2ND1A

Solution nmr structures of brd4 et domain in complex with nsd3_3 peptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Structural Mechanism of Transcriptional Regulator NSD3 Recognition by the ET Domain of BRD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17035 BET Bromodomain extra-terminal - transcription regulation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.220 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 2nd1A01
2JNSA 2ND0A 2NCZA 2N3KA 2ND1A
chains in the Genus database with same CATH superfamily
3HAJA 4AZBA 2YIVX 4NPHA 4H6HA 4F01A 1DKXA 4BNEA 3ERCC 4R5KA 3KAWA 2V0OA 1HXKA 1TQTA 2GAFD 4AZ5A 1R34A 3L3OM 1I4LA 2Z8YA 3I01A 1QX1A 4JWCA 4FZOA 3BVXA 1TQVA 4I1QA 3HAHA 2X3XA 3BLBA 1TQSA 4EZRA 4JWIA 1E2UA 3I2WA 1O7DC 2QKWA 3B52X 3UITA 1SUFA 4AZIA 1I4DA 2F18A 2NCZA 3O3MB 2EWFA 3ER8C 3EJSA 2QXLA 5FIGA 2X5CA 1SU7A 1U00A 2X3WA 2D1LA 1X04A 3ABHA 3CZNA 4AZGA 4AZCA 3BUIA 3O3NB 3DX4A 4JNFA 3LVTA 2ELBA 3RPMA 4EZWA 2OW7A 4JLCA 1MJGA 3EJUA 4JN4A 2OBMA 3A98A 1SU8A 2F7PA 2KHOA 3G9GA 2YI9A 4IM0A 3VKHA 3PLTA 3ER9B 1TQUA 3Q84A 3QWEA 3D2EA 4HR1B 3DPOA 4AVMA 2F1BA 2D4CA 4NQIA 4EZXA 3DDFA 2YKTA 4IWPA 3CV5A 3DX1A 3DX3A 1ZYLA 3C7NA 3T46A 4R5GA 3BUQA 2RAJA 3GI7A 2YL6A 2F7QA 3B51X 4EZOA 2LM0A 3KAVA 2WINM 2Z0VA 3M3WA 3DX0A 4NSWA 4AZHA 2YL5A 2ND1A 3O3OB 1O7DB 4D8JA 3VEBA 3T48A 3T4AG 4AZCB 4KIKA 1Y2OA 4EZZA 1HTYA 3CKDA 2FYVA 2C08A 4FZPA 3BVUA 4EZNA 1R5EA 3QE6A 4HYBA 4AZ7A 4IM2A 2OBLA 2OW6A 3DYTA 3DDGA 4M0MA 1URUA 4H6IA 1OA0A 1I49A 4HY9A 3CZSA 4IWOA 2ND0A 1QWUA 4ATMA 1LQ7A 4FM3A 4EZYA 4JNEA 4IW0A 2ALWA 2QFFA 4G6QA 4EZVA 1DKZA 3EJRA 2O0I1 3RV0A 1R33A 2OO2A 3D51A 1OA1A 4EZUA 2WYIA 3OHXM 4IM3A 3OWGA 3ZEDA 2OZNB 3VEAA 4R5LA 4JWDA 2N3KA 1GN9A 3EJQA 4WPEA 3DPQA 2JNSA 2F7RA 2YL8A 2Z0NA 2GA9D 2GF4A 3T49A 2YLLA 1ZWWA 3BUDA 2X3VA 3T47A 2ZXQA 3D4ZA 4DYLA 2Z0OA 2F7OA 4UDYX 1X03A 3LMFA 3BVVA 2RAKA 3ACOA 1GNLA 4EZTA 3L3PA 3QNIA 5KBPA 4R5JA 2EX3B 4H8SA 2FICA 4R5IA 2RT6A 2YI8A 2F1AA 3DPPA 4E81A 3D50A 1UPXA 5TKYA 5C5BA 