2NCMA

Neural cell adhesion molecule, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
RVLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURAL CELL ADHESION MOLECULE
publication title The three-dimensional structure of the first domain of neural cell adhesion molecule.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1996-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ncmA00
3SO5A 3O6KH 1DQLH 4P2RE 4PJGA 4JFOA 3WFCH 4G6AD 4P9MH 1CD1A 3DMMB 3PWVA 3QUYD 4JO2H 4Y2DC 1UVQB 2NW2B 4XBGA 4OZ4B 3VWJA 3NCCB 4V1DB 1J8HB 3UTQA 1T5WB 5HY9A 1QHPA 1V05A 1A7OH 4HKZA 4TTDC 5IFHL 4NRYB 3KPNA 3ABZA 4OAWB 5C0BA 3ILQD 3MX0A 4NOFA 2G5RA 4FZEH 4H1LA 1DBMH 1VFBA 1D5ZB 3V5HB 1OPGH 3R1GL 1BX2A 5SWQB 5DFVC 4JKMA 4F9LA 1QA9B 1ZHKA 5EU3A 1NL0H 4N0FA 3MUJA 4NOBA 5E1AB 1EJOL 5HYSG 5JW5B 3WE6A 4YFEA 4LLMA 3ZTNH 3O4LA 5DQJB 1EEZB 4X6FA 4NJAH 2J1KA 5A1AA 4AIZA 5C0CE 5HHOB 4CU7A 4IJ3B 4KK8D 2FWOA 4LCYA 2F8VA 2D7TL 4JDTH 5MERA 3HC4H 3T65A 2DWEA 3V6ZB 4ZG1A 1BF8A 2ICWB 3WHXB 4H88L 3BP6B 4YX2L 2X9XA 1QBAA 3HMWH 3P30H 1YPZE 5C08A 1K4CA 3A6CL 4N0UB 5MENE 4GG6A 4RDQF 4GKOA 3L95B 1WCBB 1PX4A 4UTAH 5CBEA 1IKFL 4Y5YC 3GM8A 2QSVA 1Y0LB 3O11B 5E99L 3S96B 1JZ8A 5F1NB 3OPZH 1OCWH 4OCSH 3HAEA 3OXRA 5FHBL 2D9CA 4P2QB 1FNEA 5D7KE 1MFBL 1UXSA 1GGIL 1XGYH 4M1DL 5ICYA 5BS0B 2YRPA 5E00B 1HILA 4I5BA 4NKOB 4NHCH 1ZHLB 3VJ6B 4N8CH 1NBVH 3P2TA 4MGXA 1C5BH 1MH5B 3SKJL 1D5BA 1FBIL 3QUZB 3O8XA 4GRWE 3HS0B 4PRBB 3DV6B 3G6JE 1NGYA 4HLZH 2W1NA 5E6ID 4OTXH 5JPNB 3TBYA 5I1LA 5IR1A 1S7XB 2PO6C 5A2IH 1RU9L 2PYFA 2WUCL 3W9EA 5F88B 4LHUG 1FYTD 4G80B 1K6QH 5IROA 2OR9H 3ARGB 2DI7A 1T80A 1BP3B 4QOKE 5HPMB 3MBED 5HI4C 3C8KB 2BVQA 1DL7H 4Z7VE 3D25A 1KXQE 4PLOB 3H9SE 1RUMH 4GQ9H 5E7BA 4BFBD 2UWEA 4GG6F 3QFJB 5DGRA 3L5IA 5DFWH 3UO1L 3NFNB 2ZKHL 4KJQD 1A1NB 5T3XH 1N8ZB 4JCLA 4DGYL 3TA3D 3B9KC 4MVBD 3I3EA 4KJWD 5I30L 1ORSB 5DQ9B 4M5ZH 1TZIB 2YUZA 2Z4QA 3OL2A 4P2OB 5TDNB 1QSZA 1C7TA 4Z7NF 1KCVH 2MOVA 2BSTB 5E6ZA 1QBML 1T1YB 3IKCA 5HVHC 4M9PA 2OS7A 4G8FB 3T0EE 1N7MH 4OZGE 1G7JB 4RISL 1PYWA 2Q8BH 1V3LA 1HH6B 4X5XA 2DQHH 2YPKB 4MDIA 5I73C 4UIMB 1GZQB 5ID1A 3QIWD 4JKLA 4MD0B 3VRIB 1UCTA 3BZFA 2MWCA 3WNLA 4WI4A 1YYLL 4HWBH 5KVFH 4NQEE 4IRSC 4QCIA 1CQKA 5EA0H 5FCSH 4JHAH 5LG1A 2COQA 1R3LB 3F7VB 4F3FA 1GGUA 1YY8B 4D8PB 1P1ZA 5CILL 3UBXA 4JFDB 1S9KC 4CNIB 2NMSA 4L3EA 4L8DA 2YPVL 1C08A 4Z95L 4ZNCD 1OGAD 4ZO6A 3VWKA 4DFIA 2UZIL 4D9QE 3EYOB 3RGVA 4LEOA 5K9OB 5DC0A 4HG4K 1H3UA 2R29H 3BDBA 4NKIL 1NCTA 3QO0A 2CQVA 2E7CA 4MLIA 4ODUB 4NWTH 3ES6A 4PJIA 3KPPA 5DK3A 4N5UA 2IAMC 2O5YL 3DJ9A 3HI5L 2A77L 2VJXA 2IG2L 4NCC2 5ESVB 2P44B 4BFIA 4KJYA 3G6AA 4PGDA 4LDLB 3RPIB 1K85A 1GGBH 3QAZC 1I4FA 4X0KA 3V6OE 2AABH 5IBUG 1HHKB 1BBJB 4X6CB 5DJCB 4YDVB 2GK0B 4HKBB 1UCBL 1RULL 4Z0XA 2DKUA 4X6BA 3CGTA 4OZ4A 5C0DA 2N4IA 1DN0B 1FIGH 1NC2D 1G9NC 4NP4L 4DN3H 1RK1B 1DBBL 1J8HA 4Y19A 1G0YR 1UM4H 3OF6A 1JTPA 1P9MA 4Y2DB 4LDOB 3SJVD 3STLA 1B90A 3AUVA 3MJ7B 5JORA 4KHXL 1IC7L 4GT7A 1R3KA 2B1HL 1D5ZA 4X5WB 2VE6A 5SWQA 2GSGB 1HINH 5LGJA 3MRFB 3GHBL 3FQXA 5JW3L 1OAYL 5TPWL 4JY5H 1CL7H 3D85A 5ILTL 3PGCA 2H6PA 2CUIA 4HXAL 1XIWA 1OAZH 2X70A 4QRRB 4PJFF 4HZLA 3DVNA 5AYQA 4F7CB 1BFOB 5BXFB 4ZUUA 1YMME 4PREA 2YK1L 5BRZD 4FQXC 2AXGB 2ICWA 4ONOA 3UC0L 1REIA 5GRWA 5HYJE 4QNPF 3LPWA 1BGXL 1S7QA 2MPAL 3GB7B 4FQIH 1MF2H 3OJVC 4YGVA 1FO0H 1XGUB 5FB8A 2FDBP 1QR4A 1RVFL 3BZDA 2H3NA 1MJ8H 3L95A 4JFFD 4R0LC 4OJFH 1U8IB 4PLJC 4RGNE 1OQXA 4JRYA 2H9GA 3BW9B 4TNVK 4BELD 4NUGL 4JO3L 1UZ6E 3DO3A 4P46A 2BNQD 3OJDA 3ZE2E 2PXYD 3G6DL 4ZPVB 4MCYB 1JZ4A 2HLFD 4RNRB 1CT8A 1ZLVH 3C6LB 1AJ7L 1OD7A 5DMGD 3P11H 3RZCC 1R3JA 5F6HJ 3PF2A 4ZNEA 2X4PB 3BD4A 4PJEE 3MLYL 3M8OL 2GEEA 1RJZB 4C55A 4K3JH 1JJUA 1YUHA 4N0YL 4OF5A 43C9B 1JV5B 4AMKH 2SEBB 1Q9WA 5JDSA 4XB8A 1N59B 4ALAL 2DWDA 1CU4L 4LMQE 4LPYA 4APQD 3VXOB 5KN5A 4WHYH 2V2WB 3ARGA 4PUBL 4X9FA 2PO6B 4LU5H 5EZJB 4HULB 3SDCC 3MA7A 2X4QB 5FUZH 3VA2C 3C8DA 4RBPH 5IQ7L 1AXTH 3A6BL 1QNZL 5FKAB 5FYLE 1BQHG 2ILLA 1UEYA 3HZYA 3QBTB 4Z77B 4HG4J 3KR3L 1F4AA 2VXSL 3SE9H 5BVPH 3B9KB 1CXKA 1Q0YH 3RL1B 4K7PY 1T1YA 5C0FB 3QSKB 3GSWB 4HWEL 1IARB 5J6HA 3AY4A 4PRPA 2QHLA 1KJVA 1MHHB 1HH6A 1HHJA 1XZ0A 3EZ8A 1KULA 4OZFB 4TVSa 4LRNL 4BZ2L 5EBLB 4HXBH 4M7JH 1I8IB 5HVHB 1P7KA 1EAPB 2ICES 4LSTH 3UTTA 2ESVB 6CGTA 4PG2C 5I73B 5C92A 3U9UB 2BNRB 3VFPA 4X7TB 3QXUA 5EO1B 2X9WA 1X5KA 5IEHB 3DROA 5BCAA 1NEZA 1NMAL 1NH6A 4JPVH 4JFDA 2FEEL 3MO1B 4IRSB 5C0GB 3UJTL 3QYCA 3EHBC 1S9YA 1OT1A 3DSFL 5F9JB 1OAXH 4L3CB 5DUMH 2EDNA 3F5WB 1LO3H 2IFFL 2YPLB 5JW4M 3HMXH 1JGUH 1B3JA 2J8OA 4YPGA 4JY6A 1CLZH 5EB9A 1E4JA 5C09E 2IPUK 2LV4A 3ZKMD 4GXVL 2H8PB 1EGJH 1MFDL 3RAJL 4BZ1L 2CDFA 2AW2A 5EOTB 5F9OL 3V6FB 3VFUB 1Q72H 4X8JA 5KSBA 1OHQA 3FB8A 1RJYA 2WQ8A 3MCKA 2YOCA 1RHHA 3PP3H 2IAMB 3FZUC 3VXQA 4Z7UB 2D31A 2YA2A 5F89A 3HLAB 3QAZB 4HQQH 1C12B 3O6LH 4YHMH 4OBRA 1HYSD 5HI3C 4LBEA 3ULUF 1EHAA 1ZVYA 3LN4B 2CK2A 1KXTB 1GGCH 3PP4L 4KRPC 4K8RL 4G6ML 5EUOE 3QEGH 3RIFF 3U82B 5CZXD 5I1GL 5IVNA 2XZAL 1A6TB 4K23L 2ZCLL 5C07B 5DMIH 4JFXB 3L1OH 4ACPA 3ILPA 