2NCMA

Neural cell adhesion molecule, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
RVLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of the first domain of neural cell adhesion molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords NEURAL CELL ADHESION MOLECULE
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ncmA00
4KKAD 4RMSA 1M05B 4LBEB 3MOQA 1D5XA 4RZCA 4WI4A 3TLRA 4OCLC 4WHYH 5ALCL 3GHBL 3OKLB 2YUZA 5H35A 1NEZG 3BVNA 3LHPL 1HILA 1KPUB 1NL0L 4J3SA 1U58A 2Y6SC 5SX4H 5CGYC 4ZUUA 3HPLB 3I6GB 4HWZB 1M05A 4H1LH 5E9DD 5F7EL 1HXMA 1LGVA 2PETA 2YD7A 3UBXB 5EZIL 2VLJB 1C08B 2VLJE 5GJSH 3MACH 5I19L 1Z0NA 1YMHA 3D25B 5E99H 5F9WB 2EDHA 2BCKA 4I0PA 2Q76B 4Q0XH 1UH3A 6FABL 4OZFH 5C86A 1IILE 5JORB 4ODVH 1JF1B 5DC9B 4XVSH 5I19H 4RGNE 5FHBL 3BESR 1GZQA 3HNSH 3MYJB 4RDQG 3FO9A 1LD9B 2HT2D 3DXAA 1MY5A 5DZOA 1CE1H 5F7EH 1D9KB 3OKLA 3EZJB 1LO2L 2V2TA 2I9TA 4X6DB 1NC4D 2DM4A 4HT1H 2QLVB 1IC4H 3A6BL 3LN4B 1KCRH 2FLRT 5J89A 3QDMA 3MC0A 3MRHA 1IAIM 5ELIA 4FNLL 1ZVSA 5T3ZL 4F7CB 4MD4A 3WO4B 2VQUA 4GSDH 1MVUB 2DTSA 2ADGA 3BKCH 3O45A 4M9PA 3MRHB 4U0QB 1J7VR 4V1DE 1FIEA 5ESQA 2EDBA 2MNUA 1MFAH 4EXPX 4Y5XC 4OD2B 2AEPL 4JGJA 1FYTD 5IF0B 3RZWA 5EZOL 2X4OA 1FVCB 1OD7A 5ETUA 3MJ8A 1BQUA 1NDMB 1F02I 2XKSA 4WWKB 4LARL 3CU1A 5IHUH 3OKOB 3OPZL 3U6RB 8FABB 1QSEE 1C7SA 4KROD 3QIWC 3VMOA 3GMRB 5HPOA 5HYSG 1M71A 4PJEE 4JFOA 5FYKU 2A9ML 4OLXL 1BZQK 2G9HB 3RX5A 5FM5O 4JR9H 4IBLT 3QUZA 3SJVB 4RFEA 1WCBB 5DJZA 5HVGB 5D1ZB 4PV8B 1RZKH 3GSQA 4ETQA 3GMMA 4N1EA 3KPNA 1T7XA 4XC1H 1RZGA 4ETYA 1J0ZA 1GVIA 3HE7B 1OM3L 5I1LA 1T04B 4I2XA 4DVRH 3EYQD 1JWMA 3HR5A 3NPSC 1KTRL 4DUWA 1U8QA 2X70B 3W9EB 2Q86A 4I8DA 1HILB 4ZFGH 3IVKB 1B4JL 1A7PL 5MEOB 4LF3B 4MNHB 1G6VK 1FBIH 3V7AG 5AUMA 2H8PB 3PL6C 2F74A 2H1PL 3HC3H 5I18L 5IG7B 2Y7QB 1NCNA 3UTQB 4PLNC 4W4OA 2DMKA 1AIFB 4U6XB 2EYSA 5IROC 1F58L 4MB3A 4KQ3H 4MB5A 4K9EL 3AU1B 1BF2A 4S1RH 1SMOA 4ACPA 5MENB 3G6JE 2F15A 3QULA 3D69A 4OQTL 1YJDH 4XPTL 5EFIB 3RGVA 4JFFA 3W0WB 3UYPA 1BFVH 4UUJB 5E2TH 5E00A 3QRGL 3QEHA 1GJIA 1EJOL 4UDUA 2IBZX 4P9ML 3TVMB 2VAAB 2PYEA 1JNLL 4ELMA 5I8CA 5E6IC 2X4SB 5D7SH 5HHOA 2J5LC 5EUKA 5T1MA 1XR9B 4WI5A 2COQA 4HWBA 2AI0H 1P4LB 5JOFA 2G2RA 5LAXB 3BHBB 4N0FB 1VA9A 5HPMB 5GS1A 5FIEA 1LK2B 2NXZC 5JIHA 1A6TA 5D1QC 3UZEA 2QQLL 5DO2C 5DD5H 4F7MA 3BUYA 3EYOA 1AFVH 1KN4H 5C92A 2P24A 5I16B 2EXYD 1MFBH 1P1ZA 4LSRH 5CCKH 4G6KL 2HT2C 3BISA 4QKXB 1LNUA 4U1HB 3QO0B 3AS0A 5KVEH 1GIGL 5BS0A 2C1PA 4QYOB 1X5YA 4QHLB 5D71L 1I7TB 1WBYA 2FGWH 4HXBH 3K1DA 4BH7B 4EUPB 1IC1A 2Z8VC 4W6YB 1DTUA 1KGCE 2BVQA 1OL0A 4PY7A 4H5SB 4CN4A 5F88B 2N4IA 3DUUB 3R8BB 1XEDA 1N0LA 5FYLL 3UC0L 4ELMB 4JG0H 1I9IL 5C6TL 2A9NH 1NBZA 3AUVA 3DUUA 2ZP0T 1IKFL 4RFNC 3OKNA 2CQVA 2GJJA 1HKLL 3GK8H 1RSFA 2QSVA 2FH6A 2ZJSH 4QRQA 3PNWA 5IP4A 2GTWA 3W39A 4H25B 5A2KH 4KVCH 3GRWH 2WZPD 5IOPB 5TQ2L 1F90L 1Q9LA 4EI5B 4NQSB 2IH3B 4X4YB 5I17B 1T1XA 2YXMA 4LEXL 3ULVD 4LL9A 4OZFA 4DCQA 1CFQA 5GGSB 1DANT 4QLRA 1KJ2B 4YC2B 4G8GA 5HI3D 1NUGA 4XAWH 1XF3B 3RY6C 5JIKA 1BD2D 2WLYA 3HI6H 4QTIL 3BWAB 2AABH 2EO1A 5T1KA 1HDMB 1G9EA 2BVPA 3G6DL 3R1GH 4P57B 4YWGL 4DVRL 3KPRD 5F7HA 1NAML 1QR4A 3JV4A 1QEWA 4Z0BL 4MZ3A 5E8DH 1RUKL 3KS0H 1QO3A 5C07E 4L8SC 3CFBB 3C60D 3D39D 4LIQL 1FSKB 4BH7A 4NKIL 1K4CB 2OSLA 4U1JA 4MNQD 2VLRE 4NOFA 1ZVHA 1RIUH 3EHBC 3ES6B 2AK4A 2VLRB 3QG7L 3EOTL 2X4SA 5L8JB 2PXYC 4XBGB 5GGVY 4BUHA 3OPZH 2KDGA 3V8CA 1H15A 3VXRE 2Q87A 3QO0A 3P0VH 4I5BB 2Z35A 1LK3H 2E8YA 5GQBA 5CIPB 3U48A 3HZYB 5JHDB 5DC4B 4UDUB 2PUQT 3BZFA 5DJ0A 2F19L 5DQJA 5F7YC 4CNIA 3GIZL 3VXUE 2ZWLT 3HZMA 3OX8A 5ADPL 3U9UB 4LLYB 5E8OA 3KLAB 4WHTB 3GNML 2XZAL 1FE8L 4Z8FH 3WLBB 5FGSA 1N0XH 2CLZA 4X6CF 5L2KD 1LEIA 3TO4D 3RWGB 4L9LA 1MLBB 2PO6D 2VE6A 1E4KA 3GIVA 3O8XA 1EZVX 5ITFA 4FQHB 4GUPB 2OCFD 3PHOB 4Z8FL 1OTTC 4MD5B 2CK2A 2B39A 3ZYOA 3MLXL 2XN9D 1NC4B 1SEQH 4HPYL 1IAIH 3G5XA 3JTTB 2H32A 4KKCD 4YNYA 4XHQA 5A2IH 3ZYJA 3HZKB 3BRGC 2WWMD 4DFHA 2JCCE 2X1WL 4KDTC 4OF7A 1WF5A 5I8KH 2YD2A 3P0GB 5E2JA 3GBML 4OF8A 2CLRA 4JFFE 1KJVB 2CJUH 4QXTA 5DQDL 3QG6B 1INEL 4ZUWB 1RPQA 4HKXB 5I1IL 2X4OB 2CIIB 4OFYD 5C7XH 4OLZH 1OGTA 4C83B 1DLFL 4R7NA 1U8OA 4YDKH 1SM3H 3BEWA 4OCRH 3QJHA 2BRQA 2V17L 4MD0A 1I7UB 3VXNA 5HGDB 5GZOD 3BDYH 3RIFK 3WIFA 3TO2B 1RJCA 4P2OA 3MV7A 2XI9A 3X17A 4MQ7A 5IW1B 4OFDA 5DD0H 5BO1H 3TO4A 5IB5A 5D96C 4DWHA 1JGDB 1QSFB 4JKKA 5D6DA 2ADFL 2JB6A 1T83A 3CAFA 5ID0A 2WBWB 5H35B 1Q9OA 1CGUA 3WFBL 1ZV5A 2D0FA 4LSPL 2CR6A 4PP1C 1PBYA 4YWGH 5LWYH 4XI5D 2W1NA 3WN5A 1LD9A 1PX3A 4X99A 5BXFA 1TVDA 4JO3H 4UILL 4M8QB 4LBEA 2ESVD 3LEYH 5D1QB 3BKJL 2P42B 1TDQA 3MUY1 1IT9L 5DF0A 3ULVC 1UZ6E 4MD4B 2H3NB 5TQ2H 1S7UA 4J3UA 5HDBE 4LDEB 4FQQA 3MBED 1ZVYA 1W72H 5A3ID 1OT2A 2GTZB 5INCA 4OZHA 2YBRB 4R3SB 3M8OL 2HT3D 2DBJA 5FKAA 5B8CC 3KNBB 1E4WH 4OZIF 2M8XA 4GW5B 1XMWA 1E6OL 5F7MC 3ALPA 3DX7B 2HJFA 3S8WA 2KQNA 1U8PB 2GJZB 2VDMH 4NZUL 1RU9L 4XPAL 1QSZA 1TJGL 4CGTA 2GTZA 3GJFK 1XGRB 3S96B 4IRSD 5KVMC 1RK1A 4MJIA 1N5AB 2O5ZL 1S7UB 3ARDD 3GB7A 4YXLL 4M03A 5ILTL 3UBXA 4JLRB 4ZSOA 3MA9H 