2NCMA

Neural cell adhesion molecule, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
b'RVLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURAL CELL ADHESION MOLECULE
publication title The three-dimensional structure of the first domain of neural cell adhesion molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ncmA00
3QIWD 3QUXC 3QWOA 5D93C 4IS6A 3U4AA 3FONB 1EMTH 3LS4H 5FDWA 1UM6H 4PJ7B 1S9VB 1XGRA 4S1DD 4KROB 2DQCH 3V7AG 3U48A 4M7JL 5IROA 2HJFB 1I7UA 4Z78B 4N0YH 4EI5B 5LWYH 4HJGA 1VEPA 3BP6B 5FCSH 1LILA 1TETH 4JY4B 2BY0A 3QEQB 4WO4B 1DN0A 1H5BB 4OF8A 4TVPD 1FV1B 3C5JA 3L7FB 4Q0XL 4P4RA 4ZXBB 5F7DA 5IBLC 4KAQL 3FFCD 2GY5A 1YUHB 4WEMB 4Y5VC 1IM9D 3DO3A 4P59H 2VABA 1CK0H 4PGZA 3L3DA 4JZOB 5BV7H 1FO0B 1MLCB 3VRIA 5I17A 1RU9H 2D7OA 1PKQE 2DYPD 3MBXH 3WDJA 4J4PD 5GRWA 1VACA 2XI9A 1CLZL 2P8PB 3MROA 2GJZA 1MY7A 4GUPB 3O4LA 3VGFA 2AJZA 1IILE 1EEYB 2BVPB 2VYRE 3MRHB 1OW0C 5C0BD 5JDSA 3VXSB 1NEZA 4KKBC 2EH7L 1WQVT 4LNRB 2LAAA 1I8IB 5KVEH 1IGCL 4PRIA 5ADPL 2CLVA 2EE3A 43CAB 4ZS7H 3WSQL 3FN0L 4IRSB 3QDME 4Q6IB 2VE6B 4HS8L 4P99A 1SQ2N 1RZIA 5IMMB 1ZWIB 3KPRD 5D5ME 2FHFA 4ZO6A 3ZLQC 1KCVL 5FF6B 4NN6B 5HDLA 1QO3A 2FO4B 2Z8VC 2ZOLA 4HS6A 3K7UA 4Y19B 4IBLT 1IC4L 1JHKH 4XVSL 2V5RA 2I9TA 5DF0A 4IS6B 3WIFA 4YHML 5FDWB 4F7TA 4JPKL 1TITA 1XGRB 4ZUWB 3MFFB 3TBVA 4YHYC 3SQBA 4OGXH 4NNXA 3CMOH 4RNRA 2L7JA 2IFFL 3SY0A 4FQIL 4YAQA 1UXSB 3K1DA 5DD0L 5FOBA 2YUZA 1DN0B 5JHLH 1QSZA 4UINH 5EU4A 5D1QA 1RUPH 4G5ZH 5IR1A 3T0AA 5H94B 1FYTA 1OAYL 3K3QA 1NC2B 4OM1L 3SO5A 2WBJC 4BZ2L 2VDNH 2J2ZA 3L3DB 1TQCB 3FO0L 2VTFA 4O02L 2C4XA 3O8XD 1E27B 4UUJA 1BFSA 5EU6D 1JTOA 5KVDH 4YHNA 5FO7A 1VACB 4JFEA 2VXSL 2RCSL 1JP5A 5DHVA 2OR8A 3MLYL 4RFEA 3BWAB 4IDLA 5JDSB 3RQ3A 1A8JH 1F8TL 4P2RA 1TJHH 3MOAL 4RFOH 4PRIB 4MSWA 2CLVB 4RDQF 1RI8A 3VWKB 3B2VH 5K9OA 3UTTD 3GMMB 4WHTA 3UJIL 3QIUA 2RAMA 3QDJE 1KPUA 1F13A 2FD6L 2NY1D 3HR5A 4XP6L 2AAVA 1BX2A 2XXMB 2DLIA 1QO3B 4U0RC 3CVHL 2QKIA 5JTWA 3CU1A 1RUML 1ZEAH 1TLKA 3IXAA 2X10A 1Y0LB 3BQUB 4HS6B 3CK0L 4J4PC 4V1DE 4KZEH 3NAAL 1GPOH 1M7IB 2NCMA 4X6BB 1K5NB 1X5FA 2I9TB 3WIFB 5SWQB 1K6QL 1FCCA 4F7TB 4WI6A 4DGYH 2IPKB 5C0JB 1INDH 4NNXB 1KLUB 5IEKA 3VFPA 1CLYL 5ICZA 2OTWA 3FOLA 4AQOA 1P5UA 4HBCL 4YAQB 4HIJA 5F9JA 4N0CD 5DEGB 4HUXA 5D1QB 4CU7A 1JMXA 3FQRA 5ANMA 5JUEL 3VGAC 5IR1B 4DW2L 4AL8L 5L7XL 1FYTB 2EZ0C 2ERJC 1N8ZB 2WUBL 2EDKA 1PYWA 4Y16A 3QHFH 4OLVH 3G6DL 3CJJA 4OZHF 2QR0A 3O3DB 1BQSA 4R8WH 5AYUH 3PDOA 1QRND 3Q5OA 4Q9CA 1I9RL 4X98B 5DDHA 4YHNB 4OLWH 4I18C 4TVPE 2L7UA 1OTTC 3QAZC 4X7EC 4NZDA 5DHVB 1ZTXL 3FFCE 1OOAA 2ZSVA 4WUUB 2FATL 1FSKC 2XKNB 4L8BB 4YZFE 1HYRC 1QZ1A 5HTSA 5B38B 1B0RA 3LHPL 1MJUL 4P2RB 4DZBA 2H1PH 4MHHI 5DK0A 4F9PA 1BQLH 1II4E 1LO3L 2DJUA 3PHSA 4MSWB 3RUGA 1ORSA 3VA6A 2R8SH 15C8H 1CFSA 2EDTA 2BVYA 4MA8L 4O2FB 1W2KT 4KI5D 4K55A 1I7ZA 5DYOA 5C0BE 5EIIB 1D6VH 2YKLL 2YRPA 4UT6H 1KPUB 3HR5B 5IB5B 1BX2B 2VDRL 4LVHB 3HPJA 2DI8A 1VB9A 2EDFA 4LCUB 2CRIA 3RI5K 4QXUL 1F45A 4WUKH 1P7KB 4ZYKA 5EWIL 4LPYA 1MF2H 5I71B 3ULVD 5J6HA 3KPRE 1DQLH 4JVWA 1U3JA 1KCKA 1C8PA 4S1RH 3TO2A 2D31A 1GC1H 5IEKB 4WFFD 2H6PA 2OTWB 3FOLB 3SKOA 4QHKI 3RX7A 4HIJB 4L4TA 1D9KA 2CD0A 1KB5B 4KQ4L 4HUXB 2R23A 4Y5XB 3FQRB 3IDXH 5ANMB 3L3JA 3F65A 4ZD3L 1MCWW 3QI9C 1YEFL 4PRPD 2CR6A 2H32H 1FGNL 4Y16B 2DLHA 1KJ2L 4Q97A 2Y07L 3P4MA 2NY1C 4PGDA 2NYYD 4KUCF 5I8KH 3I9GL 4NKQB 5F7HA 1QFHA 3PDOB 3WXVH 4NFCA 1QFUH 2X9XA 5DDHB 4TNWF 5IFAH 3O6FC 4HV8A 4I48A 5KN5B 3BOVA 2JJWA 2R0LH 2YN3A 5IHBA 3MRNA 4PLKC 5I1EH 2ZSVB 1I8KA 3QUYD 4XNYH 3R8BB 4GW5A 1B0RB 3DGGB 3AUVA 4DN4L 5IB2A 3KJ4B 3RZCC 3BIAX 5F71A 5KTEH 4UQ3B 4L8CA 2XNAA 3LZFH 3P40A 4IOSD 3RUGB 3RWGA 4AJ0A 2ZCHH 3QUMH 3QIBC 3T1WA 1CGXA 1JNLL 1Z9MA 3SGKA 1KEMH 5GGTH 2G5BA 1MCOL 1KJVA 1I7ZB 4KH2A 3OF6A 4PRAA 2ICEB 4GRWH 5DYOB 3SDXA 5EA0H 1RMFL 2AERT 1XF5B 5DD5H 1I9JH 5E0QA 4KDTC 5T1MA 4I77L 3HZMB 3BEVA 1EEQA 2GUOA 2WIIA 4ZUTB 1V5JA 2KBGA 2FGZA 1NLBH 5EO9A 4P9MH 3QNYA 3UTTE 5IB3A 2DMCA 4ZYKB 3MCKB 4GXUN 4NWTH 4Q58C 1J0JA 2V7NB 5HVHC 5J6HB 1AGFA 3DUSB 4L8DA 2AKRA 3KYKH 4G6MH 2D31B 4F7MA 4ZFOB 3SKOB 1TMCB 1R5VA 2X4NB 4GFTB 4PB0H 4L4TB 5LKNA 4URTB 2R23B 3JSSA 4I0PB 1XIWD 3L3JB 3QCVH 4OCMC 3WD5L 4UT7H 5DEZA 1YYMH 2PTUA 5GIRA 2X05A 5JW5B 1YN6A 4XC3L 3AREC 4DKAA 3NGBC 1JIBA 3P4MB 1F6LL 4P9HL 1A4JB 3D0VA 3T0XA 1MFDH 5E2TL 1QBMH 4NJAL 3LEYL 2OI9B 4HV8B 5TFSH 4LLAA 3HI5H 2B0SL 1OM3H 3OKKA 4UILH 4OBRA 3LB6C 4HDIA 3MRNB 5BOZG 2VNCA 3AMKA 3QPXH 1FQ9C 4KTDL 4Z76A 5HYSG 1JRHI 3VMPA 4GW5B 5IB2B 4M00A 1U8MA 4X6DE 1YN7A 4ODXB 1MFBL 3CFJA 2F8VA 3CC5B 4KXZI 4L8CB 4TRPL 1MREH 2XNAB 3VFOB 1A4KA 2EDNA 1IZJA 3VU2A 3ABZA 3FQXB 4KK8D 3EJZD 3UTPE 2G5BB 4PRAB 2D4DA 2QSCL 3BH8B 3DTXB 1DFBL 2D03H 4APQB 2OTUA 4OSUH 1MFNA 3ET9F 1NAKL 2NXZC 4HLZG 4WWID 2J8UA 1N6VA 3BEVB 4XNZB 2QADB 4JVUA 2GUOB 4U1IA 2WIIB 3S34L 2IQ9L 4GMTL 1EHLH 4QTIL 1RZ7H 1URLA 1RVFH 3LD8C 1X44A 4JO3H 3O2DH 4KI5E 3DECA 4WNQB 3PL6A 2E7LA 1U8OA 1AGFB 3CX2A 4L8DB 5CLTA 3T2OA 1DL7L 1F6AB 3O45B 4LASH 1QFPA 1A14L 5IVXA 2VZSA 1JGLH 3WFZA 1VKXA 4FFWC 