4HR1A 3F7WA 2YIAA 1I4TA 3BVTA 1GNTA 2YL9A 1DKYA 2Q13A 3CAZA 3D2FA 4UDXX 4JWEA 4DCNC 2PMRA 2RAIA 2EFLA 1PS3A 1YWMA 2PY6A 3OK8A 5E84A 4E3CA 2WYHA 3EJPA 4AZ6A 3QNJA 3BVWA 1E1DA 4AKVA 3D4YA 1WDZA 2YLAA 3LLLA 3DX2A 4WPCA 2MI7A 2Q12A 1SU6A 4F00A 3RV1A 3QA8A 4PO2A 1QWNA 1W9MA 3BUBA 1HWWA 3HAIA 1JQKA 4B9QA 3FD9A 1TQWA 2LXYA 3CVRA 3BUPA 1E9VA 2EFKA 3SOGA 3Q0KA 4KIKB 5FLEX 3I39X 3B53X 4EZPA 4EZSA 3SYVA 2JNKA 4EZQA 3D52A 5C5BB 3EJTA 4FZSA 1OAOA 3KDRA 4IWQA 4JL9A 3I04A 2YIBA
chains in the Genus database with same CATH topology
2KHOA 4FM3A 4HR1A 4EZYA 4JNEA 3F7WA 2YIAA 4IW0A 2YIVX 2YI9A 2QFFA 4IM0A 4H6HA 4NPHA 4F01A 4G6QA 1DKXA 4EZVA 1DKZA 3VKHA 1GNTA 3ERCC 4R5KA 3KAWA 1DKYA 3ER9B 3D2FA 4HR1B 3D2EA 4JWEA 4UDXX 3RV0A 2GAFD 3DPOA 2PY6A 3L3OM 2Z8YA 1OA1A 3I01A 4E3CA 5E84A 4EZUA 3OHXM 4IM3A 4EZXA 3QNJA 4JWCA 4IWPA 3OWGA 1ZYLA 3ZEDA 4EZRA 3C7NA 1E1DA 3T46A 4JWIA 4R5GA 1E2UA 3GI7A 3VEAA 4R5LA 4JWDA 2N3KA 3B51X 3B52X 3UITA 4EZOA 2LM0A 1SUFA 3KAVA 2WINM 1GN9A 3DPQA 2JNSA 1SU6A 2NCZA 4F00A 3RV1A 3O3MB 2EWFA 2ND1A 3ER8C 3O3OB 2GA9D 4D8JA 3QA8A 3VEBA 4PO2A 3T48A 3T4AG 1W9MA 3T49A 4KIKA 3T47A 1JQKA 2QXLA 5FIGA 4B9QA 4EZZA 3FD9A 2X5CA 1SU7A 1U00A 4UDYX 3LMFA 1E9VA 1GNLA 4KIKB 3O3NB 3I39X 4JNFA 5FLEX 4EZTA 3B53X 4EZPA 4EZSA 4EZNA 4HYBA 4R5JA 4IM2A 2OBLA 2EX3B 4EZQA 4EZWA 4R5IA 2RT6A 4M0MA 2YI8A 4H6IA 1OA0A 1OAOA 4HY9A 3DPPA 3KDRA 4IWQA 4JLCA 4IWOA 4JL9A 2ND0A 4E81A 1MJGA 3I04A 4JN4A 2OBMA 2YIBA 3A98A 1UPXA 1SU8A 5TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNS A;  2ND0 A;  2NCZ A;  2N3K A;  2ND1 A; 
#chains in the Genus database with same CATH topology
 3HAJ A;  4AZB A;  2YIV X;  4NPH A;  4H6H A;  4F01 A;  1DKX A;  4BNE A;  3ERC C;  4R5K A;  3KAW A;  2V0O A;  1HXK A;  1TQT A;  2GAF D;  4AZ5 A;  1R34 A;  3L3O M;  1I4L A;  2Z8Y A;  3I01 A;  1QX1 A;  4JWC A;  4FZO A;  3BVX A;  1TQV A;  4I1Q A;  3HAH A;  2X3X A;  3BLB A;  1TQS A;  4EZR A;  4JWI A;  1E2U A;  3I2W A;  1O7D C;  2QKW A;  3B52 X;  3UIT A;  1SUF A;  4AZI A;  