4C59B 4BH8B 1OGAD 5C0BB 5FO9B 2HP4A 4K7PH 4HIHA 5ENWA 4HWEH 4H20H 2KUTA 5FM8A 1RZ8A 2UYLB 3EZ8A 4D9QD 3CFKB 4NZDA 4YBHA 2LU4A 4G6MH 3WO4C 3UZVB 1IZJA 1H3UA 5AWNL 1XFPA 2PYFB 5CBAA 3T8XA 3ZT7A 1WT5C 3ORJA 2A6DA 3H3PH 1GZQB 3MYJA 5IB4A 5ICYB 4LLQA 1K8DB 5FF6A 5JNYA 2XQYK 5IBLD 3CJJA 4YO0B 1BEYL 3PABB 4MAYA 5D1QD 3B2VH 1RVFH 1LEKA 4WHTA 2PW1B 3ET9F 1G6RB 2HRPH 4KKBC 2NTFB 4D9RD 1D5BB 1FH5H 1KTLA 2FL5B 1E4JA 2A6JB 2ID5A 3QH3A 3BE1L 3FOLA 4FTVE 3RDTA 4LDOB 5M7QA 4S1QL 1J10A 4QHKJ 3VXMA 8CGTA 5E56A 4WDIA 5C0BA 3L7EA 2P8PA 5F7UA 2N1KA 4FS0A 1G7PA 3EYSL 1EUUA 1A1MB 2ADIB 5JLZA 1FNHA 3D0LA 5C0CB 1AC6A 1KJ3L 3S97C 5F1OB 3V95A 1MHPL 2Q3ZA 1HEZA 3L3JB 3ULUC 4HHAA 5ERWA 3KPRA 3MQIA 1PZ5A 4LGPB 2RCSH 5F96H 1UJ3C 2VIRB 1S5IL 5GHWH 1I9JH 4OT1L 2W0FB 3QDGB 1T2QH 4MYWB 3IDNB 1U92B 1AKJB 4QXUH 3P0VL 5SWZB 5IBLC 2Y23A 4IS6A 4PJHB 5CUSL 5B39B 1NLDL 1YY8B 1CFBA 2EKSB 3VFUB 3SDAC 5JOPE 2XA8L 4HIJB 2YR3A 2OS7A 4GRWF 3WL9A 4G9FB 1JHTB 3LRGA 3BP5B 1XGYL 3D87B 4RMTA 4P49A 3F58H 3JTSA 1UYWH 4Z95H 1FFPA 2WLZA 4OZFG 5D2NE 2EIEA 5EU6D 5I2IB 4FQXA 1WFNA 4KQ3L 4D0BB 4DVBB 1CU4H 3NFPB 5B39G 1FVDB 3SCMA 1UCBL 3ARTA 1U3HC 1KTDB 2DIJA 2KKQA 3NCCB 4G5ZH 2BP3A 5T5NF 3TN0B 1T80A 3OTTA 4CADB 1A9BA 3GSOB 3VXTA 1YZZA 1P4IH 1XT5A 5DDHB 1IVLA 3D3VA 1Y6NR 3FO2B 5ALBH 3LCYA 1MCRA 3FMGL 4WV1A 4YEEA 2DWEB 3SBWA 3VRJB 2J4WH 4K7FB 4GAYB 5GS3A 2AJZA 3BIAX 1MPAH 2NY3C 4F58L 5E0QA 1T5WA 1YECH 4L29B 3WIFB 3QUMB 2HT3C 5DJXA 2ZCLL 4KTYA 3WS6A 4LLWA 1LO3L 4GLRH 1A3RH 3MBEC 3VWKA 4JPIB 4PGCB 4Y4KC 1FP5A 1ZAGA 5DJXB 2EZ0D 1CD0A 1IKFH 2EYTA 4WVRA 3BYYA 5C70A 3T4YA 5CD5C 2WP3O 4JQIL 1KG0B 3SJVE 5MI0B 1M7DA 2XWTB 3UAJD 1QHPA 1U95B 2UZYB 1YQVH 4JRYA 5DDHA 3NTCH 4JO1L 4KI5D 5E2UH 4YEFA 2B4CL 5GSVA 4E9LA 4A6YA 3QNXA 5A1AA 4PB0L 2JKXA 5F44A 5LXGL 1NSNH 1T83C 1P5VA 5SWSD 5C0EB 1B6DA 5DJ2A 1OP5K 5EWIH 4PUBH 3NZ8B 2DDQL 4ZTOH 1UCBH 4M4PA 2R2CA 5IK3A 3V5DA 5BQ7A 5I6XB 4Z7VB 4HD9A 1CLOL 4PJFA 2F53E 1YPZF 1AO7A 4K55A 1P7QD 4WW1A 4J3OC 3PQYA 4LMQI 2E7CA 1URLA 3VFUA 1ORSA 4DEPC 2AV1B 1MHHA 4UTBH 1NGZB 2EE2A 4PR5B 4PY7B 5D72H 3SDYH 4B41A 2X1XR 2BNQB 1V7NL 1ORSB 2N7BA 3AS2A 3MNWA 1NEUA 1S7WA 2IADB 4PS4L 5FOBA 3RIFF 5H2BA 4OCSL 1JI1A 1MEXH 4IRJD 5JTWA 5MEQA 4H1LB 5M94B 2MQCA 1DSFH 3HNTL 2FHFA 4WCYL 4X9HA 3S35L 3W5NA 5CSZB 4KVCL 1N3NB 4YC2C 3HPJB 2BFVH 2AEIT 2VABA 4OCXH 4U4BA 4YUEL 3HZVB 4QXTB 1RZKC 2Q6WB 1CWVA 2HKFL 1INDH 3LKNA 3RL1A 3X13B 5KN5A 4CN1A 3DMMC 3TF7C 5SWSA 3AU1A 3R0MA 1G9NC 1U95A 1DQMH 4U3XA 1JWSB 5JXAH 5BS0E 2V6HA 5CILH 5EUOF 3NACH 2XICA 3IFLH 3G5XB 2IQ9L 1QSEB 5EBMA 3KPOB 1MNUL 1P4LA 2JIXA 2EH7L 4HXAH 4LCIL 2BDNL 4UT7H 1OCWL 3DARA 1BM3L 5SX5K 3IFPA 1ZK9A 4GMTH 1C1EH 1UM5L 1P84K 4HLJA 1YN6A 2QR0B 4K9EH 4M7KH 2A74B 4X6CB 2FEEI 2ORBL 3MOBL 5D7JB 3CXHJ 1JWUA 2RR3A 2R0WL 2ICWB 2IAMC 3PXHA 4OCWL 4PJ7B 5IBTH 3TIDB 3KPTA 3WEXA 1BBDH 5KSAD 3O3BB 2R2HB 1JN6B 4FFYL 3TZVA 5EBWB 5DC0A 4PJAB 3OF6D 4P3CH 3O8XC 5DLMH 3REVA 5K9OA 1KC5L 3G5VA 3ZDXE 3TIDA 1HWHB 4CRPA 1R24B 2DYPB 4L3CB 2HFGL 2PXYB 5BJTA 4HJJH 2GSGA 5F21B 4PJ5A 3BDXA 3EO0A 5KS9E 1BQLH 1U8HB 1WZKA 2H9GB 3NOIA 4MXVF 1JTOA 1Q9KB 1KPRB 1FPTL 1KJ3H 4HLZH 1F4HA 4E5XB 1MCPL 1KCVH 2JB5H 3VXUD 5C0CE 5GIRB 4X9FA 4FXLA 4MWFA 2P5WD 2NY4B 1S7RA 3WXWL 2VXTL 5L2KE 4KVNL 3MJ9A 4Y1AA 1NKRA 5DD5L 1BEYH 1IL1A 4FABH 1OD9A 4WV1C 3BE1H 4RAUA 3L95A 4JVPA 3E8UH 4J1UA 4PYHA 1N8ZA 4A2MA 1CT8A 3AREA 4DFIA 4JQXC 4GKZA 1FYHB 3BD5A 4K8RH 5IW6A 5KAQG 1CXFA 3UYRH 2RJMA 1R3IL 3DXAB 3FB5A 5AYUL 5EIVA 3EYQC 1I1YB 4NRZA 4XP9L 2F5AH 1D6EB 2FJGA 2O5ZH 1L6XA 3ARGD 1CDHA 1A7QH 4QGTA 1A64A 2R1YA 3GDBA 3NA9L 1AD9B 4OZHE 1BVKB 1VSCA 1HIML 2MWCA 5IQ7L 1D5BA 4O2EB 1CBVL 1RU9H 1KENL 3ESVF 3UBXI 3PQYE 4OQTH 1FZOB 1UZ8A 5IR1A 3KLDA 1FORL 1DBKL 1QFWL 4OD2A 5D1QA 4NYLA 4JGMA 1J5OL 5C2BH 1NC2B 3LKRA 4FFVC 3TIEA 5JW3L 1U8JA 4JFQA 1QSVA 1Z3GH 4PBXA 1B2WL 2YS4A 2JJTC 3FB6A 5IROA 2FATL 3L3KB 4PJXA 3NCMA 5K33A 1HNGA 4I48B 3RAJL 3MRQB 4QHUB 3CSYB 2ESVE 4M61B 2CKNA 2XPGA 3RWJB 1PKQE 4HKBB 5IESH 4DEPB 3DIFB 1NBYB 5I66A 1F3DH 1W8OA 3WIHH 1OAYL 3MO1B 3LN9A 3RKDD 2X40A 1BIIB 1J05A 1HHJA 1YMMB 4R9HA 3ZKMD 2W65A 4HJGA 3FRUA 4YFEA 3OR7B 2ADJA 1L9NA 4MA3A 4POZD 5DEFB 4M6NL 3SDXA 3KLHD 3UTSB 1MFCH 1T5XB 4YHLH 2YEZA 2DKMA 3AY4A 5F3HB 5CEYB 4WWKC 4YHMH 5GRUL 4Y4FD 5GS0C 5I1LB 4PJ7F 5IJKC 1N59A 4LQ1A 1NSNL 3MLVH 5CGYD 1YEJH 5LGJB 5ACMA 5TH2B 2Z91A 4JM2D 5JHDD 3TJHC 4X6BB 4X99B 3WS3B 3J8F7 3QUZB 1D5ZB 1AJ7H 3KYKL 1WTLA 3P4OB 1JMZA 1UACL 3D9AL 1OSPH 3I6LD 3JWOC 4YHNA 1GC1H 4JFFB 2VXUH 1UB6B 1MHCB 4H88H 1SVCP 4C56E 2WV3A 1QYGL 4CJ0A 1Y0LA 4U1SB 4V1DA 4M7JH 4Z0BH 4HIJA 3A6BH 3LKOA 2EKSA 2EYSB 3PWLA 1LP9E 1T7YA 5T5FH 1IGJA 4ERSH 2NY2D 2XQBH 1F6FB 1LE9A 4QRUA 2VQ1B 4WU7B 3LD8B 3ARDC 4PRHA 2DD8L 4EIGB 3B9EA 3U30C 3SDCC 1RZIA 4Q0XL 3MGAA 5BV7L 2H45A 1QYGH 5CFHA 3CX5K 1N8ZB 3QHZL 3QUZC 1T89C 2J8UA 3OAZK 1CR9L 2OZ4H 4D8PA 3QFDA 1FIGL 3RBGA 1J8HA 3SO5A 2F54B 3BDBA 4UU9B 3TCLB 1MFEH 3RA7H 4NZTL 4JN2B 1QRKA 2APFA 3GMNA 1YQVL 2B1HH 2BVPB 4QEGA 1CXIA 1OGAE 2E27H 4RX4A 4S11A 3LDBB 5EU7C 3QIUC 5F7FA 1KTLB 