL 2A83A 2X4OB 3V6BR 3QO1A 4G9FE 1CTOA 3MYZA 4NKOA 3A67H 4NDMA 1IRAY 1FZOA 1K8IA 3WS6A 4QKXB 1ZLVK 1HSAB 3KPRA 5FIEA 3U9UB 2NY4B 2VDRH 4PJAE 4LKCB 1FNSL 1W72L 5BS0A 2WK2A 3ZDZF 1DFBL 3PWPA 5IQ7L 2DQCL 4RGOH 1TENA 1FVEA 3UC0H 3CMOL 5DFTA 5CD3B 3CZJA 3LD8B 4KROB 1WT5C 5A2LH 2FEDC 3X14B 4OTXL 5D1ZB 5C0CD 3I6KB 2DQTL 4KI5C 3QCUH 3T1FB 3BKCL 4NCC2 3BXNA 3CJJA 1EHLH 2LVEA 1TVHB 1PLGH 1H15B 5HDLA 1MCKA 2X4UB 1FYTA 4JKPH 2HLAB 3L7FA 1CFQB 5LWYH 1J0ZA 4WHTA 3DETC 4WI3A 1DE4A 2BNUB 1YY8A 5HPMA 2PXYC 3F7VA 1DVFA 2V2TA 4DCQA 2YA1A 1RJYA 3BDXA 1A6ZB 2XTJC 3ECBB 4OUOA 4R8WL 5ESVB 4X5XA 2OM5A 1OGTA 1XGTB 4HT1L 5IB2B 4XI5D 3W5MA 2P5WB 3RVVC 4POUB 4JO3L 2Q8BL 1JGVH 3MV8B 4NQXA 4Y5VA 3QFJA 4FHBD 4I2XE 4JFFA 1RUPL 1UQSA 3N85L 4G6ML 3SDCC 5I1GH 4X7CC 3U2SA 2O5XL 1A21A 1EMTH 1RI8A 1RJLA 4Z78A 4NZTL 2X6MA 4PRAB 2A2QT 4HC1A 3LSOA 4POZD 3OKLB 3S36H 1IM9D 1ZMYA 1H0DB 1EX0A 4K3EH 5KSBF 4IJ3B 5SX4H 4XVSH 3TPKA 4CVUA 4UNUA 1MI5E 3ULVL 3JTSA 4I5BA 4FP8L 2NY4C 5C8JA 5IW6A 3P73B 4HWEL 4MB5A 5EUOA 4JPVL 2F58H 1YN7B 3AVEA 3RA7L 4ZXBB 3G5YB 3BO8A 4DAGL 1QFWL 1B0RA 5EU6D 5I1KH 1N5AA 3QEQD 2X89A 4OM0H 3X3FH 4L1HA 4PGDB 3T3ME 3OR7B 4Q74A 4X9HA 1Q0YH 2A77L 1DJSA 1I1AB 4HIEA 2V5YA 4PJDE 1LQSR 3MGTB 1DVFC 1PJ9A 3RWJA 1BBJB 3SDCD 5INDB 1AO7A 4UU9A 2P24B 4CMHB 5T1KB 3T1FA 4EN3D 3QQ9C 4NM4L 3VWJC 5JIIA 2EE6A 4QGTA 4R4ND 4IS6B 4JFPA 5H8DA 1ZOXA 3QUMH 4E42B 2BSRB 3D18B 4IJ3C 2K1MA 2CMRL 1F4WH 2HJLA 3ZDXF 3AXLB 1A7NH 3DMMA 4F7PA 2ZWLT 1NFIB 4IOFD 1J12A 3I02B 4DZ8A 4YDVA 2B2XL 1FZMB 5JXEA 4WNQB 3MLXL 4OB5H 4XP1H 5EPMA 1KYOJ 3GJEB 4UU9B 1MH5B 4XP9L 5ID0B 4JHWH 2WIMA 4J3VA 5EWIL 3FQUB 1XCQB 1FNGB 3PWPB 1HQRA 3ESUF 1ONQA 1G1YA 3B2UD 3B2UC 3Q6FB 3L5IA 4PJIE 4FXKA 4M8QB 4F37K 4OZ4A 1EEQA 4M1CD 5EBWB 2GJ6B 1JWSA 2XWBA 2YD8A 1A6UH 1T7YA 3FOMA 3HZMB 5K93A 5JHLH 5ANME 1JHKH 5CJBA 5BOPA 3L7EB 1FL5A 3NA4A 3P9MA 3VI4F 5DQJB 4PRPB 3TBVB 3IDIA 3LEXB 4CL7A 3IDXL 1FNGA 1GC1L 2OXHA 2IMNA 1YYLH 3BP6B 3EOYG 4K71C 3UBXA 4HK0B 5JIHA 3KJ6L 2NTSP 1A5FH 1I9JH 3PV6A 1YEFL 5EBWA 4WJ5B 4HIXH 4G9DA 1JWSB 1Y18B 5E9DB 3P0YH 4TVPL 3SJVE 2E7BA 1ITCA 1QVOA 2F53B 1MWAB 1VFUA 3OWEA 3LKSA 4AJ0A 4NQXB 3WNPA 2UY7A 5IBUG 3MODH 3QQ3B 2HTLD 4FQ1H 4S0SD 3U36B 1ULVA 2EDQA 3IFLL 1JPGA 4KH2A 4R96B 4GRWF 3UYRH 1DN2A 2Q3AA 4CVWA 1JNLH 4BH8B 3CSPA 2OQJB 5GGRY 2O93L 4J6RH 4OZIE 2AGJL 2R15A 1P53A 4N5ED 4PTUB 4YXHH 1KCLA 3D18A 5C0BD 5F9DC 3UPAA 2P5WE 1AXTL 4TUOA 2WP3T 4XMPL 2M2DA 3JWOC 3BH9A 1SEBB 2H1PL 4NZUL 4LCWD 1DQQA 1RQ5A 4XBPB 3WNMA 2JCCF 3BDYH 1YN7A 5CINH 5TF0A 1F8TH 1N26A 1A3LH 5FK9B 4BFIB 4B50A 2XZQH 3MLZL 5IVNA 5C0CB 2GQHA 4F58H 2C26A 1NCDH 3FFCA 2B4CL 3PUCA 1CFSA 2JB6A 3VFRB 1MREL 1WZ1L 3PE9A 5JZ7C 5F3HB 2AQ1A 1YYLL 2OZ4L 5HVFB 4OD1H 2P24A 5DFWH 5J56B 5FM4A 4Z76A 4YHZH 1IGML 5KJRL 1WVZA 1MRCH 3QIBD 4JFEA 4XX1G 1XR8A 2ITCA 2PO6D 3NTCL 4H1LB 2O26U 2JJTA 3WLBB 4ELMF 5JHDE 3SGJC 4H8WH 3D0LB 5ALBL 2FRGP 4U1HB 3I6LD 1F58H 1FFOA 3QNZA 4P59H 1BJ8A 3QDAA 3BUYA 4DKEL 1KUMA 3KXFA 4WWID 3KNBA 1FFQA 1LP9A 3W0WB 1J10A 3JV6B 5H2BB 4MQSB 5L2KD 2VDRL 4M00A 5F3HA 5EPMB 2K7QA 3RA7H 4YH6A 4DGYH 5KN5A 4LCIL 4MDIA 4BM7A 3RDTD 1M1SA 5E6IC 3OPZH 2APTA 5IHBA 5MERA 4OF8A 4OTXH 5HVHB 2VDMH 4OD3H 4N0YL 2P48B 5B8CB 1JTPA 3MLTB 4YBQD 1OAXL 4YWGL 2E8YA 5LBSL 5C9JA 4XX1E 1TTUA 1Q9WB 3S5LA 4JREB 1FN4A 2DL2A 4PP1C 1MVUA 3JWDL 1VFBB 2QQLH 3EYUH 2MCPH 3BH9B 4NQCA 5DDHA 4YDJA 1ZSDA 4XP5L 4P46A 1LDPL 1M7DA 2GJJA 3QJFB 3WFHA 3JV4B 4NO5B 1LNUB 4P9HL 2FLRT 2P45B 3KYNB 4KXZH 3ARFC 4NQSA 2H41A 4HWBL 1RULL 4KTYA 1MLCB 2R0WL 1U8LB 2PW2A 3RPKA 3SDYL 1JVKA 4PR5B 4UNVA 3PHOA 3MRPA 2FO4B 4B53A 4QRSA 5IF0B 4M1GL 3GO1L 4H1LG 3R4DA 2NY7H 