3B5TA 2BNUA 1RJCA 5A1AA 1FAIH 1P9MA 4LQFL 1T21B 5D1XD 3HZYA 4OCWH 3ZSSA 1J0IA 1U8LB 3EZ8A 3ULVE 1A3RL 2AJ3B 4K3GA 3IFNH 1BM3L 1T2XA 4LEOA 4WFFE 2ICWA 2ED9A 3D0VB 4HXAH 2ZG2A 3V6OA 3B3IB 3KS0H 5SWZA 4MB5A 1RIVL 3NCMA 5E08L 1JVKA 4YHOH 4OI8A 3A6CH 2OZ4L 4K3EH 4YFLF 1CXFA 1IGJB 3OKKB 5C0NC 4HDIB 4GW1A 4PRPE 3L3KA 4BJLA 2N1KA 3TH3T 4Z76B 4POYA 4X9IA 5DMYA 1OLLA 3NACL 4M9OA 1L9NA 4XMPL 1YN7B 1BBJB 3CFJB 1R3HA 2VRAA 4K94C 4POUB 4R0LA 5HGGS 1ZHBA 1A4KB 1CDUA 4CVUA 5DLMH 1UM4H 5DJYB 3UAJC 3WNNA 4HULB 3WFDH 2GKIA 1CDHA 4BZ1H 3WNMA 2DN7A 2XWTB 4Y4FD 1XIWC 2YD6A 4GRLB 2UWEB 1NC4A 2X70B 1OARH 3CVHA 4TQEL 5E8DH 2OTUB 2NW3A 4ZFFA 5F70A 5EORH 4OZGE 3P0GB 5K59F 4K23H 4HGKC 4EEEA 5FKPB 3NABH 3K74B 1U8QA 4NQDA 4U1HA 1MRDL 2R1YA 4LIQL 1T04A 2MCPH 2VISA 1R0AH 3LPWA 3U6RA 3OGCA 4IRJD 4DOHE 2Z91A 4WTZG 4OCSH 4CAGA 1DQTA 1YEEH 1F58L 1XEDA 3R0MA 5IVXB 1JE6A 5I8CB 3ZYIA 3D87B 1VKXB 3MOQA 5FA3A 4OZFB 1QSFD 1WC7A 2J4WL 4XPHH 4F33A 1QFWM 4ODWB 1JI1A 4NNPH 2GJJA 8FABA 3HZYB 5C09D 3I75A 1YEHH 2VITA 4E41D 5GHWL 3TN0C 3WS3B 2APVA 1VEOA 1EIBA 1WK0A 4QOKE 4KRNA 5J6GB 2X4TB 5SWZB 5GJTH 5CP3H 4FQ2L 3EFFA 3JWDC 5E56A 4K8RC 3IAQA 5F6HJ 4PJHE 4GW1B 2H8PA 1X5LA 4JPWH 3EGSA 2OSLA 5I30L 5JDJA 5DVKA 1EBPA 4UDUB 3WJLA 3BI9X 1R3HB 4R0LB 4P46C 5C07B 1AKJD 5C70A 1NMAH 1YYLL 4AMKL 2EYSA 4W4OC 1OSZB 1UM5H 3VDCA 4GW4A 3UZVB 3ULUF 1KN2H 3QXDB 2JIXA 1NCDH 2BJML 3LSOA 3NIFF 4GBXC 5F6IC 3MRLA 4G6FD 1NC4B 3CVHB 2NW3B 4QXTA 1J18A 4ZFFB 3MV9B 4EIZC 5FUOL 1B0WA 3D85A 3ZKNC 4JGMA 5JZ7C 2XQYK 3HG1D 1MCPH 5LQBH 4PP2A 1ORQA 5HY9A 5KVGL 3D69B 1CDCA 1INEH 1LO4L 2BHUA 3BEWB 1RPQA 4ELMB 2R1YB 2ESVA 2PF6A 2Q86A 4TSCL 1T04B 1DLFL 5SWSB 2X1QA 3MLUL 2VISB 3I6LD 5CGYC 1WLHA 3U6RB 3OGCB 2DQGL 4WDIA 2Z91B 2NX5E 3BP5A 4BQ8A 1NCCH 2ENSA 4WWKD 2YS4A 1IAMA 3OAYH 5FA3B 4XB8A 1YC7A 1WC7B 1JNNL 3PP4H 4F33B 4AENA 2VLJA 3UYRL 1YECL 32C2B 3OPZL 2WP3T 1JZ4A 4LP5A 5D9SA 3V2AR 3U9PH 8FABB 43C9A 2OS7A 4AEHL 4ZPTB 1MIML 3I75B 2UY7A 5CEXB 3VXPB 5KJRL 4JFFA 4RX4A 3O9WD 2VITB 3S36L 2GT9A 3RKDD 4J8RA 2C3XA 4JFXA 3BE1L 5GS2H 3N9GH 4Z8FL 1IEHA 3QXUA 5CWSA 3RGVD 3LS4L 1UQSA 2ZZUT 5CEZH 2EEAA 2Y25A 3W5NA 4U1SA 3RNKB 4RMUA 1WVZA 2BY1A 4C56D 2H8PB 3TJHD 5EUKA 4E0RA 2OSLB 1T20A 1R3LB 3CD4A 5IQ9B 3OXSA 2DDQH 4MJ6A 4QYOB 1FVDA 4M1CC 1N2RA 4GG6B 1NUFA 4J6RL 4XMLL 2EDHA 2EYSB 1T0PB 4NWUH 1CK0L 4RMRA 1QP1A 1MY5A 3I50L 2JIXB 3VXNB 3BKCH 3KVQA 1A7NH 5JPMA 4RDQG 1WITA 3SCMB 2FH6A 4DCQA 2JCCA 3MBXL 1SVZA 4LPTA 1E4WL 5JHDA 1L7IL 4QXTB 5BCAA 1DE4A 1RULH 1J86A 4X6EA 1KB9J 4KHXH 4G8FB 3RY5A 3VRJA 5J8OA 3MACH 5I1GH 1ORQB 5HY9B 4ZUSB 3TCXA 1T5WA 3GSRB 4DVBA 4EXKA 4N5ED 3FT4A 4LGPB 5CSGA 4POZD 1TTGA 2DL2A 1I8LC 1OTSD 4FABL 2ESVB 2ZNXA 2Q86B 5KVEL 3ZL4H 3WS6A 1MCLA 4WDIB 3BP5B 4ZS7L 4TNWK 3MBEB 2MTPA 4HWEH 2DQEH 4N0FB 2BFVH 1OHQA 1BD2A 5E9DD 4YHLL 5D7LB 3F5WA 3IKCB 3UZQA 4LSQH 4ODBD 4AENB 2VLJB 2A9NH 5HHNB 1QSED 1CFNA 1S7VA 5D9SB 2QQNH 2H45A 1GGTA 4NJ9H 4JQIH 5AWNL 3TCLA 1KJ2B 4W6YB 2VN7A 4NBYB 5EBGA 3P77A 3OAZK 2FGWH 1VHPA 3MJ7A 3FO9A 4FP8H 4J8RB 5HHQA 4JFXB 1WBXA 3S5LA 3GZKA 1UA6L 1D5BA 5CWSB 3RUGF 5KANG 4N90D 1UQSB 4XCCH 1GH7A 3LOWA 4OGXL 1DVFC 1S9XA 4U1SB 4X6CA 5C09E 1S3KL 4JFDB 2DQHL 4QLRA 2PETA 5EUKB 1IAOA 5GGRB 4E41E 1RUAH 1T20B 4H1LH 5CZXC 5EB9A 4R2GD 1KENH 4L9DA 3QT2A 5TDNB 1T83A 4UINL 1FVDB 1CL7H 3DVNA 1N2RB 2A74A 4QNPF 2YZ1A 4PJBF 2Q20A 4NUJA 2X9WA 5L6YH 3BPNB 2JJSC 4P23D 3WFCL 2VDNL 1UZ8B 2FYYB 2IJ0C 5L8LB 2IBGA 3HE7A 4DCQB 2JCCB 5DJCA 5KVDL 5JHDB 1N5YH 1DE4B 4MJID 1DJSA 1FL6A 2HLAA 1FHGA 2FX9H 1BQHA 4FQQA 4ZFZA 3VRJB 4ERSH 4N8CH 3ILQC 1NDMA 1T5WB 3RWDA 4DVBB 5FXCH 3SDDC 3FT4B 1DQJA 1TJHL 1BREA 3NA4A 4RFOL 2Q3AA 5HYJA 2OX5A 1ZA3B 5B39A 3B2UD 1CGTA 3FB7B 5K93A 2P7TA 1CVSC 2IG2H 1BD2B 3B2VL 3HG1E 1T89C 2P5EA 3F5WB 5T5NG 4X4ME 3S4SA 5AYQA 2F54A 1CFNB 3W9DB 4NNYB 2X40A 1VFAA 2WINA 3I6LE 4JFQB 1F42A 3P77B 4HLZH 2YPLA 4TSBH 5HHQB 4IOFC 1WBXB 1HQRA 3S5LB 4AY0A 3CPLA 4KZEL 4ONGL 5HHOA 4K7PX 3G5VA 3K80A 4PJIA 1GSMA 2NZ9C 4DAGL 1D5BB 2VAJA 3RWFA 4MAYA 1GGCH 5B4MC 5D2LA 2DBJA 1INDL 4NQCA 1S9XB 5KSAA 2JE8A 2GQHA 4IJ3C 4NC1E 1U8NA 1HWGB 4ZAKD 4N8VG 1UC6A 1IAOB 3SDXF 5EUOB 4YWGH 1FJ1B 3LS5H 3O2VH 3DVNB 4OQ1A 3TO4A 2GW5A 3KPNB 2ZNWA 1VEMA 1G6RH 4NUJB 1CFTA 1JHLL 5E4IA 2A77H 4AZ8A 2R56H 4BUHA 4C56E 2V2WA 3M07A 3RJDA 4PRBA 2XZCH 3HE7B 4R8WL 5DJCB 1R5WA 4Y2DD 2NY7H 3EYUH 2QQLH 4HPYH 4FTVD 5HHXH 2OR7A 1G0XA 4ZFZB 1NGPL 4L9LC 1NDMB 3RWDB 4HC1H 3T2PA 3SE8H 2HMIC 2H1PL 2Z31D 1CBVL 4PRHA 5HYJB 4LPCA 4PRDA 1DZBA 3BJ91 4EIGB 2RQ8A 5B39B 5CIPB 3W5MA 2AK1H 5GJSL 1MI5B 2MPAH 3QQ9C 5LVEA 3G6AA 3QQNA 3S4SB 3LKPB 2VMFA 4UT6L 2HH0H 3T0ED 4P23C 3A6BH 1EJOH 1VFAB 4QKXB 4MD5B 4OBSA 4K94H 4NZUH 3BGFC 4JRYD 1RV6X 4X7SH 3CPLB 2A6KB 3G5YB 1RSFA 1L0YA 3WXWL 5HHOB 5KSBA 2D7TL 5ADOH 3RWFB 3MLVL 4K2UH 3PHOA 1QSEE 1N6UA 1DQLL 4S1RL 5KSAB 5FAAA 1U8NB 2YMXH 3EDDA 3HTLX 4WTXA 1I3UA 3PQYD 1EH9A 5BVPH 2IBZY 4H20H 2QSVA 4CW1A 2HG5A 4DJMA 5ERWA 2J8UF 4OTXH 2PO6D 4I2XE 2NW2A 3DX8A 2ZJSH 3L6FA 4N90E 4EUPH 1Y18A 1CFTB 4KROC 1HOCA 1PKOA 3O3EB 3C6SA 5T5FL 