3N0PB 3BESR 2YN3A 3ESVF 5K9KA 1MRFH 5ISZD 2CJUH 2GSGA 3BH9A 1LP9B 3LY6A 2HT2D 3RWJB 4FZ8L 3QEQE 4PV9A 1ZA3A 1CFSB 4I3SL 5D1QA 5EORH 1DQQB 1MJUL 3SKNB 2BVYA 4R3SB 1S9VA 3BMWA 1EH9A 3WHE0 4WUKL 5L88L 1FN4B 4X6CF 4PG9A 3IU3A 4J1UB 4P3DB 3DGCR 1SEBA 5CINL 1JUFA 1WGOA 2Y5TB 5IEKA 3EOBA 1D9KA 2Z8WC 4NNYA 3WNMA 2DI8A 2P5WD 4Y4KD 1Y18B 2X4NA 5C8JA 5MEQB 2MNUA 3GKWL 1QFUH 2XWTA 2EYSB 3L7FB 5J6GB 4FQXB 5E8OB 2NY0D 1HKLH 3MODL 4PJBB 4QRPB 5C09B 4YZFF 1S78C 2KDGA 3GFUA 4BQ9A 3BZ4B 2CGRH 3FO2B 3AAZA 1QFHA 4Q6IC 4P4RB 2NXZC 3SDDD 1JWMB 4QHKJ 1A7QL 4H25A 3C5SA 4H26B 4R0LB 1QR1A 2FJGB 5LBSL 5FUOH 3JTSA 5F3HA 3GRWH 1AGDA 3K8LA 4X4ME 4H1LG 5DD3H 4XVTH 4GUPB 3K7UA 1G9MH 1J0HA 4H5SB 4LF3A 4IRJB 3WNKA 3NFSH 3RZCB 3MV9E 3FMGH 5EOCL 3K74B 2XQBL 3MYJB 3V0AC 5DJZB 5DJXB 1GGTA 3V7AG 3VXRE 1X5LA 1D6EB 1FORL 3GJFH 1QO3A 5LGHL 2P43B 4JZOA 5HPOA 2AV1A 1IGCL 2DQUH 3I6GA 5I16B 3B5GA 3N9GL 1IGJB 4Q9QL 4W81A 5DS8B 1CLOH 2VR5A 2E6PA 3U7WH 2AAVA 2Q6WA 3N50A 2IADB 2F8OA 3MPCA 3BQUA 5EUKA 3SDCB 3FB6A 3UYRH 3VXME 4N9OB 5E0QA 2VYRE 4DZ8A 2V2TA 2IAND 3QEQB 1QSFB 2DMBA 1DDHA 2Y25A 4AENB 1Q9LA 3HAEG 4YHLH 5GXBB 1FZOB 2HKFH 5I1HH 1WTGT 1YEDA 3GGWB 3P4MB 4LL9A 3IDIB 4JM4H 5D2LB 2CRIA 5KAQF 5DJ2A 1P2CB 4BQBA 2IQ9H 3GK8H 3BVNB 4XWOC 5HVGB 3RX5A 5D7LA 3AM8A 3DX6B 4OZFA 2F19L 2OXHA 2ARJA 5GZOC 4OFVA 1SM3L 4ZFOL 4OSUH 1HHHB 3VW3H 1MFNA 4NYLB 5F7EH 1T20A 5I15H 4RSVA 4X7TA 5JLZA 5JQ6L 2YUVA 5E95B 5J89A 2WLZA 1F4WH 3K4ZA 2GITA 1N5YL 2VR4A 4TSBL 2HFGL 1FGVL 2Q7YA 4WU7B 2LE9A 4LIQH 4FMFA 3ARFD 1JWSB 3IKKA 3I2CL 3WLWC 4QEGA 3W11D 2XY1A 1NGZA 1FL3B 1VHPA 4JRXE 2FEDC 1MNUH 2J5LC 4M6ML 4GKZB 2YUXA 4Z9KB 4GBXB 4U6XB 5I75B 3IU4H 1I8LC 5KS9E 3VFUA 4AQOA 1R6VA 4X7SH 2AKRB 3QI9C 4JN1H 5C0AA 3TM6A 1SBSH 4E5XA 4Z7UA 2H45A 4PGBB 5FF6A 3E6FB 3Q1SL 1MI5B 3W2DH 3LD8C 1ADQL 3TO4B 3EFFA 3HLAA 5IVXE 4EUPB 3RZWA 1YEGL 4BH7A 1E0OB 1S9XB 1SHMA 2QKIA 1TCRB 5I8KL 3IYLW 3TA3A 4JLRB 2FECL 3PG2A 3LN4A 4XPFH 3P0YH 5K9JH 1N6QH 2C3GA 1KACB 2PNDA 3LKRB 4LSVL 1A7NL 2P7TB 1SEQH 3UBXG 1BFVL 1VFAA 3TWCL 4P23A 4E41D 1CLYH 1LMKA 2QV2A 1T03H 1YEFL 2FLBT 3KXFE 2R23B 35C8H 5CD3B 1L7IH 3IFNH 5BMFH 4UTBL 4XCEB 1JZ3A 1KEML 4PJGE 1NUFA 3QIWA 4LLDB 5FYKE 1SJXA 1NDGB 3GI8H 5E24E 2A74A 2OJEB 5CIPA 3TFKC 1U8OA 2GUOB 2N7AA 4U6HB 3ZDYE 1N4XH 4WFGE 4TSAL 4RGMB 2YMXH 2H1PH 3OKKA 4M8QA 4Z7UF 5DDHA 1DUYA 4F37K 4MNGA 3FHQA 4UT7H 2PUQT 4PPTA 4UAOC 5ICXB 3BRDA 1J0JA 3KNBB 2ICEA 5C0BE 1IL1B 3PDGA 4XZUA 4PJ5E 2KZ1B 4KDTC 3U36B 1VGEL 1E4KA 1YJDL 2FSEA 1CICC 5E7FA 3FL7A 1L0XA 5GGRY 4QRPA 4POYA 3MRCB 4KFZC 3LB6D 4KMLB 4MJIA 3O4LE 2JF1A 4KY1H 1RZJH 2EDJA 1OW0A 4OM1H 4LHQB 2CMRL 2DOCA 4OLYL 4TUKL 3C60D 5E8PA 2FJGA 4YBQD 3QO1B 2C3XA 3JWOL 2BHZA 4IEFB 3RWFA 5JHLH 2VLRD 4PJCB 3LPGA 1IC4L 1MEXH 1MFCH 4Q6IB 1SVZA 3S5LB 3MNWB 4ZUTA 1LP9F 2NXZB 2VDKL 5KVGH 3RX8A 2X4OB 4NDMB 4MSWB 3U4AA 1B6DA 1KB5L 4IRJA 3A67H 2R8SL 5E2WH 5A3ID 1FNLA 2RGSA 4QRSA 5C08E 4NNPH 1OSZB 1G84A 5MP6L 3DIFB 3LKQB 1D7FA 4OT1L 3GMPA 4HUXB 3OZ9L 4MJ6A 3TVMD 4NN5C 1JN6A 4NM4H 5IG7B 2AEQH 4O58L 4PRHA 3WSQL 2XKNB 3OKOB 1F4XH 4OCNC 3UZQA 3SJVA 3PDOB 3BI9X 2P24B 3BT2H 3MGTB 1FZKA 4TQEL 3NZHL 2EYTB 3E6HA 3WL9B 3VFSB 5FO9A 4O2FB 4GG8B 3WJJC 4JDZB 3KXFB 2JE8A 2EH8L 4PJBF 4HS3B 1H5BC 5CD5C 1JPTL 5I71C 3THML 2EDYA 4P4KD 3QQ9D 1ZTXL 3GMLA 3IFLH 1MHEA 3VFRA 1E4XH 1MWAB 2IH1A 2R9HD 5L9DH 2HFEA 4B5EA 2G75A 5I18H 1Z9OA 1KCUH 3OR6B 4DGIH 1BREA 3BP4B 2YZ1A 3JV0A 1J8KA 4X9GA 4PYGA 1EEUA 4LCWD 2L0DA 1HH9A 2OX5A 3FT3B 4KC3B 5CMAB 5BQ7B 3UMTA 2R0LL 4OZIB 1G7IA 3ZZ1A 1NJ9B 1U2CA 1LE9A 2X1PA 1QPPA 3WIFB 2Z92A 2P8MA 2UWEE 1BOGA 4PJ5B 3U4BH 2D3VA 3M17A 3PWJB 1MLCA 2AK4A 4HAGA 1UB5A 3MRNB 1I9EA 3TO2B 1RIHL 5KVMC 1N64H 3TT3L 1PY9A 3QH3B 3X3FH 5KW9L 2BNQA 5IGXH 2YEZB 4FN0A 5J56B 4WU7A 4PJXB 1IGML 2WBJC 1NBZA 3PUCA 3C5JB 3DYMA 1X44A 4GH7B 2PW2A 1CL7I 5B38B 5I74C 4AEIH 2BERA 4CRPA 2VXTL 4JZNA 1XR9A 5MEPA 4GBXA 4Y4HC 3L3JB 4M43H 3TNMB 1QBLL 1INEL 4ZFOA 2J5LB 4FFYH 1JK8B 1ND0B 4J6RL 3H7BA 5D2LF 2OZ4L 3RTQD 3L9RA 3GMMB 3T09A 4XXCC 3BFOA 3B2VL 4KZDH 1E28A 4L3EE 4QRUB 4NPYB 5EIVA 4APQA 1C1EL 5MI0C 4Z76A 4JREB 4L5FH 4R97C 5FO8A 3DO7B 3BSZH 1IGYB 5JIKA 3QI9B 5HJ3B 4ZMAT 3TNNB 3VFNA 2FO4A 2BY1A 4LAJH 1JHLL 4POZD 3TO4A 4JFZL 4JPKH 1CF8L 2F8XC 4S1QL 4PJIE 3GSRB 5IOPB 1TCRA 3AU1B 5AD0B 3LD8B 4ZFGH 3BGMB 2DLFL 5BW7C 4K55A 2OJZL 5AZ2H 3S37H 3S3JA 1NEZG 2P7TA 2BVOB 4KKBD 1W2KT 1NFIB 2XKUA 4HWZA 2BMKB 3CFEB 2IWGA 1IKNC 5CD3A 3KYOA 1EHNA 2XWJA 4XNYL 4POUB 4YFLF 3W5MA 1YY9C 43CAB 1U3HC 3CIQA 2MQCA 5GJTL 2QADC 3LEYH 1ADQA 1UB6A 3HNVL 3MTRA 3VXPB 3PQYB 2E9JA 5I0ZA 3HC0B 3O6FA 2FX9L 3PWLB 1BPVA 5ANMB 5E56A 3J7HA 4Y19E 3WFEH 4LLAA 2FB4H 4RA3A 4KV5F 3QUKA 4WTZA 1S9WB 4QWWD 4RGOL 1C5DA 1M7DB 1OF2A 1MHCA 2IALB 3KPMA 1PFCA 3BKYL 4TUJA 2EE2A 1AP2A 4L8BA 1RMFL 2HJFB 4AG4H 2AXHA 4UAOB 5B3JE 5JIHA 1F13A 5D9SB 5DJ6A 5KANG 3WKML 2X09A 5HXMA 2QQKH 3GBLA 1D6VH 1A7PL 5GS1C 3MUHL 1KCLA 1S7WB 2N7BA 2ICCA 2XRAL 5I76B 4MHHG 5E2TH 3NZ8B 4WRLA 5DMKB 4I0PD 4FG6D 4WV1A 1GYAA 3QO1A 3WO4C 4GSDH 3UTSB 3PJSA 4ODWA 4CVWA 1WBZA 2CRZA 4YXKL 