4M7KH 3DTXA 1G7MB 1IFHH 3FT2B 3ZSTA 4L3EE 3W9EA 2CUHA 5F96L 1BZ9A 3I6LE 1U58B 1I9RH 5CJQL 2CDFB 1SEBA 4JDZB 1HINH 3NFSL 2H2PC 2X4PB 1TQCC 5EDXA 3C5ZC 2E9BA 3H7BB 2P7TA 5E8PA 3VE0B 1X5FA 1YEGH 2VJXA 4KJQC 4WDIB 5HYQA 4P5TD 4ZO9A 2QQQA 3MZGB 4HIIA 2EKSA 1MPAL 5CSZA 4H5SB 4EVNA 4HSQA 3TESA 1DE4B 4V2BA 4PJHA 3IXAB 3STLB 3MOBH 1CFTA 1IGFL 1LMKA 5D7JA 5IP4A 4YHLH 3GSXB 1QSFE 3ECBA 4LSSH 2DQHH 1YN6A 4OCSH 3VFUA 4M7ZC 5E8EA 1HXYA 3LS5H 3SKMB 2ADJB 1RU9L 1TCRB 3NCJH 3WN5A 3EIFA 1JPGB 3PG2A 5IFAL 4XWOC 1BOGA 1FCCA 1JUFB 4KKBC 3C87A 1RULH 1JI1A 4PP2B 3WO4C 5F71A 2HAZA 1QZ1A 5T3ZL 2DL9A 4O58H 3Q48A 1IZKA 5I2IA 4XP9H 5D8JH 1LNUA 3E8UL 3GZKA 1AP2A 1KPUB 3ULUC 1Y18A 3ROOB 1FFPB 3NIGF 4X6EA 2VLME 1P84J 3JTSB 1S9WA 4OZIA 4BUGA 25C8L 4ZFFB 2MQCA 4PJGE 2VH5L 4WUUB 5D96C 4LRIA 4PV9A 1WFOA 4MNQA 2HKFL 1P9MC 2BFVH 4KJWD 3NIDE 4RGND 3C5JB 1OPGH 4HZAA 4NUGL 4KI1A 4RQQA 1ZHNA 5D1QC 3OKMA 3ARWA 5A2JH 2CO6B 4NSKA 1EGJH 2YPLD 3FQWB 4H0GA 5CD5C 5D2NA 1YECL 3OR6A 3IVKB 2XA8L 1VKXA 2BNRB 2CRZA 1KB9J 4LCYB 4H26B 1WFUA 2L7UA 3VRIA 4AEHL 5FHAH 4EBQH 4FQPA 5KVEL 2FL5B 1ORQB 1U8IA 4DN3H 1ZVSA 1NLDH 1INEL 4XC3L 5IMLB 4NC1C 1D7FA 4R97C 1RZFH 3MRIA 2ZNWA 2JJVA 2VZVA 3WFZA 1G6RL 4ZUSA 3VWKC 1I8LC 4DOHB 1CGSH 4ISVB 3ZE1E 5A43C 2YD5A 1QO3B 3BUYB 4EOWH 3VFOA 4R4NC 4YXLL 2XWTA 1MCRA 2V2WA 4P57B 4XVTH 5IMMA 2C3WA 1P1ZA 1EEYA 5F6HI 4WHYG 4NO3B 1YNKH 2CSPA 3AU1B 1KJVA 1NJ9B 3OXSB 4G6JH 1W8NA 3B2VH 2FBJL 3UO1L 3D85B 1TMCB 1QFUH 1GYAA 2W65B 2HJFB 4CBPA 4PGJA 1DQLL 3DGCR 2CR6A 3TC9A 2IPTL 1NCAL 1U3YA 3RGVB 1F2QA 2EXYD 1OW0C 4NQCE 3BIAX 3V6OA 1EXUA 3F7QA 3LQZA 3LB6C 4XWGH 2XNAB 5F21B 5HI5D 8FABA 1LK2B 3MV7E 1LEKA 5BV7H 4N0FB 4KRPC 2BVOA 3MZTA 3SEPA 1I7TA 3FB8A 1IC4L 4HIIB 5D2NC 1PGRB 2ESVD 1NMCB 3PL6D 3ULSA 4LU5H 2Y5EA 1OF2A 5C08D 3IXAA 3STLA 3GMLA 5FYJU 5TF1H 1G84A 1GGTA 3LN9A 3T2NL 2P1YA 3MRDA 1I8KB 2UUDH 2XN9A 2Z4QB 3GO1H 3WS3B 3G5VA 1EVUA 3OR6B 5CGYC 3L3GA 2ZUYA 5C08E 4EXKA 1WBYA 4OFVA 5I8KL 4N1EA 2ZUQB 3TFKC 2R4SL 3W11D 3HCVB 5JW4Q 4JVUA 4X7SH 5EA0L 2Z93A 3RUGE 2GSIB 5HI3C 4JY4B 5I19H 1R0AH 1HSBB 1UKQA 1JHTB 5JW4R 4JRXA 2W9LA 2VE6B 1H3PH 1I3GH 1XIWD 4YAQB 3PP4L 3UTTD 4GOSA 5GGTL 1Q94A 5CJ8A 1MAKA 1Q0XL 2ADFH 1OARL 2H45A 1UWEH 1D6EB 1U93A 3CK0H 4U3CA 5IESH 1YEIL 5HHPA 1B0GA 4RAHA 2EH8H 4YR6A 1CR9L 3PABB 2DI9A 5I75B 3IAPA 1QKZL 4MZ2A 1Y6NR 3GKWL 1QEWB 4K9EH 4M1CC 4BK5A 4LKCA 5BS0B 2F15A 8CGTA 1A6WH 2F54A 4GAGH 2W65A 1MJUL 1MWAL 1HI6B 3T08A 5CP7A 2FD6H 1A7OH 4M5ZL 3RJQB 3IFOB 4DTGH 1ZANL 2IPKA 4OIIL 5E99L 1ACYL 2HRPL 3LB6D 2BC4A 4L8CA 1PX4A 1ORSA 3WYRA 3DUSA 4IIQC 5J12B 4PJFF 2BSTA 1LK2A 1SBBA 3GK8L 3MNZB 1QSED 1CGWA 4PY8I 1CIUA 1RAMA 5IROA 4Y2DC 4ODUA 3LKQB 5DVOA 5KOMC 4BKLA 5JQHC 2O5YL 4WW2F 4YNYA 4Z7UB 2F54B 3FZUC 4JM2F 5E8DH 4QEGA 5KSVA 1JF6A 1QYGH 5HYEA 1D9KD 1R24A 1YEJL 1BJMA 4ONHB 1UKTA 1I1AC 5IMMB 1UB6B 4ERSL 3WCYA 1JTTA 1CDJA 3BPNB 3BZ4A 1P7QA 1R0AL 3ZL4H 1MCOH 5H35B 3P4OA 5HBBA 3U0WH 1YQVL 1CQYA 3JXAA 5TDPA 1KLFA 1UM6L 5DQDL 2VLMD 4AL8H 1J8HD 5E2JA 1UACH 3TBVA 3NAAH 4IEFB 4PJHE 4R0LA 4TNWF 3RWHA 1BBDH 3ARBA 2AJSH 4YUEH 1L4IA 1EV2E 5E2UL 5GS0L 3AM8C 3QDJD 3DO7B 4IMKA 3IVKA 4XPTL 3QIUC 3H3PH 1TITA 3HG1A 4W6XB 2YKLL 3VW3H 2DWEA 4XMLL 3HE6B 3DURB 3KHOA 1NFDF 1N8ZB 5CEZH 5BRZB 4WFED 3MOBL 5J6GA 4MB3A 3QWQB 5KSAB 1FC2D 4M7JL 3WL9B 2EYTA 5MEPA 2VDNH 3ES6B 4PY7A 5E4IA 4YBLB 5D2LA 3BEVB 3U4BH 4JLRB 3C5SA 2CGRL 3U4AA 3VXUE 1QSFD 3SCMD 1D6VL 3WIFB 4Z7VA 3LS4H 1IGJA 4L3AA 3P4NB 3SGKA 5JA8B 3PNWA 1SM3L 3OG6B 5CP7B 3IDGA 4U1SB 4UOJA 5DURD 3RHWF 3FKUS 1VFAB 2VDML 4OD3L 1MCNA 4X6CE 4DQOH 3PHOB 2FO1A 4LSTL 5LG1A 1NJ9A 3OXSA 4DVBA 1CYGA 4KVNL 4O2CA 2V6HA 