2BJML 5IEKA 1C16A 3LSOA 3S37L 2KL6A 5L88H 4HKZB 3FB7B 3QUXC 4Y8AA 4S2SA 2HYMA 3MOAH 3Q6GL 4M02A 1FYTB 3OG4B 4MX7B 2HN7B 4POZC 4XNYH 3N1GC 3EGSA 4ORGA 2GTWB 4S1DD 4QRQB 2R0LH 2DLGA 2EE6A 5LBSH 3VA6A 2MQ3A 1E6JL 2BSSB 4PP1D 3CMOL 1NCCL 4NZRL 1RIHL 3ARED 4KMLB 3U4AA 5CD3A 1GIGH 1TMCB 3IGAA 3JV6A 2P5EB 1W0VB 5KG9B 3WXVL 1ZT1A 2AQ2A 4ZO6A 3AB0B 4G3YL 4ZUVA 1TXKA 3DGGB 1MFNA 3VFSB 1CDIA 4PPTA 5HYIA 3G9VA 4MJIB 4OIAA 1T2QL 4PRIB 3RWEA 1CTOA 1E4KC 3DBXB 3KYMB 3RPIB 3QIUD 5JW3H 1P7QB 3I3DA 1A4JA 1MQKH 4XB7A 2WINA 3KPSE 2NY6D 3SN6N 1KJ2L 3GSWB 2VDPH 4OIIL 4RGMC 4NNPH 3X3FL 1X9QA 3GJFA 2ADJB 3CZFA 1FNLA 5BJTB 1UT9A 5L9DL 3MRPB 2NXYC 3MXWL 4JFHE 3GI8L 3VG0L 1TTUA 3MLRL 1CCZA 3PIQA 4OV5B 3Q1SH 3RBSA 2OK0L 1XF4B 4PREB 1WBXA 2FGWL 3QO1B 1JN6A 5DMGC 1HZHH 4YHZH 3GSXB 5DTFA 5DWUH 3V6FA 2FJFA 2X4TB 3FONA 4HXBL 3UYRL 3IFNL 3OMZA 1X5IA 2PCPB 4LKCA 2QL1A 5BZWB 1QUNA 5BRZB 1VACA 4KK8C 1KPRA 2ZCHH 4KK9C 3O3DA 5IVOA 1G7QA 1RJLA 1CLZH 1T0NA 5GRJL 1D7FA 5E2VL 3NIGE 2DWDA 1NCDL 2MCPH 1T1ZB 1WQVT 3CVIH 2EH7H 4LCIH 4S1SL 4YK4B 2NY0D 4RX4D 3QFJB 4U49A 1MCHA 1RK0B 3OB0K 4UUJA 1YEDA 4AQ1B 4X8XA 2DKSA 4UV7L 4JG1H 1I7TA 2VDLH 3VWJA 4NWTH 4NNPL 2CIKA 2E9IA 2ICWA 4PJ7A 3U4EA 1FNSL 1I7ZA 3DETC 1A4KA 1U42A 5CWSB 3UTTB 1NEZB 3RWIA 3GSRA 5D7LE 1MLCA 3S4SA 3TYFB 3VFTA 1NH6A 1BOGA 1NGYB 3WFHB 2ERJB 1MJJA 1NC2D 1A2YB 5C71A 2ADFH 3GSNB 1WBZA 1QFPA 1Q0XL 4L3EA 4G80B 4YDVB 4ZOEA 3O6MH 3ARBA 3P0YH 5T1LB 4DKFH 2P4AB 2HT4D 4ZNEE 3RU8L 3ZE0E 4MXWL 4PJAE 4RMUA 3QA3A 4OLYH 1F3JA 1A6AA 4X9GA 2I27N 2BSTB 4XPHH 2XNAA 4QWWD 4NHCL 3LPGA 1PSKL 4XMKH 3O4OB 3HE6D 5T1MB 1PJ9A 5EZOH 4ODHL 2FEDC 2ADGB 3DTXB 1T2JA 1BZ7B 4JDZB 3MLTB 2C26A 4F7CA 1EXUA 4LRNL 5FUOL 3ARSA 3LQMA 4LSUL 2Z31D 3NCYS 5E1HB 4U1IA 3AS1A 4ZOCA 1T21A 3RZCD 3QJFA 1AY1L 2ZOLA 3VFWA 1JUFB 4NQDB 4OJFL 1UKQA 3MRJB 2IBBA 3MLTA 4LPTA 3VXQA 3CVHL 1G6RH 4OFKA 2XQBL 4RA3A 1QRNB 1TETH 4WW1B 3OKKA 3JWDC 2ICEA 4L8CB 3L5IA 3BGFC 1RULL 1U36A 4H26B 4NO5A 5TE6H 4ZO8A 5FGRA 3S7GA 1W0YT 4F37K 2QQKL 1C08A 4HAFA 4P23D 4GXVL 1KB9K 1PKOA 3QCVL 4H88L 4Z78A 2R29H 4HPYH 3SGJA 4OLUL 5C0AD 1EIBA 3T0EE 3SDXF 2A77H 5B8CB 3OB0H 2XZQL 2CK0L 3CCHA 4BM7A 3FRPA 5EO1B 4IOSD 5AAWA 5BRZA 1PZ5B 2BSTA 4OGAD 3RWDB 3T0WA 4EN3D 4D9LH 5KTEH 4KPHH 3HLAB 3WO3B 5FYJH 1AGFA 2ARJA 1G0XA 1P4IL 3RL1B 2Z31A 5F9OH 2XZAH 3QHZH 1FVDA 1A0QL 4OAWA 3BZEA 1ROWA 5ANMB 3C8HA 5FYJL 1MJJB 1EEZB 2VUOA 2VDOH 3QEGH 4PFEA 1B4RA 3MLPA 3KYKH 5KANG 4QHNA 3QIUA 3EFDH 1LVEA 1VEMA 3L6FA 3HLAA 4LP5A 4NJ9H 5F70A 3TBWB 1OF2B 2DOCA 1KCSL 2PW1A 5F7WC 3BN9D 4EI6B 1WCBA 2VLKE 4YHPA 2CKBL 4G9FE 2R0ZH 1XGPB 4NNYB 1K8IB 2D31A 3KPPB 2BHUA 5GRWA 3RY6A 3VCLA 3SDCA 1QA9B 4Y2DC 5GJTH 1F13A 3THML 5TPWL 4ELMF 3O8XD 3ARDA 3HI6L 2GJ6B 1NDMA 3IS0X 4OCMC 3QWRD 4TNWF 4JPIA 1RULH 1CD8A 4NP4H 1KIPA 2VDKH 2G60H 3F8UB 5HYEA 2APVA 2I60H 4WEUD 2WWKO 2KH2B 3KPRB 4K94C 2AXJA 3AM8C 1NAMH 2X1PA 2QKIB 1IC5H 3LMJH 4JHWH 3PXJA 2F5BH 3DECA 5B38B 1ZT7A 3FQNB 4IOFD 1H3PL 3GSOA 3DX6A 3VRIB 1J1PH 3WFEH 1D9KA 1YY8A 3ULUF 1T3FB 2MQ0A 3RZCA 1HE7A 1CL7I 4YHNB 4XZUA 2ZUQC 3FO1A 1T89A 4OZHB 3TNMB 2NY4C 1YNTA 4FXGB 1EO8H 5I1EH 3IRZA 5EU4B 2XN9E 1W2KT 3IS1X 4Z9KB 3SDAB 1OAXH 4X6EA 1MELA 4XMKL 1S9WB 1X5FA 2ZCHL 3IXTA 3QEQA 3TA3A 4NFDA 4M48L 2VAAA 4N0CC 1DFBH 3BD3A 3IGAB 5DK3A 5FYLH 3ROOA 5D1ZC 4ZPTB 1T66D 4WV1B 4K3EH 1QSFD 4DZBA 2ZCKH 1CGTA 4KJPD 2CO6B 2J8UB 4X4ZA 4X83A 4YZFE 1DR9A 5JA8B 4GBXA 2A6JA 1RZIB 1A6VH 4NC0B 1A7RH 3JV5A 2DMCA 3EYUH 1U8MB 5TF0A 4CU8A 4WHCA 4ODSL 3LY6A 4MDIA 2NXYB 1AQDB 2AJSH 4QRSA 2P1YA 3PWLB 3NABL 3T8XB 2YD5A 5I66B 2BC4B 4JM2A 3L1OH 4HWBH 1IC7H 1N4XL 2VDPL 1A7RL 1FZKB 4JGUA 2VL4A 3UJJL 2B7DT 1WK0A 2ZSVA 4DGYH 1HSBA 4TN9A 5C08D 5DJAB 4AEHL 1G6RA 2X7LA 3QUYD 3KR3L 3CUPB 3L5WA 4LF3A 3G9AB 1UVQB 1GHFL 3UTPE 3P4OA 2WNGA 1RUQH 3ARUA 3NCYP 1ZLWH 5K9QI 1MCNA 1T7VA 3U0WH 5CZVL 5HGBB 3GMQB 5FYKE 4P59L 1ES0A 1MF2H 2ZUYA 2YKLH 2NW2B 3C5ZD 1JNLH 2O61B 1IZKA 1A6ZA 4Z76B 2ESVB 4W4OC 4UQ3A 4R96B 3QO1A 4P9MH 4GRLD 5JHDE 1OAKL 4PREA 2YEZB 3FFCD 2AS5M 1DDHA 2DM7A 3PGFL 3CFDA 3ARVA 1ACYL 1SJHB 4JY4A 2FNBA 4GG6F 2VQ1A 5L0QC 3MLRH 4R4NC 1L7IH 2OQJA 1ZS8B 3LDBC 5JO5B 4MHHG 4OCWH 4EDXA 1SJHA 5BVPH 5EBGA 4GW5A 2CLRB 4MQXD 5I1GH 3EDJA 5KSBF 1X4YA 4EDWH 3NCJL 4J3VA 1EAPB 4JVWA 4MAUL 1CICA 3UTOA 5E94B 4PV9A 2K9UA 4WUKH 4F3FA 3DBXA 4LRIA 2O61A 1QNZH 1CR9H 2VN4A 5CP3H 4OLVH 5E95B 5BV7C 2VDQH 4NKDA 1EGJL 2NY5H 4P2OB 2GI7A 4MHHI 2QV2A 1KUMA 3DXAD 3S37X 1K2DB 4E5XA 1IGMH 2J8OA 5IMOA 1EHLL 1OTUD 2WUBL 2C7UB 5CBEB 1NC2A 4TRPL 3BP6B 4PG2A 1YNLL 3ZYZA 3TZVC 3KPLB 3L5XH 3QXDB 2YWZA 4KRPC 4Y89A 1P7HL 3TPKA 3T0XA 3VRLE 1M1SA 3BJ91 4LRIC 1U93A 3QIBD 4Q6IA 4YX2L 4QRPB 5FO8A 3MV7B 1JZ4A 3JUYA 4LK4A 3MCLL 1SM3L 5ANME 2EXWD 4UQ3B 4XVJH 1FG2B 1U93B 1BQHB 4PJHE 3V4UL 5HHQA 1P53A 5E08L 4NQSA 2ICWI 3L3OB 2YPLE 5I1CL 3ARPA 4G6FB 1X5KA 1GGIL 3PWNB 1IGFH 4WI8A 3RA7L 2VZOA 4ZS7H 3G04B 2M26A 3EDEA 2ZUUA 1UM4H 2OL3L 1FIGH 2Y6SD 1XF1A 2RIKA 4FQIL 4E41D 2E7MA 4K3HA 3OKYA 4LCWE 3TN0C 4Z6AT 4X7DC 3U7YH 1MLBA 1F5WA 5EUOA 1KLGA 1U8IA 3GBMH 5DI8B 