4M6NH 1M71A 4EI5C 3D9AL 3P0VL 1IAIL 1MCDA 4JDZA 5I8KL 4PBVC 1PG7X 4NKOA 2WV3A 3WXVL 4CVXB 5JW3H 3ARBD 2BVQA 5IVXF 3RBGA 1RD6A 5IOPB 1TJGH 4ZXBC 2R0LL 4R90L 5TPWL 4BYHA 5I1EL 3GSVA 3CSYB 4X7FC 1BFOA 5KANI 3VI4E 1FC1A 1ACYH 2V5MA 4JPIB 4YHZH 1M7XA 5AZ2H 3VH8G 2QLVB 2ICES 2V2XA 5D2NA 3T2NH 2ZCHL 4PRDB 3ULUD 1NBVH 1X4XA 4ONFH 5F7EH 4JN1H 4MJIE 1BEYH 4WU5B 5GGTL 3RP1A 5GZOD 3JWDH 4K8RH 2V5YA 1CWVA 1YEKH 4KKAD 5GZNC 2IPTL 1I9JL 3SPVA 3MRKA 1U92B 1RJLA 5GGSA 4CMMA 4TUKL 4PLOB 3MV7A 3CXHJ 3JWOL 1FG2A 1F3JA 4KKCC 1IZKA 4IRSC 5KSBB 4MLSA 5TE7H 4HAGA 4NWTL 1Q0YH 2ZCLH 4CVZA 5HHVH 5FYKD 5MEPA 4KVNH 4Q9QH 2GJ6B 1B3JA 1DBKH 2AQ2A 4NN6C 3KYKL 2YD7A 5EOCL 4NQTA 5JPNB 2EKSA 2Y5TB 4BH8A 5EN2B 5I66A 4PB9L 3ARFC 4C83A 5BRZA 1IFHL 4F7PB 5F9OH 2HG5B 3FRUB 4CW1B 4F3FA 2R4SH 5J9PA 2HTLC 4B50A 4UT7L 5FV1L 3U7WH 3DX8B 1L7TH 1GGIL 1WEJH 3L6FB 3EYVB 1Y18B 1U9KA 4G43A 1HOCB 3IDGA 5IROC 4P5TA 3C6SB 1A7RL 2IC2A 4XCFL 1M71B 4EDWH 3UP1A 4NKOB 3PGCA 3Q48A 1MFDL 1G7HA 5J1TC 1NL0H 1R3JB 1YEGH 4QHNA 4JQXA 5JIPA 2BVQB 3HI5L 3HI6H 4XXCA 4EI6A 5EC1B 4UILL 3OR6A 4XNUH 2VLKA 5E8PB 1BFOB 1TQCC 3B5HA 3ARZA 3I3BA 2X7LA 1H8NA 4JR9H 4OCYH 3M17A 5DD3H 1MREL 1NFDB 3MRCA 5ACMA 4BFIA 1GAFH 5DO2D 4I5BA 3OZ9H 2XRAH 4Y4KD 3MRPB 1K8DA 4XPTL 2IANA 3C9NA 1BVLB 4OSUL 5E00A 3DX6B 4UAOC 3SPVB 5L2KD 3MRKB 1RJLB 4U7MA 3PIQA 3U46B 5GGSB 4P2YA 4Q7DA 2H2SC 4PGJA 5FB8A 5JO5A 1FG2B 1F3JB 2ADFL 3VRLE 3BUYA 1DTUA 3TVMD 4ETQA 3OKEA 4S10A 4LARH 1H3WM 4WTWA 4FQXA 2GI7A 3BRDA 5F72S 4Y1AB 5IF0A 3MZGB 4NHCH 2B7DT 5HDBF 1NEZG 3T0EE 4EQ3A 1RJYA 2PW1A 1Z5LA 3F7QA 2EKSB 4BH8B 1G6VK 1Z3GH 5I66B 5L9DH 3PGFL 5EU5A 4C83B 2J6EH 1OSPH 2AEQL 4JRYE 5DI8B 2OXHA 2OJZH 4F3FB 5I1HL 4AT6A 5J9PB 4U1JA 1JBJA 5HXMA 1YNLL 4XAKD 1JZ3A 5A43C 3SE4A 5DXWA 1KXTB 3V95A 3MXWH 3IDGB 2DQJL 5DR5H 4P5TB 1KT2B 1MELA 2YD4A 1UXWB 1U8JA 4UOW1 3U4BH 2HFGH 4HXAL 3PGCB 4MS8D 2PR4L 1KPVA 1V7ML 3PQYE 4X80L 1QOKA 1CS6A 4L29A 3QWRD 4QHNB 5E6IA 1J8HA 5D1QC 4KC3B 4YHOL 1Z2KA 4X9GA 1LQSR 3VE0B 3C5ZB 4EI6B 1CR9H 2FZ3A 4HW6A 2Q8AH 1GOHA 3DVIA 2VLKB 3V6ZB 2ADJA 4FMKA 1D5ZB 2O5ZL 2WNGA 3P9MA 5D7IB 5JXED 3S37X 3M17B 5GGVY 5E8NB 2VDLH 2I24N 3IXTA 2Y7QA 4X7TB 5DLML 1UM4L 2VH5H 4QF1B 4G9FA 1OT2A 4I5BB 3WFDL 4BZ1L 4NQEA 4EVNA 1HEZA 3BD5A 3EFDL 2AGJH 4K7FA 4FG6D 2MSPA 5F6HI 3PV6B 1RIHH 4JFOA 3ARGB 5EORL 5E00B 1WCBB 5C8JA 3PIQB 5TJWK 4MNHA 1HSBB 4YUEL 1UJTA 5FB8B 3BISA 3ULUE 1JFQL 3HNVL 3GBNL 4OIAA 3V4UH 1U8HA 2BZDA 5HHME 1SEBB 1FORH 4FQXB 1EEZB 2IAMB 4NO2A 1X9QA 2MCPL 4U31A 4XVJH 3QIUC 3ARRA 2F53B 5FDYA 1KTRL 4OCSL 5MP6H 4B5EA 1BGXH 2PW1B 4OCLC 1Z5LB 4K9EC 3SDAD 4NZTL 2HVKA 2X09A 5ISZA 4M3JA 5J89A 5EU5B 1XGYH 4XPHL 2JCCF 1CT8A 5F7WC 4IMLA 4KJWD 1XGPB 3IJHA 3FCTA 2A6IA 4AT6B 3GIZL 5I8EA 1QR4A 3GMPA 2YA1A 1F3DH 4M8VA 3E2HB 4LEXH 5FYKE 1WBYA 2CUIA 2XN9B 3GEWB 3PJSA 1TVHA 2OYPA 3QG7H 4EZMA 1U3YA 4TTGA 4YX2H 1M05B 5EOTA 1U8JB 2FJGB 1P6FA 1T7ZA 1T2QH 1KPVB 4TVPL 3IDNA 4L29B 1NGXA 1J8HB 4G8EA 1X5AA 2VDML 4BA8A 5CZVL 3JV0A 4H25A 3MX0A 2CGRL 1T66D 4P49A 2AXJA 4ZO8A 3K1KC 2ADJB 2RR3A 1T1ZA 4I0KA 5D70H 4LAQL 1QFWH 3BMVA 3P9MB 4OAWA 1CGSH 4Z0BL 3TPUA 1NCBH 3B9VA 4FQPA 3MRBB 3IXTB 2Y7QB 3KPOA 2YEZA 1UM5L 5HPOA 4PJEA 2X4PA 3HFMH 5F1NA 1NCDL 3ROOA 4NQEB 3CZJA 3OAZH 4KK5D 2A6DB 4P0DA 2AQ3A 3TIDB 4JFOB 4X6CF 4Y4HD 4F9PC 5C8JB 4RFNB 1MCPL 2AJUH 4F7EA 3X12A 3CU7A 2P44B 2XTJB 1YPZE 5F9WB 3VGGA 1INEL 1U8HB 1RZFH 3MLWL 4BSJA 2GCYB 3DYMA 1CYGA 1CI5A 1CICA 4A6YH 3VI3F 2BRRH 3LH2L 1CGYA 4MQXD 4YHPA 5L2KE 4W6WB 3LN9A 3X11A 2BVOA 4BUGA 3HUJF 3TIEB 3NPSC 3TT3H 3GIVA 4J3OC 3RVUD 3PP4L 9CGTA 5FCUL 1OCWH 2N56A 2EDBA 4IMLB 3T4YA 1BVZA 3IJHB 3GUTB 1AD0A 3U9PL 2A6IB 2ZUVA 1PD6A 3TT1H 3QG6A 4MCYA 3C8DA 1PBYA 4M48H 1HSAB 4PJCE 2EXWD 3D3VA 1TVHB 3LQZA 25C8H 3L3HB 4PGBB 3ZKMC 3HZKB 2AV7A 3O3AA 2R2EA 5EOTB 1D9KC 4HXBH 1OD7A 2IALB 4BSVA 1NGXB 3FMGH 4R3SA 3HAEA 4ZDHA 3VXUD 4H25B 4TNVF 1FFPB 4IEFB 4WVRA 1YMMD 4XAKE 1RJZB 4XWOC 4D3CH 1U93B 3B9KA 4IIQA 4NHUA 2CK0L 2DBLH 2EDJA 2IEPA 4HIXH 3VDBA 5I75B 3C60B 2H26A 2LV4A 1YEIH 1J1XL 3UCRA 1S78D 3TBSA 4YBLC 3B5GA 2V5SA 3TPUB 3CFIC 1L6XA 2OI9C 2B1HH 2ID5A 3EOTL 2YEZB 3QZWA 3O6KL 5ID0A 5SV3A 5F1NB 2R1WB 4PJIF 3ROOB 4LK4A 1OWRM 1MNUL 1L6ZA 5D2LF 3LEXA 1MLBA 1XGTB 3C8KA 1AIFA 4QNPE 3OAUL 1RULL 3F8UB 3W81A 1ZT4A 4LHUA 3KLHC 3UX9B 4QHLA 4F7EB 3MACL 3T3MF 3KG5A 2HKHL 5I1GL 3X12B 3QHZH 1ZHLA 3SGKC 2ZCKL 3Q1SH 3ARDD 4TULL 3FJTA 3WE6B 4R4NC 1IGFH 4TSAH 2XZQH 3U4EA 5IGXH 1ZHKA 3WEXA 3C08H 4FQLH 4ZSOE 5I74B 3VWJB 3ZL4L 1WGOA 3GB7A 4ACPA 4YK4C 5FA4B 4YHPB 3WN5A 2BFVL 3X11B 4JRWA 2Z8RA 4WEBL 4GXVL 4M6ML 1AD0B 3DI2B 3SE9H 2H32B 4NBZB 3QG6B 4H26B 4HG4J 3LN5B 1I9EA 3MA9H 1AGDB 3D3VB 3STBA 3KLAA 2FGWL 5GRZA 1I1FB 3MNVA 4FP8L 3B83A 4KJQC 4OCRH 1U8PB 1P4BH 3O3AB 2R2EB 5IW1B 5DURD 3OXRB 4CMHB 4MXVF 4AEIH 4NO0D 1SYVA 2R29L 5TH2B 4GQ9H 5CD5D 4XCCL 3ZE2E 4R3SB 3HAEB 4ZDHB 4L3EE 4QRTA 5DZOA 3MLSL 1E6JH 4Z7UA 2EXYC 4LSVH 4S0SD 3EW3B 1F3DJ 1CDJA 4LDEB 1QLRA 3O4OC 4IIQB 5BVJA 5DSCB 1E4XI 5MI0B 5FHBH 4DN3H 1KENL 4LCWB 3QDMA 4XTRD 3HPLB 2YWZA 4UIKH 1CL7L 3TBSB 