1HQ4B 5D8JL 1XF3A 2J6EH 2VMFA 3FRUA 3QHZL 2YRLA 4NC2B 4L3CB 1WQVT 4WU5B 2G75A 4K3GA 2A74B 5F89A 2NX5A 4U6HA 5E6IA 3O8XA 4KJYB 4J3SA 3NPSC 1SBSH 1L7IH 2DIBA 3DUUA 4KI5F 3RI5K 2ICES 4OF7A 4QOKA 1MY5A 4N0UE 3MRQA 3MJ7A 2AJZB 1I85C 2CRYA 4FXGA 2P4AB 3ZKMC 2WLYA 1XF4B 3ZDYE 2AJ3A 4UZGA 2IFFL 4YFDB 4PJ5A 3VDAA 5E0QA 2AK1L 4UT7H 4TUKL 4F57H 3WLBA 1LO5A 3B9VA 3W2DH 4M7LL 1CLOL 3LKRA 5IB4A 3PL6A 1VHPA 5E6IB 2X70B 1XGYH 4ENED 5D7SH 1I8KA 4FFVD 4JRXE 3SE3C 2X40A 5ILTH 5DMIH 3WUWG 3EYQD 2H9GA 4M93B 1KLUA 3MFFA 1BX2A 2DJ4A 3HMXH 5IB1A 3ZKXC 2KQMA 2O5XH 1QPPA 5F96H 3PWLA 4BKLB 1FORL 2XN9E 1K5NB 4XVJL 3TBSB 3UTZA 4H88L 4XVUD 3RWGB 3ZE2F 3SDXF 5C0IA 1J88A 3NACL 3CC5B 4XPFL 4YC2B 3JUZA 3JV5A 4UDUB 4C4KO 4ZXBD 2VDPL 1C5DB 1KACB 3C09C 2D0FA 4HUKB 4PJCA 4WV1A 1Z9MA 4P2OC 2IANB 4DFHA 1T5WB 5HI4D 2XWJA 3RGVD 1U3JA 3QJHA 4Z0XA 2FZ3A 1EEZB 1A6WL 3U46A 3V0VB 1U8NB 3C9NB 5J7CC 3QIWC 5ACLA 1U6AH 2L0DA 4KHXH 4LK4A 1T80A 3B4NA 4M3JA 1FO0L 3U79A 4OCSL 1E0OB 2HTKD 3LMJL 3KLHD 2W0KA 1XF2A 3QI9C 3DO7A 1QLRB 5FYLE 1RJZB 2VL5B 2NW2A 2CRMA 4GH7B 3VGDA 1T22A 5T1DH 3EYUL 4Y4KD 1DSFL 1FBIH 4PJBF 3BT2L 1F42A 4M7LH 1J1XH 2VDOH 3L1OH 5GJSH 5C09B 2P44B 3GJFK 5FGCB 4ZUUA 2XKSA 5JIKA 1CL7H 4HZLB 3G08B 1SEQH 1M7IB 1IM9A 1U8HB 3OKKA 5D2LB 4Y1AB 5IBUB 5FOJA 3FT4B 4LF3A 5FKPB 32C2B 2A77H 4UQ2B 2LAAA 1AKJB 1WICA 2AJUH 2ATKB 3IU4H 4GRWB 5EC2B 5FYLL 2DOCA 5FGCE 4JJ5B 4ZTOL 5T3ZE 3H9HA 1PEWA 2FIKA 2VKXA 1HH9A 1XGPB 4DUVA 1C12A 1MCBA 5MEQB 2BK8A 2R1WB 3QO0B 1WT5A 4JFYB 1PY9A 4PRPD 5CIPH 5CCKL 3D0VA 4CUCA 2Q7YA 3G08A 3K1DA 3RWEA 3AS1A 5I66A 1V3MA 2NYYD 1S7RA 1DVFD 3O8XB 4KJYA 4ODVH 5EZIH 1KYOK 4CRPA 1BWMA 4ZS7H 2RB8A 4LVOB 3QDMD 3VXSB 1HOCB 2GSGA 1LEKB 1UJTA 4YQXH 5GS0D 2QL1A 4N0RA 3E6FA 4OCYL 1R3HB 3KYOA 1EH9A 3UBXI 4LVNC 4HUMB 3I75A 3V95A 4WUUE 4Z7VE 3MRLA 3ULSB 1GZPA 1WTGT 1OF2B 1ZS8A 3I9GH 5C3LD 2E6QA 1PFCA 4K8RL 3BX7C 3KLAB 4LOUC 5B38B 4C58B 1FL6A 2UWEE 3CH1A 5B3JE 2WBJA 3FTGB 3QUXA 2V5TA 3QUZB 3ARDA 3NPZB 3HZKA 4HJJL 1YPZE 4U0RB 4I48B 5MENB 5ICYB 1S7UA 2PYEE 3ROOA 4ZSOA 2NX5E 1EZVX 1I9IL 3D2UA 4KUZL 5IV2B 2QSQA 4JFQB 2Z92B 3O8XC 3WHE1 5DMKB 1G7LA 1OP5H 3KPLA 1VGKB 3SJVA 5EULV 1I1AD 4YAQA 1TXKA 2R69H 5DRNB 4HBQA 4XMPH 3RAJH 3ORJA 2EEBA 3U0WL 1RUKL 3D39E 3T65A 1MFDL 2Y6SC 3BAEH 5JXEC 5DVMA 3QG6A 5JOFB 3QULA 3C2AH 3QRFM 3ARYA 4NQUA 1JWUA 1CDUA 1BBDL 5GIRB 3VWKD 1LEIA 3QHZH 5I6XC 3ALPA 3DV6B 3MBXL 5E5RB 5DD3L 1MUJB 3LKNB 3MV11 5D7IB 3EO1A 3TYGL 2ARJB 4X5LA 1WEJL 4R97B 4QNPF 4APQA 3DBXA 4PLJD 4D2NA 3B83A 3E2HC 4EI5D 2ILLA 3QDMA 1BD2B 3GSVB 4X7SL 4MNGA 1BP3B 2FX9H 1NUGA 5SX5H 1K2DA 1AGEA 3ARFB 2VXUL 2R23A 2VZSA 4JRYD 4JB9H 4FXGB 2B1HL 4CAGA 5C0FA 1KJVB 2GFBA 5JIPA 4BJLA 5ALCH 4IDJL 4YLQT 2F9BT 4GSDL 3OKYA 5IVXB 3HFML 4I0PA 4OV5A 3PHSA 5BOZG 3RBSA 4UDUA 3CDFA 5DEFB 5B38A 1O7SA 5IW1B 3RDTA 1UB5A 3CH1B 4NO0A 1KN4L 1T5XB 1SJVA 3GKWH 3RNQB 2YD3A 4P4KD 3VFGL 4QO1A 1A7QL 3MGOB 2EDEA 3VD7A 5K9QI 2Y1VA 4GAGL 5ETUA 3BN3B 3AXLA 2FB4H 2CIIB 5E2TL 1MWAH 4YGAB 5AYQA 1CI5A 3OAYK 1TCRA 3WN5B 1H3WM 4JR9H 3TYFB 3GSNA 2O61B 1RUKH 1MI5D 3KPSA 5AUMA 5IQ7H 2B1AL 1I8MB 1QBBA 2P43B 2PW1B 2EKJA 4R4BB 1RJZA 3V2AR 2VLRA 4JZNA 4Q0XL 5AZ2L 5IM7B 2OP4H 4I2XB 3N1MC 5B39A 1IGYB 1ZEAH 2FEEL 2AI0L 1XR9B 5E8DL 5CGMA 1CFBA 4P23B 4JKWA 3NCMA 4HWNA 2AQ3A 3TVMD 1ZAGA 5T3XH 2Z31C 3C9NA 1KTDA 3QIUD 5EFIA 1KIUA 5D7SL 3HE6C 2EDOA 3S35L 5C92A 3MRBB 4PJ8D 4PJBE 5I1LB 3A0OA 1AI1L 4HWBH 4PRPA 4EI5C 1T21B 1EJOL 1M6OB 2GTZB 2R29L 4RFNC 3PV6B 3NACH 5IJVA 4NHUB 2IFGA 4HDIB 3D87B 4Z7WF 4M1GH 2H26B 6CGTA 3GI9L 5I15H 2GK2A 5FUOH 3BVNA 3VMNA 5JPMB 1NDMA 3HRPA 1B3JA 4ONFL 1F4XH 2YS4A 5KVDH 4K71B 4PBWD 1BF8A 5DRNA 