4NP4L 4JFDA 3FQRB 1CFVL 1Q9OB 3CUPA 5D93B 3ARFB 3ZTNL 5ICZA 3K4AA 4ODVL 2J8HA 3IU4H 2VR4A 4OI7A 5ITBL 4HS8L 4G43B 3UPRB 1V7NH 2WANA 4R90H 4X7TA 3S36X 5C6WH 1I8IB 2R1YB 1LWRA 5TDNA 5JQ6H 2R1XB 5IMLA 2BC4A 2R4RL 3QNYA 3LKNB 5FA4A 4NRXA 1BX2B 3BEWB 1TETL 1FE8H 5CSGA 1CFSB 1CLOH 2BSRA 3IJYB 4FMKA 5DYOB 4JPKL 1GGYA 3GO1L 1F4XL 4XBPA 4M1GL 4OUOA 1Q0YL 2EDWA 4F8TA 1HHKA 4GSDL 1ONQB 3MUZ1 4H25A 1BJ1H 3K2MC 4XHJC 5I1HL 4JM2C 3IT8D 4RGOH 1OWWA 5F1IA 2FJGB 2ITDA 5D93C 1A5FH 1V7MH 1MJUH 5F3BA 2RB8A 1J18A 4ZOBA 1AD0B 5GS0D 1I8MA 2PW2A 5BW7C 3EHBD 1OP3K 4PJBF 3H3BC 3CK0H 4ZS7L 4EVNA 3SKOA 3DMMA 4LPCA 4U05A 3O8XB 4YIQB 2NY5L 1YN7A 3EJYD 1UEMA 5E4EC 2VO5A 1BECA 1I7RA 3SJVD 5J8OA 2IANA 3OJ2C 2RCSL 3A67H 5FV1L 5FCUH 2X09A 5IHZA 1A14H 1AHWC 2YRZA 3TYFA 3VFTB 5GRVL 1Z0MA 4GW1A 2WWKT 3FQWB 1MCBA 3KPMA 4WUUE 1R0AH 3VDCA 4MA8L 3O9WC 3VD7A 1DVFC 1HHIA 4YHPB 3DETD 4HGWA 3RGHA 4XNQB 3VI3E 3X14A 1DP0A 3CPLA 3RUGA 5F6IB 4UBDD 1EFXB 2NZ9D 1KG0A 4F9PC 1FNSH 4GRWE 1TCMA 3MSPA 1T22B 5IFHH 1DLHB 4JEGB 3KYOB 4ZPVA 4NO2A 2AKRA 5HI4C 4F7PB 4H8WH 1ZT4B 5CEZD 1CE6A 4LSRL 2YSSB 4E0RB 1NFDA 3CDYA 4OZIB 3VXOA 1PQZB 5E8NA 3DYPA 5EZLA 3WE6A 4OKVB 3MGTB 2FDBP 4LLWB 3LZFL 4K2UH 5D7LD 1IQWH 1LP9A 1HI6B 4S1SH 3U2SA 5KBNC 2EEAA 3MNWB 4TNWK 5HVWA 4NQEB 5D1XC 3M17A 4AEIL 1SEBA 5CEZL 1N4XH 3ZE1F 5CP3A 1QA9A 1XIWB 5C0JA 5GGRB 5DHYB 4JFEB 3ROLA 3OKMA 5F6HI 2KPNA 4X6CA 2DYPD 4F7EA 3HC0B 2K1MA 5ESVA 3ABZA 3SKNA 2MHAA 5KS9B 4QHMB 3DVFA 2ERJC 3WNMA 4DN3L 4U2ZA 4N0UE 1T04A 5KSAA 4PJEB 1WBXB 2OL3B 4BSVA 4IDJL 4KHTL 3C5JB 4OZGA 5H2BB 4IMLB 4Y2DA 1AGFB 2ARJB 4UIKL 4DN3H 3EOAA 4XVUD 3N06B 5J0BA 4G42B 4IRJB 3KPMB 4JRYB 3MJ6A 3V2AR 4L9DA 3D2UB 5F8RC 3MXWH 2V2XB 3S5LA 4FFZH 1A7OL 3LQAC 1EBPA 3VGEA 5KN5B 3G6AB 1OW0A 4O9HH 5B8CA 1MHHB 5GGSY 1E6OH 3DRTA 5E5MA 3AM8A 4M5YL 5LVEA 1A6VL 2AXGB 3RPIA 3OZ9L 1AFVL 4HBQA 3MGTA 3VWKB 2DF3A 2AJYL 4AL8L 4JO2L 4WTZG 3U30B 4H26A 4J3TA 4NO5B 4N0FA 5KVFH 3BMVA 2OR8A 1LQSR 4HIIB 3ZKND 5J9PA 4LSQL 4QRTB 3E3QC 3MV9E 4G3YH 1XIWA 1HN1A 4X7SH 4UT6H 3RVUD 3T0ED 3IDMA 3QI9D 2QQNH 1RZGB 5TJWK 4PJHF 4Y4HC 1R5WA 1YEHH 2QEJA 3MZGB 1J0HA 3BKYL 4LSPH 4Z7UA 3U82B 1WT5A 5KOVC 1PQZA 2WK2A 4GBXC 1BPVA 1MEXL 1MQ8A 3BRFA 1OPGH 2HWZL 3MV7E 4FQ1L 3TYGH 3UX9B 3VH8G 4BSWA 1MIML 4NKMA 1XGQA 3IDMB 4OCRL 1JV5A 5C09B 5C0CD 4FQXB 4F57L 2Y07L 3O6FD 3QCTL 5C0GB 5FA4B 1HSAB 5H8DA 4CW1B 1NFIA 2IQAB 1WC7A 4J3XA 3CPLB 3X3FH 1DQDL 4P23B 3THMH 5JMRA 4P48A 2GAZA 1NJ9A 1T5WB 3P40A 1IGYA 4RGOL 4HWZA 1UZ6F 3VXUA 5B39A 2B5IB 2EC9U 5HDBF 5ADOH 3VWJD 3FO2A 3GRWA 3BT2L 5I8CB 1IQDB 5DJ6B 3GSNA 2JF1A 5B22A 2CRIA 2BDNH 4TSAL 3RHWK 2IEPA 1YEFL 5A40E 4K3JL 2P48B 2VIRA 5D6CA 5KOMC 5I76B 1JGUH 3PWPB 3MREB 4X98B 3LEYL 2NY7H 5KSBA 1MFDH 2C3VA 2F5BL 4GJTB 4QRRA 3EOAB 4V2BA 3D85D 2B4CH 3X13A 2BZDA 2R0LL 4M7JL 3VXQB 2CO7B 5D70L 1KCSH 3PGCA 2DQUL 4NBXB 4ZNCD 4U0RB 3K80A 5FOBB 4GXVH 3O2VH 5L7XH 3WHE1 2YRLA 2VJXA 3QZWA 2F9BT 3L5HA 3MRPA 4WI7A 5I8EB 5IT2L 4AIOA 4JFYB 1MWAB 1TZGH 1HOCA 4NSKA 5AUMB 3WS3A 3O11B 3JBG7 1KEGL 4D3CL 4J8RA 1MPAL 4J2XA 1FDLL 1RZFL 1NMAH 5C08E 3NIDE 3MRLA 1X6LA 4HH8A 3WBDA 5HVHC 4AG4L 5E08H 3O4LB 3D0LB 3GBNH 2FJFB 2YA0A 4NGHH 4XP4L 4FXKA 1IGFL 1UB5B 5KSUB 5HYJD 4L3EB 2R2BA 2SEBB 4FZ8H 3RUGE 2R9HD 4AEFA 1X5HA 5C0EA 1I7UA 5HYJA 4ZYKB 4K9EC 4N8PA 1CFTB 4FTVA 2AQ1A 1RUKH 4IMKA 5DUBA 4HZAA 5GGVH 4TRPH 3FB8A 3KPLA 1C5BH 1OGAA 3PWNA 3WIHL 1YPZA 4HT1L 3ZKMC 4LVOB 2FRGP 3NPSB 2XA8H 1EEUA 3BGMB 3MA7A 5GSRB 4U33A 4JQIH 1NLDH 1G7MA 3O9WA 4X6DE 3A0OA 4NKDB 1B9ZA 2OBGA 3GSNL 5ICZB 1T1ZA 4Y16A 5E99L 5J13C 1TVBB 4HFWB 3WKNA 1G6RL 2YZ8A 4I77H 4YO0A 2KQMA 1LEGA 4GKSA 4G7VH 3C09B 4E42A 3QQ3A 1YDPB 2WQ8A 5CD3B 1IGIH 4R26L 4JKLA 5C09E 3VFVA 5MERA 2XY2A 35C8H 4G6JH 4NYLB 2Q8AL 1JVKA 3B5GA 2HKHH 3QFDB 1XAUA 3BKML 3ZKQD 2ZG1A 4GKNA 3AAZA 1BJ1J 4YHML 15C8L 1CZ8L 3PWJB 5C08A 3BIKA 3MUGB 3PL6D 1ND0A 4LRNH 5HHME 1HHKB 1IEAA 4POYA 1Q72L 5LGKA 4CNIB 2Z4QA 3V6FB 3MV8B 3QXTA 3GSXA 4MQ7B 5IW1A 1TLKA 2YMXL 1IGJB 4WENB 2WSKA 1EAPA 4JDVA 4R96A 2J88L 3I85A 4ZUTA 1UENA 1VFUA 1XGTB 3SOBH 3OGOE 1GGBH 3MXVH 2FX7L 1HKLH 3VWKD 5GZNC 1F45A 4Z95L 4UQ2A 1J0JA 3TT1L 1RUQL 3CH1B 1S7TB 2YKLL 3ZT6A 3DX7A 1BD2A 3RWFB 2F54A 3E8UL 3DSNA 3VMNA 1WITA 4JFDB 5LGHH 3ZKXB 3KXFD 4PRPD 4FABL 3F12A 2E6QA 4RWHA 5E9DE 3B9DA 5CJOL 5D7KE 2NY1B 4NNXA 1MCFA 4DAGL 5C0IB 3N1QC 3TO4B 5ERWB 3CDGA 3BQUC 3B9KD 2BVYA 5ABDE 4X6EB 4KROB 4AYFA 4WFHE 4JREC 1OB1A 1UA6H 5JR1L 1L7IL 2MCG1 5JPNB 5JZ7D 1F8TL 3LKOB 3TVMC 3WN5B 4KMTH 4LLMB 1QACA 3IDXL 4JO2H 1WGOA 5D7LA 4DAGH 2CLZB 2Q8BL 1LEIB 2PXYA 5JR1H 3BH8B 1EVUA 1C5DB 4MNGE 3TGXA 3G08A 4HH9A 2NPLX 1DL7H 3VD5A 1Z9SA 1MHCA 2FB4H 2PTTA 4Z7VF 3UPCA 4K8RC 2EIZA 3PABA 4MAYB 4L3EE 3FT4B 4E41E 2R2HA 1YMMA 4PJCF 4FG6D 4OFVA 5E8PA 4EEEA 1PG7W 1WFUA 1X5GA 1GCFA 2FR4B 5IVZB 2FX7H 2WAHA 3H3PL 3U0WL 4IDJH 4B50A 3T2NL 3FCTB 4J23A 1P5UA 5J4MA 2LE9A 4CN6A 3OAZH 3JSSA 2FLBT 5IB2B 5GISL 1F4AA 2FB4L 1YNTB 1CICB 4GXUM 5FDWB 4R2GD 3D48R 5J12B 1JI2A 3P9LA 5J1AB 5DD0L 5BO1L 3I3BA 1R3JA 4F7TA 1T4KA 5MHSD 3B9AA 4W6XB 1JCKA 