2NDFA

Solution nmr structures of af9 yeats domain in complex with histon h3 acetylation at k18
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
141
structure length
141
Chain Sequence
GSHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Histone Crotonyl-Lysine Recognition by the AF9 YEATS Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein AF-9
total genus 22
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ndfA00
5HJBA 3QRLA 5IQLA 3FK3A 4TMPA 5HJDA 2NDFA 5IOKA 2L7EA 2NDGA 5D7EA 3RLSA
chains in the Genus database with same CATH superfamily
1CU4H 1U8KB 1INQA 1AS7A 4M29A 1YEFH 4AM0Q 5DHDA 2VDMH 3D3VA 4PMEA 3RUGA 3UZEA 1OGAA 4IYKA 1JPTH 4JY6B 1KMGA 1DUZA 2C1PB 3HC0A 2IQ9L 32C2B 2NY4D 1AIFB 4HJGB 5KVDE 3VTAA 2AV1B 4LASL 4OBSA 4A66A 4BHUA 1RK1B 3RTQA 5C0EA 1MCBA 1E6OL 3WEAA 4U1SA 2X4QA 3SDDA 4MNGA 1FUNA 4HQQL 5CMAA 5E1AB 3QUXA 4EI5D 4XXWC 3HNSL 1I7UA 3BAEH 1PY9A 1OAUH 5I2IB 2A6DB 4TMPA 1OP5K 4GUOA 1U8NB 3KL3A 3WO4C 4Q6KA 4MJIE 2H6UA 3U6XA 1OZTG 2CGRL 3B8SA 2EXWC 3ZL2A 3OJDB 1OAKH 2DW5A 1DUYB 1KJMA 3HKZA 3Q8EA 1U58B 4L8SB 1CUOA 1HIMH 2R1YB 3CQPA 3NGBC 4M1DH 1D9KD 1UD8A 2PW2B 2C3HA 1GJUA 1J10A 3EIFA 4ZUSA 3CVHH 2WK2A 3R8BB 4L4TD 4F33B 2DQ6A 2IXQA 3NZHH 3P3UA 4YXLL 4L0ZA 1F4YL 1YNTB 3FYIB 3IJHA 1UZGA 3JT2A 3P2TA 3VFWA 4IRZA 3VTTA 3KLAB 4XTRD 3VXRA 4HPOL 1MAKA 1ZVHA 2Q10A 3VTMA 3P73A 2K4AA 4A63A 4NCC2 2L7QA 5A3IC 1MI5E 3TXAA 3BWAA 5K39B 3DOSA 3EFOA 4JJHA 1GZPB 4PGEB 5MENB 5B1JC 1SMOA 1PG7X 2A74C 1Q9KA 1MJ7H 2HG5B 3B2VH 1N0LA 3MZTA 3WL9B 5IM7B 5J13B 1BOGB 3K6SA 4H8QA 4GRWH 4IRSB 4TQ8A 3WDHA 4Y19D 5E2TH 2YQGA 4LOFA 5BRZA 1DQLL 3D85B 1WBYA 4Y2OA 4AITA 3T77B 3VXSE 5H35B 4GXVH 3OAZH 1R3IL 2A9CA 5GRJL 4Y16A 5FUCE 3P9LB 4OZFG 5IMOA 5DDHB 4FQLL 1J8HE 3Q8FA 4OQTH 4EUPA 4BFIA 2DLEA 3D69B 3RWFA 2X09A 3MBXH 3S8FB 4Y2LA 4MFHA 4UQBA 4QY8A 1EO8L 2DQFA 4U6XA 5KWYC 1SY6H 1CD8A 3DX7A 3TH3T 1MH5A 3GSXB 3FZUC 2C9QA 3L4UA 5LGJA 1MW2A 3ZMNA 1CXLA 4ZS6C 5IK3B 5I1AB 4OCXH 1WA1X 2MQCA 1J5HA 2I9LB 4NKMA 1MFDH 1NC4B 3GJEB 3H6JA 3TBWB 1E9QA 1T0OA 4I13B 4GEJA 4H8HA 4U3XA 4DN3L 4YWGL 3VDCA 1ZGLB 4YC2B 1UM4H 4WVRA 3ZTNH 3QDJB 4H8UA 4C56A 1WBXA 2R59A 1ED3B 5T1KD 1JOIA 3ABKB 1QD0A 1NFIA 2CSPA 2E7BA 5JW4Q 1I7UB 2H9GB 3U9PH 3LKSB 2FDBP 1T5XB 2Z8WC 1SXNA 3QUML 5E9DB 2DTMH 5C0CB 4JRYB 2IBZY 2BW5A 4ZK8A 3ZJAA 5C0CE 4M93B 2B3RA 4OJEH 3CDYA 4LGPB 3MA7B 3OMZA 5C09D 4ZXBB 1T5WB 4XCEB 4QRRA 5E94B 1X5LA 4LCWD 1MIMH 5CJBA 4BSWB 1OKEA 3T4AA 2FX7H 1X5IA 5B38A 4P2AA 2XZCH 3UXFA 1WWWX 5AOLA 1QNIA 5JOEA 3LAFA 2VIRB 1A1OB 1JTTA 4R90H 3O2WH 4Q0XH 5K39A 2B14A 2XDHA 5CILL 4ZUSB 4KQ3H 1KFAH 2H41A 3CZEA 3PGCA 4JFPB 1NOAA 3TBYA 5JMOC 1FVDA 3FQRA 1P5VA 4EZJA 2E6QA 4OGZA 2V5YA 2ENYA 3OPZH 4NO0D 3FOMA 2CHXA 2ED7A 4IBZA 5FHAL 5LNGA 2VQ1A 2Y5EA 1KTDB 3NJIA 1G9NH 1NOFA 5AYTA 2BNQA 3LZOA 3S34H 2AQQA 4Y4FC 3SDDB 1B88A 4MGXA 2VZTA 5T3XE 3PJNA 5D4QA 1E5ZA 4HH8A 2QPEB 4JFEE 5GSVB 3VD2A 4OCSL 1WTLA 2M83A 4ZPVA 1U6AH 5KG9A 4P9HL 1KYOK 5AKSA 3VO0A 2JKJA 1N2RB 3SO3B 3WIHH 1EH9A 5H37H 1UUNA 1T3FB 3RWCA 1OE3A 3KW7A 4Y5VA 4B9ZA 4PTUA 3Q6GH 3UADA 2WYIA 1DVYA 2ZF9A 1DVFB 1AIFA 1NFDF 4HJGA 3TFKC 4EBQH 1NDMA 1QFOA 2NT1A 3V5DB 1ZSDA 2NOYA 5LCVL 5SWSE 4E9LA 3U83A 1GKOA 1TTCA 2V5MA 4R0LC 3VFMA 5AL0A 3RUGB 5I15L 2YIHA 4FNRA 2A74A 3T2LA 2EILB 3D50A 1T1XA 3GXUB 5E8NB 5HHMD 5KBDA 2UVEA 2ZX8A 3R4RA 1WO2A 4KJQD 5EWIL 1BAFL 3EJJX 1IGCL 3MV01 4LSQL 1BCIA 4L8CA 2ADFL 2YD8A 1L9SA 2NQDA 1I8MA 1QG3A 4L37A 2IV8A 4PR5B 2GI7A 1OF2A 2F18A 3EJCA 1BXXA 1J9SA 1FBIL 2RCSH 3IDJA 2XOTA 3MO1B 4K8RC 1Z3GH 1T2JA 1AHWB 4LLWB 5GRXG 2VLME 1G9NL 1E9PA 3FT2B 3ATFA 4XGZA 3FSOA 3BH9B 4UNVA 4PJEF 3RBGA 1RUKL 2X1XR 1XCTA 2R69H 3V8OA 2YN3A 3DVNB 2DBLH 1OAZL 3O11B 2XV3A 5IW6B 3HNTL 4IOFD 2CUMA 4OI7A 2XZQH 3LS4H 5AD0B 2X5PA 4FLQA 1KFAL 5CZXC 1XH2A 3VWKB 1NJ9B 4DP4X 2FO1A 2VLRE 3N41F 3IDUA 4MX7B 2EC8A 1S9KC 4NKIL 3QDGA 4G70B 3FU3A 5E08H 5MERA 2EXSA 3QDJA 4G1EA 1ILSA 4P2RD 4DETA 5DVPA 2IH1A 1QLRB 4M5ZH 1NDGB 4LPYA 1F2XK 2WTRB 4KJYA 4NPYB 4ZXBD 1HKLL 4XVTH 3AB0C 3PP3K 1HYSC 3BX7C 3PWUB 3Q3GA 3QEQD 5I6NA 2X6MA 1IL1B 5LGJB 1ZEAH 2OMZA 4F93B 4RQQB 3BCFA 5CWSA 1BG1A 4I5BB 2BFVL 4B9JA 