1PDKA 1JWMB 2XTLA 1B88A 3QEGH 4OZFB 3IKKA 3QYCA 1NSNL 3V6FA 4G6FD 4LIQE 5E2WH 2YEZA 4JDTL 5FYJE 5DI8A 2V5MA 5DGRA 1S7QA 4XNMB 2PXYD 1T5XA 1A0QL 3SDXE 5JXAL 3LMJH 1RZJH 4PYHA 3BRDA 4GS7B 3OKDA 4FP8H 3VRLE 3SDAB 3MNZA 2FSEA 5DJ2A 1V3LA 1YPZA 3M8OH 4PREB 3LPWA 4P2RB 1V3JA 3CFCH 4LQFH 5T1LD 4LVNB 4EI5B 4QT5B 1MAJA 1OT2A 5D72L 2E7CA 3CVHL 4ELKB 1CS6A 3OAUL 5D1QD 1EA9C 1I7ZB 3QUMB 1T20B 1RU9H 4PRNA 4U7MA 1NBZB 2G9HB 4Q58C 3RY4A 3OGOE 1TVBB 3HC4L 3HR5B 3L3KA 4RIRA 2GAZB 2WQRA 1R5VB 5D9SA 2GI7A 1ZT7B 1UWGH 2Y7QA 5JOPD 1H5BB 1IC5L 1VGKA 2EE3A 3IT8D 3SJVB 5HYJD 2VZTA 1EFXA 3K4DA 5I15L 3EOAB 4LVEA 4F9LA 5EUKB 4Q9RH 3HE7D 3HI1A 3B9AA 4QHMA 1MLBA 4ODVL 2DLHA 1S7TA 5EZIL 5I1DA 5I1HH 4LSVL 4TNVK 4HJ0D 4K3JL 2BFVL 4MNGE 1UM4L 4ZQKB 5HYFA 3SE4A 5DT1L 1GGIH 3HG1D 4HF5L 1QNZH 4NRZA 3BRFA 5EBGA 3MLRL 3MV9E 4KK6D 1QBMH 5K59E 4HKXA 4YO0B 4Z7UF 2NXYD 3VW3L 5E08L 4YDLB 2Q86A 3ARBD 3FONA 5D5MF 2JELH 4OQTA 4HGWA 2H8PA 2Z35B 1MCJA 4OZHA 3CLEH 2HKFH 4LLWB 1FO0B 3QI9D 1NGQL 1OPGL 1UJ3B 4Y4KB 2I26N 4D8PA 4M7LT 3OB8A 3CDYA 4QHNB 1HKLH 3LN5B 4LMQE 1BZQK 3DIFB 4M4RA 1W0WB 1P7QD 3TIDA 3MREB 4NFBA 3Q3GA 2HFEA 3AM8A 5FUCE 3RVTD 3OAZK 4QT5A 3RZCC 2Y36L 1KB5A 4M6MH 3O2VH 3UTSE 4P2OD 1JHLH 4GFTB 2OL3L 3QFJE 3S6CA 4OLXH 5DJAA 2B1HH 1YEKH 4Q7DA 1ADQA 5DD6B 4H20H 2D7PA 2F5AL 5EIIA 5DS8A 1BGXL 4GKNB 3EUUA 5A2IH 4Y7MA 5J9PB 3HPLB 1S7SB 3KWWA 2ZG1A 5AZ2H 3GUTA 1JWMA 2NNAB 3NPSB 3V6FB 5HYIA 4GQPH 4HH8A 3DMMD 4LEXL 4ZPVB 4E9LA 4QXWA 4HC1L 2XIDA 5KSUB 2AVGA 3V5HB 3N50A 3V6ZB 4MXWH 1T04B 5BRZE 4PRIE 1C16B 1EFXB 3FT2A 1MHPL 3B8SA 4F7EA 4OLVH 5C0RH 2R2HA 5EZLB 1NCCL 5IVXE 1ZT4B 4G7YL 2BVTA 4QRTA 6FABH 4Y4FD 4TTDD 1IAKA 1KG0B 4KDTC 3MOQA 5HGAB 3HS0A 4CVZA 1J05B 2NY3B 3WJLC 3EYQC 4KGLA 4B7LA 1QFPA 4QRUA 1M7XA 3ARGB 4HS3A 3ARPA 3RNKA 1CZ8L 1WJ3A 5GGSY 1REIA 4NRZB 4NBZB 1FDLL 3D5OF 4WY7L 1IILE 2VXSH 1WCQA 3WD5H 3L3JA 1HILB 3O6KH 1F3DH 2G60H 4JN2B 4RFOL 4ZFZB 3JWOH 4TN9A 5EO0B 1UH3A 5I1EH 4P23D 3KYKL 1NAKH 4KQ3L 5B39B 3KPSD 4JRYA 3HAEH 3LRGA 1SMAA 2E7LC 4GAYA 3ULVD 2GT9A 5F1SA 5D7IE 5C6TL 1HEZB 4OLUH 3V8CA 5GHWL 4YQXL 3SHSA 1RIVH 1T66D 3T0DA 2V7NA 3DIFA 5DJ6A 4OT1L 1OM3H 3UDWC 4KKLC 4N1HB 5GISL 2OTUB 3ARDC 5D1ZD 4LSUH 1Q0YL 2DS4A 4N8CL 1P9MA 2DTSA 3QXTA 4X9GA 4APQD 3OZ9H 4HUXB 4KQ4L 4UAOC 4XBGB 3H0TB 4P3CL 1CGUA 3CDGA 5GGVY 5C2BH 4HK3N 4XP5H 3IF1B 2R1XB 4B5EA 2AEIT 3F7YB 5DJDA 5FM5M 5EU3A 4G42A 2IAMC 4RNRB 3PGFH 5CUSH 3IDXH 5D7LA 4YDIL 5TQ2H 5JO5A 2P46B 4LCUA 4CMMA 1A4JB 3QDMB 1YEIH 3RWJB 1FE8L 5TGBB 3LEYL 3GI8L 4GRLB 3HC4H 3M1BB 1BVZA 4FQHA 1HIMH 1YNTB 2AJZA 3U7AA 2OJEA 3MRMB 3WXWL 3WFCL 4N68A 4ALAL 3MUJA 4KJQD 4QLRA 1AC6A 1I1YB 3EGSA 5HHMD 2FD6L 2BY0A 3MJ6A 4A6YA 5TDNA 4U1MA 4P49A 3RKPA 1YJDL 5DA0B 2ESVB 5DEGB 1I1CA 2AXGB 4IRJA 3TO2B 3SKOA 2CKBH 4M6OH 4Y0GA 4LDEB 1NKRA 3T0VA 2X5PA 5FYKE 43CAB 2R39A 2IQAA 3O45A 3QCTH 3NIFE 1G7IA 4BZ2H 3MTRA 1JZ7A 1BLNB 2OJEB 3IKCA 1KLUB 4JFXB 4M8QA 3WEXB 1PKOA 1T1XB 4KROC 1BPVA 5E1AA 5EBLA 2NNAA 3T0XA 5EU4B 5E2UH 3T0EB 3WMSA 2FGZA 3OKEB 1MJ8L 1XGTA 2GAZA 4OBRA 4P4RB 4GLRI 2WNGA 1Z0MA 2OMNA 5T5NG 4JQVA 5JXAH 2I9TA 4WW2A 2HJFA 4HQQL 2Q86B 5CBAB 1JJUA 3TJHD 4PRHB 3LRSA 4JO4H 2D31A 1QRNE 5GGRA 35C8L 2EDLA 1KCKA 5D7LD 3PIQA 4YDIH 5TQ2L 4MJIE 5MENA 4PJFA 4A2LA 4BSVB 4NQDE 2DN7A 2M1KA 3RPIA 1XAUA 3JVGA 4PP1D 5FKAB 2YD4A 3EDKA 3NTCH 1W72B 2XKUA 4AIOA 1MHCB 2DYPA 3CFJA 4OZHE 1JYVA 3C8KA 2UUDK 3TIDB 1UJ3C 1NCWL 4FTVB 3TVMC 3WKNA 4XPHL 1QD0A 1H3TA 3B5HA 4HKJB 1Q9OA 4FFZH 5CHNA 3LDBC 3PF2A 4HBCH 4XCNB 1DBBL 2AEQL 4GG6F 1AQDA 3TCXA 3GBMH 1E4XL 3MGAA 3VXPB 5DQ9A 2AV1B 4K7FA 4M4PA 3BVNB 1KJMA 4JJHA 3T4AB 3KXFE 5DD1L 5ESAA 3T0BA 3QNYB 