1QBLL 1ADQL 4S0SD 4R4BB 2P8MB 3I2CH 2HJFB 1YYLL 5I74B 4XPAH 3WFEL 3B2UD 1OAUL 4OM1H 1MQKL 3HRZA 2B1HL 4WW2B 1GGTA 3SGKC 3E6HB 3O2DL 4R3SA 2CJUL 1XZ0A 2R2BB 2SEBA 2HT4C 3GSNH 3HAEG 2X1OA 4FHBD 1S7QB 4U7MA 4V1DB 1U8KA 5KANI 5I1HH 2CRYA 3HAEB 2IG2H 3QQ4B 4HCRA 1HXYB 4PD4J 4OF5A 4EBQH 4BZ1H 2ED9A 1CXKA 1FNGA 1GZPA 4FZEH 1DBMH 4M8VA 4GRLA 3KWWB 4PBVC 4CDGC 1FLRL 4FA8A 1KLFA 1H15B 3T1FB 1FZOA 5F9AC 3W82A 2JB6B 1JPST 2WW8A 2OJZH 3BX7C 1NGPH 4NKQB 1U8LB 2WIIA 2GQHA 4ZUTB 4WTXA 4DKAA 5IJKA 1MWAL 3SHSA 1JZ2A 3P77B 1B0GB 1DQQB 4Z0XA 1FG9C 1CGSH 1A1NB 2V5SA 4J6RL 1CD1B 1VKXB 1N64H 3WUWB 1CE6B 5KSBB 4JZOA 1XGPA 5D7IB 1PD6A 4WUUA 4D3CH 1SYSB 4LLVA 4EN3C 1F4YL 3HB3D 5C7XL 4KI5C 1KJVA 1XH3A 3LIZL 5EO9A 3IFPB 1KF9B 1R5IA 3F7PC 5ID1B 2XYCA 3WD5L 1P69B 3RJQB 3BZEB 2ZG3A 1M7XA 1S9XA 2ARJQ 2X4RA 2FBOJ 3F7QA 2ZCLH 4G6FD 1UB5A 5KSUA 5T3ZH 4LHQB 2DQUH 3VXPA 5EZIH 4PJ9C 3MRFA 1AJ7L 3B6SA 5T1KD 3BHBA 3QHTC 1I7RB 1OTTD 4TTDC 2X1QA 2XT1B 3RVWD 3DPBA 4HC1L 4PGDA 2X4UA 3KPSB 3TV3H 4HIEB 3NFSL 4JM4H 4Q97A 3ULVL 1VEPA 5IMMB 3DNKA 4RNRB 5F97E 1G7IA 4A6YH 5HHOB 2AEPH 3LEXA 3OJMB 4MNGA 1JPFA 1S7SB 1UG9A 1FZMA 4X4XB 3ULVE 3ZE2F 2BMKA 4JZJC 3K1KC 4L1HA 5J3HD 1KYOJ 4CDHA 3MLYH 4G5ZL 4LQFL 1BAFL 3GIZH 1DANU 2HFTA 1PG7L 1M71B 3IDGB 3UJTL 1UACH 1Z3GL 1PYWB 3HG1B 5I2IA 1DJSA 1ZGLB 2A73A 4X4XA 3B9KA 3L7FB 1D9KC 3B83A 3BP7B 3KPQB 4HMEA 3LHPH 4YDJA 1GYAA 4HAGA 4WFED 5E03A 5GS0H 1JHLH 3UTQA 3OR6B 5IGXH 1NFKA 2CUHA 5C07B 5L7XL 2FBJH 3QCTH 4L8SA 4KTDH 3I6KB 4Y16C 2APXA 4G43A 3UPRA 3OR6A 4U6VH 4EXKA 4B5EA 4H0IA 1M6OA 4F15B 5FB8A 1RV6X 1CQKA 1CI5A 1NMBH 3IJHA 2IH1B 1RUML 5GGRY 5FK9B 2HRLA 3C9NB 4U1KA 3W0WA 4NM4H 1M7DB 2XWTA 4KK5D 1FNAA 4IMLA 4Y2DB 2A73B 3T2PA 4RGMB 3TJEH 1N3NA 4PRDB 5C0NC 3HPJA 5J6GA 4NT6A 1UJTA 4UQ2B 5CAYB 4AH2B 4RMWA 1G84A 3O3UN 4I3RL 2B8OT 4WU5A 2VITB 2EDOA 4JM4L 4MJIE 5HY9B 2H6PA 3P4NB 1EFQA 5DVMA 2X9WA 3PE9A 3W39B 4XTRD 1VPOL 3U9PH 1JNHB 1S3KH 4GS7C 2DKUA 4R97C 2Y5EA 3CNKA 5IEHB 4UI2A 5EU6B 2AJVH 4HK0B 2H8PA 5EFIA 3RGVB 2YXFA 2NNAA 2YC1B 3RNKB 4OF0A 5J9PB 1A9BB 3VXTB 4DK3A 1A4JB 5IQ7H 1AGCB 2XA3A 5IW3A 1KFAH 3OF6A 3V6OE 3PP4L 5E7FA 1YEIH 1R3LB 5ILTH 1U8QB 4YE4L 4TTDD 3QWRA 2A6IB 4M6ML 4U1NA 1GGCL 5DLML 2ICEB 5JXEA 1SVZA 4N5EC 1EAJA 1CGSL 4M6OH 3RVVD 3L5JA 2GY5A 4GAYA 2DJUA 1T0NB 5DMGD 3QIWA 1UADC 4UNUA 5E2TL 1F3DJ 4ZUSB 4KHXH 4MJ5B 2V9RA 2GITA 3TCXA 4M48H 3ZYIA 1TCRB 3BGMA 2YD1A 2R56L 3HFMH 2HFEA 3T4YB 2YD9A 4JB9L 3NPZB 3A6CL 2EYTB 4ZOAA 4CMHC 4P4KB 4OIIH 1FH5L 4KZDL 4GMTL 4MS8D 5B3JE 3RDTD 1MH5A 4AIZB 4P5TB 3S3JA 4HZLB 5MEQB 3QUKB 2WBJD 3IDXH 3E2HC 1GRWA 1ERNA 1H8OA 4WI3A 3QIBC 4PIRF 4WI6A 1A6ZB 3K8LA 4LCUB 1EMTL 1G7JA 4RGNB 3ZT5A 2R2EB 3RTQB 5C0BE 3GSWA 4FQCH 5C08B 1INQA 2HKFH 3ZSSA 1ITBB 3LS5L 1C5CH 3KLSA 3O4LE 3S34L 5HYSA 3VFPA 4XMPL 4CVZA 4FFYH 5EOTB 4RZCB 4YXLH 1CXEA 1JHKH 3IKKA 1E4XI 3S5LG 4YAQA 4M5ZH 5FGCB 2BJMH 4NN6B 4HPOH 2PTTB 2XXCB 1JGLH 2F54D 3CFJA 4ODWB 5DSCB 3QUXD 4HUUB 4OM0L 3I6LE 3TH4T 5GZOC 5E9DB 2VISB 2ORBH 5IM7A 3LN4A 5HDOA 3ZDZE 4OFYA 4YFLI 3TPUA 5IVNA 4NQTA 2CH8A 5K9KA 2AJ3A 4Q6IC 4ZS6C 3SCMD 2VC2L 3CGTA 3HC3L 3FQXA 1VPOH 3U9PL 1BZ9A 3ULUE 4CUCA 4BFIB 5L0QB 1NBVL 1AXSA 2RGSA 1FGNH 5JMOC 5J7CC 1ZSDA 1D5IL 3IDJB 5ISZA 3WXVH 3I50L 5HYJB 4GRLC 2W91A 4OZIA 2DJSA 2DD8H 1DQJB 1K6QH 4KAQH 5AG8A 4DN4H 2FX9H 3D18B 1YC7A 3W9EA 3FZUD 5HGAA 4X0KB 2DWEA 4ZXBB 4O51B 3KYNA 4OLWL 5C09D 4BZ2L 4K23L 3VFMA 3OKDB 4KJWC 3UTSA 1R5VB 3F7YA 5TF1L 4LAQH 3U9UA 4PD4K 1DBBL 2YHGA 5DEFA 5F9WC 1CVSC 4OCSH 1JV5B 5C09A 2BSED 4WU7A 2AVGA 4TNVF 3EJZD 5ADPH 4U1MA 5INDA 5DRZA 5EBLA 3P11L 3GMRA 3OJDB 4URTB 1DLFH 3HZYA 5JHDA 2CKBH 3GKZA 4JM2F 3LB6D 1H3VA 3T0EB 1F3RB 1P2CA 2L7UA 4P0DA 5F7DA 2OM5A 4FQ2H 2W59A 3QEUA 3QUYA 1YNKH 3HB3C 4BQ6A 4Y4HB 1ZE3C 1J1XH 4HIHB 2FZ3B 4I3SL 1UWEL 2PXYD 4D9QE 2OZ4L 2DB8A 1JF5A 1TNMA 2IBGA 5DJYB 4WFHD 5E94A 2HMIC 4PJBA 4Y19E 1N5AA 2X05A 1RY7B 4W4NA 1IEBB 4GO6B 4PRPE 4W70A 5C0FA 4HFUH 3WFZA 4R7NB 5D7KD 2XKNB 3P2TA 3ZKXC 3ZL4L 2OJZL 1WWAX 5J12C 2F53A 4XNZB 2J4WL 3MR9A 3F7VA 1IGML 3QISA 1L7TL 4DN4L 2OTUB 5ALBL 3FO9B 3TZVD 3KPSD 4L3ED 2XRAL 5SX4I 4D0CA 1N0XL 1KEMH 5JW5A 3D2UA 4WDIB 4YHIA 4GQ9L 2YUWA 3MRBB 1QFUL 3KJ6H 2XPGB 4KWUA 2WUBH 1NJ9B 4NFCA 2YPLD 4QOKD 2V5MA 4MA7L 5IEKB 2ZJSL 2I07B 1I8KA 3BO8A 1UB6A 1OGTB 1I9JL 4OT1H 4ODHH 1NAMA 4OAWB 4LCWD 1YEJL 1U8IB 4MA7H 1PSKH 1T1YB 3ARFC 3TCLA 1FC1A 4HUVB 4Z7NE 1CK0H 4JANA 4M8QA 2A6KB 1JRHL 5IMOB 3LB6C 4GQ9H 5DEZA 2E9WA 4OGXH 1XR8A 1CL7L 3WLBA 3CSYA 5CZXC 3S6CA 5FUZH 1WFOA 5ID0B 4TUJA 1D5XB 1EBAA 3V6OC 4Z77A 1C5BL 1CG9A 1HSBB 2PKDA 1VADA 2NY5C 3EYVA 3HMXL 1MWAA 1BGXH 1B0WA 4MWFB 1MFCL 3MRCB 2EICA 3OG6B 1EHAA 5FO8B 1I75A 4QRPA 3VXNB 3IDUA 5HGDA 3S34H 1U3HB 1FFRA 5I0DA 3TEUA 4NQVB 4O5LH 1C8PA 4IOIB 1YY9D 3B9VA 2OQJB 1NPUA 5JW4N 3MGOB 3VFGH 3GBNL 3AREB 3MV8D 4ELKA 5D2NC 3RTQC 2VDRL 1L0XA 4XNQA 3IKCA 5D8JH 3DLQR 2AV7B 2Y36L 3C2SA 2C1OA 1IL1B 2QSCH 4NO3A 5IT2H 4PB9H 5D4QA 3C5JA 3LQZB 2P5WA 2D7QA 5DHXB 2EC9T 2VLME 3LEVH 1KV3A 1YEGH 3GSUA 1CF8H 1MVFA 1ADQH 4AY0A 5EH1A 5JDJA 4JG0L 