1I4D A;  2F18 A;  2NCZ A;  3O3M B;  2EWF A;  3ER8 C;  3EJS A;  2QXL A;  5FIG A;  2X5C A;  1SU7 A;  1U00 A;  2X3W A;  2D1L A;  1X04 A;  3ABH A;  3CZN A;  4AZG A;  4AZC A;  3BUI A;  3O3N B;  3DX4 A;  4JNF A;  3LVT A;  2ELB A;  3RPM A;  4EZW A;  2OW7 A;  4JLC A;  1MJG A;  3EJU A;  4JN4 A;  2OBM A;  3A98 A;  1SU8 A;  2F7P A;  2KHO A;  3G9G A;  2YI9 A;  4IM0 A;  3VKH A;  3PLT A;  3ER9 B;  1TQU A;  3Q84 A;  3QWE A;  3D2E A;  4HR1 B;  3DPO A;  4AVM A;  2F1B A;  2D4C A;  4NQI A;  4EZX A;  3DDF A;  2YKT A;  4IWP A;  3CV5 A;  3DX1 A;  3DX3 A;  1ZYL A;  3C7N A;  3T46 A;  4R5G A;  3BUQ A;  2RAJ A;  3GI7 A;  2YL6 A;  2F7Q A;  3B51 X;  4EZO A;  2LM0 A;  3KAV A;  2WIN M;  2Z0V A;  3M3W A;  3DX0 A;  4NSW A;  4AZH A;  2YL5 A;  2ND1 A;  3O3O B;  1O7D B;  4D8J A;  3VEB A;  3T48 A;  3T4A G;  4AZC B;  4KIK A;  1Y2O A;  4EZZ A;  1HTY A;  3CKD A;  2FYV A;  2C08 A;  4FZP A;  3BVU A;  4EZN A;  1R5E A;  3QE6 A;  4HYB A;  4AZ7 A;  4IM2 A;  2OBL A;  2OW6 A;  3DYT A;  3DDG A;  4M0M A;  1URU A;  4H6I A;  1OA0 A;  1I49 A;  4HY9 A;  3CZS A;  4IWO A;  2ND0 A;  1QWU A;  4ATM A;  1LQ7 A;  4FM3 A;  4EZY A;  4JNE A;  4IW0 A;  2ALW A;  2QFF A;  4G6Q A;  4EZV A;  1DKZ A;  3EJR A;  2O0I 1;  3RV0 A;  1R33 A;  2OO2 A;  3D51 A;  1OA1 A;  4EZU A;  2WYI A;  3OHX M;  4IM3 A;  3OWG A;  3ZED A;  2OZN B;  3VEA A;  4R5L A;  4JWD A;  2N3K A;  1GN9 A;  3EJQ A;  4WPE A;  3DPQ A;  2JNS A;  2F7R A;  2YL8 A;  2Z0N A;  2GA9 D;  2GF4 A;  3T49 A;  2YLL A;  1ZWW A;  3BUD A;  2X3V A;  3T47 A;  2ZXQ A;  3D4Z A;  4DYL A;  2Z0O A;  2F7O A;  4UDY X;  1X03 A;  3LMF A;  3BVV A;  2RAK A;  3ACO A;  1GNL A;  4EZT A;  3L3P A;  3QNI A;  5KBP A;  4R5J A;  2EX3 B;  4H8S A;  2FIC A;  4R5I A;  2RT6 A;  2YI8 A;  2F1A A;  3DPP A;  4E81 A;  3D50 A;  1UPX A;  5TKY A;  5C5B A;  4HR1 A;  3F7W A;  2YIA A;  1I4T A;  3BVT A;  1GNT A;  2YL9 A;  1DKY A;  2Q13 A;  3CAZ A;  3D2F A;  4UDX X;  4JWE A;  4DCN C;  2PMR A;  2RAI A;  2EFL A;  1PS3 A;  1YWM A;  2PY6 A;  3OK8 A;  5E84 A;  4E3C A;  2WYH