4DVRH 2OK0H 3O3DA 4FQ2L 4NBXB 5LCVH 4ZD3H 1L7IL 4PRHE 1X5KA 3VXMA 5L7XL 1X6NA 4U6YB 2A83B 2ATPA 4PG2A 4ZG1A 2BCKA 4K2UH 3SDDA 1S7VA 3L5WA 2NY6C 1HDMB 3FO0L 5D7KD 2IFFH 1HKFA 3RWFB 3EYFA 3TO4C 1NGPL 2V9TA 4Z9KB 3QO0A 4K55A 2NXZB 4MMZC 5DJYB 3A6BL 5E00A 3I02A 3T4AA 5DUMH 1IGIH 5F8QC 2JB6B 3QWRD 4LVHC 4MNQD 4DZ8B 3ARGA 3AMKA 1FZMA 3K8MA 2I5YH 5J1AB 1LD9B 4BK4A 2OL3B 3ZZ1A 3QDGB 3WFBH 4RX4A 4NT6A 1OP3H 4G43B 3G5ZA 2CDEA 5DWUL 2PTTA 3C6SB 4QYOA 4DGYL 4PRNB 4JZJB 1OTUC 5DR5L 1RK1A 3VGEA 1C16A 2V17L 2FBJH 1OP3K 5L2KB 1MFAH 1CGXA 4O2FB 3F7VB 4XVJH 4Y16A 4NHCL 1IKFL 5TQ0H 5E4EC 3V5DA 1DQTA 1P5UA 2IPTH 1CZ8H 1FG9C 5A1AA 2ZG2A 3OKOA 4P2YA 5SWZA 5FKAA 1HYSC 4POZC 2ZOLB 1QFWI 1IM3A 3O9WC 4MHHI 4OLWH 5TDOA 1YEHH 1V7NH 4XPBL 4ZOBA 3GMRB 4RMRA 5F6HJ 3TBTA 2AJVL 5D96B 3WSQL 5GS0C 3P11L 3NZ8B 5EU5B 1HN1A 2IG2H 3UO1H 5BV7B 4TSCH 3RFZC 3TPUA 2D9CA 3TH3T 3DMMC 4W6WB 3VXPA 1JE6A 1Q9WA 2VZUA 1RZ7H 1N64L 3ZO0A 5EOQH 3TV3L 1JF1B 1R5IA 5IVXF 3S34L 3FZUD 4G8GD 3QCVH 1EVTC 1FBIL 1JPSL 1DR9A 3K4ZA 3VGBA 2OYPA 1J11A 1RUML 3GIZL 2KUTA 2DQGL 5E94A 3RWDA 1Q8MA 4KKAC 4TSAH 4X6FA 3I84A 3SPVB 2DYPB 5DLML 4E41A 3DV6A 3RVWC 3DX9A 2GITB 3RX7A 3GJFA 4GW5B 4NQSB 1P4LA 2X4OA 3BPNC 4HG4K 4LGPB 1A1MB 5J0BA 2R29H 1TNNA 1WWBX 2YPKB 3V4PH 3F58H 1EBAA 1GGCL 4Z7VF 4KY1L 4RAVB 1WCBA 2IADB 5HHOA 4JFDE 3ILQC 5DHVH 5DRXB 3SQOH 1KN2L 4LSQL 1H3UA 4ZS7L 4X4YA 1VEOA 1HXMB 2ADGB 2OTWA 1NFIA 1E27B 3S5LG 3VGAB 2BY3A 2AJYH 1OW0A 3CU1A 2BVPA 1CTNA 2XG4A 5KTEH 1E6JL 1IAOB 4XC1H 4PG2C 1W0YT 3O6ML 5IBTL 5HI4C 4EUPB 2XY1A 4O9HL 1SJHA 1RV6X 4QRTB 4Z7UE 3MOAL 4N8VG 2J8UA 3QISA 3IKCB 1U92B 1QKZH 3RL2A 3JV6A 3LPGA 3A67L 3GSXA 4NP4H 3RNKB 5LXGL 4X8XA 4LLVA 1J0JA 3GB7A 2AEQH 4WVRA 2CDEB 3H9SD 2JK5A 1FL5B 2UZIL 4JN2A 3U9PH 4ODSH 1CIDA 4PRHA 3VWJB 5FDWB 1JFQL 5AAWA 4XH2B 4YBQC 5FHBL 2LFGA 1YJDH 5GZNC 3CFEB 5D1XC 2FH6A 4M6OL 2JCCE 1X5ZA 2AV1A 4K7FB 1K6QL 2R2EA 3KS0J 1PLGL 3BN9C 2LAGB 1EERB 1AGFB 3H2WA 3QA3A 1G6RA 1B0WA 1UA6H 4K7PX 4U1IA 3KPMB 1KIPA 2F53A 1U8OA 5I1CH 5BV7C 1IL1A 3BAEL 5B8CC 5HDBE 4KUZH 1A6VL 1MQ8A 5FHAL 4EBQL 1QRNA 2HWZH 2WINA 4PJ8A 3JV4A 1IQWH 5BZWB 1ZHLA 1UCBL 1T2QL 4PBXA 3C5JA 5CZXC 4E5XB 4GRWE 4GKZA 1N59B 3UYPA 3ZKXB 4G3YL 3TPUB 5ID1A 4YE4H 1KBGL 4DKDC 1PG7X 4V1DE 2DBJA 5EN2B 2YBRA 2C3VA 1FVDB 3RU8H 1T1WB 3TZVB 3NCFB 1X3DA 5JHLL 3GKZA 3OJDB 4MJ2A 4N9OB 5LAXA 4CDGC 3D25B 3TNNA 2CIKB 2DKSA 2AP2A 4W4OC 5HHXH 1HZHL 5SWZE 3H3PL 2Q76B 2OXGA 3TYGH 4NO2B 3B2VL 4EKXA 3FQRB 1TTGA 3LZFL 3MBEB 1CFQA 1OM3L 2QSVA 1EGJA 5I8KH 3IDUA 4MLIA 1CU4L 3K2UL 1YMME 3VI4E 4LSUL 3VFOB 2VITB 3ULUH 2XZCH 4Y16B 3VI3E 4P2RA 5ISZD 5HHNA 4JM4H 3CGTA 3DUHA 4JFHD 3WKMH 1K3ZA 1J8HA 5INDA 3HE6D 1NUNB 1D5IH 4O2EB 5E5MA 4G7VH 3RGHA 3BPLC 4ODWB 3FAXA 4WFGE 2IG2L 2V17H 1S9VB 5LJYH 3M45A 1Q9LB 3D0LA 2VLLB 1AGDB 5B4MC 5I1CL 2IBGA 2YSSB 1VACA 4N9GA 3HNSH 3H3KA 3SGEI 1U8KB 5T5FL 3PQYD 5EU5A 5HYSG 2DLGA 1FL3A 1YN6B 5IFHH 4N90E 3UROR 4GAFB 4QXTA 1UG9A 1SVCP 4Q0XH 2PCPA 5DRWA 1YYMH 3D0VB 4HLZH 3OG4B 4R2GC 1UENA 3MLZH 4GUPB 1S3KH 5EU6A 5ELIA 3MMEB 5HDOA 3ZDXE 1OSZA 3SKJH 3NFNB 3E6HB 3BW9A 3V0WL 4P5MA 3RL2B 4X6CF 1P69B 4MMXC 4FZEH 1WIOA 3D3VE 2EE9A 1MRCL 3DX9B 1AP2B 1KPUA 2RCSH 1IT9L 5D1XB 1FG2B 1XH3A 3V5KA 3GB7B 4GMSL 5GGTA 4EN3B 2FR4B 3FB5A 4G6FB 5DRWB 1C7TA 5HHOE 1JZ8A 3SE8L 2YRZA 1OB1A 1VFBA 5AWNH 4QRRD 1ROWA 1N4XL 5IG7A 5IIEA 2GY7B 2XZCL 1KENH 2ZCKL 5T1KA 1T03H 1PEZA 1U3HB 3D25A 3TNNB 5EOTB 4GG8A 3ARUA 1M05A 1ZK9A 1NFDE 4FQJH 4D8PB 4MQ7B 4NBYB 3MBEA 4Y1AD 2GHWB 4WEBL 4HUWA 4QHUB 5FYJL 3CVIH 1MWAA 1BFVL 2ZZUT 2ZUXA 4QRPE 3FQXB 5I8CB 3VD9A 4EN3A 2FR4A 4UB0L 4R90L 2PTVA 2NY1C 4PFEA 1IEAA 4XXDB 2YN5A 