1AHWA 4NQDD 5D5MA 3PV7A 1R24B 4QY8A 4TPRL 3RVUC 5L6YL 1JF5A 4WENB 2ARWA 2HN7A 3EUUA 2XACC 5KS9E 3QZWB 3WFEL 5IVNA 5JORA 4JHWH 1Y6MR 1NCWL 4JFZH 4ZG1A 5ICXA 1GVIA 3LEXB 2EXWC 5C3TA 1AIFB 5IWLA 1N5YL 4U05A 5I19H 2PXYA 2ITDA 1BPVA 1ZT4B 2HJKA 5D1ZA 2FX9L 2WWMD 3V6FB 3CLEH 4QHLB 2DJ4A 4K7PL 4N8CL 4RWHA 4ERSL 3ZKSD 1OPGL 4MDJB 2A0LC 4U0QB 1C1EL 5DHYA 2BX5A 1F00I 4LSUH 3E8UL 3WEXB 2EECA 2B1AL 5HI3C 5GS3A 1HHHB 1N4XH 2XIDA 1NLDH 1UZ6F 4PJDE 4HZAA 3WN5B 1S78C 4B0MM 1EGJA 2E9JA 2QV2A 3FQUA 4LCYB 2ZUXA 3ALWA 2HT3D 5C6PB 1JYNA 3PL6C 2E7LC 3MRQB 3MYZA 4HD9A 5CP7B 4TSBL 3CFEA 3KLAB 1FVCB 3DO7A 4MB3A 1WZKA 4XP9L 1W72A 4TUOB 3GSUA 4F8QA 1AR2A 1DLHA 3RTQD 1HHKA 2C26A 1P9MC 3EO0A 2P49B 3O2WH 1U6AH 3SDYL 5GGVH 5FM4A 3V8CA 3IRZA 4QRTB 5I1DA 2AEPL 4NKDA 2W0FA 1A9EA 3BPLC 4Z7UB 5HI5D 6FABL 5BVJB 3WO3B 3Q6GL 3QNXB 1OP9A 3QDMB 5D71L 3O2VL 1MJ8L 2JB5H 2F9BT 4ESKA 2BRQA 1FC2D 4D0BB 5D5MB 3IGAB 5ALBH 4JO1H 4QY8B 3QDJA 3V6OC 4LKXB 5TQ2H 2MJWA 1CG9A 2WBWB 5IW3A 3T4AA 2HN7B 1MVFA 3OR7B 2R56L 3E3QC 1YMME 4HKBA 5CJ5A 5ICXB 3INUH 4V1DA 5FHAL 4BM7A 5D8JH 2X4UB 3FZUD 3EYUL 1PDKA 4HPYL 3S7GA 4R0LC 5DA4A 2HJKB 5HHXL 4KK6D 4J23A 3WLWD 3PWNA 1EO8H 4KJYB 4Z6AT 1RUKH 1JPFB 1UWGL 2CXKA 1G9EA 5DHYB 3CFCL 4HC1L 2EIEA 4YDIH 1N5AA 3SE8L 1T03L 4FZEH 4IRZH 3N06B 4D0DA 1PJ9A 3BMWA 2AABH 1MFEL 3QIWA 3BHBA 2O5YH 1BZ9B 1HH6A 3OG6B 4XTRC 2MPAL 1F4YH 4XX1E 2DIJA 3EJYC 2ZSWA 3CSBA 5ETUB 4OD3H 3VMOA 1L0XA 1KXVC 1DQDL 1TTFA 2AW2A 4M61A 1EJOL 3TWCH 3MRMA 2E7CA 4GLRH 4N68A 3CFEB 5CUSL 1PG7L 1U3HD 1BOYA 4GAGH 4GG8A 5DUMH 5HD8C 4D8PB 4X7SL 2I25N 3ME0A 3GSUB 4XRCA 3P30H 4X99B 2DI9A 1DLHB 3FFCA 2YSSA 5DHVH 1IM9A 3D5OF 3FKUS 3MUY1 3NCBB 4JZNA 2LU4A 4M7LL 3TA3D 4OJFH 1EFXB 3FO1A 3X3FH 5FO8A 3VCLA 4ZNEE 2W0FB 3MLRH 3F58H 2DYPA 2EDYA 3QO1B 4J4PA 5B3JE 5BVPL 4H20L 4M5ZH 4YDVB 3GHBL 4O51A 1AC6A 3DBXA 1R6VA 1YNKL 3MTRA 5C0BA 4YHYB 1VFUA 5C1MB 3UBXI 1BECA 3UMTA 1FNSL 3Q6FA 4N9GA 1CG9B 2F74A 1OQXA 3T4AB 1XGQA 4W81A 3QUZD 4M6NL 3ZDYF 4DEPB 2I07A 1U95A 3W2DH 5J56B 4HKBB 1MCQA 5EC2B 4K9EH 4LCIL 2AK4B 3WJLC 5HJ3A 2WUCH 3OGOE 1AI1H 3L5WA 1NBYA 3KPRA 5DFVD 1F90H 5JIIA 5TQ0H 4PS4H 1ONQB 1N0LA 4XNQA 3OX8A 1N5AB 4MZ2A 2DB8A 1UWEH 4K71B 5GSRA 3RWJA 4YHZL 3NFPB 4XPBH 5F88A 5JXAL 4D0DB 4GOSA 1DUYB 4I1NB 3O11A 4ONFL 3FB8A 5F7EL 2F5AL 1BEYL 1JZ7A 4QHUB 3OJDB 1IQDA 3FOMB 3JWDL 4K8RL 4XHJD 1UT9A 5EU7E 3KPSD 3GMNA 2ZSWB 5MHSD 1Z9OA 4M61B 3RVXC 5E5MA 2P46B 4HK0A 4PJ8D 4PJXE 5C0AD 3MRMB 2GTWB 2X4QA 3QH3A 4GSDH 4LPWA 4GG8B 2BVEA 5GGQL 4HWZA 4RAHA 3FT3B 3FFCB 2YSSB 5TE7L 1CLOH 4KK6C 1XR9A 1F4WH 1IM9B 3DLQR 1S7WA 3ZKXC 1DBKL 2FX8H 1K9TA 3FO1B 2V9QA 3H2WA 5FO8B 2FBJH 3O8XA 2PYEB 1S7XA 2DYPB 5EU6A 3N85L 1PQZA 2R2BA 3BW9A 1G7JA 5F9OL 1FFNB 2AV1B 4O51B 2R4SL 4YHKL 3DBXB 1CXKA 3WFHA 3QEGH 4JHBA 3LKQA 5C0BB 3TESA 1QFOA 5F97E 1N64H 4O58L 1XCTB 2DQIH 2OMNA 1Z6JT 3S6CA 2F74B 4LU5L 1S5HA 1XGQB 1KCLA 3STLB 2I07B 4BFBD 3BZFA 5HYFA 4L1DA 3MJ6A 4O5LL 5E2VH 4C58B 1H3GA 3VD5A 1NL0L 1YEGL 4M5YL 1CU4L 2C1PA 1U3HC 4UDTA 4OFVA 3UTTA 3R8QA 3I6KB 2ERJB 3S3JA 3HI6L 2ORBH 3L5WB 4UMGA 1NBYB 3KPRB 2BDNL 2F54D 4XNUL 3BPNC 5DJ6A 4L4VB 3MGAA 1OD9A 4GAJH 4YXHH 4XNQB 3OX8B 4NUGL 1V7NH 5GSRB 4I3SL 3W39A 2W9EH 4OCYL 4M1GL 4WV1A 5F88B 4MXQD 3UTSE 2BSTA 3QAZB 4J12A 1Q1JL 5IG7A 5IFJB 3C6LD 4X6FB 4IDJL 1JNJA 3GI8L 3OZ9L 3UJJH 2XRAL 3DETC 4TNVK 1H0DA 1JWUA 4XP1L 1IQDB 3RDTD 1G7IA 2NLJA 2JK5A 1LGVA 1OAUH 3CFKA 4OLYH 2J88L 5E5MB 3WS6C 3QH3B 2RB8A 2MHAA 5JNYB 1E6OH 2P43B 2YPVL 1IGTA 3TO4D 3I02B 3PWPD 4NPYB 4LARL 3UPCA 3IS1X 2HFFA 1QBAA 4G8IA 5IV2B 1JYXA 1P4LA 1I7RA 2NY0D 3GI9H 4NHCL 4JHAH 4BFEA 1FP5A 4XGZB 1WV7T 2EEDA 3OB0H 4X6DA 4PJEF 1NANI 1DEDA 1QRNA 1YA5A 3MUZ1 5EU6B 4TOYH 2J6EL 1KCRH 2R2BB 1OSPL 5CJQH 1G7JB 2AVGA 4HUUA 1MAJA 4PP1C 1LEIA 3T77B 3D0LB 1E28A 3LPFA 1UGNA 1PEWA 4OCXL 1H8OA 3MXWL 1S5HB 4QXWA 2AJVL 4WO4D 3A67L 1R5IA 1S7QB 2WWKT 3SKMB 3BZFB 2HFGL 4JLRB 2W0KA 4NRZB 2MOVA 1S9YA 2BNQD 2C1PB 2KQNA 1T83C 3CAFA 3WHE1 4UDTB 3UTTB 4HWUA 2EIZA 3ZYOA 1CR9L 4M7JH 4NO3A 2Q8AL 4XXDA 2NY1B 2PW2A 2XWBB 3T0BA 4DUXA 3F6LA 4WJ5A 4J1UB 5HYQA 3W39B 3HE7C 3FN3A 4HUKB 2IF7A 2DQDH 3NIDF 1JK8A 4KRPD 1MH5A 4Q0XH 5IG7B 1AD9A 5FECA 2C5DC 2VH5L 1RHFA 4KAQH 3EIFA 2ZOKA 1H0DB 3VXSD 5A40E 3U7YH 4NZRL 3TNMA 4BH7A 5L8KB 1A6TA 5KG9A 1G7IB 5EBMA 2NLJB 2JK5B 4MB4A 2X1OA 2AGJL 1X6NA 4LFHD 1IKFL 3RZCB 3FRPG 3CFKB 4PRNA 1RIHL 3BZ4B 3JXAA 3LKNA 3QIBB 5T3XD 4GAYA 3P2TA 2XQBH 3PE9A 2ZUWA 3H9HA 1M6OA 1BQHG 2HFEB 1FORL 2HFFB 3DVGA 4G8IB 4PRPA 2EH7H 1P4LB 5ESAB 4XVJL 1I7RB 3KPSE 3D1MC 5MHSE 1OP3K 3MREB 5ADPH 4X6DB 5DJXB 4JM4H 1MFCL 5C0AE 3G5ZA 1BZ7A 3MODH 1HILA 1QRNB 5EO1A 5IFHH 1VGKA 4LVOB 3FN0H 1XGYL 2A9MH 2VZUA 2NTFA 3WNOA 1NBQA 4FQJL 5DQ9A 4HS8H 4PJFE 1J1PH 4MWFA 1KCVH 4LLDA 1LEIB 2V7HB 4MAYC 3QUYA 1OGAE 1QACA 4WU7B 1YQ2A 4HIEA 3L3IA 4OZGA 5KSAC 3HUJE 3QG7L 3UJTL 1A2YA 3R4DA 3UZEA 4RMSA 4YX2L 1R5IB 4U6HA 5F44A 1IC4H 4U3CA 4WW1B 4XVSH 1S9YB 5E70A 4OB5L 4XBPB 4YHMH 5CGMA 5IJKA 4JPKH 3TO4C 2V2TB 4U1NA 1NC2D 4CDGC 2N4IA 5IESH 3MQIA 5HYSB 1I1AD 5DMKA 3NGBB 1BZQK 