2JIXB 1F8TL 3TZVD 4CJ0A 1VB9A 3HE6C 1HHIA 4HUXA 5IT2H 3QWOB 3WDIA 4UB0H 3CLFH 2GY5A 5B22A 1DLFL 1JZ5A 4Z7OE 3DETC 2I9TB 2MSPA 6FABL 5IV2B 4F7PB 1O5DT 4NN5B 5ICZA 4KZEH 2BFVH 1U92B 1TIUA 3MNZB 1ZLVK 5AG9A 3RY5A 4EI5C 4JDZA 2ZOKA 3C5ZD 1KJ2H 5CEZH 4N1HB 4LSQH 5K59F 4EI6A 4ZNEE 5MHSE 1F90L 1UJ3A 4BQ6A 2V5YA 4D3CH 4XP6H 4XBEH 3ULVD 3BPCA 1KB5A 4JB9L 4QYOB 4H0IA 4FNLH 1H5BB 4MMXC 1P4BH 3OR6A 4J4PD 5EU4A 5I71B 3VDBA 3RWHB 4NM8H 4PJCF 4LASH 3FT3A 3MBXL 3WNNA 4DJMA 3MGOA 4D2NA 5JTWA 3BZEB 4NRXA 3VH8A 5IB3B 2W9DL 5DC4B 5BS0A 3WIFA 25C8L 3GMQA 3UAJC 5IVZB 2P5WA 5KAQG 1Y6KR 1PLGH 4GAGL 2DM7A 4Y16A 3AB0C 1CWVA 3KPRD 3MRNA 2GQHA 4NO3A 1MCIA 3HNSH 1F6AA 5D1XD 3BIAX 1VKXA 1FYHB 3GMNA 1TZHB 3O81A 4EIZC 3SDDA 3L3DB 3UJJL 4FQPA 4ZFZA 2VLJE 5EBMB 5HHME 1Q9KB 2E7HA 4KHTH 1XGPA 2MKLC 1AHWA 4S1RL 4G3YL 4PJ8C 4PRPE 3HB3D 1WFTA 4XAWH 3ARDA 5HYIA 2P45B 4XVJL 1UYWH 3EJYC 4K07A 1J88A 4HKJA 4QHLA 2A6KA 2WBJB 4P9HC 1UKQA 3HRPA 3LQAC 4HC1H 3SCMD 4HUVB 3E1F1 2F54B 1PEZA 5F6IC 2DTML 5SWSB 3I85A 5F1KC 3CU1A 5KSAA 3DRTB 1IGFH 1ZEAH 2YUWA 3FB7A 4OZIF 5DYOB 1I7RB 4Y4HB 2XQYG 3LZFH 3F58H 5JA9A 1RUKH 4UOW1 4YDKH 3W0WA 4RQQB 1T7WA 3DHJA 1KN4H 4XP9L 1CFBA 2VITA 5EZJA 4OBSA 3HCVA 4MAUH 1ZHBB 3MNVB 5FYJL 5HJ3A 3J8F7 5DHXB 3U79A 2WLYA 4OZFG 3TPUA 3QUYC 5CAYB 5MI0B 4WVRA 5BV7C 4XWGH 3WXWL 3GSQA 4CVXA 1FNGA 1XGQB 3MLRH 2R69L 3VG0H 2XY2A 1FZJB 2EDOA 2I26N 4N5EC 1NAKH 1E27A 1FNSL 4LLQB 4PJXF 5FM4A 5KSBE 2XN9B 4WEBL 4K3DL 2X2YA 1T4KB 1WJ3A 4O9HL 3ILQC 2OZ4A 3MV7D 4Y4FD 2GTZB 4IRZH 4ZOBA 5GGTH 1N0XH 2DLIA 2RR3A 1IQWH 4KUCD 1LEKA 3PP3K 3ARWA 2NYYD 4GRLC 4M3KB 2AQ3A 3FT4B 1CI5A 1M7IB 2O5XL 1JRHH 4P57A 1N26A 32C2B 4NQDB 1U3HB 5DR5L 2VAAB 4JY4A 4LLWA 4KK8C 3AS1A 2QADB 4KQ4H 1VADB 2XA8H 2EIEA 5J9PA 1AD9A 1QOKA 3ARFA 1QRNA 4UDTA 1MSPA 2PW1B 3WV0A 1LNUA 4XCCL 1I8KB 3EGSB 5DK2A 3GBNL 2OXGA 3LKSB 3D9AH 1BD2A 1PW3A 4S11A 4YHYB 3TJHD 4HIXH 4KDVA 2FJHB 2VABB 2XZCH 1S7WA 4H20L 5T5NF 1YECH 3LEXB 2Q86A 5HHVL 2CDGA 1CGSH 1KFAL 3C2AL 2W0KA 5GS1B 3RWCA 4TUOB 4WWID 4M7LH 1T83C 1I1AA 5CUSH 1A8JH 4OLWH 4ZTOL 1ZVHA 4PS4L 5TDPB 5ESAB 3WO4B 3O3AA 3MLXH 4Y88A 3UPRA 1JHKL 4M1GL 1Q94A 3RRQA 5E5MB 5E6IC 1MJ7L 3T0XA 5JW4Q 4X83A 3V6BR 3ULSA 2VLME 3QB7C 1LO4L 2R1WA 4M7KH 5DHVB 3ARBD 3EFDH 3S35L 1PG7X 1KTDB 5EZIL 3UDWC 3CSPA 3O45B 4NRZA 3V4UH 3HE6B 1JYNA 1G7QB 4O2EB 2JB5H 3SQOH 3MBEC 5JPMB 4J8RB 1U95A 1A6VL 1Z3GL 3MOAH 4PD4K 2VXQL 4PRNA 3VD7A 4ISVA 4I48A 2BRQA 5EU5A 1S7SB 3AXLB 4JDVB 1YEKL 4KJQC 1G7HB 4HH9A 4XVUD 4WI7A 5T1KD 7FABH 1I7TB 1OD9A 2ORBH 4MVBC 2P8LA 4EI5B 4DCQA 2PKDA 4KJWC 3U0PB 4D0DB 5EIIB 2CLRB 3ZSTA 3T77A 3KLHD 5HHXH 4JN2B 1VDGA 1F97A 1YNKL 4N8VB 1KIQB 3RY4A 3SGKC 1XH3B 1BJ1J 5D93B 2B39A 1JNHB 1Z5LA 4GAJL 4U33A 1MCOL 2QL1A 3MRHA 3Q3GB 3SQBA 3B4NA 3NCJL 1GXEA 3H8NA 4EN3D 1GCFA 1RK0A 4XXDA 2V5MA 3AS2A 4DUWA 4KH2A 4U1HA 1QZ1A 5L2JA 1FVDB 5BJTA 3T0DA 4PGJA 2V7NB 4PGCB 3O6KL 1DQLL 5T5FH 4MNQD 3QQNA 4HWUA 3GBMH 4P9ML 3C60A 4JO2L 4XNZC 4BFGA 1P7QD 5GS0H 4OIAA 5HTSA 2VLRA 4ZAKC 3OAUH 4Z5RB 5C2BH 5D7LE 1YEEL 4DUXA 5D6DC 1GC1L 3S4SB 1M05A 2DN7A 3LV3B 1CLCA 3PV6B 4PJ8B 4OCYL 1AQDB 3ZL4H 5GS2H 4FZEL 3TYFA 5C7XL 1VFUA 2EECA 3NH7H 4R4BA 4U1LB 4TNWF 1FJ1A 1LEGB 2GK2A 5F6IB 4L9LB 1HSAB 3QJHA 2NY2D 3ZTNL 4RA0C 2NZIA 3VE0A 4ZUVA 4HCRH 4NJAL 4JGJA 3VI3E 3F8UB 3H9YA 2QLVB 3HC4L 1DVFA 1WBXB 3REVB 3HZVB 3OKDB 4UQ2B 3CFKB 3NCFB 3RWEB 4J3VA 3QHZH 3O0RH 4KAQL 2Q87A 1NGPL 3MRKB 5BV7B 1MUJB 2J8UA 5J4MA 1FYTE 3SOBH 1CIUA 3HMWL 3P30L 4P2RD 1KCSH 5IHLB 3QCVH 2GT9B 1F3JA 2C3HA 2IH3B 1I1FA 2ATKB 3SDYH 3U2SA 1RUPL 4OCSL 3CFCL 3TBWB 3IVKB 4NKMA 2VNCA 3GHEH 1XGYL 1OP5H 5JOFB 3CVHB 2XACC 3F6LA 1CGXA 3T4AA 2X4TB 1RZFH 4LVNC 4GRLB 32C2A 4ONFH 4NHCL 4NWUH 4WW1B 2X10A 3K2MC 1C5BL 4IS6B 4MWFB 3BDXA 3QEUA 3G5YA 5LQBH 4J3UA 2DYPA 3DHMA 4OF0A 2YA1A 4OTXL 5HD8D 2MFNA 3CXDL 1NMBL 3VXUB 1ZGLA 1ZSDA 5IB1B 5IB2A 3CFJB 4LSRH 1TJHH 1ES0B 3V0WL 1R0AH 4EUPG 1K6QL 5IFAH 1OB1B 4P5MB 5DJAA 3IJYB 2OR9L 4EQ2A 5C0CD 1A6AB 5F7WC 3IJHB 4B50A 1TNNA 4PBWD 4PGEA 4PD4J 3DUSB 1FH5L 2OI9C 3LEXA 3M1BA 5K33A 5CBAB 1MAJA 2PXYC 3QNYB 1MCCA 2AERT 5I19L 4OD3L 3GUTA 3OKEA 4UQ3A 2HLFC 3LIZH 4MNGE 5T3XL 3D39D 3WS3B 1I1YA 5F71A 5GQBA 4WUUB 5MEND 3KG5A 1ZKAA 1OGAE 1QLFB 5DT1L 1HQ4A 1BM3H 4PJHB 5IESH 4ZO8A 1OOAA 5C0JB 1T66D 3FN3A 2ZUWA 2IMMA 2APFA 1KCVL 1BJMA 5DHYB 3GSUB 2HLAB 4U1GC 1BOYA 3L3GB 2LQRA 2Q8BL 3KPSB 1YN7A 1SY6H 2DQHL 3REWB 3DX7A 5E6IB 3ULUH 4BH8A 5C6PB 4HWBL 5KVFL 1T5XA 3OAYK 5EA0L 5EWIH 4XBPB 1F4YH 3MJ9H 3L7EA 1KXVC 1AKJD 5JR1H 3AXLA 1KF9B 2YWYA 3MBEB 2VDQH 3PGFH 1JGDB 4XC1L 4YJZL 2ZNXA 5I6XB 1AO7B 3QG7H 3JUYA 3DX9A 4RZCA 3HR5A 3X11B 1KIPB 2QR0A 5FCUH 4YQXL 4D0DA 3HE7D 1UFUA 5TE6H 5IWLA 2R29L 2EYRA 4XRCA 4WWKA 5E2VL 4NWTL 2LVCA 3H9SD 3SJVE 2EDKA 3MLSH 4ZO9A 1FNHA 2GCYA 2W65B 4PRDA 3PV7A 4DVRH 3BWUC 3MRQA 1NLBH 4TN9A 3S5LG 2XFXB 1JNNH 1D5XA 3OHXB 3T3MF 3ZLQC 1L7TH 4U6VL 2WK2A 5A2JH 1GGBL 2FJFB 2VWEC 3SPVA 2AABL 2V9QA 2ADJA 3MXWL 4NFDA 5I9QC 1JTTA 2R1YB 5AZEH 4XCFH 1A6WL 3EJZD 1S7UB 1FIGL 2XNAA 5IUSA 4L4TB 3TBSB 4NQED 2FHCA 3GI9L 3IDJA 