A;  3EJP A;  4AZ6 A;  3QNJ A;  3BVW A;  1E1D A;  4AKV A;  3D4Y A;  1WDZ A;  2YLA A;  3LLL A;  3DX2 A;  4WPC A;  2MI7 A;  2Q12 A;  1SU6 A;  4F00 A;  3RV1 A;  3QA8 A;  4PO2 A;  1QWN A;  1W9M A;  3BUB A;  1HWW A;  3HAI A;  1JQK A;  4B9Q A;  3FD9 A;  1TQW A;  2LXY A;  3CVR A;  3BUP A;  1E9V A;  2EFK A;  3SOG A;  3Q0K A;  4KIK B;  5FLE X;  3I39 X;  3B53 X;  4EZP A;  4EZS A;  3SYV A;  2JNK A;  4EZQ A;  3D52 A;  5C5B B;  3EJT A;  4FZS A;  1OAO A;  3KDR A;  4IWQ A;  4JL9 A;  3I04 A;  2YIB A; 
#chains in the Genus database with same CATH homology
 2KHO A;  4FM3 A;  4HR1 A;  4EZY A;  4JNE A;  3F7W A;  2YIA A;  4IW0 A;  2YIV X;  2YI9 A;  2QFF A;  4IM0 A;  4H6H A;  4NPH A;  4F01 A;  4G6Q A;  1DKX A;  4EZV A;  1DKZ A;  3VKH A;  1GNT A;  3ERC C;  4R5K A;  3KAW A;  1DKY A;  3ER9 B;  3D2F A;  4HR1 B;  3D2E A;  4JWE A;  4UDX X;  3RV0 A;  2GAF D;  3DPO A;  2PY6 A;  3L3O M;  2Z8Y A;  1OA1 A;  3I01 A;  4E3C A;  5E84 A;  4EZU A;  3OHX M;  4IM3 A;  4EZX A;  3QNJ A;  4JWC A;  4IWP A;  3OWG A;  1ZYL A;  3ZED A;  4EZR A;  3C7N A;  1E1D A;  3T46 A;  4JWI A;  4R5G A;  1E2U A;  3GI7 A;  3VEA A;  4R5L A;  4JWD A;  2N3K A;  3B51 X;  3B52 X;  3UIT A;  4EZO A;  2LM0 A;  1SUF A;  3KAV A;  2WIN M;  1GN9 A;  3DPQ A;  2JNS A;  1SU6 A;  2NCZ A;  4F00 A;  3RV1 A;  3O3M B;  2EWF A;  2ND1 A;  3ER8 C;  3O3O B;  2GA9 D;  4D8J A;  3QA8 A;  3VEB A;  4PO2 A;  3T48 A;  3T4A G;  1W9M A;  3T49 A;  4KIK A;  3T47 A;  1JQK A;  2QXL A;  5FIG A;  4B9Q A;  4EZZ A;  3FD9 A;  2X5C A;  1SU7 A;  1U00 A;  4UDY X;  3LMF A;  1E9V A;  1GNL A;  4KIK B;  3O3N B;  3I39 X;  4JNF A;  5FLE X;  4EZT A;  3B53 X;  4EZP A;  4EZS A;  4EZN A;  4HYB A;  4R5J A;  4IM2 A;  2OBL A;  2EX3 B;  4EZQ A;  4EZW A;  4R5I A;  2RT6 A;  4M0M A;  2YI8 A;  4H6I A;  1OA0 A;  1OAO A;  4HY9 A;  3DPP A;  3KDR A;  4IWQ A;  4JLC A;  4IWO A;  4JL9 A;  2ND0 A;  4E81 A;  1MJG A;  3I04 A;  4JN4 A;  2OBM A;  2YIB A;  3A98 A;  1UPX A;  1SU8 A;  5TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...