2IFFH 2FECI 4NCDA 4UZGA 2QHLA 2G9HB 4FQIH 5D70L 1CE1H 1QFWL 4OGYL 5DD0H 4BKLA 1ERNA 1ZKAA 1CGSL 5HYQB 4F7CB 2JB6B 1MCCA 3DARA 4OZFH 2W91A 1JK8B 4MX7A 1MH5B 4LLYB 5AG8A 4HUMB 4AQ1B 4OGAD 1OAYH 4LVEA 5FECB 2NMSA 3O6MH 5DMGD 2ZOKB 3HFML 1YY9D 3MNWB 3ZDXE 3TNMB 4BH7B 1A6TB 2UY6A 4V2BA 5EBMB 2D7PA 2GAZB 2D9QB 4PRNB 2HJLB 3JV4A 3SKJH 5HI4C 5DRNA 3VWKD 5HDQL 1C08A 4QOKA 3S35H 2AJUL 3HA0A 2VXSH 3RNQA 5E8OB 3MGTA 5J57B 3CH1A 3MLYH 1XIWA 3QFDB 1M6OB 4LVNC 5CBAA 4PJHA 3DVGB 1GZQA 4PRPB 4WTZA 4W70A 1F8TH 3MOAH 4UOJA 4MNGE 3QQ3A 3GSQA 1BZ7B 2QQQA 3T3ME 2Y6SD 2ED8A 5EO1B 3BQUD 2ATPA 4HS3B 4Z95H 3LD8B 2NTFB 2OCFD 1OCWL 3L5IA 3AAZA 1BOGB 5DQ9B 1DBBL 4G80A 3UJIH 4HFWA 1T3FA 3TT1L 2FD6H 5EO0A 3QUYB 4M48L 4HHAA 4PY7A 4E42A 4F15C 4M8QA 25C8L 5FYLD 5EZLB 3CVHH 3L3IB 4OZGB 5EPMA 1A2YB 1TVBA 4HZLA 4U6HB 5F1IA 4HIIB 3NAAH 5E2UL 4HXBL 3NCCB 4JANA 4ENED 2VZ3A 3RY6A 1PX3A 1X5KA 1D5IL 4PJ7E 5E6ZA 4NQSB 4TVSa 4OKVA 3BN9C 5DMKB 4MNQD 4DOHB 1FL5A 1OF2A 4JDVA 2C3VB 5DMIL 4HBCH 2AJYH 1JI2A 4M03A 5FK9B 1MCFA 3QEQE 1YEIL 4MXVE 4PD4K 3D39D 4KDVA 1NGQL 1ZANL 2H2PD 2BNQE 3MRIB 4LCCA 4AL8H 4NKMA 3G9AB 5H2BB 5J11C 1Y6NR 4WUUD 3WO4C 5EG6C 3QPQC 3GSNA 2PTVA 5T33H 3G6DH 4P3WA 3JV4B 2G5RA 4G3YH 3I6GB 2OJEA 4P3CL 5DRNB 5EIVA 1I9RH 3HN3A 2KKQA 3RX5A 5D2NC 2YUWA 3RNQB 3P9LB 4ONHA 3CH1B 5D1XA 5CSZB 1XIWB 3ZE0E 2FATH 3TEUA 2EC9U 4DFIA 1X6LA 1IGFL 3VXSE 3LHPH 3L1OL 3LRGA 1YQVH 1T1XB 5GS0C 3PHQB 3FHAA 1JGDA 4GJTB 3QQ3B 3GSQB 4HKZB 3ARSA 5T3XE 4ODTH 3EYQD 2ATPB 4K3DH 5E6ID 4QCIA 1K3ZA 1DBML 2GEEA 2D0HA 4UU9A 4G80B 2DAVA 4OGAC 1QSVA 5DS8A 2YKLH 1FZJA 3WL9A 2M26A 4HHAB 2VDRH 4E42B 3MA9L 2Z93A 4M8QB 3E1F1 2VR9A 5EOQL 1EBAA 1TVBB 1IAIM 5ITFA 2HYMA 3NA9H 4QXUH 2JJUA 4TTDD 3EO1A 1AFVL 4JANB 5EWIH 4GRMA 1ZT1A 3RWIB 3QXTA 1IGYA 4Y4FA 3B8SA 1FNAA 1NMBL 1P7QB 2RHEA 1F2XK 1FZMA 1T4KA 3TN0B 4LSVL 4OKVB 2ADGA 3S3SA 2A38A 4KMLB 1OF2B 4JDVB 5ALCL 1F11A 4P5TC 5TDPA 3QXAB 3AS3A 4DN3L 3SQOH 3GGWB 3BZEA 4XCNB 4UIKL 1HI6A 4R26H 5JQHC 4ZOBA 4Z18A 4JHZA 4JJHA 3RWHB 5IB4A 2APXA 1FNEA 4JQXC 5CJOH 4ZD3H 4UTAH 3IDJA 5E4EC 2VWEE 1QQDA 2W59A 2EO9A 3X3GL 4IRJA 2XY1A 2Y07H 4YZFF 4XCEB 4FNLH 4LOUD 4XPGL 5I19L 4DKEL 2OJEB 5JOPD 1QSFA 5CFHA 3D6GA 1WWWX 3QQ4B 3KYOA 1RZGA 3MGOA 4NOFA 4HJJL 1PGRB 5GISH 4ONHB 2FL5B 5C09A 5IMOA 5C9JA 5GGSY 4Z0XA 5TDOA 5F6IB 3FB6B 1B0GA 1X5ZA 4YBHA 4DN4H 3BIBX 5FUCC 4E41A 1NKOA 2BMKA 3BP7B 1N4XL 3MPCA 5FFLA 5T1KD 5ICYB 3OV6A 2ICWJ 2MWCA 1JNLH 5C0DB 5JA8B 4GMSH 4MVBC 4IOIA 2NY4C 4FQXC 1KLFA 3L7EA 1RMFH 2MMXA 1FZJB 1S7RB 1J5OH 1LD9B 3IETB 4RGND 1IEAA 1G9NL 5DQJA 3MXVL 2Z93B 4I77H 1BJ8A 1J88A 5ECJE 1AY1L 2AP2A 3R06A 3GSXB 1YNTA 2O93L 1AKJA 4RBPK 1P4IL 4I0PD 3GMRA 5E2JA 3ETBF 4BSWA 4IMKA 4Y4FB 2YD8A 3EDFA 5F8RC 3RVTC 1T4KB 3SE4C 5A2KH 4YNYB 5B38G 2CR3A 3GMLB 3QUKB 4YDJA 5E2WL 4GO6B 2DIBA 4HWBA 3HG1A 3ZHDA 1HI6B 5C6WH 2VJXA 4X4MA 3ZMRA 2VERN 5ALBL 5E6IC 3WD5H 2CRYA 3IDJB 4JDTH 1FGVL 1D5MA 1QQDB 4XC3H 4JVPA 5GS1A 4IRJB 4MNQE 1T1WA 1WWAX 4HH9A 5MENB 3BDXA 2W9LA 4WWKA 3INUL 1J0KA 3ARVA 3QEUA 4FFYH 5E2TH 3D2UB 5E24E 3D39E 4NJAH 1QSFB 3ULUL 1EVTC 5T1DL 4YFEA 3T8XB 3DSFL 3KYOB 1RZGB 2B0SH 5E8EA 1RUKL 3MLTB 3ZDYE 5C92A 4Y0GA 1FNFA 4WUUE 5DEFA 5C9JB 2NXYC 2X42A 4Z0XB 5TDOB 5IMOB 3O9WA 4APQD 4PJ9D 4E41B 5IB1A 2EYTA 1I7TB 1FE8L 3B9DA 1UB6B 3EHBD 4TRPH 5I0DA 2QADD 2I27N 3RGVA 4RFNC 3TNNA 1I4FB 3K2UL 1QVOA 2YD3A 3KPLA 4PLJC 1F4YL 1ZLSL 4XZUA 1DANU 4J3WA 4P3DB 1AR1C 3CDCA 2FJHB 2GITA 2XTJC 3BGMA 3OKDB 5F9WC 4OD3L 4WFGD 4IOIB 2YD1A 5FYKL 5DC0A 4P4KD 3OTTA 4C56A 1G0YR 5J1AA 3TWCL 3K81A 2FJFA 1IEAB 2Y06L 5EH1A 3AXLA 1X5IA 5C0FA 4Y5YA 1ZGLA 5DUML 2COQA 3S34H 2IQ9H 2BSSB 1CGUA 4QTIH 4DGIL 3WHXB 1EHXA 2CLRA 5IIEA 2P42B 1PAMA 2JF1A 3GMRB 2DQFA 3SJVB 1EUTA 3RVVD 1CDIA 1X5JA 4OZHB 4PGEA 2HT4D 3OKOB 4BSWB 4N8VA 1GYAA 5KAQF 1DL7H 1A14H 3MLRL 4UIMB 3L5JA 4YDJB 5FGBA 1M7DB 1K85A 3HLAB 4QWWC 4LHUD 3TBWB 4ORGB 3HG1B 3C5SA 2FWOA 3O81A 4LQFH 1GGUA 4L3CB 3E6HA 3RAJH 3TM6A 1SM3H 1G7QA 2HVJA 4JM2A 5FYJH 1Y6KR 4JG0H 1A3RH 5FM8A 6CGTA 4MAUH 1D5MB 1MCEA 1NUGA 3RVWC 1BM3H 1KELH 2NTSP 5GS1B 4JY6B 1T1WB 4K9EL 4R4BA 4WWKB 5I75C 5IHUL 3V4VH 4LF3A 3QEUB 5E9DA 1TVDA 1BIIB 1ZLWH 5E08H 1QSEA 2OZ4H 5E8EB 2F8XC 5IHZA 1F90L 1D3CA 3Q3GA 1UKQA 2B5IC 4GRLD 2ARJQ 3WKML 2XG5A 2HRPH 3G04B 1A6VH 1KPRA 3QDGD 3NACH 4GKNA 2DKUA 5JA9A 4XMPH 2EYTB 2E9WA 2NY3D 3BVNA 4NT6A 4QRQA 1JWSB 1OWWA 5BJTA 4U1GB 5JOPE 3RGVB 3RI5F 3KPLB 1P2CB 1QVOB 4I2XA 4XZUB 1P84J 4MA3A 1N26A 3BXNA 3SDDB 2EYRB 2GITB 3RU8L 4OF6A 4QRPB 4KHTH 1UACH 2CJUH 4KI5F 4C56B 1EDQA 2YA0A 1CICC 4RGMC 12E8H 1HN1A 4Y5YB 2JELH 3F6IA 1ZGLB 1ADQL 4NQVA 4AM0A 3L3GB 2NR6C 4U33A 4Z7VE 1FIGH 1WTLA 4YFDB 1KCSL 5IIEB 1OT1A 1CLOL 4P5KB 2P48B 3RWCB 2DQFB 4NZJA 2NNAA 4BZYA 3U1SL 2J8HA 4N8VB 2FX8L 2XKSA 1QBBA 1JF1A 4Q2ZA 4RGNE 3ULVF 1BJMA 3MRFA 1FH5H 3RPKA 3X14B 3SGDI 4MJIA 4G9DA 2J4WH 3U0WH 2E8ZA 4R7DA 1QR1A 5DRXA 3QEGL 2P8MA 3BESR 4IJ3B 1G7QB 2WIMA 1N64L 3UPRB 1RHHA 2CDGB 5GHWH 4H8WC 3EOBA 3RHWF 2Q7YA 4KKLD 1NFIA 3B9KC 3GBML 3P73B 4IIQC 4OV6F 1XCQB 5ITBH 1KIQB 3AVEA 1XF3B 