3L3OA 1UM4L 2C7UA 2VZUA 3FOMB 4XNZB 4YHIB 3ZKMC 1OGAB 4WFHE 1NLDH 5JHDB 1WUNT 3GIZH 3QPXH 2BVUA 5BOPA 3L5WA 4ZAKB 3TZVA 1HQRB 1K2DA 1PAMA 1T3FB 4TVPD 5J1TC 5L2KB 3PXHA 1VPOL 2BC4B 1ZLUH 1JPGB 1KIUA 3EDFA 1EERB 1IZJA 4WEUD 2BNQE 3BP5A 5EFIB 2BVTA 4D9LH 1I1CA 1HINL 1LEGA 4OLUH 3NABH 5T3ZH 3FRUB 4JY5L 4PJ9D 4HFUH 1CL7L 1U8NA 1U8MB 5DRNA 4F2MB 1WIOA 5MEOB 3HZMA 5E8NA 2NQCA 1K3ZA 3NA9H 3EDJA 1HYSC 2B4CC 2DDQH 3G5XB 4NQTA 3V95A 3HN3A 1RZIB 3IDMB 4G8EB 4U1NA 5I8CB 4KI5D 1A9EA 2F74B 4UBDD 4E9LA 5I17B 1EEQA 1NC2B 3MRPA 1MF2L 3EO0B 1KYOK 1FO0L 1OSPL 5CFHA 1BWMA 1FFOA 5F3BB 1CE6A 1MJ8L 3MXVH 4KI1A 1W0WA 2HFFB 2IH3A 2J4WL 1I9IH 1M71B 1OTUC 5SWZB 2AEPH 5B38G 5IJVA 2DJ4A 3PNWA 2HT2C 1FDLH 1IEAA 2DJSA 5ERWB 1WQVT 5CHNA 4CL7A 2W38A 1XF5A 4UOW0 1KJMA 4UINH 4ZTPH 3MLUL 4I2XB 5D1XA 2HVKA 3P11L 3OB0K 2BDNH 4E42A 1MVFA 4KMTH 2M8XA 3SN6N 1NMCB 5B4MD 1ZA6A 4W4OA 2GKIA 4A2MA 4LVNB 5AYUH 4OF7A 3IDXH 3MJ6A 4JVPA 5DJ8A 4Y4KC 2FYYA 4F37F 4HAFA 2PF6A 2PTTB 4XPBH 5BRZB 4M7LT 2NY0C 1O7VA 1SJVA 3JVGC 3ZE1E 2NY3D 3C9NA 3QIUD 2HN7A 5HGGS 3SE4C 1D5IH 3OV6A 2B7DT 1DE4B 3ARYA 3QR2A 4QLRA 5FUZL 2MQ0A 4JFFB 4XP1H 1FZMA 5EBWA 3ET9F 1CK0H 5HYJD 4XCNA 4X4YA 3R06B 1TETH 4WO4D 4P5TA 3I02B 2PXYB 2GW5A 1QLFA 2D7PA 3QNZA 3ZTJG 4QXTB 1WT5C 3F7RA 2FR4A 9CGTA 3G04B 1NUDA 3KYAA 1RZGB 5D7IE 4RX4D 3SE9L 5BVPL 3VD3A 1QRKA 4PJAB 4LHUD 4ZXBD 4EEEA 5E9DA 4YDJA 5KSVA 2XTLA 3KPSA 5GGRA 3QDJA 4X9IA 5E8EB 4YR6A 3K0WA 1FIEA 4ZQKA 2Z9TA 3O9WA 1EJ6A 2XV6B 3NIFF 4MA3B 4U1GB 4M7JL 3TN0D 2ZSWA 1K8DB 3G08A 3U1SL 3QWQB 1URLA 2VL4A 4Y4FA 2CIKA 4LSTL 4OV5B 4WTWA 3ETBF 1EIBA 2CXGA 1IEHA 4G7YL 5FGCB 4JPVL 4KKAD 5ID0B 5EU6B 3QDGA 1FVEA 4A6YB 3IDNA 5GHWH 1OAXL 4RIRA 2FIKB 5DUML 1X5AA 1ONQB 3HMXL 1JGUL 1CLZL 3EYSL 1I9RL 3CVIH 1B4RA 2ITDA 3MRGA 2H32A 3VXTA 2W65A 3OJ2C 4Y1AA 4PJHF 1QACA 1EGJL 4HUWA 4BK5A 4HWBA 1A9BA 5EO9A 2D9QB 1I7ZB 1Q72L 5IKCB 1ORQA 3RVVD 2FH6A 5ISZE 2VLLA 1I9JH 4XX1G 1S5IH 3T0WA 3DGGB 5D6CB 5F8RC 4Y0GA 2BHYA 3X13A 4RFOH 3K1KC 4N0CD 3VGFA 5GGQH 3E8UH 4HQQL 1H15A 3O6LL 4YHML 1U0QA 4FXKA 3T4YA 5I9QB 1KPUB 1G9NH 2XXMB 5GPRA 1S7UA 5DZNA 1GGCL 3STZA 5JXEC 3SE3C 3UEZA 4LKXA 1JRHI 2P5WE 2VLKD 3L5HA 3QEGL 4JO4H 2BCKB 5D1ZC 3WFHA 2ADIA 2VC2H 3QULA 3DVFA 1KYOJ 5LJYH 3MJ8A 4XCYB 5DMIL 2A0LD 3L1OL 1MREH 3G5ZB 4PRIB 3T2OA 4EQ3A 4LGSB 1LD9A 3ARBA 1FCGA 3RDTD 4DN4H 3QRGH 1MRFL 2IGFH 2CJUL 3HNTL 2YD1A 3QXAB 1FC1A 2AXJA 2YD8A 2IPUG 4L4VA 2VUOA 3X12B 4TOYL 3OTTA 3K8KA 5F96H 3QDAA 3S6CA 3RY6A 5MEOA 4NKDB 3O41B 4NNXB 1QEWA 1BBDH 2ZNWA 3KWWA 3OGCB 1LK2B 4F7MA 5T1KA 2YD7A 5I1JH 4G8EA 4TULH 2D0HA 4AH2A 5IK3A 1XR8B 1KBGH 4DK6A 5CEXB 2OTWB 5DRZA 3L5JA 5DJDB 4HW6A 1BZQK 1QLRA 5FGBC 1QFUL 5HYQA 2HTKD 3W0WE 1HKLL 1U91A 2MHAB 1Z6JT 3T2NH 5DI8B 2F53D 3U0WH 1BLNA 4CADA 2CGRL 3EUUA 2QEJA 5E94A 3QCTL 3D3VD 1VESA 3SDAD 4JZJA 1IT9H 1KCRL 1U8HB 4TVPL 5ERWA 5FUOL 1XGRB 3GRWL 1KIRA 5DURD 2V7HB 2Z31D 3ZKXC 1AY1H 2BOCA 5DD3L 4XVTL 1NCWH 2GFBB 3QQ4B 2IANE 3MRIB 4YNYA 3EOAA 1G9ML 3RNKA 3QEHA 3BIKA 3OGOE 3NFSL 4GOSA 3FMGL 1FO0A 5BO1H 1A1OA 3RVUD 4PTTB 4Z7WB 1UM6H 3MRBB 3B6SA 5B39A 5TH2B 1AGEA 3LB6C 1HCFX 2DQUL 3EDDA 3UJIL 5ECJE 5FOBA 2NY0B 1CLOL 5L6YL 3MRMA 4KXZH 1ZLWH 1EFXD 3U7WL 4YBQC 4AYFA 4XNQB 1CYGA 4X6EB 1QRNE 1SJHA 2JLLA 1JL8A 5E70A 1K3IA 4UNVA 3W9DA 1OM3L 5FKPA 3RNQA 4FQQB 1BD2E 3G04A 3DARA 5A3IC 1OARH 1G7PA 3CMGA 3TEUA 4YHLL 3KLAA 5I1HL 3VDAA 4JM4L 3TVMC 1EZVX 1V3JA 1GVIA 4BUHA 1HXMB 3RKPA 1U3YA 2FX8H 3GK8L 5E8EA 4O51B 2Y72A 1EEYB 4OSUL 2FD6H 1FL6B 1OTSD 4FQ2H 3RVXC 5F7EL 1OP3H 1YYMH 5DD0H 3WJLC 5I15L 5FFLA 1ZT7B 3L3HA 5KVEH 4MNHB 5CWSA 4P4KC 1S3KH 4U3HA 1M6OB 4HKXA 2IQAA 1BVLB 1S7TA 4N90D 5A16A 1A2YA 1ZS8A 2H2SD 2R9HC 3MLPA 1AIFB 3KPOB 1G1CA 5EPMB 4YBLB 3AROA 4KTEH 3ARED 4AM0A 1AR1D 2LTQC 5E03A 2YD5A 1AXIB 4G8GB 2EKJA 2VTFA 3HPJA 1MNUL 4PLKC 1UZ8A 4Z0BH 4R7DB 2XPGA 2XI9A 3VD5A 3NACH 4F7TB 1PD6A 4MXQC 2CKNA 3KPLA 3VFTA 4E41E 4ELKA 5DVKA 3U7AA 5TFSH 3WS6A 4RMRA 2E7LA 5CGYD 1MCSA 4R6UA 1NPUA 2PYED 1WFNA 4PJAF 3RU8H 5BOZG 4BSWB 4R96A 3S3SA 1R24A 4X7SL 3HG1A 1YNLH 5DRXB 5K9QI 3QDMD 4JN1L 4MA8L 1SBSL 1JF1A 4NQCA 4MCZB 1R5WB 5JXAL 4I8DA 1WAAA 3ORJA 1N6VA 3W2DL 1IJ9A 3E3QC 3HMXA 5ACMA 3I9GH 5DK0B 1A6UH 1KPUA 5D2NC 4ODXB 3P73A 1IAOB 1LE5A 1QSVA 3HI1A 4YWGL 5K9JL 4LFHG 1EGJA 5D5MA 1MLBB 2YWZA 1SEQL 3S7GA 4DKFH 1QFOA 1G0XA 3SKUD 3FO1B 35C8L 4WJ5A 1L7IL 4HUKB 4YEEA 1K8IB 5F7LB 3RTQC 3AS0A 3IFNL 4D0BA 5BMFL 5D1ZB 3MFFB 2Z35A 5BZDA 1VEPA 1YEHL 3DVGB 4OUOA 4N8VG 3IJSA 3ROLB 4HDIA 2DL2A 1KT2A 4JRXD 1ZANH 4XHJD 3GI8L 2VN4A 3PL6C 5EC1A 3EYUH 2VLRE 2Y7QB 4POZC 3U83A 2ZOLA 1N4XL 4IDJL 4WNQA 2YMXL 4F58L 2H1PL 2VZOA 3MLVH 2NW3A 3W81A 3DURA 1WAAF 2OMNA 2VDLL 4EZMA 2O5ZL 5DWUH 4F9PC 1MJJA 2BSSA 5TGBB 4C57C 4G8IA 3NPZB 4C54A 3D18A 2OTWA 2OBGA 4KKBC 3QG6B 4XMLL 1F5WA 1TITA 4NUJB 5CEZD 3QXDA 4W6WB 2VZSA 3KYNA 1QHOA 2W0FB 4QTHA 4E41B 1H3VA 2IFGA 3FO9A 1XF4B 1RZJL 4OD2B 5HGBB 4OM1L 5DJ0A 4FTVA 3FFDA 4QO1A 3S4SG 5JHLL 1EMTH 4UU9A 1MEXL 2AJZB 4HFWA 3WIIH 3RUGE 1X5IA 5KVGL 5EOQH 3PDDA 4LAQH 3MRIA 1AGCA 5D70H 3V8CA 3WIHH 4HGMA 