2A38A 4UV7L 4X4YA 1HI6B 2AEPL 2IWKA 4FFWC 4ZUUB 4AVIA 4XX5A 2IH3A 3LKRB 3PDGA 1S5HA 3TV3L 1LNUB 4X80H 2CCVA 4LLQB 3VA2C 1T1YA 4JDVA 3D7PA 2AJUL 4PJGE 4Q56A 4XPHH 1NMCB 4HFUH 3WJLC 2JTDA 4PJ5A 3WMSA 2UZXA 3SDAA 3AU0A 5EU7E 4ZD3L 3UTZA 1L9QA 3VGFA 3B4NA 4OLYH 4BH7B 5ITBL 1FG2A 5GS0D 1FL3B 2P5WB 3NZ8A 1L7TH 4U6TA 4UIMA 3QCUL 1S3RA 1E8XA 2W59A 4YSCA 1SY6L 2PWFA 3CU7A 4WFGE 1F6AB 1NGQH 1HWHB 3QCTL 3MLZL 3WFCL 5C0DB 4GIPD 4OCXL 4HIQA 1IBGH 4HIHB 4NRXA 1Q0EA 2KDGA 3R1GH 3V55A 5CU9A 2ZKWA 3QHFL 5MP6H 4JRXB 3E3QE 4Y19B 3V7AG 2AJ3B 5F7DB 3CDGA 3D4ZA 5L9DL 4MJ2A 5FUOL 3MV9A 4TKWA 3VXOA 4AKOA 2PO6C 4FYRA 3KGSA 4LSSL 1WZ1L 4PY8I 3AS1A 3MRKA 2NT0A 1LO5A 3NCBB 2ZXEB 3RX9A 1S5HB 2EYRB 3HNVH 4JJ5B 2W92A 3QUXC 3MUGA 4P04A 1Q0XH 3LEVH 5IGXH 3U9UB 3H4FA 2VLMD 2TSBA 5DC2A 5TH2A 1VACA 1FNLA 4RMSA 3ZIMA 4HUWA 2AXGB 1YPZB 3H9ZA 3KPMB 1TVBB 3O3DA 3QJXA 4KTGA 3S4SG 3AT0A 4RVBA 1E9OB 5IF0B 2YKLL 5TQ0H 2R4RH 5AOZA 3G6DH 1I7TA 4RAVB 2UWEA 1F6LL 5C6TL 1HXYA 3MV7A 3U82B 4R9HA 2X4PB 4KKZA 3ENEA 4S0SD 3ETBF 3VD5A 3KLSA 4PRDA 2VLRD 3HG1B 4PVMA 2KH2B 3VE0B 3V9FA 4B5EA 3HG4A 2B08A 4LSPL 4M1CD 2VH5L 2WBWB 4KMQA 3UPRB 4HWBA 1RIUL 3LV3B 1GW6A 2Y06L 3AY4C 2XSKA 4B3EA 3UPCA 2PTUA 2NMSA 43CAB 1UT2A 1M2OA 5HYEA 3CBJB 4G6ML 1D7BA 2EDOA 4U4IA 4RRPG 4ZFOL 3MJ9H 1MG3C 3WTTA 3L3IA 2VDPH 4Q6YA 3OXRB 5FPIA 3WE6A 3KL5A 4IOSA 1LDPH 4XMVA 4M03A 3BWUC 3HNSH 3U4EB 4X4YB 2LQRA 3BKJH 4GQRA 2EYSB 2C8NA 5DD0H 1AOZA 5FYJU 3TBVA 2AK1H 1DBJH 3BZ5A 1KCWA 3K46A 4R5TA 5F3HA 3CFEB 3MRMA 1A7PL 5F21B 3VH8A 2MQ0A 1Q8MA 4U1KB 5BW7C 4QGYA 2B15A 3NH7L 4MD5A 3UTTB 3O3AA 3SGKA 5L2KA 2P42B 3BUPA 3VI3B 1NDGA 2FB4L 1FFOB 3INUH 4FYQA 3ZRFC 4XVUD 1QLEB 4FTVE 3WKYA 1A4KB 4HUKB 4O2EA 5I1LA 4ZYKB 1KC5L 4G6KH 4DP8X 4BZ1H 2VLJD 2XTJC 2BHUA 3F05A 3NN8A 4IGBB 4N0UE 2Q86A 4GAAA 3RDTA 1L0YA 4UM8B 3O4OC 4MJIB 5I73B 4Y4FB 4BCXA 4N2AA 4S1QH 2BY2A 5MEND 2ZPKL 3MRLA 4QRRD 4QRUB 4XTRC 5T3XD 2G0LA 3HN3A 2F8OA 5KVFH 4JFWA 4MMXC 1S9VB 3EYSL 3UMTA 1VHPA 1KYDA 5FDWA 1X4XA 3V0VB 5FLUA 3WUWA 2MOVA 3U36B 1CLYH 4CC1A 3KPNA 4G1MB 2KI6A 4PRAB 5DF0A 1A8JH 2EDWA 3V0HA 2Q3ZA 1CLOH 3WGUB 2BC4A 2NLJB 4L4TE 3IS0X 2BSRA 4TQEL 4CILA 1IGJB 3HA0A 2HP4A 3TIDA 3U6XS 1QHOA 2Q2EB 2GJRA 3S96A 2XXMB 2WYTA 3ZKMD 3MFGB 1ZT7B 4GQPH 4HD5A 3O4LA 1ONQB 4PJ5E 3VYPA 4S1SH 2WXMA 5GGUB 4KQ4H 2EH8L 5B1CA 1B0GB 2ITCA 4R4ND 1EZLA 2PP8A 4XN5A 3WYRA 2MTPA 3ZKQD 1T1WA 3JWOH 1YYML 1J18A 2APWA 1R1CA 2FE0A 2NTFB 1UWFA 4WTZA 1BQ5A 4L29B 3VH8G 4M8QA 1YO4A 2VW7A 2BSSB 2WKOA 4JZOA 1KCRL 3TEYA 2H3XC 1VRSA 4BH8B 3C60C 4LVOC 4ODWA 1N7ML 4X8JB 1G5AA 3EOYG 4NAMA 5EOCL 5D9SA 1ND0B 1N4XL 1OGTA 3DIFA 3ILPB 4LLMA 3S2CA 5J1AA 3ARZA 3GUFA 3QIUB 2AABL 2AK4A 1RURL 1REIA 1ZA6A 4QPEA 2EDJA 3TN0C 4QHNB 3GI9L 1UWXH 4QNPF 5TFSL 3PQYE 3CC1A 1HNYA 2C9AA 2IIJA 3KGTA 3HTLX 5AALA 5FYLD 1F18A 1RI8A 4TYUA 2HT4D 4LCCB 4AJ0A 2NYKA 2BP0B 5F6HJ 2VXUH 1MNNA 3FSVA 1ED3A 4IU3B 2JQAA 1YVLA 4BZ1L 2W80C 3UFIA 3H2PA 1ZANL 1IBYA 4OD1L 3ZDZE 3X13A 4D0DA 3NIDF 1T6BX 4JGMA 5KVFE 5EBMB 1IGIL 3UZVB 2WVTA 1G7HA 3ZQ9A 4LCWE 4FAAB 2AANA 3RZCA 4PJ7B 4DKFH 4Z18A 3ZQXA 2GJJA 2ZSVA 4EVNA 1EAPB 5CD3A 5HGAB 1OT2A 5D6CA 2WLIA 4OCRH 3V52L 3K2KA 4YFLI 5DMIL 2BNRE 3HJ0A 4JZJB 1HSAA 4NRZB 3IBEA 4YFDB 5JTWA 1AQDB 2RACA 3LDBC 4Y9GA 1IKOP 3ARGA 3UBXG 1X5ZA 4E42B 1MRFL 4MWFB 3CDCA 4OZIE 2CUAA 3MBWA 2YMXH 3IRCA 4BK4A 5D93B 1IFHH 4RMQA 5FA4A 2XBDA 4M7ZC 4AJYV 1HESA 3WIHA 1W15A 4YL9A 4A2HA 1BQHB 3V79C 4IHOB 4ZUVB 1F4WL 2DMGA 3L48A 3RTQD 1KXQE 2WWMD 3LMJH 4PR5A 2H8PB 4GFXA 4FQ1H 4G9FB 5D6DA 4HLEA 2NPLX 4AC2A 1MQ8A 1IV8A 3QH3A 2ADYA 2WXIA 1A6ZA 4MD0B 1FC1A 2PYED 3VDBA 1MHHA 3X12A 1KY7A 2EO9A 2RH0A 3TOPA 1B9ZA 5I82A 1ZGLA 3GJFK 3S96B 4HH9B 1EZSA 3OJVC 4LARL 2J56A 4MASA 3BAJA 3ZY7A 5JDSB 3V5DA 1T66C 3L5JA 5E8EB 2I32A 5B38G 5C09B 1IGMH 3FT3A 3HLAA 4K9EC 2DM7A 3NPSC 3S5LA 3CC5B 3VQMA 4RCAA 4AQEB 2R1XA 4EKXA 5KVGH 2ZAHA 5I5IA 3TCTA 3RWJA 3FJTA 3U4KA 3RFZA 3WNJA 2RA1A 3D3VE 1LO2H 3QP3A 1HNFA 5IGXL 3KPPB 2EDNA 2I69A 1PJ9A 1KXQA 3OAUL 1KTCA 4HVBA 4XOEA 3V6OE 4PSPA 4CN1A 4YZFF 4KAQL 2XG5B 3QDJD 4K5PA 3L4YA 4KRPD 4YQXH 1IBBA 3RL2A 5JHDB 3KAAA 1S9WA 3BP5A 5CZRA 2PF6A 5JXEC 5I1IH 