3EZJB 3G5XB 4LF3B 4MD4A 5C07D 5E9DB 5LCVH 1FFQA 4MD0A 2ICCA 4GLRI 1KJMA 4EOWL 4FQ2H 2G2RA 2PUQT 2AXFA 2VSDA 4PTUA 2I9LA 3CDGB 1EK3A 5I30H 3GK8H 1KPRB 1R3KB 4YIQA 5JMRA 4GKNB 3HMXL 3MV9D 4FXKA 3BVNB 3LV3B 2AJXL 1CFVL 4FXGA 3DURA 4NT6B 3JWOC 5CMAB 2BK8A 1YYLH 4AMKH 1LP9E 4I2XB 4QTHA 2IPUK 3B8YA 5E94A 2BJMH 2ZKHH 5SWSD 3WLBB 1ZAGA 4RSVA 5H37G 4ZAKA 5B8CA 1W0WA 2VN4A 3DVFA 1EO7A 1TDQA 2FB4L 3U82B 3W82A 4K3HA 4R2GB 2HA1A 1KIPA 3ELAT 4NQVB 1KIRA 3ULSA 4LHUG 3WN5C 3ILPA 5DC9B 1N6QL 5KVGH 4ZFGL 1C12B 2X89D 1KLGA 1HYSD 4P23B 1TQBB 3GI9L 3MLUH 4WFGE 2BHZA 4ETYA 1IC7H 2DQGH 3DHMA 3FTGA 4OLXL 5CKAA 1JF1B 3BGFB 4JO4L 1GGBH 3MRFB 3QO0A 2Q6WB 1H8SA 3HB3D 1KC5L 2GTZA 4ELKA 4Y2DA 4MJIB 3REWB 1SYSA 4G9DB 4FTVA 3UTOA 1JNNH 1YECH 5L0QB 3OPZH 1I75A 2FSEB 5DRXB 2P8MB 4F8TA 4AEHH 5A3IC 1JPSL 5KJRH 3RA7H 2YBRA 5GS0H 1RHHB 2Z31A 3S36H 1XGUB 3EOBB 4PJHF 3BE1H 2Y1VA 2Q7YB 2VXTL 1NFIB 4LLMB 4U6YA 1A6AA 1A64A 5HPMA 2L4OA 4E5XB 4MD4B 4NC0B 1HKFA 1AHWC 1UKTA 4MHHG 3T0WA 2AXFB 2LTQB 3T0EA 3MCG1 3T0DA 1BAFL 3SCMD 3B6SB 4UBDD 5C0RL 3VH8B 1XZ0B 1CFQB 4G42A 1FNGA 5DQDH 4JO2H 3JZ7A 4JRYA 3BP4A 2DQDL 3U30C 1W8NA 5IWLC 2PXYC 2P8LB 1N59B 4J6RH 4LSSH 4XMLH 5D1ZC 1U58A 2X4OB 2BVTA 3MRDA 3U7YL 5EBWB 4TUJA 4LLVA 3I50H 5E94B 4XVUD 2UWEE 1UCBL 4ZAKB 4OI7A 3CX5J 1W0WB 3QDGE 3QYCA 1E4WH 1IGMH 3PQYA 1L7IH 5CS7A 5GSVA 3MBED 2DMBA 4KKLC 1O5DT 5BS0B 2YRLA 2OBGA 5IK3A 1D5XA 2XQBL 5IVOA 3IAPA 1UYWL 1KIRB 3ULSB 5T3ZH 5DD6A 1SHMA 3CXDH 2PO6A 3ILPB 1AXSA 3P0YL 1TZHA 5BO1L 4ISVA 3UTZB 3MRJB 3BO8B 4FABH 3SKNA 2BOBA 1ZVSB 3KPQA 2V9TA 4GKZA 4QRUA 4I0CC 4XPAH 3BT2L 4JM4L 5A2IH 2VLRB 5FYLH 3MNZA 3MODL 1EZVX 3QO0B 5IFHL 2A9ML 4ELKB 3ARBA 4YHLH 4ALAL 4FTVB 4MA1C 1J1PL 2AEIT 1T7YA 4PUBL 2IPUG 4N0UE 1I3RB 4U49A 5AWNH 3VXOB 1G1CA 4NM4L 2EH8L 4FFVD 4JFDD 1JMZA 2YBRB 3ARFB 2Z31B 3L9RA 1F2QA 5JLZA 4HFUL 5LAXA 4AIXA 2P5WD 1A6AB 1JPTL 5HPMB 1UA6H 5F96H 3QWOB 4DK3A 4AEFA 5ELIA 2VR4A 1T2JA 5IESL 3C09B 1GCFA 1I7UB 3IVKA 4ZOEA 1S3KH 3T0EB 4HJGB 2DQHH 3AU1A 1CE1L 4JB9H 4DEPC 1OLZA 1NKRA 1RK0A 4OUUA 5KSUA 1JGVL 4BELD 3FO2A 3ZSTA 5JIKA 1SBSL 2EE9A 3BPCA 3C5JB 3N1QC 5C07E 4P4RB 3MV01 5F7DB 3RIFF 4U2ZA 3O6ML 3FQTA 1OAKH 2HT2C 3QXVA 3MSPA 5K9JH 3MRDB 3WFCH 2VABB 5HGDA 3WUWG 4LLVB 1GOGA 2ED7A 3B9EA 5I17B 3VRIB 5EZOH 3SKJL 4R7NA 4RQQA 4K71C 3KWWA 5LGHL 3S35L 5GSVB 3MV9E 4CU8A 3MROB 5IK3B 1D5XB 4LGRB 2GJZB 3O4LB 3QIWC 2AJZB 3F7PC 5DD6B 4ZS6D 2PO6B 1K4CA 1TZHB 4ISVB 1NEZB 4S1DC 4ELME 4UAOB 4YPGA 5JQ6L 2R0WL 5SWSE 4LP4A 3KPQB 4GKZB 2FX7L 3W11D 4MQSB 1KBGL 4UQ2A 4Z95L 1P6AB 2H3NA 5A2LH 2ZUQB 1WAAE 5HGBA 1RZIB 3HC4H 2WBKA 4ORZC 4YEEA 5KVFL 3DYOA 2Y72A 4KV5F 2DTSA 4WW2A 3L9RB 2ZOLB 5JLZB 4QHMA 1AQDA 3ECBA 5LAXB 4M9PA 4ONGH 2DD8L 2JJVA 1YPZA 4JGUA 1U36A 4DAGH 3VFSA 4Y4KA 3OWEA 3ZYJA 4LSDA 2CKBA 3TBVB 1QLEL 2CSPA 5I1KH 1BQUA 4RNRB 3IVKB 4HPOH 1CTNA 3SY0B 2J5LB 5L2KA 1MVUA 2AJYL 3AU1B 4YEFA 4PY8I 1FZOA 2C7UA 5FOBB 1CXEA 4OUUB 3U79A 3FO2B 5EU4B 2OK0H 3BPCB 3TVMA 4GG6E 3SHSA 3CMGA 3FQTB 3H0TA 4BQ6A 1XR8A 1JHLH 4YR6A 5C7XL 5D72H 3GJFK 5T33L 2WAHA 4O9HL 4QRSA 3U9UA 2NZIA 4GAFB 3KPPA 4G3YL 4R7NB 4UUJB 1ADQA 5K9QG 3KWWB 4XI5D 2H9GA 5FO7B 2NY2D 4RBPH 4RMQA 5IEHA 4JFEB 3UTPD 1MI5D 1T1YA 2VSCA 1NGPH 5FUZL 3E0GA 4RFEB 2EIDA 4CN4A 2J12B 1IBGL 5AUMA 1MCIA 1YQVL 3CH8A 2CQVA 1C5BL 5EZJA 3MRGA 1CBVH 3V4PL 3ARTA 3TFKD 1Q94A 1MCNA 4ODTL 3QWRA 4K3DL 5GJSH 1KNOA 3CCHA 5KVMC 5K9OB 5D7LE 5F1KC 5F1SA 5HGBB 2NY6D 3OMZA 4J3XA 4WHTB 1NQBA 3QIUB 5E1HB 3F7YA 4X5WA 4MA7H 5J12C 1J11A 3OJVC 4O4YL 2QKIB 4PJBA 2APBA 4X9HA 4WW2B 5JXEA 3O8XC 3V0AC 1K4DA 3IXAB 2UUDH 2C4FU 3NA9L 4G7YH 3WNLA 1B90A 3ECBB 2KQMA 3WXWH 1RIUH 2I5YL 4Z7QF 2EIBA 4RCAA 2D7TH 3FFDA 4Y4KB 3MLVH 4X7DC 2FEEL 3IFLH 2WM0A 5T5NF 2XG4A 1B88A 2Q76A 3CIQA 4ZSOA 1A3LL 2O5XL 4HH8A 1ZV5A 3VFPB 5ICZB 1BFVL 2WSKA 3PNWA 4JFDE 3HMXA 4PG9A 3SQOL 5F9JB 3MR9A 1SJHA 5J3HD 1FZOB 1NUNB 4R26L 3IKKA 2P5WE 1CTOA 1OP5K 5L2JA 2P4AB 4PJAF 4UTAL 5CJOL 2FLRT 4OCNC 3H0TB 1PYWB 3IDYB 1LE9A 1TPXB 5T5FH 3D9AH 4YDLC 3P0VH 1IAIH 2QR0B 4QRSB 3U9UB 3VG9C 4FNLL 4WGVB 3SDAA 3KPPB 1J87A 3MOBL 4Z5RA 4HUNB 3BGAA 4WV1C 5TE6L 3TH4T 3JV5A 4NQXA 4R90H 5GISL 1OY3B 5TPWH 3HAEH 3HI1A 2V17H 3OKYA 3RHWK 4OM0H 5AUMB 2VB5A 4H8WH 3NOIA 4OKDA 5HYIA 1XAUA 5EZJB 3ZYZA 4DZBB 3MRGB 5DK0B 4NCC1 4JM2F 4J3TA 3UBXA 4U3XA 4WHDA 1ORSB 1CFSB 4N0CC 3VXRD 3CCHB 3ZHLA 4GMSL 5KS9A 5KAQG 1VCAA 2GJ6D 1CDBA 4X5WB 3SGJA 1J5OL 2IPTH 2DWEA 5FYJU 3HPJB 4YBQD 3AB0C 4D94A 2M8XA 5AAWA 4MJ4A 4TUKH 4L5FL 3NPSB 4PJBB 3JWOH 5DFTA 4DVRH 1K4DB 3ZTJH 4LVOC 3HZVA 3FFDB 5EFIA 1S7UA 1XH3A 4D9LL 4XNMA 3TO2B 5T1LD 5EOCH 4ZSOB 4IHOA 2H6PB 5TE4L 2DF3A 5D96C 4PJDA 2FBOJ 1ZVYA 4PB9H 4PG9B 5DJDA 1L4IA 4Y4HA 5CINL 4QOKD 2A2QT 3K46A 1D9KB 4FQ1H 4MJ2A 1JZ2A 3SDCD 3MR9B 5EUOE 1IFHH 2SEBA 1A0QH 5I8OL 1KJ3L 5L2JB 1MRCL 3KJ6L 5JW4N 1FNLA 4KI5C 1GGIH 4JDTL 2VLLA 5ESVA 2OL3A 1ZLUH 3G6JF 1KEGH 1A7RH 4XCFH 1V3LA 7FABL 1FFOA 3WMSA 2XXCB 4PGDB 3HCVA 3VI4F 5I18L 4YBLB 1GZPA 1AP2A 1SJVA 1MCKA 4FFYL 3SDAB 2DQUL 4Z5RB 1P1ZA 4I48B 2QSTA 2D4FA 1TFHA 4NQXB 4HKXA 4FZ8L 