1NQBA 2Y07H 3A67L 3ZKXB 5I1DA 5E2WL 5T33H 4QWWC 4DUVA 4NNPL 1XCQB 3BP7A 3VGEA 4NM4L 5LAXB 1VERA 4I3RH 1A4JA 2AEQL 1RPQA 2ZCHL 3VWJD 1KJ3H 4YK4C 1F4XL 2EXYC 2YRZA 3BKML 5ACZB 2WANA 1WBYA 3BT2L 4RWYH 4UT9L 1PKQB 1MWAH 1TVHA 2PN5A 3D2UB 3FN0L 5F1SA 1E4WH 5FYKH 4I0PC 4FG6C 1A7BA 1OP5K 3VGHA 4KK5D 3GRWA 5LCVH 3PGDB 2YD2A 5DJYA 4YXLH 2HTLD 3MV8D 1F2XK 1Q9OA 1ZVSA 4RMWA 1NFDA 1BEYH 4ZO7A 1AGBA 4G9DB 1RFDH 3MZGB 5KANI 3BUTA 3E3QE 4OF3A 1W0VB 3T8XB 5L9DL 5DD6A 3VA6A 2HA1A 5I18L 4M02A 5EO0B 3WN5C 5D2NE 4DGIL 3LOWA 1UA6H 2HKHL 3O4LD 4MXWH 4PB9H 4M9OA 1WC7B 3U0TA 2HVJB 4LLUA 1WWAX 4EXKA 4CN1A 4RAVA 3K2UH 2CLZA 3GJFA 1FG2B 2NX5A 4Q0XH 5DUBA 1PZ5A 2DKMA 2JJSC 3U4BL 2JB6B 3DXAB 3CPLA 4GRMA 4N9GA 2X1QA 4JFYA 4Z7WF 1G6RL 4OFIA 1GIGL 3ESUF 3C5ZC 1CBVH 1CFVH 3BX7C 4KVCH 1RZ7L 3KPQA 3X3FL 4RAHA 3ULVC 1KG0A 2NTFA 3HPLA 1BVLA 4PP2B 3ARXA 4RCAA 2AEIT 2ADFH 1PG7L 3CFBA 3ISWA 4J4PC 5INCB 4P4KB 2ZJSH 3EO9H 5I66B 5GRVK 1WICA 2OR8A 5AUMA 1NFDF 2BVPB 4OD1H 5IW6A 1M7XA 3JWDL 3RUGB 3FQTA 1KN2H 2A38A 2LTQB 3CDCA 4M43L 2AJYH 4NGHH 4LCWB 3O8XD 1GPOL 4FFYL 4PY7A 2B2XL 4HLZG 2GAZB 4AQ1B 4JAMB 4LRIA 4CW1A 3TYGH 4L5FL 1YA5A 1JZ2A 5SX5H 4EDXB 3BSZL 1T89C 5EZOH 2CH8A 3LH2H 3W39B 3VMPA 2D03L 4DVBA 4JPKL 3JBG7 1GHFL 1C5CH 2EDRA 3MREB 5FA4A 1FLRH 2MJWA 4WO4A 5ITBH 1TJIH 4HK0B 2IBZX 1T22B 1KNOB 3FB5A 2YKLH 5IBTH 1A4KA 4ZFGL 1IFHH 4P5KA 3HZKB 5AZ2L 3IDGB 3QT2A 3SCMC 4YXHL 2VUYA 4QY8A 2R1XA 2Q3ZA 3QCUH 4CMHC 2NZ9C 4LHUA 1T2JA 5D71H 4XI5D 3CCHB 1F11A 1K8IA 4Y5VC 5ADPH 1C7SA 3RL2B 4LLVB 5DD5H 4R7NB 4ETQA 3PWPA 1XF2B 3HC3H 1Z9SA 4DZBB 4HBCH 1EDQA 2NY5C 4G6JH 5DUPH 5TE7L 4Z8FH 4JFEA 2NNAB 5I1IH 3RTQB 4HJGB 1CFNA 1EVTC 1PQZB 3LEYL 4XGZA 4NFCA 2AEWA 1QSEA 5JW4R 2WBKA 1A6ZA 1HXYB 2WNGA 1LO2H 2WM0A 3P4LA 3GIVB 1KELH 1NBYB 5CJQH 2YSSB 3GMOA 1H3TA 1R5VA 2CK0H 3O3BA 1GZPB 1G7LA 3V4PL 3PL6B 3PWUA 5ALCH 2GHWB 3LKNB 3WEXA 1P4LA 3CUPA 2DIJA 4NZDA 4JKKA 1AXSA 5LVEA 3V0VA 4UILH 1DQJB 1INQB 3H0TA 1YNTB 2YZ8A 1ED3B 2CDEA 4H8WH 4OCWH 5IMKA 4AG4L 3FQWA 2EDQA 1ZV5A 3KVQA 1BWWA 4R4FH 1SQ2N 4X8XA 5D4QA 5IB4B 5C0RH 5FOJA 1U8JB 4I18B 4JQIL 5GS3A 2B1AH 3RWDA 5E2TL 5IF0B 3NGBC 5HHQB 1CR9H 3DUUA 3WXVH 5I2IB 2F58H 4S2SB 2H41A 2GJ6D 1JGEA 4FFVD 3ZT7A 4GSDL 3ULVE 3P4OB 2I25N 2XZQH 5M7QA 1AFVL 5LWYL 2K7QA 5HDBE 2DAVA 3RVWC 3RGHA 3CH1B 5HGAB 1EAJA 5IIEB 4MXVE 1U42A 1HNGA 4TSCH 1MIEH 1TPXC 2R39A 4IOFD 5IT2L 3ARQA 4FFZH 3T3PE 3FQRB 4UB0L 2NLJB 3CLFL 3TJHC 4PJDA 4OLZH 3S36H 4IMKC 3PWNB 5ACZA 5FHAL 4V1DD 3IFPB 4WDIA 4F57L 2AS5M 1MCPH 1J8HD 5KG9B 3LEVH 3I3BA 4KZEL 3OF6D 2BFVL 3NN8B 3OKLA 1U8QB 2IEPA 3LMJH 4YK4B 1GL4B 1KJ2L 5J57B 5CEZL 5IP4A 1A3LH 1IEBB 3QUMH 4B7IA 4ODBD 4XPAH 4YUEH 2AI0L 1SJEA 2A73A 4MQXD 3MA9L 4UT6H 4D3CL 4XP6L 3L6FB 4XBEL 5DF0A 3V5KB 4FNLL 4E0RA 1P4BL 3OWEA 3ROOB 3JV4B 2H26B 4LASL 2IPTH 3P4NA 5B8CA 1WITA 4C58B 1XIWD 3WNOA 1DANU 5J1AB 1N5AA 4WY7L 1P69B 3MFGB 1UC6A 1CG9B 1N0LA 4LCUB 1PSKH 4I13B 3NCYS 4C56A 3EIFA 1PLGL 3N85H 2B0SH 4MQSB 2ED8A 4UDUA 1I7UB 2Y4SA 1J1PH 1I3RB 2F53A 2P8PA 5C9JB 2AXFB 1NUGA 4K7PH 4L29B 4X98A 2Z91B 3Q6FB 1ZWIA 3D3VA 4JRYD 4RRPA 1YQVH 5IFHH 3SDAA 1KLUA 2DQEH 3FQUA 3C5ZB 2VQ1A 5IW1B 4KHTL 5E9DE 4P2QD 3KLHC 2VDNH 2Z31A 4J3TA 2K9UA 4G6FD 1MRCL 4JPWH 3VRLE 1DBKL 5BS0D 4XC3L 1LDPL 1UYWL 3MRRB 2DQFA 5DO2C 4RWHA 3LSOB 4HC1L 1R3IH 5MHSD 5DEFA 3CDGB 2J2ZA 4GAYA 4HIHB 1T6VN 5IB5B 1G6RA 2V6HA 1IGFL 1ZEAL 5E5UB 2RCSH 4EN3C 1IAKB 1U3JA 3LZFL 2FZ3B 2D7TH 3F58L 4UV4H 1RUKL 4YDKL 4I4WB 1MCDA 1ZT1B 1YMHA 1KN4L 1JPFB 3ARUA 2ITCA 3VFGH 4ZFFA 2Y1VA 4WHYG 3ARGD 4HIEA 3MR9B 3EYFA 1XGTA 3KPRB 4YX2H 1FFNA 2OQJB 3QZWB 1EFXA 4DWHA 3ZO0A 3QFJD 2W0PA 4Y1AE 5IHUH 2C26A 4PR5B 2HG5A 3MLRL 1YQ2A 4JPIB 1NAKL 4X6DA 3P40A 5FHBH 3G5VA 3EDKA 5DTFA 3WMSA 1JNLH 2RFXA 3FOLB 1MFBH 4X7FC 4U7MA 4M1DH 3BUYA 2NTSP 4IRZL 1NC4B 5GGTL 3NIDE 1KTKE 1N0XL 5IMOA 4BSVA 4JFPA 1IQWL 1EK3A 3RUGF 4Q9CA 5HHMD 2ENSA 4CMHB 2VL5A 1RZKC 3S9DB 2NY2C 5BZWA 4Y5VB 4G43A 5INDA 5T1MA 1UXWB 4NQSB 2WUBH 1JRHL 1CVSC 3U4EA 5IMLB 4LEXH 3OX8B 1RU9H 4L3AA 1NCDH 4IMLA 1SYVB 1I75A 1RZ8A 1H9VA 4WHTB 3VMNA 3UTTD 1CDBA 2OLDA 1JHTA 5FO7A 1ZGLP 4JFDD 5GIRA 1CE1L 5TDOB 4GMSH 1NCAH 1DUZB 2A6IB 4NO0A 2K3TA 2VDRL 1DQJA 2BSRB 3D9AL 3VXSB 4HV8B 3DOSA 5DEGB 2YBRA 4QHNA 4YAQA 4ODHL 1A02N 3CC5B 2CD0A 1K5NB 2XZCL 4I18A 4L4VE 1T1XA 1N3NB 5C0EB 5I30H 1CFQA 1YECL 3LKPA 3MV7B 4OKVB 4BFEA 2PYEA 3RPKA 4LQ1A 4RMQA 1LO5A 4LPCA 1QBMH 4M7LL 5T1LA 3NGBB 5ITFB 1T6WA 3DVIA 1RD6A 5DHVH 1UH4A 3B9DA 3OXSA 4LCIH 2YC1A 5CP3H 3GNMH 5GRXG 1FE8L 1IM9A 1YYLH 1Y6NR 4HS8L 5HD8C 4KK6D 4K9EC 5EH1A 5IW3A 1BVKB 1T0MB 3IRZA 3EFDL 2MQ3A 5DD1L 1NGQH 4IDLA 3DWTA 5KSUA 4X4XB 3SBWA 1TPXB 1JPSH 1WEJH 3ARVA 3KDMA 4G9FB 2JJTA 2JB5L 3SQOL 1X7QB 2UZYB 4OUUA 4Y2DD 2R0KH 2P5EB 2UZIH 3MOAL 3B3IA 5H37H 1G7MB 2OSLA 1ZLSL 4NKIH 5E4IA 5CSZB 5JIPA 2VQUA 4MD4A 5FDWB 1U36A 2IC2A 4MNQE 4ELMA 4MA7L 1BF2A 2M2DA 2ORBL 4LCCC 1KB9K 2QJDA 2AV7A 5I1AA 2F15A 4D9RD 2O5YH 4PLNC 3CJJA 5GGSY 5J3HC 4JANA 1CFTB 3JV4A 5D1QD 3EYVA 1BAFL 3K3QA 4CKVX 4NZJA 4NSKB 1OGTB 1MCRA 1QQDB 3JTTA 4NN7B 1FFPA 4R2GD 2JELH 