4JGUA 4XAKE 2E27H 3AWFA 3KVPA 3EYQD 3QUMA 4EJ1C 3I6LE 3Q9QA 1ADQH 4MZ3A 2GABA 3D1MC 4PLKD 4R83A 1AFVH 1JI1A 3AW5A 3QG6A 2EKSA 4JFVA 3RWHB 3UOAB 4Y9CA 2JXMA 3SKNA 4BRJA 1DVFD 3FQWA 4JVUA 9CGTA 4JO8A 2BNUA 3EJUA 1RY7B 3BOVA 4GUPA 1U3ZA 1UB5B 3QORB 5D1QE 2Y06H 3LXAA 3B1TA 3T71A 1U4EA 1CB4A 4FFZA 4M5YL 1H0DA 2MKLC 5DJCB 4X7CC 4I2XE 3QUZD 3T6QC 5C7XL 3U6RB 1T22B 5AZ2H 2WQWA 4NQDA 2X7LA 2SEBA 3DNKA 5KYWA 3KVDD 1U58A 2F54E 2GAZA 1U42A 4L8SA 4N2CA 5EO9A 2Y7LA 3RU8L 3O4LE 4E9SA 5EOQL 3ZHDA 3W5NA 3DC0A 4QTHA 2F74B 3BSZL 5DJAA 1GH7A 5DQDH 5B1BB 1S7SA 1UFUA 4GW4A 3RA7L 3L3OC 3MROA 2APFA 3EH2A 3EJZC 4XCFL 3QIWA 1JRHI 5AAMA 5HTSA 2VN6A 1IZJA 4R7VA 4UIKH 1CXIA 3FO9A 4MNQA 4XWOD 1FSKC 3AFLA 2G4EA 5KBNC 2FD6L 4PJCF 1ZA3A 2UWEF 2VKWA 3NBNA 1R3JB 5CEYB 3LY6A 5GRUL 2ZUVA 3ZHNA 3VG9B 5C0IA 1XIWD 3CVBA 2ZUTA 3Q2CA 5IFAL 1OD9A 4GG6A 3D3VB 3GXMA 4HC1A 4B9GA 4YHKH 1GL4B 5F96L 3CC5A 5B4MD 2VXVH 4WKXA 2WNKA 4NX0A 2B1AL 1LEKB 2XN9A 3MOAL 1J8SA 1IAIL 2VCOA 3SSGA 4XCNB 3FH5A 2P43B 5CN3A 5FO7A 3WFCH 3SKUD 2YEZA 1VGKA 2PLTA 5D72H 3WKPA 5FO2A 3GIVA 4AZUA 2QHRL 3WMQA 3RZCC 1GS8A 1CFSA 2MPVA 3IETA 2Z4QB 3RAJL 4DZ8B 3HS0A 3C09C 1D5ZA 4QLRA 4WWKC 4G59C 4ODXA 1QEWB 4HKZB 5I28A 4CVUA 2XACC 4F24A 2J6WA 3VXMA 3MVSA 3TO2A 2QLYA 1OANA 4ZTOL 3NDZE 2IAMA 3FUIA 2PP9A 3CLFH 5CD5C 5ILTL 1KLUA 4H40A 1AG6A 2AVGA 1KJ3H 1BJMA 1HE8A 5D55A 5I1GL 3L3JB 5IWLC 4DH2A 5HI4D 1TJMA 2DQHL 4ONGL 4MAYD 1WBXB 1GS6X 3SBWA 4J3OH 1NSNL 1O6SA 2FX8H 2YOAA 2ZAGA 4OB5H 2P52A 5ALCL 4YUEL 2CBOA 3N04A 3P73B 1URIA 3SCMB 5IEHA 5CLYA 3NCMA 4E0RA 1B4JH 4DQOH 3VMNA 1DDTA 1QPPA 2WLLA 2IPTL 2OJZH 1RUQH 1WZMA 2BHYA 1Z9NA 2WXLA 2UX7A 4G6JL 4L3EE 1S8DB 2BLFA 3Q6FB 4YHPA 5AZ2L 3L17A 4J4PC 5T5FH 1BQHG 5JW3H 3QI9C 1JF1B 1A7OH 1D5RA 4N86A 5E8OB 2F19H 3T1WA 2YAHA 4LB8A 1YNKH 4PVLA 5D2LB 1I8LA 1VFUA 3QHZL 3L1EA 4Q9QL 5DDHA 4XHJD 5IB1B 1XD0A 4R3SB 1Q0YH 4XMPH 1EGJL 5FCSH 2NXYB 4ZUUA 4NKQB 5HHXH 3KJ4B 3ZT6A 1EDHA 3MRIA 2VDOB 1LWRA 4PY8J 1V3KA 1IE4A 1OQOA 4GRLC 4U0QB 5D71H 4ZUWA 4APQA 4EXPX 4M6OL 3ARSA 1BOYA 3OR7B 5F71A 1MFAL 2A77H 4J3SA 1TYRA 3TIEB 1QRNB 1UM5H 3PU7A 3ZT5A 3II3A 3V4VL 1U92A 2BJML 1ADWA 2JLLA 1FVCA 4D8PB 4DVRL 2EIDA 2VW4A 3GSOA 5TQ2H 1Z3RA 2ATPA 2C9RA 1ES0B 4XCCH 2VMFA 4K2UH 4PRBB 5I1EH 2VL5B 1OY3B 1RV6X 4K9JA 4X4MA 3WFHA 4AQZA 2VDNB 4CC0A 1MDTA 1XF4B 3HAEH 1LP9F 1PG7L 4J3VA 1BYPA 5LO7A 1NIEA 1DDHB 1V7MH 1NCUA 4KKRA 4ZJ9A 3POCA 3HLKA 2F53E 1BAFH 2Q76B 2MMXA 1NFKA 1OXYA 1QO3B 3FU6A 3JV6A 3I6GB 3QEHA 3NJNA 1G7JB 4W4OC 2CJUL 2IQAB 4KJQC 2Y25A 1MCCA 3JSSA 1MVYA 4N8UA 4HAKA 2H1PL 2CUHA 4JFZL 5EEWA 1QBMH 4XNZB 4XPTL 1NH6A 2HX8A 2E9GA 3T9WA 4Z7WF 1HZKA 3CD4A 2VC2L 3ZR6A 4N2MA 2ICEB 3MGOB 1OSZB 3NFNB 3OXRA 5DK2B 2VDNL 4Q7DA 3W9EA 5ILTH 2WYHA 5ICYA 4FQ1L 1ZGLM 3EO9L 1K8IA 4OZFA 4PB0H 2PW1A 5I6MA 4QHUB 4FLHA 3BIAX 3BP6B 4BKLB 3DIFB 4LLMB 3FOLA 1ITBB 3O45B 4N5UA 3H2QA 3OSKA 3EXJA 1F4WH 5D71L 1UJ3A 4AE0A 2P9RA 1A1NB 2X4TB 3OKOA 4OCSH 5DD6B 2WM0A 2HVJA 2G5BA 4NQCA 4X4ME 5EOTA 4JKMA 1PX8A 4HXAH 1LQBC 3L3KA 1GKEA 3H53A 3LVEA 1FLRH 4UZGA 3PIQB 3D06A 4I77H 1FAKT 4U1GC 5BV7L 5DUBB 1ICTA 2VDLB 2B1AH 3KLKA 2PR9A 1ADQL 4U2ZA 2DL9A 2HFGL 2J21A 3WNLA 1IAMA 1N70A 4NO3A 1Y07A 2J2ZB 2H1LM 4N2LA 4PTUB 3T3PB 3W11C 4QRPE 4P2OD 4F5CA 2C3XA 1CL7H 4FQXA 4J3OF 2FWLB 4LQ1A 1GCFA 3MRHA 1LD9A 5C3IA 3P11H 3VVVA 5F9DC 4C55A 1OE1A 2BC4B 1NGYB 2F0CA 2NLJA 4DT2A 1WWBX 2DQEH 5GGSA 4HJJH 4JFDD 5HYJE 4KBPA 5CFHA 1RPKA 1U8CB 2X1OA 4MB1A 3G04B 4Y2DD 3DV6B 3RX5A 5JYMA 3RA7H 1HFUA 3BP6A 1R3IH 1WCBB 5IQ7L 5TQ2L 4YE4L 4PLJD 1U2HA 4KNUA 2Q7YA 2O30A 2EJ1A 1G7PA 1A66A 4N0RA 1HSAB 1RZJL 5J06A 5K9OA 1S7WA 2IF7A 2R2EA 3IJSB 2QSCL 1JZ7A 1FF5A 2QGCA 4UM9D 3B3BA 1JPFB 2XV6B 4WUUE 1D7FA 4QXVA 3QEUA 4X6CE 1EJOH 1S9XB 3BDBA 4U1MB 3ZUCA 3ISRA 1MAMH 4DEPC 4ZYKA 5LGYA 4JFDB 1WWAX 4UOW0 1SF3A 3GBNL 3JV4A 3ZUNC 1KIPB 5E2WH 1SDYA 4APQD 4AQ1C 4LCCA 3S34L 4Z77A 2HVBA 4B9IA 4Z78A 4N22A 3U1QA 1BFVH 3MLRH 1UACH 3PHQB 5DZAA 5DSCA 1ET7A 4K3DL 4HWEL 2BMKA 1U0QA 4XO5A 4JREB 4M48H 2D8KA 2FD6H 5CWSB 3TIEA 2WINB 3HZVA 2HN7B 3QDGD 5E2JA 1NQBA 5IT2H 2QMKA 1AZRA 3K7UA 3GSWA 4UUJB 2Q6WB 3Q3GB 5T1KA 2BIPA 3WEOA 3QO0B 3VXUB 