2NYYC 3IJYA 4GRLC 3QUXD 4R96A 5IB3B 3PWVA 1O0VA 1MF2H 1CG9A 1F11A 2GCYA 1RVFL 4HPYL 1F4XL 5BVJA 3N9GH 4TVSa 3EZJB 1P6FA 2NLJB 3OR7A 4P57A 2RFXB 2A1WH 3WLWC 3IFOA 4HJ0C 1X6LA 4U2YA 5LKNA 4NNYB 2IAND 4Q97A 4X5WB 4DTGL 1O7VA 1U95B 3NOIA 2IBBA 3GIZH 4TTGA 1NGZA 4R7NB 3C6LB 2I9LB 3ALXA 3LKPA 4DUXA 3GBML 4JY6A 1M4KA 4WDIA 3VWKA 4DGVL 3C6SA 5T1MB 3LH2H 1TJHH 4CDHA 4WFFE 2XQYK 3P9MB 4HWBA 4ESKA 5J89A 3PGDA 4HIJA 3FN0L 3O4LD 4PJIA 2A6DA 1I1FA 1DBAL 2W0LA 1KFAH 1KG0A 2OI9C 5HGDB 4PD4J 1NFDB 3FO2A 4R7DA 1LHZA 1RMFH 3R06B 4U0QB 3IDNB 1CLCA 1B6UA 5E2VL 5IQ9A 5TJWK 3SQOL 3D2UD 4FG6C 5GGUB 5DD5L 3OQ3B 2Q3ZA 1Q9LA 3MCLH 1KULA 2QADC 1IGIL 5ADOH 5JW5B 2ZOKA 3DGGB 2ICWJ 3TWCL 3DVIA 3TT1L 1KTLB 1WZMA 1GOHA 3DI3B 2Z4QA 4UTBH 3WS3A 3D1MC 5C9JB 4P2QB 1LK3L 2CDGB 4LQ1A 3MJ9L 3BWAB 1QRKA 2C3VB 2WSKA 4C54A 2A0LD 2X4NA 4KTDL 2CLRA 4XAKE 2NY5C 4K7PL 4GW1B 1TJIH 2MHAA 3Q0HA 1KCSH 3DSFH 4NDMB 4JFPB 5E6ZA 3U30C 5DRZB 1CICB 2E7HA 5IT2H 2DAVA 3MLTA 3GNMH 4NSKB 5I74C 4LCIH 1FNFA 3GJFB 1UXWA 4CU6A 4O5LH 3Q1SL 4YR6B 3I2CL 5L9DL 2E5EA 1N6QH 3J7HA 5TFSH 1A1MA 2IALB 2D7TL 5HY9B 1G7JA 4UOW0 1WISA 1B4RA 3M17B 3MRBA 4KWUA 1AIFB 4O4YL 4OZFG 1ES0A 2NY6B 5F9OL 3BUTA 1KJ2H 5IROC 3MRMA 2HLFC 4QTHB 2A74A 4ZD3L 3BZEB 4HIJB 1AE6H 4PJ9D 1M71B 3O11B 4MSWB 4WO4D 3GM8A 2BSTB 4FNLH 3LD8C 1A64A 5J13B 1F4HA 2XOTA 2WWMC 2V5SA 2XTJD 3NABL 3T1WA 1NCCH 5E8OB 4UTAH 2P5EE 4RRPA 1T4KB 2EXWC 4GKSA 1I3UA 3DX7A 4OZHF 4S2SB 4DWHA 5J11B 2PN5A 4ONHA 1NKOA 2ZOKB 2E8ZA 3W2DL 4GG6B 3V7MA 3ROLB 2Y07L 2V7HA 1WLHA 1T0NB 5DHXB 3VJ6B 4XXCC 5CEZD 3MRKA 4WHYH 5C09D 5A2FA 4M5YL 3V5DB 3JVGC 2IGFH 4P2QA 1YEEH 4NWTL 3C8DA 1BVLA 3WXVH 3R1GL 5LWYL 1Z3GL 1CU4H 1NUFA 3K2UH 4U7SA 5DURB 3VFGH 2FLBT 4XTRC 4AM0A 2VR4A 1HHJB 5DDHB 4WHTB 3WFDL 3VFWA 5KVEH 1ZSDB 1A4KA 4C57C 3OMZA 1KB5H 4L8SB 2MPAL 3Q5OA 3ARBB 5SV4A 5C6PB 2DBLL 3KJ4C 4PTUA 4EUPG 4ZXBA 1DQJA 4C56E 5C0EB 3GMMA 3ZE2E 4FTVE 3VFMA 3TIEA 1CXEA 2BVEA 5I8CA 5IBTH 4MYWB 1NMBH 4PRDA 1G9NL 5CJXC 5MERB 5BQ7B 4PY7B 4RRPG 4OJFH 4PJXB 2R9HC 1G9EA 1SQ2N 4MD0A 5BVJB 4JO1L 4S1SH 5HPOA 4KK5D 1IGJB 4JVWA 1N2RA 1BFVH 2PO6A 5HGHB 1CDCA 5C0EA 3GMQB 3LH2L 4K3HA 1GC1C 3SDAC 1MLBB 2D3VA 4X5WA 1HK6A 4PJ5D 1ORQA 3GHEL 4P46B 4Y88A 4J3WA 1MFCL 4WUUA 1DBKL 1LE5A 5HHQA 5BV7L 1A3QA 5L8KB 2X4UA 1KB9K 12E8H 5KVFH 4DUWA 4CADB 2CMRH 4KI5E 4Y2DD 5F89B 4Y5VC 2WM0A 4NJ9L 1DVFB 2FX7H 3O8XD 1WC7A 3PDGA 5IFAH 2W0FB 2EECA 2PW2B 2AERT 5K9OB 5DVKA 3LRHA 2DQEL 3DUSB 3GGWA 3RWCB 5E5MB 1GPOH 4NZRH 1F2XK 1X5JA 4IS6A 3QDJB 3MREA 4J4PD 1T1YB 3S4SB 4BZ2L 1DBAH 3QI9A 1I4FA 1YMHB 2XA8H 1ZT1A 3BGFB 5GRUH 5L2KA 4D9LH 1MHEB 4GO6B 4WI6A 1A4KB 3QZWG 4R90H 1PKQE 1UT9A 2ZNXA 5EC1B 1B2WH 1KIRA 3O3BB 5E70A 4OLYL 2BSSA 2OSLB 3HAEB 4NGHL 3H9SA 3I6GA 4NRXB 5EOCH 3UX9B 3D39A 1Z6JT 4KK8C 4GKOA 4MA7H 4LARH 1I1RA 3GMMB 1U36A 3QUYB 3LQAL 1VERA 3S97C 4ZAKD 3HNTH 2Y25A 3DRTB 3BP4A 4RGNB 4YK4B 1SY6A 1URLA 1ZXQA 5JOEA 3WKML 3HE7C 5F7NC 1C5DA 1G7QA 1A0QH 4OLZL 5MP6H 4UT9H 4J3XA 3SGEH 4KUCF 1RZFL 3CFCL 3FQWA 1PG7W 1QFUL 3BPCA 3L3GB 1QFWM 3O3EA 2DI7A 4YXLH 4OI9A 2AKRA 3DSFL 3V6OE 4K8RC 1IL1B 4J23A 3IDIB 3F62A 4PJEA 1LO2L 1OWWA 4M8VA 4HS3B 2C4XA 5AD0B 1FNEB 1PD6A 5C0DB 1KT2B 5DD1H 1ZHLB 1ACZA 4BH7A 3VFMB 5I9QB 2BJMH 4X7EC 3TH2T 4MAYB 5T1LA 1MI5B 4MNHA 4O02L 1JZ2A 5SWSD 2YBRB 3DOSA 3T2PA 2DQCH 3HCVA 3ULUE 4DVBB 1PG7H 1OGAE 3GRWH 2A6JA 1YC8A 1C1EL 4ZAKA 3VXSE 2YK1H 1T1YA 3P4MA 3QH3A 4TVPD 2WWKO 3OGCA 2H1PH 4NZUH 4WHCA 3QG7L 4ZMAT 3JBG7 2HJLB 4WO4B 3MRKB 5CFHA 4F7PB 2KBGA 3QUKB 5I71C 5GS0H 1FLRL 3IFPA 4ZSOE 1J0HA 1HHKB 1KELL 4JG1H 1DQMH 3SKMA 3SGKC 4YZFF 5E9DD 4D0BB 4HPOL 1FGVH 4D0CB 5E8OA 4ZUSB 5JR1L 4M3KB 1T7XA 