4HKJB 1NGWB 4MQSB 3I9GH 3VXMD 4LVNC 2PW2B 1TJIH 1CGWA 3ARWA 5I9QC 1JYNA 1FVEA 3Q5TA 3G5ZA 1PEWA 4JCLA 2FX9L 3JV4B 3JWDL 1EX0A 2BY2A 4ODSH 4X5XA 4PJ7E 3Q6FA 3T3MF 3ZMRA 5IMKA 1KC5H 3RRQA 3H7BA 3PP4H 5E00B 1I3VA 1MJ7H 2ESVA 5IB1A 1NCTA 1AHWA 3ARGA 2FEEL 4X0KA 2BNUB 5BZDB 2AXFB 3DSFL 1N7MH 4JDTH 4KUCD 4LPYA 1VERA 3WHXB 4M61A 2XTJB 2BRRL 3TH2T 5E1AB 2XTJE 2XY1A 5F88A 5IBTL 3ZKNC 1UXWB 2NW3B 4HULB 5BZDA 1HHGB 3VWJB 1Q9LB 4L4VB 3C8KB 3DV6B 4M6MH 3G6JF 3EDDA 5IB1B 4OV6F 3WIIH 1DN0B 2QBWA 1VFBA 3P9MB 2CDFB 3UYOD 1LDPH 4OCYL 2CDEA 2HJLB 2DBLL 4FP8H 1S7VB 2CRMA 1J1PL 1JPTL 2ICCA 4WJ5A 1ZHKA 5IHZB 1CLYH 4P3WA 2GT9B 3WUZA 1IGTB 3ZDYF 4MNGB 5I8OH 1IGIL 4KY1H 4R26H 4YJZL 3REWA 1DQML 1OAZH 4LCCC 1L9MA 2G5BA 4LPUA 2ILLA 4FQHA 4HKJA 4RFNB 4Z7VA 1P1ZB 1X5ZA 4P4RA 3L9RB 1ZLUK 1VACB 2VABB 3DMMB 5D2LB 3QBTB 1C12B 4OZ4B 1S9VB 4NN7B 9CGTA 2BHYA 3BO8B 3A6OA 5KSBE 4QYOA 3FHQA 4XVTL 1BLNA 3MBEB 1JWSA 5GGQL 3RWDA 5CZKA 3U0PA 3RVTD 4GBXD 4WFEE 4LKXB 4UILH 1GPOH 1IE5A 4BFBD 1ORQA 5IHUL 3SGDH 3B4NA 2LFGA 3OXSA 4QRRE 4QXGH 5GGTA 1O5DT 3QXAB 1CQYA 1GGBL 3MXVL 4NPYA 3LV3B 4ZDHA 2YRPA 3G5YB 3QEGL 5DYOA 5IIEB 2NY6C 4FFZL 3MOAL 1VGKB 2BOBB 2AK4B 2VLRA 1J0IA 3DHJA 2R1WB 5E2WL 4LHUA 3S88H 3S35X 1TJHL 2O5XL 3NAAH 2OMNA 4ZFZA 1GH7A 1WZMA 2DDQH 4HEME 1I1FB 1QLEL 4NGHL 4ZTOL 2Z92A 3VFOA 3U7WH 3X3GH 1H9VA 2R69H 5EUKB 3N1PC 5EZLB 3VXPB 4ZFFA 5EORL 4GS7B 4DZ8A 3QUXB 5JOEA 4BSJA 4JZNB 4TSCL 5GS2H 1YEIL 4O4YL 1UFUA 3P4LA 1T03H 3G5VB 4XT1C 2IC2A 3NTCL 4JO1H 5E2UL 2XZCH 3LS4H 4N0UB 3GNMH 3BUYB 3EYOB 4ZXBD 2X5PA 4LMQE 3Q6FB 1FL5A 2GCYB 4X4MA 5KZCD 2QADC 3C5ZA 4OSUH 4NKOB 2P5WE 1GSMA 4N1HB 1DDHB 1VEOA 3LS4L 1JMXA 2XRAH 1B0RB 2LABA 3NFSH 4FQIH 1MCQA 4X6FB 2BNQA 3K46A 3ARBB 2APTA 4WW2A 5FGCE 5EC1B 5HGAB 4KXZI 5A16B 1U58B 3ME0A 5FM4A 3JVGA 4OF3A 1TITA 4LPWA 2F53B 1X5JA 2EDRA 5IVZA 3TFKC 1HWGB 4PJFB 4JRXB 4NKIH 1NUNB 1RUPL 4DUXA 4GW4A 4ZTPL 3FT2B 4O2FA 2HLFD 2VWEC 4GRMA 3SGEH 5FYJD 3QIBB 4L29A 4Y5XA 3V4PL 4NO0B 5ICXB 3O4LD 1BFTA 2DS4A 5DEGB 4L4TB 1CE1L 3V4VL 2CXKA 1I3RA 2YPKB 3K74B 2DQTH 3LKQA 3HNSL 4OI9A 4B0MM 1TZGL 4OLUH 2NX5D 4ONFH 3AREC 4XP5H 1AIFA 4ODWA 5DSCA 3HCVA 3H9HB 5ACLA 4U7SA 3MRKA 4LAQL 2VR9A 4PLJD 4S1DC 4Z78B 3GMOA 3H9SA 1NGXA 3C8DA 4LIQH 5C0IA 4HK3J 3V4PH 1ED3B 4P99A 1CG9B 4C54A 4Y16D 4MAUH 1FN4B 2PYFA 2YD8A 2AXHA 5LAXA 3WIHA 1FGVH 5HBBA 2I9TB 3QCUH 2E7BA 4QOKA 3TVMD 1YEKL 3BP7A 3KPQA 3ULUD 3MRRB 5JZ7C 2NR6D 3LRHA 1QRNA 2Q86B 3QAZC 4HBCL 4LCUA 4YGVA 1QFUH 3IXTB 3QEQB 3MLUH 2IPKB 4C56D 5HGHA 2PYEE 3PL6A 4I0PB 1OARH 3BOVA 4PG9A 5LKNA 1IM9B 4RRPA 4HZLA 5DJZB 4MA1C 2Z9TA 4KRLB 2WWMC 4A6YB 5CWSA 5DRZB 4X6DA 4I1NB 4HFUL 1KIUA 4LHJB 1HXMB 4LP4A 1T5XA 4XPHL 3DTXA 5F1SA 5ICYA 1QBLH 5IB4B 2QHRH 1R5VA 1EZVY 5CJXA 4NQCB 1BVLB 3FB8B 4WW2F 1UH2A 5INCB 5E6ZA 3SKJL 1BQLL 4UNTA 4X5WB 2Q76A 1I4FB 3GMLA 1AGEA 1F4YH 3AC0A 5T1LA 1F6AA 4E42B 3BSZL 5KJRL 3KXFA 5F7LB 3O45B 4HWEL 3OB8A 4NWUH 2IAMA 4ONHA 3QUMA 43CAB 2CMRH 1XF5A 1ZHNB 1DVFB 2VXTH 4R8WL 5D5MF 3VDAA 1MF2L 1ND0B 1RK1B 2VLJD 4MB4A 4ORZC 5C8JB 4WO4C 2BVUA 3FO0L 4G8FB 5FHAH 4KJYA 3GKWH 4QT5B 2D2OA 1J1OH 5T3XH 1WUNT 1OTSC 3ULUL 2XWBB 5HHQB 1YPZB 5K59E 3V0WL 5IJVA 2DQCH 5F9JB 1I8KB 3IJSA 4LEOA 4KZDH 4WWKD 1KCUL 5EU4A 1E0OB 2HLAB 5EU5B 1EVTC 5HTSA 2AGJH 1FPTH 2VRAA 2CIIA 5T3XL 2ICWJ 5JXAL 1A7OH 1IAOB 2W07A 1BBJB 1D6EA 4PRDA 5DD3L 3KXFE 1HYSC 1NCWL 3QWOB 2HFEB 1TFHA 3V0WH 1CDUA 4G8FA 1J87A 2PNDA 4L8BA 1UM5H 3DI3B 3UDWC 1MREL 2A1WH 3CCHB 4YFDB 3MODH 3HNTH 4WCYH 4XC1L 1R0AL 4BFGA 1OSZB 1Z6JT 1XF5B 4NZJA 4P2OC 4PV9B 5SWZE 5C0CA 4XNZC 2WP3T 4HFWA 4OB5H 3O81A 1I1AA 5TFSL 4R8WH 4HPOL 2N56A 3D39B 4OGXL 1KIPB 3PIQB 1QTYT 1YQ2A 4JVUA 5EIIA 4PJGE 4F15C 2VB5A 4G6JL 35C8L 3LPWA 4HCRL 3RDTB 4L1DA 5DFVD 4NQCA 1NFIB 2J12B 3KLAA 3WKMH 4XMPH 4MSWA 5F93C 2XWBA 4JHWL 4G8IA 2A83A 2FWOB 5I18H 2NNAB 1MFAL 4K2UL 1X3DA 4QT5A 5IB5B 1Q72H 1NGXB 1INEH 2E7LA 4LLQB 3TM6A 4NM8H 1U8MA 5DVLA 4LVHB 4GAJH 3HMWH 5KSVB 4RGNC 1H3PH 4Z7UB 4Y5YC 4N0YH 3VFSA 2I5YL 1NC4A 2YPKA 1QLFA 4P9HL 1RIHH 4PRPA 3RTQA 4MAYD 3QQ9C 4RNRA 3AVEA 3VWKC 1NANI 4Y5YA 2OSLB 4U1JB 2PO6A 3D18A 5I75B 1T0PB 5T1DH 5DRWB 5C0DB 5F3HA 3A6CH 1JWUB 4K7PX 5JUEH 4M3JA 4XNUL 4P23A 3PWPA 5JW4M 3TBTB 1P9MA 5MHSE 2ZUXA 3RNKA 4HX1A 2YC1A 1JPGB 4PJEF 4XXDA 3LEVL 5DD1H 4P57A 2ZKHH 4KV5E 3GSVA 3OBAA 3BMWA 4OQTA 1RZ7H 1JFQH 3CH8A 3I6KA 5HI5D 5CZXD 5L8LB 3BZFB 3SE9L 2NXZD 4LARH 5C3TA 3IF1B 4IOFC 3MNVB 2XOTA 1WIUA 2GJ6E 1ZHLB 2BNRA 4QWWC 1YNKL 1MJ8L 2IALB 4NN5C 2AJUL 2A9MH 3DMMD 3OAYH 3QWQB 1I4FA 4YDJB 4K3EL 5J6HB 2FECL 3O0RL 3SE3A 2UWEF 4ZUSA 5DR5L 4P46B 3M07A 3VJ6B 1TJHH 2O5XH 2ZKHL 3FAXA 3MTRA 3RJDA 2EXWC 2VKXA 2XXMB 3HKFA 4YHYC 4Z7VE 5JIPA 3QAZB 3T0DA 4D94A 4X7CC 4K23H 3VXME 4YNYB 1HHHA 1KNOB 4PJCE 1HCFX 3QI9C 3DO3A 3HMXH 2W9EH 1HDMA 5EU3B 3LV3A 3MNZA 1S5HB 4JO4H 4P9HH 3PHOA 1G9NL 15C8H 4PGZA 4BZ1L 4BQCA 3MLUL 2D31B 1S8DA 5F6HJ 2VE6B 3GIVB 5FO7A 2VDQL 3VD4A 3HUJB 5GGSA 1AO7B 4PJ8D 4OZIE 4RAHA 2YN5A 4GAGL 3CLEH 5A2FA 4NKOA 1EGJH 1FL5B 3PF2A 3HZMB 3OX8B 5GHWL 1NFDB 4QCIA 4OLVL 1NFDE 3H9SB 3FAWA 