5T3ZD 4OGAD 2C3VB 3PHQA 3FFCA 4OFPA 1B0GB 1ZLWK 1KJ2A 2A83B 3WDJA 1F02I 3IGAA 1DANT 1I3RA 3IF1A 2OL3B 1DLHA 4MJ5A 5KJRH 1DBBH 4YFDB 4LK4A 3BHBA 5T5FL 4HUMB 2X4UB 4LPXA 4LSUH 3FQNB 1T21B 2X42A 4JFQB 3HE7C 5GS0L 3LS5L 3TC9A 3VD4A 3DV4A 4YBHA 2B1HH 2VIRA 5F1IB 5CEYB 4M6OH 5C2BL 4L8CB 1YDPB 3A0OA 3C6LD 3IETA 2FRGP 4QRQA 5F44A 3VXNA 4WENB 4P9HH 2CIIB 3LQAH 5F1OB 2DJUA 1JWUA 5ILTH 3VFOA 3S34H 5JA8B 3ZL4L 1R5IB 5E6YA 1OP3K 3TGXA 1FVCA 5FYJU 1MQ8A 3OR7A 4ESKA 1NDMB 3OJMB 4KK9C 5HGHB 1C16B 4U1IA 3OKMA 2GY7B 3T0EC 5IHZA 3QIBB 5HVWA 1IQDA 1TJGH 1V7NL 1MIMH 4HCRL 5ENWA 4OCRH 5ESQA 2PO6D 2OQJA 4PJ7B 5DC9B 5BV7H 4HT1H 2VKXA 3MV8A 1S7RA 4MB4A 1RVFH 3EJZC 5D7JA 5H35A 2HJKA 4RFNC 5F6HI 3LS4L 1KLGA 2W9LA 2DQTH 5HI4D 4M5YL 4HC1A 5IM7B 3OKNA 1P7QB 3BAEH 3O0RL 3BQUD 5LKNA 2D0GA 3HG1E 3HUJB 3VCLB 2VERN 3QQ3A 2JCCA 1KCSL 1NC4A 3AC0A 1AJ7H 3B9KD 4NQCE 3CVHH 3QCVL 5EN2A 1NKOA 3SGEH 1CIDA 3BKCH 4U31A 3SDYL 2Q76B 2ZG1A 4PFEA 4JG0L 4Y7MA 4MAYC 2R2EB 3MLYH 4PJ9C 2R2BB 5D7LD 3S36X 4QHMA 3M8OH 5K93A 3GHEL 5F9WC 3DRQA 3FTGB 4I1NB 4PYHA 3D39E 1BZ7A 3I6LD 5IMLA 1RZFL 1EA9C 1EXUB 2I60H 1X5XA 4ONFL 4XAKE 4NWUL 3LN5B 2KUTA 1KTLB 1WWWX 1ZHNB 3EAKA 2ESVD 1JGLH 2NY2B 5D5ME 3QNXB 5LQBL 1ETZA 1HSBB 2EXWD 1T0NB 3LRSB 4KI5C 5DRWA 5AAMA 2VZ3A 4IRSD 3V6OC 5GGTA 1TJHL 3QISA 3VXSA 4ORGA 3D48R 5IQ7H 1R0AL 3A6BH 5JIIA 2YPLD 3CSYB 3GO1H 5E1HB 2A6DB 4FXGA 5IFAL 2X7LB 5TF1H 2LU4A 4NO5A 2CKBH 3CLEH 5IBLD 4P2RB 3JV6B 1SYSB 1U58B 1XF3A 1KTRL 2JCCF 1T2QL 3MCLH 3D0VB 1TVBB 2F5AH 3MRJA 5JNYB 4HWEH 1KB9J 2FX7L 2WP3O 5C0AD 4DGVH 3V9FA 2EKSA 2IAMD 1BM3L 4MB3A 3MRDA 5JQHC 5B4MC 3SY0A 4LRNH 4BZ2H 3HRZB 3MRLB 2XT1B 4ONHB 2G9HA 1T1WA 1BVKA 5I1EL 1VACB 1SY6L 1NMAH 4ZUWA 3O2WH 1LK3H 4Q9RH 3ULUL 4Y5XC 2NY3C 3QIUC 4HIJA 3DSFH 5DZOA 4GKNB 2UYLA 4YEFA 2DQGL 2DICA 5EWIL 4P23D 3BRGC 1F4YL 3MJ9L 1MHPH 3VRJB 4YE4H 3QJFB 2J6EH 5C0CB 5JR1L 3PGFL 3AMLA 2VDQL 4KVNH 1TQBC 4WFFD 4KQ3H 3H9HA 4GXVH 3GSOA 3WUWB 4JM2A 1E6OH 2WP3T 1MFDH 3RAJH 4BZ1H 4EVNA 5EZLB 1A22B 5F9OH 4RFEA 4RGNC 5TE6L 1NUNB 3IDYC 4QF1A 2ATPA 3KYMA 2PCPB 2Z93A 5TF0A 4HJ0D 4LCCB 1YPZB 4ZXBC 1RIVH 5MENB 5BVJA 2UUDH 3MLSL 3L3IB 2V2XA 5CLWA 1II4E 4DVRL 4B0MM 3MROA 4MX7A 1V7ML 4GW4B 3GKZA 4TVPE 4K8RD 5CJ5A 1D5MB 3UTZA 3MMEB 2ZG3A 4ZPTB 2OMBA 3TN0C 4AL8H 3ZDZE 1L7TL 5GISL 4CN6A 4OGXL 4ZUSA 4DW2H 3PIQB 3I75B 4FQXD 4QRPD 5I1GH 5AZEL 4XCFL 4GRWB 2I27N 2X4UA 3IXAB 3NMEA 2GJ6A 3ZE0E 2VISA 3G6JB 3V52H 2R0ZL 2EEBA 4MJID 3T2QA 4XMPL 4HGWB 3VFVA 4NJ9H 3BEWB 3VFWA 1HEZB 1X3DA 2GIYA 1ITBB 2WIIB 3GJEB 4KI5E 4JM2F 4PJFA 3N1MC 2DTSA 3HE7B 2X5PA 2EC8A 5C6WH 3GIZL 3QPXL 4NT6B 1BZ9B 4XP5H 4QOKB 3DPBA 3B8SA 4PRAB 3DUHA 1KC5H 3A6OA 4Z7VB 4Q2ZB 3H9SB 4IRJD 4B41A 3DMMA 3RVVC 4C83B 1BIIB 1UVQA 2NW2A 3NVQA 4D9LL 5L88H 2DBLL 5T3ZL 4V1DA 4PRHD 5CINH 4FHBD 1T5WA 1MAML 4HFUL 3SGJC 4QHKI 4N0CC 4NRYA 2W59A 4OAWA 3GKWH 5DMYA 4U1SB 4CMMB 4P2YA 4X4ZA 3V5HA 3MODH 2DIBA 5IJKC 3T0EB 1I85A 4OZGB 4DFHA 1QA9A 3CDYA 3DYPA 3B8YA 3TH2T 5M95B 1HZHH 5E1AA 1I8MB 2VZ1A 3SDCD 2OTPA 5JW5A 5FA3B 1A7QH 2VSDA 4ENED 2GTWB 4RRPG 5JO5B 4ZSOE 3VCLA 5DQJA 1EEZA 1QSFD 4NQEB 5ADOH 3CZFB 4K71C 3MXVL 3VGGA 1ROWA 1LEIB 1HHGB 5HHOA 1A3QA 3RDTC 2WW8A 1L9NA 1I9IL 1DSFL 1HDMB 1VA9A 5FIEA 2X4RB 5SX5K 4GKSB 3V6ZA 1HE7A 1DFBL 4HCRA 4MJ4A 1UM5H 5GSRB 5EOCH 3WHXA 1ZT4B 3BP6A 4JHWH 4WFHD 4UINL 1TFHA 1DQDH 4XH2B 3GSNH 4N0UA 4MAYB 2AK4D 2BDNL 4YO0B 5B8CC 1OTTD 4PJ9B 1X5FA 4KMTL 1WCBA 1FNFA 5F9WB 2RJMA 4IIQC 4P2CG 1Y0LA 3O11A 5CCKL 4JQXC 3D0LB 3S96A 5F1NA 5AYUL 4Z7QF 4HBQA 3IDXL 4PJ7F 4P2QA 1FCCA 4U0QB 3S35X 3B5HA 4K94C 1N2RB 3ALXA 1FFQA 4Y5YB 2WV3A 1SBBA 4UUJB 4YC2C 5E00A 5GGVY 3UCRA 4MQ7B 3UXFA 1VGKB 4NKOA 2HTKC 4WHDA 5FM5M 1ZHLA 2A1WL 4M1CC 1UH2A 3VJ6A 2X7LA 2OTUB 3EHBD 1MH5A 3EKCA 1D5IL 3QUZA 5D96C 4PRBA 3HS0A 3DV6A 3HUJF 2HRLA 4GBXD 3VD9A 5H94B 5E08H 1TMCB 5JPNA 2X4SB 3ARZA 4MS8D 5HYSB 2VB5A 1CK0L 1DEEB 1S7XA 2DIAA 1TVDA 4U1JB 4D0CB 3U46B 5F88A 1UQSB 1MFAH 4G80A 4PV8B 3F12B 1PJ9A 5HPMA 4WW2C 4YHPB 2Y5EA 3C8KA 1F2QA 3CFDB 1SM3H 2ID5A 3WLBB 3QFJA 2BOBB 4FA8A 2GJZB 3TO4D 3RVUC 3JXAA 3FZUD 3NFNA 3WDHA 1A1NA 1DN2A 1N8ZA 3H3PH 2HFGH 1MVUB 2JJUA 2YXMA 3IFOB 4QRTB 1ORSA 1EUTA 4OLVH 4A6YH 5DQ9A 4ZDHB 3WFZA 3QUXC 2G5BB 1I3VA 1TZIA 4ZSOB 4P2OA 5TDNA 3S8WA 4HUUB 1JF6A 3TLRA 2NY3B 4M6MH 3QIUB 2BSTA 4CVZB 2R2HB 3I6KB 4G8FA 1FLTX 3SDXE 4DK3A 3CFIC 1G7JA 1AGFB 1JYXA 4JQVA 1YMMB 2FH8A 1S8DB 1JGVH 2YPKA 4G42B 4JHBA 5GHWL 4UIMA 4X99B 1GZQA 3O2DL 3V5DB 4MD0A 1BJ1H 1HOCB 3VRIA 1DTUA 2YS4A 5FECB 1TQBB 5HYJB 4PJDE 4X9BA 1B0RB 3CVIL 2VLKE 3O6FD 1SY6A 1R3LA 3F7VA 1YY8A 3ME0A 3WFBL 4RGNB 4D8PA 5KZCD 3TIDB 3U6RB 3IDYB 4CNIA 4F33B 3K80A 4ZXBB 4QHUB 4LLYB 4FP8L 3MJ9A 1YEGH 1F58H 1AH1A 3EYOA 1S5IL 3P9LB 2GSIB 4QXWA 3L5XH 5K9OA 3RVTC 1AQKH 3KGRA 4ODUA 5HHPB 5JZ7C 1R3HB 3TN0B 3DBXB 4RFOL 4LSVH 1A7NH 1B4JH 4PJEB 4NQVB 1H3PH 4L8SC 2H2SC 3E8UL 3AREC 4FQLL 4LKCB 5ESVA 1AR1C 1G9NL 4OLEA 3RPIA 3MOBL 4UTBH 2AGJH 4JO4L 1HHKA 1BBJA 4X6CA 2AJSH 5DJCA 4YDVA 2GK0A 4HKBA 4U1MB 4PRAA 1CQYA 5CGYC 2VN7A 2YD3A 4AY0A 1MREL 1YPZF 2F53E 4TSAH 