5I66B 3PJSA 1CD1A 4L8SA 1MREH 1WZ1H 3UBXB 2VDLH 2P42B 4JO2H 5K9OA 4ZO6A 2UVEA 4NC0B 3ZSSA 4XPBH 3HI6L 2C5DC 4RZCA 4ACPA 4NKMA 2ZPKH 1UWXH 3AB0B 2FJHA 3DVNA 4A6YB 3BSZL 4C83A 4ONGH 3CK0L 3WDIA 1IKFH 4F9LC 2MJWA 2OL3H 3BH8B 4UQ3B 2CKNA 5F1KC 3C60D 3KPRE 5HI5C 2MMXA 1GGBL 2XI9A 4HIHA 1KIQA 4MS8C 3WDHA 2DJUA 4G9DB 3OPZL 2ICCA 3MRJB 2IWGA 2DQIH 4OAWA 3TIEB 5JLZB 4LHUA 4UT6L 4S0TD 4OFYD 2FJHB 1ZVSB 4PR5A 5GS1C 2MHAB 4H8WC 1YMMB 4HKBA 3P0VH 4GG6E 4LSDA 2X7LA 3KPLB 3UZVB 2P8PB 3WNNA 1JYXA 2VLJD 5FK9A 5FUOL 3ZKQD 4LLDB 2E9WA 5FFLA 3IJHB 4UBDC 1D5BA 4PJDA 2W0FA 4M9OA 3MLYH 2DB8A 3MUGA 5ALBH 3QULB 4HUNB 1AO7E 1CLOH 4Y5XA 1V5JA 1R5WB 3DURA 4X8JB 2A38A 4RSVA 4JRXB 1I7RB 4BA8A 1DLHA 2EICA 5TH2B 4NO2A 3PWVB 1TCMA 3CXDH 4P5TC 5KVDL 3I50L 2BVQB 1SJEA 1Y0LB 3P4NA 2YEZB 4M7ZB 4Z7WE 3KNBB 4J4PC 3S37L 1BVKB 2C9AA 1TJIL 2HT2C 3WUZA 3BZFB 4LPYA 5DT1H 1OGAB 5CEYB 2DQFA 5KN5B 1WSST 2NY4D 2FWOA 4N8CH 2VLKD 1XR8B 4XMLH 3WXWH 4JQXC 4L8SC 5IHLB 4K9EC 1LO4H 2CXGA 5T1MA 2CLZB 5MEND 4CNIB 1IJ9A 3PL6B 1JI2A 3OXRB 4ZUWB 3IDMB 3UAJC 4LGRB 4OZ4B 3L5XL 1UWXK 5D71H 4UT6H 3S37X 4MA7L 3QUYD 1HDMA 4DKFH 5D72H 2W0PA 3SE4C 1IC5H 5BS0D 3G6AB 1Z5LB 2CGRH 2FBOJ 3HNTL 4HUVA 1ZV5A 1UXSB 1A7PH 3MJ7B 2APBA 4JGJA 4XBEL 2EEAA 3H6JA 4U1LA 4FQXB 4Y16C 4NO0D 1N0XL 2AJUL 5E00B 5DJXA 3VXRD 3NIGE 3TP4A 1RJYB 5ANMB 1C08B 4Z7UA 4PJ5B 1MJ7L 3PJSB 3T8XB 1Z2KA 5IFJB 5DYOA 1KEGL 3SY0B 1KT2A 2M8XA 2BSED 4WU7B 2J7LA 2DQHL 4AG4L 2NR6D 1OY3B 4MVBC 5B8CA 1RUAL 4QYOB 4JZNB 4YEEA 4PV8A 1UA6L 1JPTH 4KZDH 1EHAA 3EOAA 5FXCH 4TULH 2YUVA 1ND0B 2FX8L 3W9DB 1B0GB 3UYRL 3IDGB 5IHUL 1UCBH 4E0RA 5K9QG 4FQQA 1NFKA 2PYFA 1DANU 1QLFA 3B43A 2ICWI 4JFDB 4PP2A 2Y23A 3N1GC 4F9PA 4ZAKB 1ZE3C 1NANH 4LARL 4OCYH 1HHIB 5C0GA 1RZKH 1EO5A 3HKFA 4B7IA 1ZHKA 2FECI 4HMEA 2F53E 5KW9L 4XP6H 1XF5B 3FONB 3HMXL 1IARB 4C59B 1N3NB 1CLYH 2JIXA 4HLJA 5JLZA 5BRZA 2D0HA 1RFDH 4KRMB 2P7TB 1KCSL 1J87A 2MSPA 4OKDA 4XPFH 4J7RA 4NCC1 4YHYB 3RRQA 3V52H 4HLZG 2X7LB 5D6DC 1I1AA 5MI0C 5GZOC 1GRWA 1EK3A 1LO3H 4RFOH 3EO1B 1HWGB 3OSKA 3Q3GB 4LSRH 1ZGLM 5C7XH 1GGYA 2QLVB 2QV2A 3VCLB 1WC7B 2Y5TA 2HFTA 2VN7A 4AEHH 2OK0L 4CNIA 4EUPH 3O2DA 3IJSB 3PHQA 3QUYC 4TYUA 1QSFB 2C7UA 3SCMB 1U95A 3ULUF 1U8IB 3X3GL 3DMMB 4U0RC 3IFPB 4JFZL 4I77L 2RHEA 4LNVA 5LGJB 2BNQD 3MXVL 5ACMA 2EYRA 1X4XA 2HP4A 1K5NA 4JO2L 4WNQA 1DSFH 2BVQA 2H2SC 2H2SD 2DICA 4G8EA 2VH5H 3BHBB 5KSUA 1T20A 1WFNA 2NW3A 3BKJL 1ONQB 1QPXA 3UMTA 4LVHB 1FDLH 3RVUD 5MI0B 3AU1A 5HHOB 2WUBL 1WEJH 2P5WA 2DTMH 1P4IL 1TZIA 4JAMA 1ZWIA 5KW9H 4D3CH 5MEPB 1EO8H 3MV01 5I1JL 2BNRD 3G04B 5IFHL 4QWWC 2FCBA 4KK6C 5TPWL 2EC9U 1KPRA 2NPLX 1OTSC 4XPGH 2JB5H 2DQJH 3QEHB 4L4JA 4L29B 2IGFL 1D5BB 3T3PF 5C0GB 1IAOA 4MA1C 1BJ1J 4M62H 3THML 3TJEL 4WY7H 2NZ9D 1A6AA 4IOIA 1MVUB 3O4OB 5F7LB 5C0AD 1T03L 5DHYA 1P2CA 1VADB 4HWEH 1C08A 2CKBL 5E9DA 4LHUB 4XNQB 1GZPB 5C0IB 3B9EA 1JP5A 4LAQL 1QFWH 3LQAC 3X11A 3P30L 4GMSH 1QFOA 1RIVL 9CGTA 2DM3A 4WEBH 3ARQA 2XQBH 1Z9SA 4KFZC 4TOYH 1R3IH 3NN8A 5HDQL 3PWJB 4BH8A 1JMXA 2VQ1A 1U8NA 1U3ZA 2P5EB 1C8PA 4KQ4H 3T0ED 4LNRB 3B9KB 1MCDA 2J4WH 1K4CA 4MXQD 5D93B 5GPRA 1RZGB 3RP1A 4C4KT 5CIPB 3EYOA 2J5LC 2G5BA 4JY4A 4HPYH 1RVFH 4G42B 3WHE0 4AENB 4LPUA 1DN0B 1AY1H 5F6IC 4AMKL 5I76B 4PYGA 2QHRL 4KDWA 4LIQH 4QRPA 3BZEA 1N0XH 1X5AA 4PJ8B 5DA4A 2YOCA 3HB3C 1RK0B 1XMWA 4Z7QE 2X4SA 2D4FA 3W0WE 2VDKH 1PZ5B 1CFVL 3H7LA 4XPGL 3FFCB 2DQFB 4Y1AA 3V4UL 3RWCA 3DX6B 3MRLB 5D7IA 3HPLA 3KWWB 3FQUA 3ZKSD 3QXAB 2DIAA 3SDCB 2WANA 4PUBL 1DBBH 2XFXB 3OJDA 2DD8H 3OBAA 1ZT1B 4QWWD 4YDKL 3S35H 1KPRB 2Q8AH 1RMFL 4XBEH 2CLVB 2H32B 5EZJA 4OB5L 3O4OC 2J5LB 3VI3F 4NUGH 2DKMA 4ODXB 5ITBH 3WV0A 4CW1B 