4L1SA 5TJWK 4ZMXA 2GIXA 2FX7L 5C86A 4KKPA 3WIFB 3EYFB 3Q1SL 1XSIA 4P46D 4K3EH 2B7DT 2A99A 4B9FA 1GIGL 3ZK0A 4JO5A 5GGQL 4NM8L 5D7KD 4YFLF 2OL3L 4EIBA 3UDWA 4MAYA 4XN4A 5D1XE 2FVNA 1NA8A 3CK0H 4WUUB 1KJ2B 4FL4B 4GP4B 4YLCA 1G6VK 5L4FA 4R0LB 4HGMA 4H8WH 4G5ZH 5HDQH 3SQBA 4B7IA 4DSYA 4AGPA 3DMMB 1IC1A 3I50H 4POUB 1OP5H 3V4LA 5ICXB 1F11A 2ERJB 1WHOA 4AIZB 1JWSA 2Z7ZA 4YDKL 5IQOA 1XH1A 1MDAA 2FYVA 1UHVA 3WENA 3NTCL 1MF2H 3WFDH 3BLKA 5KEZA 3EZ8A 1XGTA 1ZK9A 1WCBA 1BVLA 1EEYA 4JFFB 2CCLA 4YR6A 1FAIH 1BX2A 4OZFB 1AGDB 1ZWIA 3MO1A 2UZXB 5F97E 2IOIA 4HCRH 3M1BA 5JPMC 1CC3A 3DRTA 3OG4B 2DLTA 4JFDE 1DBJL 1JK8B 3SO5A 4P2OC 1SLVA 4KO6A 2NYYC 5KOVC 3BKJL 4PP2A 3NSFA 2OR7A 4OZ4A 3U7YL 3OKNB 1MCNA 1TZ8A 2NY7L 3E8UL 4WEEA 3SPVA 2YAQA 1M53A 5CSBA 2YMOA 3V9CA 4WK2B 3DX3A 4YHNB 4ANKA 4O2EB 1FIGL 3OLIA 4XXCA 5CJQL 3VG0L 2AMGA 2ZKXA 4PJXF 5ADOH 5GS1B 2E9WA 5ACLA 2AQNA 2WCSA 2ZSVB 1FZOB 3V0AC 4Y5VC 5I8CB 5FB8A 1NKOA 1WG3A 2XN9B 1UGKA 2IH1B 3U0TB 4DN4L 5K9QI 3S4SA 5EEXA 3LZLA 1PS3A 1KTLA 3THML 4FE9A 4FKEA 3BP4A 4XPAL 3UBXI 4J7RA 1IGTA 4P2QD 2JELL 4QHUA 1N59B 4HPOH 4NNPL 3GXPA 5B8CB 4J6RL 3ZO0A 4AJWA 1JPFA 1OL0A 3IXTB 1G7MB 5EU4A 5DCCA 1A02N 5IIEA 3ME0A 1YMMA 2YFOA 4NOFA 1AGBA 1BM3L 3KPLA 4KXAA 4GI9A 4MVBC 1JZ5A 2OZNA 5LGKA 2K8MA 1UH3A 2ED6A 2EQDA 1IO4C 2ISDA 3W0WA 2A1WH 3KGRA 3WTWA 2Y5TB 1T0NA 4Y7OC 2ICWJ 2ZG2A 4K94C 3VD9A 3QZNA 2VITA 4F7MA 1A9VA 1WSST 1CYGA 1NCCH 3FO1A 3H42H 5C0FB 1OAUL 1OSPL 5LWYL 5JA9A 2V7NA 5EPMB 5E56A 1TDQA 3MLPA 4JQIH 1GTFA 1RHHB 1JHKH 4D0CB 1BBDL 3WLBB 2F58H 3FQWB 4PJHA 4KK9C 3IFPA 1Q9WB 4X6CA 1A64A 4JZNB 1UWEH 3TYFA 3PWVB 5E7FA 5CD5D 1J8HD 1UB5A 4IKLA 1B6DA 1VFBA 1UASA 4HHWA 3LRSB 5C08E 4QJ4B 1UB6B 4LRIA 2WHVA 4NC1C 4K5MA 2NY1B 5L7XH 4B0MM 1U3JA 2ZTBA 3QEGL 3PWNA 4AMKH 3TPUA 1M05A 3B7YA 5ECJE 3IMUA 3WY3A 5CN2A 3NCJL 1LE9B 1XMWA 1MW1A 3BPOB 3DSNB 3P40A 4LHUB 1IC7H 2ARJB 4OFQA 2QR0B 4U05A 1LO5B 1QSFD 2VKXA 4UZUA 2XJKA 3MSPA 3V0VA 3WUWB 5BOPA 4JO3L 3DO7A 4MMZB 1TCRB 5HD8C 1XR8A 2QQNL 4S1QL 3CUPA 3ZIYA 1QLFA 3UJTH 4QIRA 1NBVL 4WU5B 5I1CL 5EB9A 1MWAL 2VDMB 3PL6D 1MWAA 4LLVB 4IOFC 1J5IA 4P99A 3QQ3B 1KIQB 3LQMA 3QDAA 5CLTA 3T2PA 3T8VA 2WNWA 3SE8L 4OLWH 4GIAA 4JDTH 3PXHA 1IAKA 3NT0A 1HXKA 4FS0A 4L8CB 4U4BA 2YBGA 3PWLB 1MN4A 1OSYA 1U8PA 3FFDA 4MD4A 4Y4FD 2J88L 2VR7A 4MJID 1DSFL 4E9TA 3CV5A 3TYFB 5T5FA 3NCXA 4OBRA 1QUNA 3QDMD 4MAYC 2BINA 3FQRB 2DWXA 1CGSL 1OT4A 2K0RA 3L9EA 5HI4C 1P4LB 3RI5K 3NEXA 4FCHA 4Q9CA 4LSRH 3R1GL 3BKMH 1KBBA 3H3BC 4N9GB 4QT5A 3MV8E 4H26B 1NIAA 3KH3A 1I7ZB 4ZNEE 1TEGA 2JJVA 3PV6B 5DK3A 2HT2C 3SGKC 4FQCH 3X11A 3CFUA 1ZPUA 4ONFH 1VZHA 4JDZB 1RXLA 1FH5L 1C5DA 5GSRB 4J28A 2ZUUA 5EU5A 4JN2B 1MLCB 3BEWA 5KANI 2P5WD 3P69A 5JO5B 2XPYA 3GSUB 1F02I 2WV3A 4PW3A 2O5ZL 1PAMA 3BCDA 3GZOA 1B4LA 4F37F 4XNDA 4J2XA 2EIBA 4L3CA 3UBXB 5DTFA 1AIZA 1KXVC 2IMMA 2AQPA 1KUMA 3WLWD 2B4CH 3FONA 4RAHA 1T7VA 3GS7A 2VMCA 4E9YA 1IGTB 4I77L 3ZYZA 2W65A 1QLRA 3FRUB 1LEKA 1Y6NR 5D4IA 2FRGP 3D0VA 2VDLL 3F64A 2ENPA 1JGEB 2FO4B 2LVEA 4QRTB 4ERSL 3P4MB 4DJMA 1AANA 3CXDL 4GMSH 4H8WL 4PJ7A 4XBMA 1RMFH 3SKJH 1RP9A 2B0SL 5FK9A 2R4RL 3VSVA 2CA4A 2DWEA 5IVXE 3CSTA 4G9DA 1IGCH 1D6VH 2EDBA 4YHPB 4QI3A 5I66B 4BQ6A 4JCMA 2DI9A 2XLLA 2WMPB 1N5YH 3LRLA 1JXGA 1ZHBA 3QZWB 4JPSA 3CFIC 4G11A 2OW6A 4XPTH 5D7KE 4KNSA 2X4QB 3CFQA 4NJAH 4JR9H 2DD8L 2XG4A 1CE6B 3SBQA 1TSRA 2J6EA 5KYUB 2VB5A 5FM5O 5HHQA 2DKMA 2J6EL 1BHGA 2N0MA 3ABMB 1TVHA 5GS3A 4ZX4A 1H5BC 1SYSB 1N26A 2E0PA 5J89A 4QAWA 4P9HC 2B2XL 2D3VA 5JPMA 1J8HB 5B3SB 1K2DB 2RBLA 4C4KO 3FF8A 5E6UB 5HGBA 1E6JL 2V8LA 2NY2C 1ZS8B 2V3FA 2W88A 3CN2A 4IRSA 3VB8A 3E1ZA 4MMXA 2VWEE 4ONOA 2EC9T 3ZU8A 4XCCL 1PX3A 1OTUD 1BMZA 3ZTJG 3IDYB 2DLFL 1PGRB 1KBKA 4HH9A 3LHPL 4PLKC 4FXGB 1UQSB 2K6YA 4ZMNA 3V0FA 1MJUL 1UB6A 3C6SB 3OPZL 4FFWD 3CPLA 5J1SC 3CVHA 3T0EC 2Z6FA 4TNEA 4R8WL 3DKHA 3BVDB 1QI3A 4I85A 1FHGA 4MAZA 4L4JA 4YVUA 4WTZG 5I9QB 1UATA 2EVFA 4CSPA 2AJYH 3AMLA 1B2WL 3EF4A 4NQUA 1VESA 3B83A 3MRJB 4RDBA 2J5WA 4NBYB 3QJUB 3OAZK 4PH8A 2N56A 2DQDL 5F70A 5C92A 2IALB 1HYSD 5D72L 4N6QA 3MRNB 1DUYA 2VDOL 1DJHA 4PVBA 2DIEA 4EUPB 3DX6A 3IAPA 2EEFA 3CNKA 4ZDHB 3TT1H 4FLRA 1JXDA 1M71A 