2IPKB 4AK1A 3QRGL 1NCBH 2EE3A 2IGFL 4U2YA 5ACLA 1DN0A 3D3VE 1GRWA 3HI6H 2BNUB 3BWAB 1RK1A 3GSVB 5E2UH 4Y2DA 1XCTB 3W82A 3HA0A 3PABB 3MJ7A 4OZHE 3TF7C 2FATH 1YJDH 2B4CH 1BBDL 4P48A 1J11A 2BJML 4X5WA 3TT1H 3BKJH 2APWA 4GRWF 4M4PA 1FC2D 3G6JF 3H9ZA 1F3RB 3MRFA 1KBGL 1PZUB 3N1QC 3RX7A 4AEEA 15C8L 2NY4D 2A6JB 2CMRH 4OLYH 3STBA 1OAQH 1KPVB 3JWOH 4F8TA 4R8WL 1IZKA 4QRRA 1QFWH 2NR6D 4O00A 4F7CA 2VDKH 1BFOA 3U0WL 4LVHC 5F97E 5BXFA 1HN1A 1B9ZA 4FOMA 3MLZL 3O3DB 2AJVL 2FGWL 4Z7VF 4K71B 2R8SH 1A0QH 1QYGH 2AXGA 1IT9L 3FT2B 5GSRA 4K3EH 3RDTB 3RHWK 1KEGL 1X5YA 4OT1H 2UY7A 3OZ9H 4CUCA 4Y16D 3GB7A 1AY1L 1XGUA 4YDLC 4O58H 1NCWL 3KS0H 4XWOD 1U8IA 5JOPD 1FL5B 3TPKA 3BW9A 1CDCA 2JJWA 4UV7H 3NZHH 4DOHE 4RDQG 1RUAH 5IMMB 2VH5H 4M48H 5BO1L 1H0DB 3ALPA 4UNTA 4ZPVA 2EH8H 4MCYA 4Y5YA 4HH8A 4IIQB 1UM6L 4LSSL 4RNRA 3RWIB 3C6LA 3K46A 4OZGF 3QZWG 4MQ7A 1F45A 1I3GH 1ZTXH 2W9EH 3ARDD 3ALWA 3ZT6A 3SKOB 1LDSA 1MCFA 2X4PA 3BRFA 4YC2B 1X4ZA 3RKDD 3SKMB 3DI3B 3RI5K 5H94A 1RJZA 3NFPB 43C9A 1JV5A 4AEHH 2SEBA 5D96B 5KSAD 1N59A 3EDEA 3D69B 4YH6A 4FABL 4N90E 1EZVY 3P9MB 3F12A 3W0WD 5F9AC 3VXOA 5CJXC 2V2WA 5EUOB 4F7EB 4HX1B 3P3YA 4IOIB 2PO6A 1IMHC 1OARL 3CFDA 3TBVB 1CD0A 4OZHB 3O3EB 3QI9D 2X4QA 4OKDA 1NAMH 5J06A 3KHOA 2YN5A 4WW2B 1W72H 4M93C 2FX8L 5LXGL 5FKAA 3VWJC 3R8BB 5KW9H 5DQDH 2PYEE 3KJ6L 2W60B 3QDME 1DP0A 5GSVB 4FQ2L 4Z77A 4ZOAA 4KK5C 5ETUB 4XNMB 3B9KA 4KTYA 1YYML 5DD0L 4PBVC 3RL1A 2G2RB 5J13C 5DZLA 5KVEL 4CVZA 2HTLC 5C0FA 2OM5A 1S3KL 3GSWA 5GRYA 1VFMA 1YN6B 2NY7L 3INUH 3QUXB 4F9LC 1MHHA 3RWGB 5KBNC 3LQZB 1BHGA 5EBLA 2D2OA 4J6RH 1I8IA 3KYKH 4NQXB 5FXCH 5HI5C 1EAPA 1J05B 3PQYD 3RP1A 2ESVA 3U9UA 2BNRA 4EIGB 4RAUB 3NACL 5EO1A 1C1EH 4NCC1 5IEHA 4NIKB 5TFSL 1A5FH 2HJLB 3MO1A 4IRSA 4KTDH 5C0GA 4M61B 1HNFA 3RBSA 1QRND 3RU8L 5F9JA 4L3CA 1JHLH 1FAKT 3F5WA 1YNLL 3WNPA 4S1QH 5I8EB 4JKPL 2YPLA 2FL5B 4ELME 1BD2D 3WD5H 1FV1B 3QFDB 2EIZB 4AT6B 4N1EA 5ALBH 2H8PA 3O2DA 5CSGA 4NQVA 3T1FB 5GGSB 3SGEI 1U8LB 5EOTA 3V6FA 1JCKA 1BQHB 3MV9B 4HF5H 1A6UL 3DX8B 4HHAB 4L8SB 1MY7A 3VXRB 1I1AD 3KPTA 2IAMA 2VQTA 5GRJL 3AREB 4MB5A 4DKFL 4HPYH 3EOTH 4HS6B 2AK1H 5CEZE 3O8XC 4FXLA 2PR4H 2JIXD 4U6YB 1CD9B 2OR7A 4FS0A 1C12A 5EU7E 5HDLA 1UT9A 2BX5A 4OF8A 1NGWB 4BZYA 1A7RL 3EO1B 1UZ6F 2BNUA 4HIIB 1ZANL 3QPQD 1M1SA 2BVEA 1JP5A 2J8HA 3GSVA 3GSXB 3VXMB 5IFJB 3ZE2F 5IROC 3QDMB 3BKYH 1A6TA 4LARH 4M3JA 5C07A 4R4ND 4JFXA 4KRPB 2WSKA 2KBGA 4WU5B 4DKDC 3DTXB 5L0QC 1A3RL 3BXNB 4PJEF 5DWUL 1LP9A 2O26U 1Y6MR 1X9QA 3LKOB 1S5HB 2RAMA 3RWJA 2O61B 3FCTB 1CFSA 5CD5D 1DQQA 2YXFA 5IQ9B 8CGTA 2A9MH 4J23A 4O2CB 4XI5C 1MQKH 2P47B 3SKNA 5JUEL 1T04B 2P46B 4R3SA 3LAFA 1DJSA 1FN4A 2D0FA 4OI8A 4J1UA 1MCQA 4P3DA 5DEZA 4I9WE 5A2KH 5L8KB 3K81A 1F8TH 2Y5TA 3FT2A 4X80H 3MV8E 4JJ5B 2HWZL 4LVHB 2EH7H 4YHNB 1EMTL 1BECA 1Y18A 4JHZA 5MEQA 3BISA 3NPSC 4H8WC 2EYSA 3L7FA 4JRXB 4WHCA 1YEIH 5J6GA 4FQXA 5E8OA 3TIEB 1RI8A 3QA3B 4PJBA 4LAQL 5C09A 5TQ2H 4X9HA 6FABH 5D70L 3BZ4A 3WIHL 2Y07L 3EYQD 4NZTL 3FO2A 5T33L 5HHNB 2I9LB 4O5LL 3V7AE 4YDLB 4P4RA 5KS9B 1JWMA 5FK9B 1A1MB 4H26A 4R0LA 3MUGB 4KROD 3OAYH 4I3RL 3VWKC 4O02H 3RGVC 4FFWD 4PTUB 1KJ3L 4GUPA 3T08A 3SKOA 4JB9H 4RWYL 4M62H 3AVEA 2CLVB 5C1MB 1MWAL 3IAPA 4H5SA 4IHOB 1E4WL 2WBJD 2XQYK 4GG6E 5LCVL 5IVXB 3RZCA 5SWSD 4YXLL 2EDTA 2QSTA 3MYJA 3P77B 5DJZA 5DJXA 3TCLB 5HGDB 4Y4HD 3X3GH 1RFDL 4Z78B 1KUMA 2R0WH 2W9DH 1D6EA 2DLGA 5CLTA 3IXTB 25C8H 3U9PL 5I1KH 4GAGH 3WCYA 4ZODA 5F7UA 5I16A 1UA6L 1IGJA 3WFDL 2C1OB 4Z7NE 5DS8A 4ZS7H 4IOFC 5C0IB 2IADA 2V9TA 4GO6B 4OFYD 1DVFD 3X14B 4PJGB 1AC6A 4JFOB 3SDCA 3ZHLA 1CD1B 3PWVB 5K9QG 1P9MC 5C3TA 2E9WA 3QEQA 3MQIA 1QSFA 4M93B 4XBGB 2LFGA 3VWJB 4AENA 5DLML 1FZOA 4YDIH 4KVCL 3P4MA 3GGWA 5D2LA 3IDIA 3UTQB 5HY9B 4MQXC 1P2CA 4HKZB 1YN6A 3BVNA 3DX6A 4FQ1L 4GMTH 2BP3A 5C0BB 2ADFL 2DTMH 5J13B 4H1LB 4LGPB 2X6MA 5FYJD 1WFOA 5FV1L 1VFBB 2ZJSL 1HHHA 1WTLA 1BX2B 3NAAL 1OT2A 2Q7NA 4OD1L 1ZHKB 4G6KH 4KKNA 4NYLA 4OGZA 5EU3B 5L7XH 1XIWC 3HHRB 1ZXQA 3BN9C 4NQDD 4N0FB 2E9BA 1KN2L 5EUOF 2QADD 3WE6B 4BJLA 4LLMB 2AJYL 4NGHL 5GZND 2HJLA 4U7KA 3O4LB 1ACYH 1J1XL 1PKOA 2VAJA 4PG2A 4YHZH 2DYPD 3WYRA 1JWSA 4U7SA 4AIZB 2FWOB 4LCYB 3MZTA 4WW2F 5MERB 2NXYD 1FL3A 4ODVH 3T65B 4U6TA 2DWEB 2EIZA 4FQJL 4GKZA 3TYGL 4UIKH 5CZVL 4QT5B 4U6XA 2AQ1A 5EZOL 4UI2A 3LH2L 3T1FA 4P46C 4WEBH 5C08B 1K4CB 4GG6B 1C5CL 3MCG1 1FLRL 5ITBL 5CBEB 2UUDK 2AKRA 4J3WA 2YKLL 5IBTL 1IFHL 3HAEB 3NTCH 3OXRB 1FNEB 4PGBA 4HGKC 1UXSB 3BE1H 3E6FA 3WUWG 3QCUL 1UACH 1MI5A 2C9AA 5ICYB 2O5XH 5D71L 1HILB 4I5BB 2DQDH 4EUPA 5ADPL 3RIAK 5DR5H 4YLQT 1S9XA 1J0KA 5DD5L 3EBAA 1D5BB 4JLRA 3HC3L 3O8XB 1NGWA 3OB0H 2A9NH 4LPUA 3QHFH 2GJ6E 2J12B 4G6JL 4GAFB 4Z8FL 4JR9H 1NGYB 5I1IL 3VG9C 3VXMA 3LKRA 4EDWL 3UZEA 3C08H 3HE6D 3TBYB 3ARGC 1ACZA 5I1LB 4OV6F 5IR1B 1B0WA 5CJQL 4JG1L 4PJFE 1UENA 2R23A 2CK0L 4WU5A 1RURH 4LFHD 5ALCL 4XCEA 2BVQB 3D25B 4LLDA 1S5HA 2UWEB 5HHVH 3S88H 1NDGA 4UILL 2O61A 3FCTA 4OCWL 4QNPE 5L0QB 4JFHD 3C2AH 2ZUXA 2OJEA 1FRGH 1UWXK 2EZ0D 2AQ2A 4R4FL 2BSED 2GUOA 3BN3B 3ARSA 4U6HA 4V1DE 2I5YH 1J8HE 1P5VA 4WWKD 5DXWA 