2XG5A 2BY2A 2X42A 2APWA 2MTPA 2P8MB 1QYGL 3F5WA 4AM0B 4CVZB 3S37H 5EBLB 1G9NC 4NN5C 4JFQA 2V9RA 5J6GB 4P2CG 1JNNH 4HXBL 2VYRE 3MJ9H 4WW2B 4X99A 3VXME 1KELH 2C1OB 3OV6A 1NCWH 3UDWA 1U8PB 4V2CB 3SKNB 1P4BH 2A9MH 1GC1H 4MLSA 1A3RL 5I1IH 5ADOL 1AGBA 3LKSB 4MD4A 4N0CD 4AIXA 3SQBA 3C5ZD 3CVHA 1ODAA 4ODHL 1A7OL 4M5ZH 4LAJH 2IAMD 1JYWA 2AKRB 4JCMA 4QXTB 4LCCB 5IBLD 1OAYH 5IKCA 1XZ0A 2K7PA 3NFPB 1PQZA 4RQQB 2R2BA 1X44A 1IKNA 3J8F7 2ATKA 5FCUH 3EHBC 4PJIF 3RVVD 4LGSB 4HUUB 4P99A 2FB4L 5I76A 2OBGA 3D48R 1AXTH 1NC4A 3K0WA 1GOFA 1DL7H 1MNUH 4I9WE 1CLZH 1ORSB 4RBPK 2AXFA 2R9HD 4U1KB 3MRQB 4JEGB 1F3DJ 2ED7A 4RNRA 5HHVL 1F8TL 3FFDB 4J4PA 3P9LB 2BMKB 3CFKA 5IB5B 5GZOD 1RZ8B 3VXNB 3U36A 2OR9H 4XT1C 2W91A 3P11H 1BFOB 4GRLA 1MCQA 1R24B 2Z91A 1AJ7L 1NC2B 1BVKA 1HCVA 2V2WB 5GSVA 3BQUD 3OGCB 3MA7A 5FDYA 4K3JH 1J8KA 5F9OH 2DLTA 4X9BA 3IS1X 3SO3B 4HHAB 4U33A 2MKWA 4HS6A 4RBPH 1AD9B 4TUOB 4KTEH 4TTDC 1PY4A 1BX2B 3FQXA 3DROA 3KPOB 4PLJC 1S7SA 2OJZH 2GTWA 3QG7H 4KJWC 4HH9A 2IBZY 3M07A 3TEUA 3VXQA 2XA3A 3O3AB 5DEGA 1BIHA 2ZSWB 2GYSA 1R3LA 2DDQL 1JF5A 3QEHA 3UEZA 2OZ4A 1CXLA 2VDNL 2I07B 1B4JH 4EVNB 1BQLL 5AYUH 1G7IB 4LU5L 4YHYC 2IQAB 2NTFB 2NY2C 5BCAA 2IC2A 2KL6A 3RU8L 4JY5H 1KB5L 3MLVL 3T3PE 2AJXH 5EU4A 1IAKB 5KSAA 2BHZA 1HH6B 3PWPD 4JFFE 2VLJB 1BIIB 1LEGA 2PNDA 4P48A 5IMOB 4LSTH 2CK0L 2I25N 5IKCB 2BRQA 2ITCB 3QUXC 3UTPE 4HEPG 1YEEL 4NWTH 1OAXH 3MQIA 1DP0A 1EJ6A 1KN2H 1NDGA 1I7ZA 1LO0L 2EXWD 5I0ZA 1FV1B 1T21A 2VSCA 2XT1B 5EIQA 4M48H 4JDTH 1D5IL 3VGHA 1TVBA 3MJGX 3QSKB 1A6ZA 4O2CB 2H26A 3OAUH 4X5XB 2DQUL 4HV8B 4TSAL 3ZYZA 3OX8B 5L0QC 5GZND 1TETL 4I3SH 3QFJB 4JANB 3A6CH 4RDQF 4PV9B 4Z7VB 1JNJA 1JV5B 4Y4HB 2DQTH 2YD1A 2FGWL 1IQDB 1BHGA 1D5MB 2WV3A 4OKVB 5GSRB 4XPAL 3H0TA 1ZHBB 2A6KA 4O51B 3MV7A 4Q6IB 1JNHA 4OGAD 2HFGH 5CWSB 4X8JA 2VLRD 4HG4J 5DMGD 2HG5A 4IRSD 4PRIB 3OKDB 3IU3B 3B9DA 5FYLH 5AYUL 5J4MA 4LIQL 3FRUB 1OAQL 3DROB 1IC1A 4YX2H 4HH9B 5C1MB 4JY5L 2VXVH 4M61B 3GHBL 4QXGL 4WO4A 4E41E 4NZRL 2EIEA 3NAAL 1CICA 2R1YA 4OBSA 3MXWH 4LP5A 5DFVD 4UILH 4Q6IA 4X4MA 3B6SB 4HIEB 3GEWB 2EYRB 2AEPL 1P1ZB 3CFBA 1RZ8A 3VXNA 5E1HB 1FZKB 1FCGA 2WUCL 3HA0A 3QDGA 2YWZA 5F1IB 5D5MA 2ESVA 1V8HA 4ODHH 3FB6B 4LSSL 2VR5A 3L3HA 4YE4L 1EO7A 2X70A 3DRQA 1DCLA 4YEFA 3H8NA 5DQDH 3UTTB 3EDEA 4FG6D 4UB0H 3TZVD 4JREC 4MD4B 4ETQB 2IEPA 4Y4FC 3WUWB 5FCUL 4XCFL 5J12C 4BSJA 1JNNL 1WK0A 4NQVA 4Q2ZB 5E1AB 3GSQB 4M6NH 3FFCE 3NFPA 1IGFH 1IM3B 3RIFK 4JZJC 4WUKH 3P0YL 4L4TD 4TVPH 1CXKA 5ID0A 3QUMA 3L3OB 3V5HA 3RKDD 1BGXH 2IPUG 5CP3H 2OX5A 4KK9C 5K9KA 3MODL 3O4LA 3T65B 1FIGL 3W9DA 2C1PB 1OAYL 3O9WB 2PETA 3FMGL 5ESVA 1V7MH 5E5UB 1AXSA 4FQIH 2Q8AL 3IYLW 3S96A 3CZFB 1CGTA 2H3NA 3QXDB 4JZOB 5C0JA 5DMGC 2E9JA 2WBWB 2WBJB 3FTGA 5CZVL 1JF1A 1R5IB 2ADJA 1NGYB 4I3RH 3IU3A 1VCAA 3TT3L 1S9XB 1I3RB 5FA4A 4I48A 3RVTC 1S7UB 4KVNH 3DNKA 2NW2B 3WN5C 3HRZB 2AK4D 4M61A 2VE6A 4GBXA 2DM7A 4D0DA 1ITBB 4M43H 1CDBA 2M26A 2ADIA 4JHWL 2HKHL 3SDAA 3U0TB 3ARFA 4ZPTB 4L3CA 3N1QC 1J18A 3DXAE 1P4BL 2A9ML 3QDGD 1X7QA 4X6DA 3JWOL 3ARBC 3OB0H 1UVQB 2X4QB 5GRZA 3I9GL 5J11C 2X44D 5KAQF 1IQDA 2XWTB 4OKVA 2AJXL 1HSAA 3KPRB 3ZHDA 2GSGB 4P2RE 4Y5YA 4JFOB 1RIHL 1OGAA 1F45A 1FGVL 3QQ4A 3PHQB 1OLLA 2G9HA 4OFKA 2AAVA 3EGSB 1FAIL 4G6KH 4FRWA 5DUPH 2DQDL 2GJ6A 3HC0A 4XP4H 3FO1A 4LASL 3FT3A 3FOMB 1YZZA 3REWA 1VB9A 1U8QA 1DQQB 1H3GA 4FFZL 4XWGL 3TCLB 3L7EA 2HTLC 1NLBL 3CIQA 4WCYH 5LGKA 4GRMB 4FNLL 3WIIL 1JK8B 3HUJE 5I8EB 4HWZB 5T3XD 4EEEA 1D5XB 3QXUA 3ZYOA 5EIIB 3EO0B 5KSVB 4GKNA 4J3OC 4IDJH 3TA3D 2G2RA 3IETA 1KJ3H 5GGVH 4YDVB 4HS8L 4EJ1C 2D2OA 3FQNB 3K1KC 3LEYH 2IH1B 3LOWA 5GS3A 4L3EA 1JNLL 1BFSA 4NO3A 1EAPA 4QHLA 5