1E2WA 3FO2B 3ARGB 4FD0A 3IU4L 5L4IA 2XQ0A 2YUVA 3TS8A 3BEVB 3ZGIA 5FHBL 4ZG1A 2DY2A 2XQYA 4IJ3C 1EGJA 3LEXB 4JAMA 3C12A 2WLIB 3F7PC 3RKDC 5HYJD 3QIUD 3GPSA 1MREH 4HEME 4YO0A 1A9EB 4FQIL 2YLHA 3K72B 4OFDA 1YYLH 2ZOLA 3FQ1A 4GP8B 3D6GA 3VGDA 3RL1A 3SDCC 3EH4B 3PUUA 2V4LA 2VR8A 3M86A 5ISZB 5AWNH 1T03H 3ZVVA 3UP1A 2VR4A 2YD5A 4U1IB 4AQ8C 1TPXC 1P4IL 3HJEA 4X5LA 5L2KB 5EUOF 3IJEB 4NSKA 3TASA 4GW5A 5JXAH 4Y8AA 5FYLH 1U2CA 1GC1C 3WKNA 3UGEA 4G8IA 2BOCB 1F90L 1NFDB 1MFDL 3V6FB 4RSYA 1U8OA 3H3PL 1FYTE 4LHUD 1QOKA 4PWGA 4TLSA 4PLNC 3TBVB 1JERA 4LVNC 3MQIA 2CKBL 1RZKC 1YNLL 5IKCB 3VX1A 3QUHA 3UROR 2MHAB 4CN4A 1DEEB 4Y2NA 3T8XA 1PFOA 1DN2A 1DQKA 1TVDA 4WKZB 4IBQA 5FUZL 4H26A 3EOAB 2X4NA 2BM3A 4LCWB 3MCLH 1EBPA 4MXQD 5HVFB 3C2SA 3MREB 3HG1A 1C16B 1T2QL 3GI8H 3IBOA 4JQXA 2NCMA 1J7VR 3TESA 4PJAA 1P9MA 2D9CA 4MS6A 1TZIA 5AW9B 3AG4B 1PG7H 1MCHA 2F15A 2HKFL 4QWWC 3VE0A 1CE1H 2J72A 2FL5B 4OKDA 3B9AA 5FV2A 5ACZA 1VZIA 3HZYA 4WI4A 1E3XA 5D93C 3LKQB 3QCTH 4XO8A 3ARFD 3VXMD 2KYIA 4LLDA 1JMZA 2E76C 3PABA 1YN7A 1INDH 2HX7A 2QADC 3DJ9A 1QZNA 2GSMB 4OKVB 1OOWA 1G0XA 1P69B 3NJHA 3KVQA 3BQUA 2AXGA 2XTJD 4Y4KA 2XIDA 5IZ7A 3CLFL 2AAVA 4BXSV 4A2FA 4IJ3B 4LAQH 3VMOA 4OM1H 4QRUA 5IWLA 4M6OH 2CGRH 4N0UB 4NPJA 2LAGB 3FCTA 5DZLA 4ETQB 1OZUA 2QTVA 1Z5LA 3FQTA 1UEYA 3H0TA 4R4BA 3QDGE 3I3DA 2YBRB 4HP5A 3ZKND 1V3MA 1A3LH 2X89D 1RZKL 5F1KC 2KLTA 3I75B 3L95B 2W8CA 3FAXA 1J1XH 2FCBA 2OI9C 3A4DA 3CHSA 4G7SB 5C0BE 3TT3H 3NOIA 3ZYJA 2P8MA 3O6KH 5EZJB 1HKFA 4Z76A 4K55A 3AY2A 3TA3B 2PETA 4J12A 1A4KA 4PGDA 4KWUA 4HUVA 5DRNB 1TOXA 1QO3A 3O6MH 4AIEA 1JPST 1SLWA 4PRIB 5FAAA 3L3HA 2ZOWA 5D1XD 3KPOB 4YHOL 1UWYA 4JFYA 1GXEA 3GSNB 3K2IA 4H2CA 3R7QA 4R7DA 1RUQL 1R3KA 3QULA 4KXCA 5D7LA 2OMYB 4XPGH 4LO9A 4L8BA 2R0LH 1QQDA 4BE6A 1EUTA 1XF5A 4J8QA 3ZZ1A 3ZKXC 3L13A 3SDAB 1QNZL 3KCPB 3N44B 1BZQK 1OK0A 5AB0A 1LO0L 1EAQA 4X5PA 4PCYA 3O3BA 4IKNA 3APFA 2AV7A 4NHCL 1NMCC 4GRWB 4UUJA 2H0PA 1ID2A 2AQ3A 4TF4A 1AZUA 2OULB 4ZAKB 3WXWH 3QQ4B 1KGYE 1ANUA 4PVNA 4ZS6D 1AMXA 5GGRA 3VI4B 1HINL 5HHVH 4X6FB 3S5LG 4N1CA 2NX5D 4OFKA 5CCHE 4BGDA 1NUGA 2VDKL 3RRQA 2DQCL 1DQTA 5ACZB 5JUEL 1ZTXH 3RDTD 5T3XH 3DX9B 5D2LA 4UINL 3LNHA 4AQOA 4L18A 2A73A 4YFEA 5KSBB 2W0FA 2NTFA 2UUDK 2NNAB 1JHTB 5F1SA 1XTLA 4M4PA 4TNVF 4RSVA 5CP3A 2EYTA 7FABH 1NBCA 1FNGB 4LPTA 1J0HA 3FU8A 3QDGB 3BKYH 1U93B 2XU9A 1XCTB 3BXNA 1NIBA 3IVKB 1XGQB 3MTRA 4E36A 2QADD 2Y07H 3EKCA 5TD4A 4KHTH 3L2NA 2NY0B 4LPVA 5HGHA 4DO6A 2G3MA 3W9DA 1I9JL 4AIXA 3A6CL 5IHHA 4HCRL 4OF5A 4PV1C 4QHMB 1LO4L 5KYYB 4HGKC 1QSED 3GLDA 2R0WL 1KZYA 4XCFH 2HMIC 4QHLA 1LHZA 35C8L 5K93A 5HGDA 5E4IA 4JHBA 2JIXB 4M1CC 2XT1B 4QLWA 3MRRA 3UTQB 2CLZB 4G8IB 2YEQA 4P2RA 1SFDA 5HYSG 2BDNH 1F86A 3SDYL 2YAFA 4OW6A 3DXAB 4IMLB 1BA9A 2JKSA 4C8XA 5HD8D 1YPZE 4YGVB 3CSYB 5AEAA 5MENA 1WA0X 3L2MA 1CLYL 1O9WA 1RFDL 3POHA 4JPIA 4KMTH 4J3TA 3APNA 3JWDL 4L23A 4H1LA 5D7IE 5DO2D 4Z7AA 1F58L 3O6FC 5EEYA 5E6IC 4AGOA 2YD0A 3ZE2F 2Y2WA 5HY9B 1GZQA 3GKZA 4X0KB 2YUZA 4QRQB 1AQHA 3UYPA 1TMQA 1MW3A 3OTTA 4YHLH 4Z7UF 3O3DB 1ID5I 4N0CD 2CO1A 2WO3B 4HT1L 3GM8A 2J12B 3QDHA 4H8WC 2DI7A 1E5BA 5D1QD 1N67A 1YEJL 2WZPA 4DF9A 4TUKH 1Z9OA 3HRZC 5BQ7A 1M42A 1LJMA 3L3OA 4LF3A 5AAPA 4GG6F 4CMHB 3NIDB 3IK2A 5DEJA 1KB9K 4CA4A 5CGMA 3ZDZB 4Z23A 4FQCL 3RPBA 4HUUB 1EERB 3T0XA 4NNXA 3VXNB 1IGFH 1U8NA 5GRVL 2Q9OA 3SGJC 2EC9U 5DZNA 2D7TH 1SJEA 3CDGB 5DVLA 2DMKA 4Y5XA 5LN4A 1F4HA 5G55A 4IGBD 3LZQA 1M1XB 3TVMA 1G6RH 1NCGA 2WZAA 4AENB 3AREB 1H3UA 4OLVL 1OSZA 4LKCA 1LO4H 3F6LA 3QG7L 2NY7H 4M7LT 1HYRC 3OAWA 1OAYH 1A4BA 2F8IA 2RGSA 2J88H 3OHXB 1MOEA 1IGIH 3E38A 1P84K 5MEOA 3L4VA 1T22A 1WE5A 5A6LA 4WAFA 1QSVA 1KB5L 1R46A 2P5EE 2WGXA 4HETA 4J6IA 4F2EA 2OK0H 4F58H 4JFDA 4UIMB 3GHEL 5GZNA 2F54A 2HUHA 1FGNL 1YRKA 3FT1A 5D7LB 1WEJH 1JZIA 2OX5A 4JQXC 1U2YA 3O2DA 1F8TL 2GJ6B 4DKEH 2FJSA 4QF1B 5IOPA 1T5KA 4G6MH 1KLGB 4PRDB 1MCDA 1HILA 4QXWA 2VRKA 5GGTA 3UC0H 2AFNA 4LMQE 1VADB 4MNQE 3LEYL 3P3RA 5B38B 2IH3B 1E9OA 4TPRH 4YE4H 2O5ZH 1KN2L 4AE1A 2IBBA 4DOHB 4HWBH 2I24N 1TYJA 4Q9BA 1F13A 3CFCH 4FG6D 4N3UA 3S5YA 5IFHL 3QEGH 3T0AA 4KHXH 3FTGA 3NFSH 4BQ9A 2G4GA 3G6AA 2K4WA 3KL0A 4JFEB 