4ZTOH 2B1AL 4PS4H 3BEVB 5ICXA 1NBQA 1CR9L 3AY4C 3WXVL 2J7LA 2F58L 3KNBA 2VXVL 2Z4QB 1IL1A 5TE4H 4HJJH 3QP3A 3U36A 3IKCB 4KU1A 5KOMC 1FHGA 1JTOA 1PYWB 2OK0H 1VFOA 2XZQL 3OAZK 4MDIB 1PEWA 5ID1B 5CKAA 4GQPH 3BGAA 3MRCA 3BZFB 3P0VL 3BMVA 2QQQA 4TSCL 1IBGH 3NPSB 1G9EA 4QCIB 1CICB 5FK9A 5HHOE 4NC0B 2L7JA 1LWRA 4F3FB 4OLZL 4S1DD 3S36L 1P1ZB 4PJCA 1PVHA 4L3EB 1OAUH 4Q6IA 3V4VH 3S5LA 1N6UA 3MNWA 4L8DB 1MCPL 1C08B 5A2LH 3I84A 2X4OA 4NDMA 4MSWA 3VWKB 4IHOA 3SEPA 4ZS6D 3RGVB 4LEOB 1RIUH 1C8PA 4PJ8D 4N0UE 1OSZA 1YNKH 3QO0B 4Y2OA 2ZCKL 4KJPC 4LQFH 3DIFA 3LKQA 3QUML 3SHSA 3VGDA 4XPAL 4YUEL 5C6TH 5E8DH 3ES6B 3FHAA 4OGYH 4PJIB 3KPPB 4JRYE 5IG7A 4J3XA 1G6VK 4G5ZL 2XKNA 4K3HA 3OKOA 1AE6H 3WIHA 3PDOA 4P2QE 2P24A 3MGTA 2EE6A 3NCJH 4ODSL 4BFIB 4KJYB 2EYTA 3G6AB 3WL9A 1WK0A 5BS0E 3VFSA 2IPTL 3T1WA 4O2FA 4GG8A 4S10A 3ZKND 1I4FB 3KXFA 4X0KB 4YIQB 5C0IA 4HS3A 1BMGA 5F7FA 1DZBA 3WHE1 1PSKL 4Z0XB 4X6BB 5CJOL 3X14A 1MWAA 4URTB 5KS9F 3N85L 2B0SL 3MC0A 5D7SH 4ERSH 3AFLA 3QUMB 3BP4A 1J1PL 5C0DB 1JFQL 1BQUA 1KV3A 2A2QT 4N5ED 5CMAA 5BQ7A 4K7PL 4Y19B 4OZIA 1YEEH 1UEMA 2KKQA 3ULVH 3STLB 1NJ9A 1PX3A 2Y6SC 1GC1H 1YQVL 1IRAY 5AAWA 4WI6A 5JORB 2DQEL 3QFJE 4OCYH 5IVXF 1HWHB 4PJ5A 1R3KB 2VDNL 4TRPL 5C7XH 2VE6B 3PWJA 1J87A 4JPWL 1RAMA 5KOVC 5D1QC 1T7YA 3TO2A 4W70A 4GRLD 5LGJB 2R4SH 3QH3A 3FQXB 3H2WA 4R2GC 2D4FA 1R3IL 3P0GB 4M7ZC 3D85B 2YEZA 4OGAC 2Q8AH 3VMOA 3PGCB 2H6PB 3LHPL 1XIWB 2X70B 2E3VA 4PJXA 1D9KC 2FHFA 2RCSL 3DVNB 4HZLB 4ODTH 3VXUD 1L6XA 3C5JA 4UV4L 4ZUUB 5B38A 4G7VH 4PJGF 4PREB 3RBGA 4ZD3H 3TP4A 2NY1D 1LO0L 4QT5A 4W4NA 4KAQH 3VFGL 1NGPH 3L3JA 4MZ2A 1QFWI 3X17A 1HIMH 1MAKA 1S7QB 3TNMA 4CBPA 4YGVB 3UTTE 5FB8B 1JK8A 5I74B 3ZDYF 1ND0A 3B2UD 2H3NB 5IHUL 3ULUE 3GMMA 2M26A 4JRYB 2H9GB 4JFDE 1QLEH 3C6LC 4Y8AA 4P46B 4QRUA 5AWNH 4NPYA 1I8LA 1RUPH 4P5TD 3OJDB 3CFCH 1JNLL 4WUUD 1ZGLM 5HSFA 4G6FB 3DO7A 1IGYA 3QI9A 1CT8B 1ITCA 3TNNA 4G6AC 1GSMA 1DBJH 1R3JB 2EDBA 2Z8RA 3GSRA 4R97B 5E9DD 5IOPA 2NY5H 2CO6B 1NSNH 3AU1A 2DQIL 5AD0A 3KPSD 2J88H 3QDJD 3BGMA 4V2BA 4OQ1A 5T1DH 3O9WD 2HYMA 1YUHB 4P3WA 3R8QA 2BVOA 2WUBL 3CXDH 1NMBH 1NFIA 3NCYP 4LEXL 1Q9WB 5GGUB 5JDSB 1NCDL 2BMKA 3CFEA 3V0WH 1E6JH 1F3DH 2DWDB 3BJLA 3VG9B 5T3XD 4OCMC 1MCHA 4X6CE 5KN5B 4MA1C 3MLWL 1AO7D 43CAA 3QDGD 1FH5H 3BQUC 4GMSL 3MA7B 4S1SL 1NCAL 1UJTA 5FDYA 1CDIA 2F5BL 3VXPA 5I19H 4OD3H 3PQYA 4N68A 2ERJC 3HC0A 3K4DA 3PWLA 2DQJL 4UMGA 5ANMA 1GGYA 1EPFA 4YZFE 3HZYB 5DT1H 3BDYH 3BEVA 5EOCJ 2JKXA 4Y1AD 4I77L 1S9WA 4JJHA 1CS6A 1M7DA 3AM8C 2IALA 2VLJB 5HHMB 3O2VH 2HJFA 3VGAC 5J6HB 5D9SA 4PRPB 1KJVB 4D9RE 1HHJB 1XZ0B 2H32H 2E8ZA 1NGXB 3ARRA 4LCIL 4FQHB 4KDTA 2BY2A 3MACH 3GNML 2EXWC 5I76A 1DBAH 2HRPL 3NZ8A 1X5JA 1P7KB 5DMKA 1CICA 4QRRE 3UTTB 2R4RH 1MCJA 4Z6AT 3VFPB 3H42L 5T3ZE 1YEJH 3UTSA 1NGQL 4XVSL 3DLQR 3DROB 1NEZB 4TNVF 4CDGC 4XC1H 1JPSL 1WEJL 4L4TD 1S9YB 2UWEF 4YQXH 4NZUH 2R0KL 5JHDD 2JIXA 5IBLC 4YHKH 4J3OC 1K4DB 1BFSA 4ZAKD 4YPJA 4DTGH 4GLRH 2X05A 4YPGB 4JY6B 2UZXB 5E2VH 5L2KD 1CD8A 5J0BA 3QWOA 1FFRA 2CDFB 2I9TA 5IV2A 4UOJA 4F7PA 4X8JB 5KSBB 4L4VD 4DQOH 3FB8B 1U92A 4L1DA 1RJYB 3MNZA 3MCKB 4U6VH 3BPNC 1A21A 1RHHB 2V17L 4YIQA 3VXQB 3MXWH 2JELL 5HDQH 2Z0BA 2D31B 2OL3H 3TA3C 5F89B 2R56L 3WJJA 4QYOA 3Q48A 1H5BA 4LBEB 1A6WH 4P59H 3RWHA 3QUMA 2XWBB 4P23C 1V3KA 5J1SC 2IF7A 5KJRL 3GI9H 1VEOA 2AJXH 2EIBA 3BZEA 4LSUL 5IB3A 5SWZD 1KPRB 3QIWC 5IVZA 3ILPB 3I50L 4QKXB 1VPOH 4PJIF 2EIDA 4M6OL 5K9KB 5KVDH 4HJ0C 3S37X 2CXKA 2E27L 3BH9B 4P9HL 3LQAL 4LVEA 1OLLA 2EDEA 1TZHA 3AB0B 4PV9B 1ZA3B 3S34L 4K8RC 5D1QB 4NC2B 3L3DA 3WFCL 5EBMA 5HDOA 1H3WM 1S9VB 1Q9KA 2VRAA 4R2GB 4M7ZB 3UZVB 4PG9B 3IU3B 1E4KC 1U6AH 1CZ8H 2ZSVB 1SEBB 2X1WL 1JUFB 2BHUA 3B9AA 5IEKB 3EOBB 1D9KB 4NNYB 3I6LE 1A7OL 5EG6C 2WBJA 4HD9A 1TJGL 4HUVA 1MIML 2F54A 4OCRL 2X4NB 5C8JB 4PB0H 1J7VR 5SWSA 1OSPH 2ESVE 2XWTB 5BV7L 4HT1L 1AI1H 2BNRE 1OW0C 1DBML 1OPGL 3DRTA 5DYOA 1I7RA 4Y4HA 3Q5TA 3N1PC 2BXYA 1NL0L 2J4WH 2DQTL 2V5RA 2DBJA 3AAZB 4CN4A 4RQQA 3BAEL 5CSBA 3DI2B 4H25B 3C5SB 1IM3B 4NZRH 1QR1B 3GDBA 3JTSB 5F3HB 1MCNA 1ZHBA 2YPLE 1HWGB 3MNVA 4XPTH 4XXCA 1AGDB 4IRJC 5B3JF 1I3UA 4GW5B 3MLUH 3CVHL 5F7KC 3BKCL 4JDTL 2BRRH 4OFYA 2E5EA 2H2PD 1RZKH 1XGQA 2N56A 1FZJA 4LF3B 3MV11 2VDMH 3QUYB 4LLQA 1A47A 2XN9A 3EW3B 5GGUA 1T4KA 2I60L 5C0AE 2GTZA 1JGLL 4UTAL 4XMKH 5BW7A 4Z7UE 1QO3B 2L7UA 4JZOB 2AV1B 3I6GB 3OPZL 1OCWL 3FT4A 2PETA 5EU6D 1IKNA 4ENEC 2EICA 2CO7B 4B53A 1UWEH 1M7IA 5F7YC 2Q6WB 4MA1B 1B2WH 1AC0A 3GO1L 4NQDA 4Z7OF 2AJUH 1U3HA 2VAAA 3BQUB 5EUKB 4N8CL 1NBVL 3FB6B 1ZOXA 5TF1L 2CKBL 1VADA 4DZ8B 2V2TB 1J0YA 3CLEL 2ERJB 5C07E 4YHOH 1DDHB 2DM2A 3QXTA 1Q9LB 2PW1A 2Y36H 1GH7A 2VLJA 3MCLL 1I8KA 3EGSA 3KS0J 2JJVA 1YEDB 4WFFE 4U4BA 3LKSA 4GW1B 1E4XI 2F5AL 2C3WA 3HG1D 5DJ2B 4DEPC 4AIOA 1OTTC 4DGVL 5D7LB 4PIRF 1LP9E 2FJHA 4K2UH 1VCAA 2VABA 4KUZH 4HZAA 1NGXA 4NQCD 5J11C 4FQHA 3OKYA 3RHWF 2ARJB 1DL7L 3VGAB 3U1SH 4NBXB 4K9EH 1RUML 3BGFC 4GQ9L 4DKEH 1T20B 1WZ1H 5GS1A 1XF1A 5JLZB 4G7YH 4TUOA 4NKQB 1QUNA 2GITB 1IAMA 3O2WL 1LK3L 2CKBB 1OAKH 5DMGC 8FABB 1CGUA 4Q9RL 2Q7YB 4XAKD 4NHUB 2P42B