3OJMB 3HI1B 1I8KB 3ULVC 1EA9C 3FB5A 3VD3A 1MQKL 1KV3A 4KY1L 5ENWA 4JFPA 3RWGB 3NFSH 3CUPA 4HX1A 5J7CC 2VDKH 1MI5E 3R0NA 5DFWH 1KJVB 3VXUA 4XPTH 1SJEA 1Z9SA 3DUUA 4Y1AD 4JFHD 5CGTA 5GRJL 1YMMA 3SDXB 1VFOA 2NX5D 3R1GH 4YK4B 1J0ZA 2DWEB 3DYPA 5T1MB 4UI2A 2NYYC 4QRRD 4XWGL 5GQBA 4NCC2 1BF2A 2ADFH 4NN5B 5K9QI 4WFED 4MZ3A 5EO9B 3QNYB 5IB3B 5CAYB 5EIQA 1XH3B 3MRRA 2AKRB 3IDIA 3QUYC 4NP4H 4KWUA 1YEDA 3NPZB 3BX7C 4F7MB 4K7PY 4FMFA 3MUGA 3PGFH 1PVHA 1R5VB 5DJDB 3IJSA 1KG0A 2AEQH 2FO1A 5HBBA 5HGHA 5E99H 5I1HH 3RAJL 3ZDZE 1SM3L 1YNLH 3C5ZD 1EGJH 3ARDA 4OZ4A 5FYJL 5IJKC 2RIKA 1WIOA 5GIRB 4JG0L 1YN6B 4P48A 2VLLB 4MAUL 3O4OB 2DQJH 1KELL 2ZUYA 1CD0A 4M6AA 1VPOL 4QO1A 5B3NA 1FFOB 4PREA 5MEQA 4S2SA 5DJ2A 3CGTA 3P4LA 3V4VL 2PR4H 1V7MH 1GZPB 1AP2B 2R0KH 4X80H 4N1EA 4BQBA 3OKLA 1W72H 3H9SD 1P1ZB 2MQCA 2C1OA 1JL8A 2HRPL 4ZPVA 4LIQE 3NTCL 3O41A 1A6VL 4ZNEA 4PJGF 4M93C 3BRGC 3ARGD 1N0XL 1U8MB 2O5ZH 3CFDA 2DTML 1R3IH 5ENWB 3GM0A 4OI9A 5TF1H 3CUPB 4NO0A 2OR9L 4HJ0D 3VRLF 1RZKL 4KHTL 2IAMD 3IDMA 4MQ7A 5JMOC 1UACL 3VXUB 3DROA 2CJUL 4F9LA 1SJEB 3EFDH 5I1CL 3GMQA 4PJ5D 1X5HA 2EDXA 1CN4A 12E8L 3KLDA 2J8UB 2JELL 2P1YA 4YUEH 3RIFK 4U1IB 4ZTOL 1JFQH 4XCYA 3HNVH 3GBNH 5DC4B 1FIGL 2QQKL 2WLZA 3VXRE 1ZGLM 1DUZA 5KSBE 3PL6B 2YD9A 1U8OB 1DQML 4FRWA 4ZO7A 2GJ6E 3QSKB 3OQ3B 3QEHA 3T09A 2FIRT 1YEDB 1FH5L 3PG2A 1A9BA 2XYCA 1X5YA 4NZTH 2EDDA 3MUGB 4XAWL 2BNUB 2APWA 3IJSB 1S7TA 1HWHB 1YDPA 2YOCA 3U0WL 1KG0B 3V0WL 1WZMA 5HGHB 3V0VA 1LDPL 1NBZA 3GIZH 4KK8C 3RY6C 3EJZC 1JF6A 3ARDB 4M62L 4OZ4B 7CGTA 1AO7D 1U2CA 3WIHA 3BPLB 4PJXA 4YLQT 5F3BA 2DS4A 2VKWA 4LEOB 2ICWB 5EOCJ 1PY4A 5DJ2B 5ITBL 4LLQA 4TVPH 4D9RD 3BKJH 5LCVL 3VGBA 4M7ZC 5BXFA 4WIQA 1NGZA 1RFDL 4C55A 1JRHH 3TJEH 2VDMH 2EC9T 5CZVH 2LE9A 3NIGE 4LCCC 4OIBA 2ARJA 1C7SA 2CGRH 2C1OB 3VFNA 4KXZH 3QRGL 1Q38A 1U41A 3L3KB 4ZPVB 3O41B 2GY7B 3GK8L 1UKSA 1CQYA 1MPAH 1QKZL 4LAQH 3Q0HA 4N8PA 3CFDB 2GSIA 4Z0BH 4I13B 5T3XL 1NFDE 1TZIA 1ZHBB 5DURB 4KMQA 5E95B 5FGRA 1Z9LA 3RTQA 3MJGX 4WCYH 4NO0B 4RWYH 3AS0A 5D1XC 4MQ7B 2ZKHL 3DROB 5AG9A 4C59B 5CEYA 3PXHA 3SE3A 1PLGL 4MMXC 5DJAA 3F7VA 4FA8A 5SX4H 1LO2L 4RA3A 1DR9A 1U8QB 4NQDB 1HXYA 4U1HB 4XP4H 1AXIB 3MLWH 1DUZB 4H0IA 4DKFL 5HVWA 1G9MC 4Y1AE 4JFHE 2E9BA 3LH2H 1AGEA 1IC7L 1QHOA 1MAKA 3QEHB 1GGBL 3OHXA 2UZIH 1KUMA 4JZJA 2LU7A 1DBJH 4QRRE 1S7TB 2CDFA 5FCUH 2VL4A 4CN6A 5C0GA 4LLUA 4WI9A 5BW7A 1A5FH 4WFEE 2EDWA 2E7MA 4Y4FC 4G6KH 3ARUA 3RA7L 5GS0L 1H3PL 5F3BB 5D7JD 3LKRA 4PTTA 5C6TL 4G6AD 2YR3A 4LLQB 3B4NA 3KYAA 1MHCA 5BXFB 3DRTA 4HGMA 4PV8A 3AC0A 3SOBL 5I1JH 2CRZA 3EFFB 4RIRA 1H3UA 1TJIL 3EGSB 1WFUA 3V5HA 2CK0H 1K2DA 1VGEL 4IRJC 5DQDL 4JO2L 1J1XH 1KTDA 1U3HA 4BQCA 5CBEA 5D7IE 2GSIB 4XP5L 1TZIB 3ORJA 4LSSL 4WW2F 3H9SE 3D25A 2BNRD 3EOTH 2XZAL 4NDMA 2VDQL 3KS0J 3O6KH 4GW4B 1YY8A 1YPZF 1WFNA 3TA3A 4LAJH 3GM8A 2V6HA 3EDJA 3LSOB 1MNUH 3MRLB 3VWJD 4NFBA 5CEYB 3JV6A 3PWVA 3F62A 1IGML 3K8MA 3OAUH 2HTKD 3D85B 3F7VB 1DQQA 3JTSA 2HKHH 4PFEA 4PP2B 3BH9A 5T3ZL 3ZE1E 3CXDL 1AJ7L 2WQ8A 2ZCKH 2X1WL 4KJPD 1KTKE 4JM2D 4TULH 2HLFD 4QEGA 3QUZA 1ZS8A 3U2SA 2F53E 3GSWA 1AGEB 2XFXA 4PJ5E 4XPAL 5FYLL 4PJCF 2WZPD 2CMRL 3OHXB 2Z8SA 3W9EA 1AGBA 3LDBC 2FEDD 1CD1A 1MHPL 4WEBH 4GXVH 1G1YA 1HCVA 4M6MH 4OD1L 1NJ9A 4LLUB 5C0GB 2YXMA 4H0HB 3ZKXB 4OF3A 3MZTA 43C9B 1T7VA 2W9DL 4IMKC 2IQAA 4JFFB 2XN9E 2GT9B 4Q6YA 1IQWH 4LCWD 3T1FA 2XQYG 4P5MA 3GRWL 4PTTB 1CZ8H 5F96L 1GHFL 3VG0H 2R29H 4F57L 1MHCB 5LGKA 2VXQL 5EULV 5HHPA 3KPSA 4KV5E 1IEBA 3MLSH 1AO7E 4RIRB 4I3GA 3ES6A 4PJ8A 2VOTA 5C0AA 1JZ6A 4JB9L 4E0RB 1K2DB 4EN3D 5GS1C 3TZVD 3OXSB 1PY9A 1U3HB 4MJ6B 2XICA 4WWKC 4HSQA 4D0CA 4PJFA 4D9RE 4X4XA 2M1KA 4TPRH 2D9CA 1OAKL 5DMJB 4D2NA 5K9JL 3FRPA 1YY8B 3WFEH 4XMKL 2VQ1A 3HUJA 4NC1C 1NCWH 5JPMB 5DVOA 5EZOL 2Y5EA 3O9WC 3SGEI 3PWVB 1YJDL 3RKDC 1RUQH 4X6EB 5DA0B 4U1GC 1XF4A 2K7PA 3RGVC 4G6AC 4K7PH 1Q9WA 1ES0A 3BH9B 1OPGH 3CSGA 1C1EH 4KPHL 1U2HA 3E8UH 1ZS8B 2YD5A 1UENA 1FPTL 2B1AH 3GSWB 3TJHC 2XFXB 5D7SH 1I8MA 4N0RA 4RAVA 2W60A 4XHQA 4Y5YC 2QHRL 1CD1B 5ACZA 3DMMD 3HC4L 1S7VB 1OTUD 3S96A 5M94B 3TCLB 3VMNA 3ULVH 1FL3A 2FR4A 2CDEA 3ZE2F 2IQAB 3BKML 4P2QD 3MJ7B 3FO9B 4JAMA 2N7AA 3QUXD 4XP9H 5GRYA 4JCLA 3T1FB 5IMKA 5FGBC 4RGOL 1I9IH 3C6LA 3H9ZA 3QXWA 3RDTA 3TC9A 3OL2A 3SDYH 5I1AA 1B6DA 4N5EC 5I1KL 2AEPH 4KJPC 4POZC 4X6CB 4HPOL 4JM2C 4KZDL 5IP4A 5KS9F 1OTSC 4MNGA 3ES6B 4PJ8B 6FABH 5C0AB 4HMDA 3Q6GH 1ROWA 4EBQL 4Z7QE 4Q9BA 2F5BL 5D71H 5IBLD 1MJ8H 5TGBA 4D0CB 2OK0L 2A74B 4XVTH 4DTGL 3PWPA 1ZHNA 2PN5A 3QCUL 3S8WA 5D72L 1J7VR 5CJ8A 5IKCA 5F7MC 3HUJB 3Q2CA 4YO0A 2E6JA 2VZ1A 4PJAE 1M1SA 5FHAH 3JVGA 1FL6B 5IT2H 2HLAB 1MOEA 3LAFA 2MFNA 4PJDF 1BQHB 4PJ7A 1YEJH 1XF4B 4FQQB 3RKPA 1UWGH 3BSZL 4KKBD 1ES0B 1RZJC 2BNRE 3BAEL 3CFCH 4Z78A 1DQJB 3GHEL 3BP6A 1J05A 1T03H 4JY4A 3CSPA 5IW6A 3QEQA 3BPOB 4S1SH 4WO4A 5FIEA 3IB4A 1FLRL 1I8MB 1H5BA 1MFEH 2W60B 4JJ5A 4R2GC 2BNQA 2P7TB 3L7FA 3PP3K 5C0IA 4H88H 3T3PE 2P5EB 3LMJH 2F54B 2XOTA 1DQDH 4MA7L 2E5EA 1EFXD 1TQBC 1FO0A 1FL3B 4CDHA 2CDEB 1BLNA 2DM4A 2WINB 5JW4Q 2VL5A 1Q0XL 4EQ2A 2YPLB 5CUSH 1PG7H 