3DBXA 1EQWA 3OHMB 4ZXBC 2D73A 3NDYE 2YA0A 3QQDB 1FFNB 1MRFH 3QDMB 5GGSB 3DPBA 5DD3H 1VA9A 2ZE0A 5ANMB 5TQ0L 5C1MB 4Z7OF 3N55A 3GDCA 3LRKA 3D2TA 4GXUM 3U2SB 1HEJC 5K9KA 2DWEB 2NDFA 1XT5A 3TBWA 4NKOA 1S9YA 3ESPA 5HVGB 5HYQB 4PP1D 1S7TA 1FORH 1TITA 2X89A 4G43A 4J2QA 4G7RB 2WLNA 5DEGA 1CZ8L 1WV7T 4NYLB 4BQCA 1KCSH 3GSXA 3V0IA 5KZCD 1GGTA 2EDFA 2YPLB 3DX0A 1FVEA 4GKZB 4JG0H 5IHUL 4KQ0A 1J9CT 2AXJA 4EE2A 3GTTA 3V0WH 4OD2A 5IUCA 3VQLA 4JMXA 3P4NA 7CGTA 1NCAH 3HRPA 3KBHE 5FYKU 3LH2H 1MF2L 4OLUL 1SJHA 4TPRL 3VI3F 3EYSH 1ZAGA 3UC2A 1XSJA 4J6RH 3UTSB 5I5MA 1KTKE 4GUQA 1MJJB 1HE7A 4LQFH 1FL5B 2CDFA 3F65A 3PAUA 3I02A 2WVVA 3TO4D 1N8ZB 3LPGA 3SGEH 2AJZB 1AYOA 2R8SL 1SM3H 3APDA 4U1JB 1FFTB 3S35X 2CHDA 5DYOA 1JVOA 1RZJH 2V3EA 3EG9B 4F58L 4YLBA 4MRBA 3QZPA 5HVHC 3WXWL 1FZKB 3OWEA 1SMDA 2DLIA 1UT9A 3T6VA 1D5ZB 1MCWW 7TAAA 3TH4T 2N01B 5HDLA 2A74B 3CBRA 5F93C 4DGYH 3QJTB 3OMIB 2DEWX 2JI2A 3ELAT 4PJ9A 5AENA 2VLLA 3D2UB 1YN6A 1EA9C 4EZKA 3GRWL 3PCYA 4ATWA 1N0XL 1EAOA 4P2QA 4JG0L 5IHUH 3T3MF 2YSSA 4Y4HB 1DVQA 2CNYA 3LVTA 1H9DA 3MYJA 4C58B 2ZOUA 2BWQA 1AD0B 3ULUD 5E5MB 1G1CA 4JM2C 3V6ZB 1NGWA 2DMHA 3BPLB 3DJSA 4OY9A 3BP7A 4L4VD 4MQSB 1MHEB 3RB5A 4ZQKB 3BKYL 3HMXA 4FQ2H 1ZA3B 1ZE3C 3E9TA 3V5HA 4LEXL 4OD3L 1PYWB 1G9MH 1IEAB 1N64H 3NTCH 1YY8B 5HVWA 4QCIA 2AK4B 2DQGH 4A38A 2L7UA 1FH2A 1GY2A 2NXYC 4X8XA 3T3MB 2JKWA 3FK3A 4RFEB 4YHMH 1ORSB 3O8XD 2J25A 3FO2A 3QAZC 4GKLA 4HXAL 5I1DA 2ED9A 3MUJA 4U1SB 5DLML 5EA0H 2RD0A 3N2JA 2Z91A 2DDQL 1T0PB 3KYKH 3LQZB 4YBLC 4DVBB 3WTUA 2XZQL 4HMCA 5MENE 1WRFA 1MY7A 3OG6B 5F0JB 3A67L 4CUCA 4UQDA 3F7RA 1FNEB 4NJ9H 4XR8C 1JUFA 2G9HA 1YY9C 4G6JH 2XVBA 4N3TA 4PEEA 5KSUB 4O4YH 1IC5H 4FF9A 5FYLL 3V0GA 3IAGC 3FH8A 4AYFB 4DERA 4E9XA 5DR5L 3MLWL 4L1TA 4D3CL 4L1BA 3BYYA 2HFFB 1V05A 1CG9B 4FG0A 1T21B 4NUQA 1WA2X 4RDQG 2GCYA 3W11D 5I24A 4ZFOA 3MV9D 1VGEL 1IBZA 2DF3A 2ZSWA 1TU2B 5C0BB 4HK3N 1WJ3A 1HH9B 2DI8A 3ARPA 4OV6F 3BMWA 1JF5A 2XIIA 4X5RA 3RY6A 5FGSA 3MHZA 3SYAA 1BZ9B 4XAWL 3KGUA 1UVQB 2JB6B 2K3HA 4GAYB 4XNYH 3REWB 5A3ID 2CHZA 4IIQA 4CADB 1AXIB 1F41A 5BPPA 3LKPA 1M7IA 1R9FA 2XN1A 2J71A 3VFTB 4XP9H 3WTXA 2H3NB 1BFVL 3T0EE 3MCKB 5F7HA 1BZ7B 4YAQB 1BZDA 4KK9D 1LDPL 1RZQA 5CINL 2GUOB 1I31A 3R8QA 3M7OA 3ASOB 3VFUA 1EHLL 5EO0B 4O02B 5EBLB 2BJMH 3FBKA 1PW3A 1BD2B 4NKIH 3C6LC 4XMLL 4P48A 1MAML 2OMBA 3TZVD 2VM4A 1LL1A 1E27B 3GUTA 1OGAD 3TVMD 1WFJA 3AROA 5I71C 5IW1B 2OCJA 1VDGA 2VC2B 3LKNA 3S97C 1SQ2N 2BNRD 3OZ9H 3QJSB 2BERA 4JZJA 4Q97A 4L3ED 4L1HA 4YDVA 3AQDA 2PCPB 5F0PB 2E6JA 3BRDA 4R97B 5E1QA 2NY4B 1L5GB 4MVBD 3T3ME 3QEQA 1QSFA 3IF1A 4KXZH 3UTSE 4B5ZA 4Q9RH 2WUCL 4GQQA 4BFGA 4AC4A 1F45A 1FE8L 2WWNA 3RVXD 5GZNC 1KSRA 3EGXB 1UD2A 1ZT1B 3ZL4L 5FHAH 4MTMA 5AWNL 1T03L 3P4OB 3KR3L 4WO4C 4LVHB 5KSBF 3STZB 3C5SB 3NJGA 1TZOA 2YAPA 3EBHA 5IT2L 3VXSD 5AOKA 3MNWB 3V0JA 3QIBD 5C0AB 5KVDH 1W0WB 5JORB 4CN6A 3DURA 4YAQA 3ULVC 1NGPH 1R5WA 3M07A 3DTXA 3WY1A 5LDSA 2WXNA 4HWEH 1A6PA 4G42B 4BFEA 4GH7B 3F7YA 4LSSH 2ZUSA 4DK6A 1CD0A 3P4NB 2AZUA 2XV2A 4R7NA 2XN9E 4NQSB 2G75A 4N0YH 2NRDA 1B4TA 2OTUA 43CAA 2QHLA 2EE6A 2YPLA 4OLZL 4W68A 4LOUD 1I1FA 1T5XA 3MTXA 1GR7A 5CJOH 4PJIF 3KXFA 2B9BA 4DP1X 4QT5B 2IC2A 4E41D 4UTAL 4JG5A 4XBPB 2AJVL 2WB7A 5HYQA 4U3SA 5EU6E 1ZKAA 3KWUA 1CFQA 1IBDA 3FCGA 3H9HA 3MJWA 3RPIA 2VN5A 1DANU 3N85H 3S36L 1W9XA 1OAQH 1XGYH 1AZVA 4ORGB 4M7KL 1L7IH 25C8L 4XN9A 1K4DA 1O5DT 3AB0B 4Y2DB 2A6DA 5IK3A 2Q6WA 3BZ4B 2P5ED 1EVUA 2A6JB 5BJTB 2EXYC 2H2SD 2F9BT 2QPFA 2NY6C 1E4WH 4OZHB 1DL7H 3QO1B 3S37L 4XMKH 3SHSA 3NZSA 4BCYA 5BXFA 1BBJB 3OX8B 4FMFA 3B9KB 4MQXC 5D96C 5JIKA 3GQFA 5GISL 2QJDA 4GQ9L 5C9KA 4JK0D 1SHMA 2R2BA 2J1WA 1EZUA 3BPCA 3G9AB 3DRQA 2ZXBA 4OCYH 3CUPB 4X9FA 2VE6A 1BXVA 1QBAA 2BP3A 4ZAKC 1WIPA 4RMRA 2NYZA 1HCZA 5IQ9A 3SDXE 1U3YA 1MCJA 1R33A 1JZDC 4P5KA 4BFNA 4N8VG 1XGPA 5E8DH 2XX1A 4UOQA 4UTBA 2BCMA 4MJ5B 1NAKH 2COVD 1FJ1B 1R6VA 3SPGA 1T2QH 5BUPA 3FH7A 4Y4HA 5DS8A 3N41B 2OL3A 3L5HA 3L45A 2OTPA 3LIZH 2A9MH 4FNUA 5IMMB 1V5JA 2M26A 3QWOA 1S7RB 3FHEA 4Q52A 3LYRA 5EN2B 5FFGA 2I5YL 2PPFA 3U4BH 3B2UD 1P6WA 3EDEA 4MNHA 2H7WA 4H5SA 5IMMA 4HWZA 2P8PA 1MEXL 4RGMB 4GSQA 3HB3D 3VFSB 1W0YT 4HIIB 