1ZGLM 1KPVB 1OTSD 1A2YA 3DOSA 3QXAA 5T33H 3I75A 1CT8B 1JGUL 3WV0A 4TPRH 2P24B 3V52L 1NUDA 2ZZUT 1MCDA 3GHBH 4PJCA 1A6UL 3LAFA 1MIMH 3QQ9D 1CGVA 1ZA6A 3Q3GA 4IJ3B 1AGDA 2P7TA 4L3AA 4M62L 4BQ8A 4KK6C 4QF1A 4Y4KB 3V5KA 4Q58C 1I1FA 3E6FB 1L6ZA 4D0DB 1RZJH 1C12A 1U2CA 3T2NH 5DJCA 4TVPD 2NY3D 2P7TB 5ITFB 1K4DA 3MUHL 2JLLA 4I0PD 2BOCA 4RQQB 5CHNA 5EPMA 4DTGL 1J9CT 2R1WA 2W0KA 4PRIE 1CLCA 1Q1JH 1F4WL 2HG5B 5T5NG 5DFWH 5B3NA 4EI5D 2H41A 3RWCA 1A8JH 5IUSA 5E8OB 3BI9X 3OXSB 3RUGB 2QQLH 4UIMB 1FL6B 4WHDA 5IEHA 4FN0A 2EXYC 2GUOA 4OGYH 1W0WA 1U3HD 4P3DA 2FATH 2R8SL 3ULVH 4OD1H 1FO0A 3H7LA 4YR6A 5DMKB 3WE6B 3MLWH 3QRFM 5I6XC 2JCCF 3O2DH 5EA0L 3ZZ1A 3VXOB 4FOMA 4XCFH 4IRZL 4WU5B 1MCPH 2C4XA 2UWEA 4Y7MA 3KJ4C 3NFPA 4S2SB 2DI7A 1J8HE 3KJ4B 4UV7H 3EKCA 2YUXA 3EOYG 4XCFL 3GSUB 2AEQH 3O6FC 4AL8H 1CBVH 2Y7QA 4JFEA 3T1FA 3B3IA 3CVHH 5E6IB 2IBZY 2AK1L 3QUML 1MRFL 4KUCF 4LASL 1PX4A 4YDVA 3WN5C 3KWWA 4PLJC 3EYUL 2IANB 3GI9H 3SE8H 4L8SB 5FV2A 3W2DL 2QJDA 3FL7A 3ILQD 4U31A 5AWNH 2X4NB 4JREB 4ZFZB 2ARWA 2FD6L 3U0PB 5C0RH 2FSEA 3T0EC 5L9DH 2DLIA 2FCBA 3BT2H 1QBAA 1ZANH 3EO1A 2C1PB 4WUUB 5FECA 4PJ5B 1DFBL 1DE4B 1E4WL 5IFJA 4NPYB 3KYOA 4AEIH 2FR4A 2QHLA 2YPLA 3O3AA 3L9RA 4HXAL 4P4RB 3L7EB 2A0LC 2B4CC 2BVOA 5D2NB 1YEDB 3KR3H 4O2CA 4AMKL 2ATKB 1WV7T 2Z4QB 1FL6A 3UJJH 3P9WB 4KJQC 2YN3A 4FFWC 1VGEL 1BLNB 2H1PH 4Y1AB 4F9PA 1FLTX 1U3JA 2AV1A 3SDXE 5AZEL 3TWCH 2NX5E 1P84J 2EYRB 3SDDB 1CK0L 2DQJH 2LU3A 1QG3A 1A6AB 5EIQA 1D5ZA 1CICD 1LILA 3HE6C 1NGWA 2EECA 4GAFB 5IK3B 4L4VA 1T1WA 1AE6H 4G80A 2XG5A 2PCPA 4LKCB 4PJ9D 5BZWA 2NMSA 3B6SB 2EYRA 3SDDA 3Q3GB 1EO5A 3BGAA 2FIKA 5FO9A 1OM3H 2AGJL 1NQBA 4PGEA 5D72L 5AZEH 1CLYL 3SDYL 3TWCL 3UTTA 5DI8A 2DM2A 2VXVH 3S4SG 3IKCB 3E6HA 4JO3L 1E4XL 3TJHD 1KBGL 1DEEA 3NIFE 2EIZB 1XF4A 2HAZA 5TDOB 2HFFA 4HF5H 4RIRB 2BNQD 1P4BL 2C9AA 4XNMA 3UTTD 3U6RA 1A3LL 2X70A 1AXIB 3SCMC 3KAAA 1DE4A 1A02N 4XB8A 4O9HL 3W81A 3SOBL 4EKXA 2PTUA 5DMIH 2YMXH 3RVXC 3MO1A 5EDXA 4NJ9L 3W9DA 3VI3F 1RUPH 4UNVA 1FBIL 4M3KB 5FUZL 3EOBB 4E41A 1QSFE 4P4KD 3L3KA 4PJXB 5I1IH 1MJUL 3F7VB 3D3VB 1AR1D 1BFSA 5JIIA 5IVXB 5DRNA 3T2QA 3EO9H 3QUYB 2RFXB 3MBXH 4M7ZB 4YBLC 1KJMA 1KFAL 1JPSL 2W9LA 4ZFOL 4JANB 3W5MA 3ALWA 2PO6B 4OZGB 4KQ4L 5HHVL 4UOJA 2DLTA 2I60L 4U1MB 5CSZA 1JIBA 1LEGB 3O2VL 3OKEA 4IIQA 5JORA 4P4KC 4P2QA 4OSUL 1Q0YH 1AO7E 4LLAA 4ODTH 1E27B 3D69B 5MP6H 3VJ6A 2Y4SA 5ESVB 1U8KB 5F72S 5D9SA 3OKDA 3ROLB 4PJGA 5B4MD 3BZ4A 2VUYA 3MRMA 2D0HA 4MS8C 5H94A 3LSOB 1V5JA 3HI1B 1RJZA 2BNRB 3I02B 2FWOA 4G8IB 4N90D 3CLFH 4Z5RB 3BP4A 5FUCE 4PRNB 5INDB 4JKWA 43C9B 5HGBA 1P7QA 2GHWB 4XCYA 2J1KA 4HIXL 5ACZA 4WO4D 5GGUB 3P73B 5ESQB 3PGDA 1NMBL 1N6QL 1A7NH 4HS3A 3OAUL 1JNNH 5FCSH 1MCKA 4UMGA 4KKAC 2DQDL 4Z7UF 4PGEB 4ONHB 2JIXD 2FGZA 5DJYA 4Z76A 3QPXH 5DJAA 3VXUB 3SE4C 1XCTB 3FTGA 4P5KA 2WM0A 1XR8B 4OB5L 1XGYH 3GMQA 1E28B 3VI4E 4I3SH 1UWEH 1BF8A 3QSKB 5FYJU 2EIDA 5D1ZA 2BXYA 3IAGC 2X2YA 3SGDI 2E27L 1KTDA 2VH5H 2VKWA 1JTTA 2D7MA 1ETZA 3CVHA 4YAQB 4BFIA 5HDLA 2NYYD 2V5TA 3GFUA 4Y4FB 2VLLB 4LEOB 1R5WB 1HH9B 1ACZA 3FHAA 3CDFA 4RWYH 1KLUB 1SY6H 5TF1H 4DKDC 3C60B 4L4VE 1MFDL 4RFOH 4YH6A 3O3AB 4Y19D 3OHXA 1I9IH 3B8SA 4H1LG 5EOCH 1MI5D 4XBGA 2XKNA 4WUKL 4CMMB 1HIMH 1KB5B 1N2RA 3PGDB 3MRDA 4NC1C 5GRJH 2NY0C 3N9GH 4XCYB 4XXCA 1IM9D 4PRHB 5IBUB 4PBWD 3EW3B 3F12B 2VXSL 1DVFA 1ZHNA 2LTQB 3CVIL 5EU6E 2X10A 4NRYB 3DYOA 5EBMB 2YK1H 3VGGA 5EN2A 4Z7QF 5SWZD 3UMTA 1LE5A 2YZ1A 3RNQA 3FQUA 2B1AH 1QFWM 1UWXK 5H94B 4QHKI 4I9WE 3VFNB 4IRJA 3O6ML 5FFLA 5D2LF 1KLUA 2XACC 1FNEB 5SWSB 4O51A 3QEUB 5EG6C 1T03L 2IQAA 3MLVL 5EOCJ 2X89D 4UAOB 1CXHA 3GI9L 2EH8L 2P44B 3D85B 3HS0B 1AQDA 4QTHB 3CVHB 5C0AA 5E5RB 3QPQD 2BVEA 3U79A 3V4UH 2X89A 1XCQB 4EI5A 4ODUA 1NFDF 5KVEL 3RZCB 3BVNB 3NAAL 5D7IF 4BYHA 4H0HB 4N8VA 1YC8A 4G6KH 1HNFA 2X4PA 2NX5B 3TFKD 2APWA 3MV01 4N8CL 2LTQC 3L3IB 1MAMH 2Q20A 3JUZA 2H32H 3O11A 1WZ1L 2Y06H 3QIWB 2DTML 2ZUWA 3C6LB 2C3HA 5I1KL 4K94L 3QDJB 2AJYH 1VFOA 4NQCE 43CAA 1Q9WB 3PJSA 4R2GC 2NLJB 3RVWC 5TDPA 3FOLB 4WUUD 1G7HB 2ZOKA 2VLKB 2XTLA 1O7SA 4P2RA 3QFJE 1U8OB 4HUUA 1D5MA 2H6PB 3P4NA 5F9JA 2E6PA 3UPAA 3VG9B 3ZHKA 4P5TA 5B3JF 4LLDB 4HBCH 3MV8E 1XGQB 3SPVA 4P4KA 4F7PA 5KVGL 3GMOB 3GJEA 1DUZA 3HE6B 3QT2A 5CEZE 4Z18A 2JJVA 5HHOD 4HK0A 1T20A 1TQBC 4PJ5D 3QEQE 5I1AA 3BAEH 3DVGA 1HQ4B 1U2HA 2OXHA 5DA4A 3ZE2E 1QLRA 2Q7YB 4TUKH 4KUZL 1T21B 4U1IB 5DO2D 2Q3AA 4QY8B 1GGCH 5FHAL 4YHOL 3BFOA 2YD4A 4TUOB 1IM3B 4EZMA 1IQDA 5DJ6A 5CINH 2IPUG 4PRBB 5F1NA 1OSZA 2VNCA 1H8NA 3RIAK 1OP9A 5HPMA 3DRQB 4RA0C 3QUKA 4Y1AD 5F1KC 4X5WA 2IADA 5BMFL 3NFNA 4W6WB 2OTWA 3AY4C 4ZDHB 4PP2B 4EQ2A 1FN4A 4Z7WA 3BQUD 4WFFD 1JYVA 4XNMB 1G7JB 1FL3A 4IJ3C 3ZHDA 3MRJA 1ORQB 2GSGB 4P23C 3BQUA 4G42A 1A7PH 3H9HA 2OTPA 4PRID 3N1FC 4HV8A 3RVTC 3INUH 2E9JA 1ONQA 4MD0B 3R0NA 4AIXA 2VQTA 3VXSB 4X5LA 2Z35B 3CC5B 4K94H 2OJEA 3PL6B 1S7SA 4WO4B 2OX5A 1Y6KR 2AK4D 1NCUA 4KI1A 5FECB 3T77B 1CFSA 3ECBA 5T3ZE 5KVDH 3WFBH 1YPZE 4TULL 1EFXA 1KELH 1G0DA 5AZ2H 3EFDL 3QA3B 3P30H 5HYQB 4XP6H 2R56H 5IB3A 2A74A 1FV1B 2OP4H 5E4IA 1H5BA 1U0QA 