1ZGLP 1XFPA 4JAMB 4G7YL 1HQRB 2P8PA 2X44D 1RIUL 3G5VB 4PJIB 3MRHA 1HZHL 3D48R 4MAYB 5L0QC 3AY4A 3VXSA 5D2LB 3IFLL 4XC1L 3RDTB 4M7LH 4LL9A 4LNRA 4ZUUA 3NBNA 4NQCB 1I8IA 3DV6A 43CAA 4JKKA 1CD8A 1KB9K 1JPGA 4LCWE 1A1OA 3GHBH 4Q6IA 3B2UC 2VE6A 3TO4B 1S5IL 5TGBB 1YNKH 1T0NA 2WBJD 3PWPB 1ZWIA 2KDGA 3N1PC 5FF6A 1HHGA 1FNSH 2E7BA 4GRWE 2NY0B 2LTQC 1JV5A 1V05A 5IKCB 2FO4A 2WQRA 2V2WB 4YO0B 2LAGB 4PRBB 3V7MA 4LCIH 4G6JL 3IT8D 1R5WB 4HEME 4Y88A 4NFDA 3OKMA 4MXWL 4PV9A 4ZUWA 1IARB 3G6JE 3GNMH 3MFFA 3V9FA 2V17L 1GIGL 4JRXD 4OM0L 4H8WL 4J3UA 2Z0BA 5BZWA 1J05B 4HCRL 5DZLA 5IW6B 1ZOXA 4ZAKC 5B8CC 1UXSA 4PRHB 4X9FA 5JXAH 4Z7NE 3P4OA 2A83A 4JJ5B 2F5AH 4OGZA 2BNQB 5C0IB 5H94A 4LVNB 1VENA 5HHMD 3G6AB 2D7QA 1NC2A 3QRFM 1AE6L 5C2BH 2JTDA 1I1AA 3VXQA 3GSNH 3S36X 2MQ0A 1BLNB 1E27A 3VD7A 8CGTA 2PYED 2VL5B 4P2CG 4DVRL 4KRPB 5GGQH 4Y2DC 5B3JF 3ARXA 1E4KA 3BWAA 1OB1A 4X4YA 3V7AE 1IE5A 3PHOB 4NN7C 4MLIA 1OGTA 4F15B 4L1HA 3PWLA 4LMQI 2PYFA 4OQTA 4ZUUB 1V3KA 5BMFL 5LBSL 3DV6B 3QJFA 4Z7UE 2Z31C 3N85H 2HAZA 4P2QE 3VWKA 4FQ1L 4WY7L 1JPGB 1A0QL 3S98A 2IGFL 1A1OB 4YHKH 2EZ0D 2VDOL 3UEZA 1HKLH 2WW8A 5ERWB 3GMMA 1BBDL 1T0NB 3IF1A 2NW2B 3KPTA 1G9MH 1HHGB 4L4VD 4O58H 3C09C 4LU5H 1KEGL 2VZOA 1JV5B 3T0EC 1KF9B 4JDZB 4O5LH 1Y0LA 1OTTD 3BQUA 1CU4H 1V3JA 4LHQB 4M5YH 1EX0A 5DRWA 3VXMD 1M7IA 1Q9KA 4HWNA 4X6BA 1A6UL 1K5NA 1ZK9A 5J11B 1BWWA 5SWQA 1WFOA 5FKAA 1PG7W 3OKMB 4PV9B 2BDNH 3WO4B 1NUDA 2DLFL 3GSVB 2IPKA 2PCPA 5C0JA 1KLUA 4HMEA 1J12A 1ND0A 4NUGH 5AZEL 3CZFA 5BZWB 4I3SH 1OAQH 1G9NC 5GS2D 4M1GH 1O7VA 2V2XB 1JTTA 5DEGA 1F4AA 4PJXF 4NRYA 5D2NB 1GOFA 1Q1JH 3NFSL 4RMVA 3P4OB 2A83B 3OAYK 4IDJH 2VDKL 3GI8H 4P2OD 2YZ8A 5CEZD 2ITCA 4XP1H 2Y36L 1N8ZA 2OP4L 4PJGE 2QSQA 2PO6C 2AXHA 1I1AB 2VQTA 4MNQA 3VXQB 3R1GL 1A6WL 2J88H 3O3DA 2YN5A 3D39A 3GRWA 5DD1L 4X4ZA 2VZVA 4CMMB 4X98A 3MV7B 2YPVH 4AG4L 1F4XL 1IAII 5J0BA 2D7MA 5J13C 1WIPA 3ARBC 2ZUQC 3DUHA 3MJ9L 4WUUA 2XKNA 4L8BA 4CVZB 1OB1B 4X4YB 5MEPB 4KTYA 5B38A 1OGTB 1X5XA 3PWLB 4NP4L 2PYFB 3KHQA 3CVIL 1K8IA 3QJFB 1NFKA 1EFQA 1MEXH 4C4KT 4O2FA 3S37H 5BRZB 3KXFD 3ULUC 5E99L 3QI9D 3S97C 2IH3A 3L5HA 3S88L 2WMPA 1EGJL 3IF1B 5EIIA 5GZOC 3L5XL 4G43B 4OCXH 5IB5A 3MUJA 2AJVH 4KKAC 3A67H 2J5LC 4FS0A 4DGVL 1G7HB 2AK4E 2R0KL 1QNZH 2FHBA 3O6FD 4LCUA 3VGHA 1W72L 1A21A 5DRWB 1Q9KB 1P7KA 1MQ8A 3MC0A 5E4EB 4PLKD 4U6XA 5FKAB 5I2IA 3OR6B 4LSPL 3VFMA 4YGAB 5I73B 2PCPB 5AAMA 3E6FA 5MEOA 3RZCD 1B2WL 5FGCE 1ND0B 4OUOA 1MRFH 3CZFB 1R3IL 4KMTH 3QIBD 2X7LB 1KB5A 3WCYA 4OFYD 4NRYB 5TF1L 2LQRA 3MRCB 4HWBH 4Y5XA 4BFIB 5EZIH 5I0ZA 4K3JH 4OZIF 2Z92A 2ITCB 4NZRH 3AS2A 5FOJA 1K8DB 4UT9H 2BHYA 2IANB 2ZPKH 1IKFH 3C9NB 4JRXE 4MNQB 2L0DA 1HIMH 3WBDA 4ODSL 4YE4L 1EEUA 2G60H 3D39B 1BMGA 5JO5B 2DQTH 4WI5A 4RA0C 5KN5A 5HSFA 3BUYB 4ETQB 3J8F7 3OKEB 2NY4B 4Z7WF 3H3BC 5KZCB 5IF0B 1Z0NA 1KCUL 3DGGA 1RJYB 3UYPA 3B9AA 5D6DA 4ODHH 1MFCH 3KAAA 4JKMA 4LSTH 4UQ3A 1K8IB 2PYEE 4WW2C 2CXGA 2AEWA 4MQTB 3WDHA 1N7ML 4FQJH 3T08A 1A1NA 4ZUVA 3VFVA 5DO2C 4Z7OE 4L3ED 4U1JB 1LVEA 2IH3B 2ICEA 4Y4KC 5F93C 4P2OC 3ARED 2Y4SA 1XF5A 3UJTH 5C0CD 4JG1L 4M43L 3NZHL 5T1KA 3HZMA 2I60L 1JZ8A 3BKJL 4Z7VA 4ZUTA 4PBWD 4OB5H 5F8QC 5E6IB 1JRHL 3TJEL 3LB6D 3QDAA 3MCKA 3TVMC 4U6XB 2V7NA 2FZ3B 5I2IB 4WI2A 1HINL 3DUSA 1O0VA 3VFMB 4L4VE 3IDYC 3E6FB 5MEOB 1TPXC 2B2XL 3IYLW 4OFDA 4ZFOA 1MPAL 2BVUA 4OGYH 1WT5A 3CXHK 2X4NA 1CD9B 3BDBA 2H41A 3H7BA 3VXME 1SMOA 2BERA 4I0PA 4LPXA 4WCYL 4RWYL 4G9FB 5H35A 4F2MA 2Z92B 1IRAY 2NXYB 5JW5A 1SVCP 4EVNB 1HEZB 4WEUD 4K7FB 2NXZD 1A47A 1A4JA 5HDQH 2C4FT 3UROR 4MNHB 4MS8C 1JUFA 4AIZA 3TF7C 4XP4L 5CEZE 1LK2A 4PJFF 2KH2B 4NO2B 3TP4A 3WFBL 5LGJA 3THML 4FFWD 3MLXH 4ODXA 3RJQB 2UZIL 1CIUA 3CC5A 4ODVL 5DUPL 2HVKB 3VFOA 5ISZB 1DBJL 5EU6E 5JXEC 3RWEA 1CT8B 1LP9A 1HQ4A 2DOCA 3FQXA 2XKUA 5LJYH 1DBBH 1A1NB 4ZUVB 3VFVB 5GXBB 1RZJH 1A5FL 4WHYG 3FCTB 5I8EB 3GMPB 4OLZH 3BH8A 3DTXA 3JUYA 1WBYB 4G6KL 2DL9A 3ALPA 3PJSB 4TYUA 4APQA 4PJ9A 4P57A 3TV3L 4FG6C 5DVNA 3I84A 1ODAA 5T1KB 2HP4A 3GO1L 5E2UH 1QBLH 4Z7VB 3NCYS 3IDNB 3KXFE 1D5IH 4G8EB 1YC8A 5C0ND 4WNQA 5I1JL 2VDPH 4P4KA 3KDMA 3VDAA 4Q9RL 4HCRA 4RGNB 1F6AA 3O45A 4G8GD 2PNDA 4PYHA 5DMIH 1T1ZB 3ZDXF 3HE6D 5F21B 5GRUL 1NAML 4H1LG 4OAWB 2FLBT 3SDAC 1U0QA 2E7HA 1NGQH 1ZANH 3UAJD 4UV7L 3EKCA 3MV8D 1SY6L 2AXGA 2GK0A 3H7BB 4DQOH 2EDLA 3JBG7 3KPOB 2ILLA 1T21A 2B5IB 4KJWC 4HLJA 1Q72H 5H35B 2KL6A 1CQKA 4PJEB 2X4PB 1U8LA 4F2MB 2AJ3A 2FNBA 1WZ1H 4HAFA 2RBLA 3DRQA 3QJHA 4P3CH 5CHNA 3UYOD 4GS7C 3QISA 2LABA 3B3IA 1JUFB 1SJXA 4U1MA 4AIZB 2PKDA 4I3RH 1IGJA 5GRXG 1LK2B 3L1OH 3MV11 1CICB 1T66C 4LPUA 4RGMB 4LRIA 4CRPA 3SGJC 5LGJB 4JKLA 2AJSL 2BCKA 3EYFA 2Q8BH 5LXGH 2CIKA 1BBJA 4LSRH 2BVOB 1QA9A 3UBXG 1QRNE 4LKCA 3GIVB 2LU3A 4NN5C 1LP9B 5DJYA 1HQ4B 4LDOB 1MWAL 1DBMH 2IH1A 3RWEB 3T4YB 2XWTA 1P7QD 4GRLA 1FFRA 1QD0A 4MCYB 1DBAL 1PKQA 4PJ7F 2UWEA 2X70A 3TN0D 4J3VA 3QDGA 4FOMA 3LQZB 4PJ9B 4KK5C 1J0HA 4P57B 1IQWL 5EOQH 3LQAL 2AV7B 1CZ8L 1Q9OA 1UG9A 5FKPA 2EO1A 4Y4HC 3VG0L 1AFVH 3M8OH 4BSVB 5D6CA 4K8RD 3U0TA 1NMBH 1HXMA 4UTBH 5SX4I 2B20A 4P4KB 3KDMB 2CLZA