1QUPA 2UYLA 1DQIA 1CFNB 4OFPA 4MD5B 4DP0X 2Q7YB 3LNGA 5EIVA 3RAJH 4YNYA 2D03H 2Q7AA 3MRRB 3IJ8A 4UQ9A 1C12B 2ROXA 3CDFA 3FPYA 3T4AC 4NAJA 4QRRE 1A3LL 4XI5D 5TE7L 4X7SL 1BMWA 3ELQA 5EU3B 1Z2KA 2NXZC 4WK4B 5C70A 1KCKA 3HI6H 4I2XB 4P3CH 2AGJL 5D7JA 3CZFB 4F7CA 3FQYA 3NJKA 5EOCJ 2AQRA 2Y7SA 1P7HL 5FF6A 3E0GA 1QR1A 1FN4A 1JN6A 2ZXQA 4FQIH 4F7PA 5D7IF 3P3SA 5EUKA 4FQQB 3QWOB 2YAEA 1JFHA 4PJHE 4N0FA 2Y1VA 1HEZA 5ALCH 4F27A 3DJZA 3OKDA 3HI1A 4JPIB 4L0PB 4S10A 1ZXKA 3M46A 4Z7UE 1JZJA 4K2UL 3NJVA 1FI8C 1KGCD 1WHPA 4J3OD 4W9FC 2WYZA 2F5AH 5CEXB 1TQUA 4JB9L 2AERT 1NWPA 4X6BA 1DL7L 2NY1D 3S37H 4BFRA 3QRFM 5DHVA 4KO7A 4Q2ZA 4AEEA 1XSOA 3HC4H 3HN5A 5E4OA 4FP8L 5GXBB 1E5AA 5F3HB 4HOWA 4Q14A 2DQDH 1FIEA 1PZ5B 1ODUA 2XRAL 4MZIA 3DHMA 5D1XB 2Z31D 1MFBH 1QFPA 4X5XA 3DYPA 4HIJB 4WO4A 3GDBA 2VDRH 2G9KA 2NY3B 2O6EA 3QO1A 4UAOB 2WP3O 3FT2A 4PJEE 2UXTA 3TTSA 2EXTA 3FSAA 1D3CA 2LTQB 2ESVA 5F6IB 1G0DA 5L88H 3VFNA 2ZCZA 1LK3H 2DMCA 3QXWA 5SWSA 1OP4A 3X1EA 1JMXA 5EFIB 3C75A 3UTPD 5J12B 4M62L 4JBSA 3ECUA 3FUKA 4D9LL 1RIVH 5IOPB 1B0GA 1KGUA 2ITCB 1TCMA 5HVHB 5TGBA 3DECA 1GC1H 1QI5A 2Z8RA 2LGNA 3ZSTA 3U7AA 3J2PA 1PVHA 2P3YA 4NM4L 5LN8A 2V2XB 6PAZA 5F6HI 3GHBH 4OCMC 4V2BA 2AKRA 1H3XA 1JRHL 4X99A 1WIUA 4A67A 4HA1A 3VD7A 3BAIA 5KSAB 1RJLB 4TTDD 1DSWA 3MN8A 1XF1A 2K9FB 3VSQA 3EBAA 4YC2C 3QUZC 1JAEA 3WV0A 4ZAKA 3ZE0E 4HS6A 2Q3AA 1LP9B 1PF3A 5I8KL 4BH7A 1OK8A 2L7JA 5EOQH 5I8OL 4OQTA 4PJ8B 1PD1A 4XZUA 3T1FA 1ZHKB 3SPJA 1AO7E 4XC1H 4DIXA 3D39A 2CJSA 1L9MA 4EZLA 2COQA 3VJ6A 1JK9A 5KBLA 2QQKH 1KIRA 4KGLA 1LNUA 1SY6A 1JWMB 3IN2A 2FBJL 3PQYA 1KCUL 1RK7A 3H54A 4ILDA 2YMTA 2QZ5A 4GI8A 4HLJA 2EDRA 3EYQC 1JD9A 1KY6A 1DN0B 5IHZB 4P5TD 3NGBB 1S8DA 5B1JA 1N6QH 1XO8A 4J1UB 1I8AA 3OAYK 2V2WB 2TRHA 4HIHA 4NRXB 4K23H 4PRIA 4WNQB 1OPGH 5CM1A 1XVSA 2N59A 4NO5A 2NXZD 3CFKA 4TNWF 1K4DB 4PGDB 4YDKH 4HUVB 4FXKB 4M43H 2KHAA 4IBVA 1SVZA 1TO4A 3H55A 3KPQB 4WWNA 1J9RA 1JP5A 2QSQA 3Q48A 1W8EA 4OR1A 2MQ3A 4N2NA 4L5FL 5GGVH 3NZ8B 4BK5A 2LVCA 3AC0A 3DX8A 5F3BB 3OJ2C 1Z5LB 4XPBL 1ZD6A 2X0VA 3SD5A 4K0OA 1P9MC 4NZUL 4TUJA 2GIYA 1A47A 1TJXA 2GK2A 3Q2WA 4ABWA 4HUXB 5IBLD 1S7WB 3LKPB 5IKCA 1IQDB 3ZN6A 1AXSA 5J7CC 4WHTB 5HI5D 3SOTA 1WZAA 3PNWB 1OM3H 3QI9A 3OX8A 5AVVB 3AGVA 5TTRA 2D3NA 5LDUA 1RUMH 3LOWA 1C1EH 1WT5C 3U79A 3O8XB 1KWGA 1M6UA 5CU5A 3WO4B 3TYGH 2V37A 3OKEA 2ODIA 4NM4H 1OWWA 2Y1AA 4WJG3 2HJLB 4JFHD 3HUJF 4LCIL 5IESL 4K5LA 4JVWA 4PJBE 4IRJC 4K9EL 4MYWB 3TBCA 1JZ8A 5J9PB 4M9PA 4YHZH 2NZ9C 3MJ8A 2ZKHL 4JREC 3OVUB 5C0JA 3QR0A 5DHYA 3RKPA 4X6BB 2D3JA 1I82A 4WO4D 5JLZA 3GINA 4CKQA 4FI8A 2WWKT 4GAFB 4RWYH 1P4BH 3GYRA 3RHWK 2VXTL 2X6AA 2VZSA 4I18C 3IF1B 5IG7B 2L0DA 3RVXC 4KZDL 1NCWL 5F7UA 4N87A 1R5VA 3L5WA 1TTFA 3FRUA 1J5OL 4XPAH 3RIFF 4JL2A 3AABA 3FN0H 1QFWL 1NDMB 3RGVD 3IFLL 1CFVH 2QQKL 4KMLB 4NN7B 5BS0B 5B1KA 3CBKB 3ZKMC 4LHQB 5CKAA 3WN5A 1PYWA 1RPUA 3ZYOA 3KLHD 4GRLA 3QEQE 1EEZA 5H37A 1T4WA 1T3FA 1NGZA 1WGOA 3QAQA 2ZCLH 5C0BD 2Y7OA 1JXKA 3NRQA 2SEBB 3OM3B 3V6OA 3MYZA 4LPWA 3LQAL 4DPAX 1I8IB 1BOGA 3K6SB 4YH6A 5KBKA 3COOA 4L8BB 4MJ6B 3AREC 1PSKL 4NEHB 2EICA 1CDCA 1FO0B 1PSKH 1X5HA 4GIOA 5E2VH 1OSPH 2RTTA 5LBSH 1KBWA 1SBBA 2KPWA 1GSMA 4TL4A 4ZUTA 1R47A 4RDQF 3CMOH 3JWNC 3KLQA 1YEKH 3GXDA 4G9FD 2CA3A 3ML8A 1F4AA 2OTWA 3UL4A 3IEAA 4PJDE 5A1AA 1YDPA 2P5EA 4HKXB 3L9RA 1RJYA 2QELA 2EVHA 5JPNB 4YBQC 5KVEL 4PJFE 4W9DC 4N20A 3CSFA 3LNEA 3KYMB 4AI7A 4IKIA 4Y1AA 4F1ZA 2HZHA 4X9IA 4HJIA 3QIBB 1YMME 1EHAA 4OI8A 3JV0A 1INEH 1A1OA 1CICD 4Y7MA 1ETA1 4HX1B 4M7LL 4JDEB 4UQ3B 1F3DJ 4ELKA 2ROYA 1K5NA 3SBPA 2ZNXA 5AAWC 3VJ6B 4DP9X 5CAYB 3GSOB 3WN6A 1H3PL 3BPNB 3CHOA 4JM4L 3SDYH 1PKQB 2I7OA 2Z9TA 1BBJA 1T6WA 3ECWA 4UNIA 2AJXH 2YA2A 4NWUH 5GSVA 1QR4A 3BPCB 3AT9A 1A6TB 2A6JA 2LLNA 4OT1H 4O9HH 3QNYA 3NIGF 3PWUA 3DHUA 3R0MA 3HAEG 3TNMA 2FJHB 4CW1B 1XTMA 2XWTA 3CLEH 3H9SA 4F8LA 3K6IA 4XP5H 3C6SA 1AAJA 3MLUH 4WWID 5F1NA 1NMAH 1OGAB 4R3SA 5ERWB 1UQSA 1OGAE 3PE9A 2FL5A 5AVRB 2HJFB 1A3RH 1ZANH 1IGYB 3QCVH 3EH3B 4YHOH 3WGVB 1PQZB 3DUSB 2H0EA 3X3FL 4EEEA 3FULA 3GMOA 2MKWA 1CXKA 4KI1A 3IDMA 4XH2A 1SN2A 5F3FA 5AD0A 5IJVB 4HEPA 3EJPA 3UG5A 1CDIA 4NQSA 2GG1A 1MFEH 3L9BA 