5E8EA 1JGDA 2DN7A 2CGRH 2EDKA 4NHUA 1NCBH 4FFWD 5FDYA 1EXUB 2NY6B 3QUYC 3PHQA 1NGYA 3GSVB 3WFHA 5GIRA 5I1DB 3KXFB 1JYWA 1UXSA 3C2AH 4OKVA 4ZQKA 3STLA 4KU1A 4MA1B 3LKQB 4YE4H 2C4FT 1IAII 1ZTXL 5L6YL 4PJAF 4ZAKC 3L3OA 3B9KB 3WNOA 4LQFH 4Y88A 1T22A 2P8PB 3BWUC 4I2XB 2HH0H 3C9NA 5IFAH 2JJWA 4LVNB 4YXHH 1A7BA 4O2FB 2V5RA 2YD3A 2WIIB 3QPXL 4BJLA 1FAKT 3O6LH 2J88H 1GC1C 4XNUH 3SKNB 1IM9A 4X5XB 1A6PA 5IWLC 3T65B 4QNPF 3OAYK 3U4EB 5K9JL 1HH6A 3AROA 4OFPA 3VD9A 1VKXA 3K3QA 4N0CD 2VTFA 2BOCB 3D2UD 4QGYA 2CR3A 1REIA 2IAMD 3KPSA 5HI3C 5ALCH 4U1KB 1GZPB 3MLZL 4WI2A 3NA4A 1J8KA 3QFJA 2P5WB 4HS6B 5IESL 1MUJA 2HJKA 1NBVH 3SKMA 4NO3B 1JNJA 2X4RB 3VA2C 3DGGA 3MYZA 4M1DL 4BKLB 4PJIF 5JDSA 1A14L 3VGBA 3HHRB 3V7AE 2CRZA 3ZDXF 5EO9B 1U6AH 2BVOB 3HI5L 4KDVA 3MLZH 4UINH 3KJ6L 4ELKB 3UAJC 3V7MA 1XGRA 3RWIB 5BV7B 1RUAH 2IGFH 1A6WH 3VW3H 3D3VE 2HG5A 3S3SA 1Z9MA 1MWAH 3FONB 4F7TB 4FQLL 4GQPH 4L4TA 5C6TH 4JHZA 1A1NA 3RL2A 4NRXB 4XP1H 1B0GA 3P77A 4UOW0 3WDHA 5DMJB 2XG4A 1KXQE 1S9VA 2BNQE 4WGWB 2AJUH 3DURB 4IRJC 1VENA 4Y4KA 4L4JA 3V5KB 3TESA 5CJXC 4ZAKB 2HLAA 5EU5A 2FL5A 4BK5A 1II4E 1YYML 4Z77B 5CS7A 4GRWH 4HG4K 1S5HA 3FQRA 2VLJA 1NCWH 3EYSH 1JPFB 2VERN 5C0JB 4KI5F 2D7OA 5DJ8B 5HYJE 4B7LA 4Y2DD 5EB9A 1T4KB 2DL9A 5KTEL 2J8UF 3MJ9H 2ITDB 4TSBH 3RZCC 4ZAKA 5B4MC 1KGCD 5CCKL 5D7IA 1HYRC 4YFLF 3BXNA 3BPLB 3MRFB 3VXRB 1U91B 1FYTA 2GCYA 1JGVH 4JE4B 4YR6B 5DMKA 4XBPB 1NMCB 5BS0B 1S7QA 2QQKH 2IPUK 5C0AB 3TO2A 1J5OH 4H8WC 4U6TA 4YXKL 4JY5H 1KT2B 3WJLC 4KK5C 5DHVB 5AZ2L 3IF1A 1DVFD 3GGWB 3VI4F 4PJXF 2OLDA 2UZXB 1ACYH 3CFEB 2HRPL 3UTTE 5JQHC 4F7MB 1HQRA 1Y0LB 4U1SA 4LPVA 5FYLE 4NQDD 4OQ1A 5GISH 1ZMYA 2VZ3A 3I50H 1YJDL 2GIYA 4J6RH 5DJCB 5J1AA 5FDWA 3FFCA 3P9LB 4JFDE 3CDCA 1CDBA 4M00A 4MNQB 3RVXD 1WBYB 1OT1A 3CXDL 1U8LA 3VH8A 1HXYA 4HUWA 2BOBA 4OUUB 4XCEA 4ZUVB 1A3LH 3H3KA 3FJTA 3ZKSD 4UZGA 4NC1E 4PV8A 1CS6A 1EFXD 4ODBD 3NZHH 1AR2A 3VH8B 4Q9RH 1MAJA 1BJMA 1ZS8A 4EDXB 3T0VA 3FO1B 1ZXQA 5IV2B 3VE0B 3L3GB 5DD3H 3EJZC 3DUSA 2FD6H 2WBJB 2FO4B 1R3KA 4LVEA 1GXEA 3WYRA 4QXUL 3ZSTA 4RSVA 3DVNA 4WWKA 4K7PY 1OPGL 1CFNA 2HWZH 4FQ1H 3TYGL 4ZFGL 1SHMA 3SO3B 1TQBB 3OL2A 5L2KB 3MRGB 3WL9B 5AYQA 4IOIA 4RAVA 1MREH 2A1WL 3GZKA 1SBSL 5DRWA 1PY4A 4U6YA 2X4QA 5DURB 5C0DA 1C5CL 4XVUC 5D2LE 5L2JA 5MEPA 2D4DA 4F80A 5F71A 4Q6YA 1K2DA 2NW2A 2UYLA 1SBSH 4PJXE 4W68A 1X4XA 5IQ9B 2EDEA 3S35H 5FGBA 4K3DL 5MI0C 1P6FA 1GAFH 1Q38A 5HHMD 5DXWA 4GRMB 1AC0A 3L3DA 1KN2L 2QSCL 5JXED 3TBVA 1S7XB 4Y19A 4YGAB 4IM8A 12E8L 1LDPL 2Y36H 1OAKH 5EZJB 4MDJB 1DUZB 3KHOA 4MA3B 4OLXH 3MROA 1U9KA 3TBYA 1WZ1H 2Y06L 4CVXA 5TE7L 1DN2A 5C3LD 4C56B 3GGWA 4GLRI 3WHXA 2D9QB 3P4MA 5EIIB 2VLLA 3TNNB 1RMFH 2BNRE 4L4VD 1G7MB 2VSCA 3ESUF 3BKCL 4KKBD 2IH3A 5A2LH 1D6VL 3BW9B 1IEAB 3GO1H 1BQSA 3MLXH 1MI5E 5HYFA 1OP5H 4KRPD 4QOKE 1VFAA 2WBJA 3L3IA 4MXQC 2X44D 3DX9A 1INDL 4XX1G 3MRLB 4LOUD 1WTGT 4ESKA 4JFED 1LMKA 3WCYA 1OTUC 2C7UA 5CBEA 4BELD 5MERB 1XCQA 1N6UA 2JJUA 3RVUC 1HYSD 2E7LC 3K8KA 3DO7B 4XC3H 5MP6L 5FHBH 4KRPB 2DQGL 2CDGB 5J06A 4G7VL 4ELME 1F6AB 3ZO0A 2NCMA 5GGTH 1VDGA 2VXSH 3UTZA 3MFGB 4F3FB 3IJSB 1NGQL 2BK8A 4HG4J 1MCLA 3RDTC 1TTFA 3KDMB 4Q7DA 4R0LB 2GJZA 3MBXL 3QJHB 4QHLA 4XH2B 4AZ8A 3FQXB 3HAEH 3NCBB 4JHAL 2K7PA 4O02H 4Q9QL 5EN2B 1N64L 4XX1E 1RJZB 2UUDH 2DI9A 1WCQA 2AJ3B 3VU2A 3BKJH 1RI8A 3JXAA 5I15H 3U4BH 1QZ1A 3MREA 4X98A 2VXUL 4R0LC 5K59F 1P6AB 3QG6A 1CFTA 4WEMB 5IW6B 4FTVB 4JO4L 4NQVA 2MPAL 5TGBB 4PG9B 3QCUL 4PJAA 3FKUS 1YMHB 3WUWG 5ADOL 1XGTA 5FYKL 3MV9B 2OI9C 3IB4A 3LQAL 5HHXH 4RBPK 3RVVC 4ZPTA 3G6DH 4AG4H 4OTXH 3I6GA 4FXKB 3F5WA 2EKJA 3RU8H 3STZB 3MUGA 1KB9J 2C3GA 2ZUQB 3N85H 1FNFA 2MPAH 3MJGX 4JRYD 1WC7B 2YD6A 3ISWA 3ARDB 1BREA 3VW3L 2R2EA 1QSFA 1X44A 4LEXH 3BKMH 4MX7A 2JIXB 2C5DC 2OXGA 1UKTA 1R24A 5T33L 4KGJA 4HGMA 5KZCB 4KRMB 1DZBA 3UTSD 1JZ6A 3AS3A 1A4KB 1FZKA 2D7PA 3QFJD 1AD9A 4PTTB 3ZHLA 1VFBB 4MLIA 1YYLH 2CSPA 3DWTA 4M1GH 4ZUWA 1PEZA 1QBBA 3RNQB 3J7HA 3CU7A 4XCCL 2R0KH 3WNLA 5GJTL 1JUFA 4NQDA 2DYPA 2P8LA 2BNUA 5HXMA 2AK4E 1YN6B 2QR0A 4FTVD 5K9JH 1AGBA 3ZL4H 4NBYB 1TTGA 2PR4H 4KJPC 4WW2C 2FIKB 3GK8L 4WWID 2NYYC 3TH3T 2VL5B 1LE9B 4LCCB 4BKLA 3PP3K 2E8ZA 5D5MA 1DQDH 5FAAA 4FZ8L 3ULSB 4TTGA 4PJFE 4DK6A 3IVKA 4PJGB 3DX8A 1BQHG 3MA9L 2VISA 4ZD3H 4GG6E 5I1JH 4QHNB 4Y0GA 1J1XL 4JFPB 2WUCH 1UCTA 4HCRH 1B6UA 2VZTA 1RJYB 1CTNA 3HE7A 5GRUH 3BKYH 3SEPA 3MRNB 1IM3A 3MRKB 3MCKB 1IARB 1A9EB 4X6BA 4KJQD 2LVEA 2DLFL 1WWWX 1V3KA 3F7YB 2W9DH 2AEQL 2JE8A 4FFVD 5IBUG 1S7WB 3GBLA 3ZTJG 3MCKA 3DX6B 3CSBA 4LSTL 4IHOA 1N59B 1UC6A 2CUIA 2ENYA 4XVTH 4DQOL 1I3RB 1RJYA 3LOWA 1MCEA 3P30L 3QHFH 4C55A 1FC2D 4Z7WB 3MGOA 4TVPE 4HIEA 3PV6A 3R06B 2X4UB 1H3GA 2P47B 2QKIA 3DX8B 4RISH 3IJHB 4ISVB 1DBML 4LNRB 4M9OA 4ZQKB 4P46C 3ETBF 3HC0A 1AQKH 3QXVA 3X12A 1G7HA 2PN5A 2ZOKB 1DUYA 3SGJC 3VGFA 4XBEH 5KG9A 1NANH 2H2SD 3R06A 1QSEA 4G6ML 3BYTA 1MHEA 2I9LA 5TE7H 2R23A 1SEBB 5DFVC 4MNHA 3SDDC 3WFDL 4K7PL 1SYSA 4LLVB 7CGTA 2IFFL 4HQQH 3QP3A 1AI1L 2Y72A 2IANE 5HJ3A 3ARXA 1MRDH 4G9FD 3LN5A 1DQQA 4Z0XB 5GS0L 1ZGLP 1UWXH 4TQEH 1JPTH 1IBGH 2