3A4EA 3F3HA 4IK6A 1IM9A 4MA3B 1Z9SA 5ECGA 4LNRB 5FCUH 4P3WA 4TTGA 2N7SA 2ZWZA 4DCQA 4IRSD 1AD9B 3VI4E 3BUBA 2PWEA 4HBCL 5E6IA 5JIIA 1GVIA 3EOBB 2NY5H 1K4CB 5EOCH 1I1AA 4KX7A 5KSAC 3LZFH 3EZJB 4EDXA 5E03A 3T6WA 3SKMA 4CVXA 3HEIB 2C26A 2VR6A 4K3GA 1U91A 3CVDA 2KZWA 5GQBA 1NC2D 1GYCA 5IVXB 1MELA 1EXGA 2G2NA 5KBMA 3KEDA 2BOCA 2RQEA 4KI5E 2R0KL 4YJZL 4ODTL 2OL3H 3BUYB 4HKZA 5D70H 2VLKB 4P3DB 3IMWA 4CBZA 3KBPA 4JPVH 4ABUA 1D5XA 2OMTB 1GPOL 2X3AA 4X5WA 3THMH 4ZNEA 4S2SB 3CZGA 1II4E 3QYCA 4IRJA 1JJUA 1ZDQA 1KTJA 2DQIL 1LGVA 2XTSA 1HAWA 4AV0A 4GRMA 3A5VA 2JV6A 4M48L 5DD5L 3WJLA 1CL7L 3P77B 4F92B 2IWFA 1A14L 5C0CD 4JHWH 4I48B 3T2NL 1QLFB 4L4TA 3D25A 3QISA 5CFAA 1PCSA 1KJ2H 4HPYH 3U2SA 2VQ4A 4H20H 2JJTC 4KY1H 4PP2B 3MUHL 2KQNA 1N8ZA 3RNQB 1IBHA 1MCLA 1R3LB 1YEDA 1PKOA 2W91A 2VISB 2VOTA 4LFHG 3KXFE 2JI3A 3U30C 3TF7C 3SE9L 2NZ1A 2XZAH 2GHZA 1DZ0A 5F1OB 3V8CA 1CR9H 2PYEA 5HDWA 2HT4C 3MXWH 4XNXH 2J1XA 1K3IA 4GKOA 4EAEA 4QTHB 1MXDA 5DURB 3AS2A 4BZYA 5J11B 4AY0A 3AG3B 2D4FA 2X2IA 3DUUB 4WK0B 4DO5A 3DYMA 5JXED 4IBWA 1CG9A 1K9TA 3G6DL 4PIRF 3OZ9L 3TN0D 1SXAA 5IEKB 1P4IH 2NX5A 5E5UB 3OR6A 4UTAH 1TU2A 5A2FA 3UJIL 2OV0A 3VGAC 1ET8A 3A6BL 1JXJA 1GW0A 3HG2A 5BMFL 2QKSA 1CFTB 1XFPA 5DHVH 2F19L 3GSVA 3AQZA 3O6FA 2GB2A 5LXGL 1QWHA 2Y2TA 3LQZA 2DKUA 5HHPB 4MSWA 2CJUH 3EGSA 4WW2C 4Y88A 5CSZA 3SQOL 4WI3A 4Y5YB 4LCYB 1BVNT 2AZAA 1Z66A 3H9SB 1YNTF 4XN2A 5DHXB 4CBPA 1JV2B 1P2CA 4PTTB 2OMNA 4UAHA 2X4UA 3N5AA 1NEZA 3LN4A 3PXLA 2OJEB 3JVFC 1XH3B 1LMKA 1HWWA 5DZVA 3DTDA 2XKNB 3B7RL 5HGHB 5FYLE 3RUGE 4ZMTA 1IIKA 4OI9A 2XG5A 3MRGA 3FT4B 3IFOB 2AW2A 2G2RB 4TULL 1SDAB 2J20A 2WP3T 3N1QC 4ONGH 4M5SA 4Y9BA 1RZKH 5K1NA 1W8NA 1SN0A 4MDIA 5IMKA 2MEJB 4DVRH 4Y16D 4ELDA 5DSCB 2VDKH 3KWWB 4FCAA 2NNFA 4ELKB 3GRWA 4FFVC 3F12A 3UO8B 3IFPB 1EUUA 5J5EA 4IQHA 3TEWA 4Z7NF 1BECA 3WS6C 3V6ZA 4NT6B 2UZIL 3IE4A 1XGYL 4ODSL 4Y1AB 4WFED 1IC0A 4UDTB 3CFKB 3S3JA 4A2GA 5E9AA 2JJSC 2GHWB 3BN9C 3OKDB 1MVFA 2YS4A 3PAVA 1TZGL 2QSTA 3S98A 3V9EA 3L7EB 5D1QC 1MCEA 4B3VA 5DK0B 2X42A 1U8LB 1PG7W 1YC7A 4F7EA 3MKKA 3U4EA 4PJ5D 1L9TA 2HXAA 1AQKH 5DTFB 5HJGA 3K5SA 1Z7JA 2MPAH 4LE8A 1NCOA 4JQVA 2E9IA 4WV1A 3BVXA 3S88H 4MNQD 1G87A 1ZVYA 3TA4D 1ZK5A 4ZSOE 3FTVA 5AW1B 2Q8AL 5DQ9A 4X50A 3DVIA 4BIKA 1GTNA 3P1VA 1JZEA 4G8GD 4L4VE 5L0QC 4U1HB 2YXVA 2DWYA 5F3BA 1GGBH 4AYDC 1KEML 4NBZB 4P2QE 3VRLE 2VISA 1I7ZA 1GZPA 3GBDA 5CR8A 5FO8A 4J3WA 4MCYB 4BK5C 5A6IA 3ZQWA 4R2GC 3U0TA 4UILL 3EOTL 5C07D 2Q3XA 2DIJA 2MSPA 5FO9A 3ZTJH 2HCZX 2YAMA 2WWOA 2ZXGA 3DYOA 1ORQB 2D7MA 2GUYA 3H9SE 5EZLA 4OM0H 1IE5A 1G7LB 3VRIB 3IU3B 4KROD 5CZVH 1AKJD 3B6SA 4YDVB 3CXDH 1HHGB 3AACA 1S78C 1GZQB 5I6OA 4M3HA 1RVFL 1BG9A 4YDJB 2R29H 3HI5L 2W38A 4I18A 3QFDB 2XN9D 3CX5J 3TJEL 5HHNB 1X44A 3AXLB 1INDL 4MXWL 2BHFA 4JY5L 4OTXL 1ZT4A 1Q0YL 1PAZA 4XMPL 2FYYA 1GCYA 3MRBA 1MW0A 5I0XA 1ZHKA 2DM4A 3BVNB 4ZT1A 2CLZA 3K8KA 3GGWB 4A2DA 2R1WA 4EDWH 1P7KB 2BCKA 3RZCD 4NQVB 4ACTA 2BNQD 5DRWB 4AQAB 2JF1A 1NOLA 3S2AA 5E6ID 2R27A 3J8F7 5ITFB 4ONFL 2F1BA 1G9NC 1G9EA 4R90L 5ICZA 1T04B 5FHBH 4IDJH 4K8RL 4B27A 4JNXA 2ZSWB 2MCG1 4KZEL 2Y7MA 1O5PA 1YUHB 3KEHA 4BH8A 4D94A 4Z5RB 5I23A 2Y6TE 5BJTA 3SDDC 1CVSC 2Z31A 1UURA 4WCYL 1OB0A 1FZMB 1DLHB 2VN4A 9PCYA 2P47B 5LCVH 1E40A 3EFFB 4L8DA 5B39B 3IVKA 1N3NA 1DJXA 3DXAD 3MJ7B 4M8QB 3ETTA 2Q20A 3QUXD 4EI5A 4GINA 2X88A 4IHBA 4S1DC 4LP4A 3J27A 3VD4A 2JLPA 1DSFH 3C8HA 4NQTA 4URTB 4HG4J 5HJ3A 4DKFL 4DGYL 3LDBB 1D5BB 4I4WB 4XOBA 4GG8A 5FYKD 3TWCH 3CVIH 2OMWB 3DHPA 4Q4IA 5FEBA 2B5IC 2EEXA 1E42A 2WXOA 4ISVB 4XXCC 4BDVA 3ECBA 3IS1X 2YC1A 4X98A 3H3PH 4KHXL 1JWUA 2AAAA 5FECB 2MHAA 3P4LA 5J6GB 4LVHC 4WUUD 4OSUL 5MEOB 3UTTE 3C2AH 2WVUA 4HWBL 5JOPE 3OZLA 3GKWL 4EN3B 3LH9A 3GZKA 3CJJA 3D87B 3PRZA 1T7WA 4A2EA 4ZMOA 4FQJH 1MQKL 2OZ4L 3PXJA 5I0VA 4YDLC 5I6XC 2Y23A 4P5MB 2HFEB 1RZ8A 1W16A 3AU1B 1HZHL 4OVUA 4YZWA 2BNQE 3Q43A 3U9WA 3HRZB 1S7QA 1W0WA 1LD9B 5JORA 2IGTA 3EGDB 4QXUH 3CZLA 4PU2A 3NACH 5F96H 4XNMA 4XE0A 4FNTA 1MRCL 5KSVB 5EEUA 5MERB 2EDMA 5C0GB 2JK5A 3O81A 2Q7NA 5KVMC 3PGDA 2WJ5A 1BD2D 3AITA 3L3OB 4LF3B 5EN2A 1OCRB 3VXME 2NX5E 3BSHA 5F72S 5DMKB 5I1JH 2FEJA 3HS0C 3A3YB 1SDDB 3LKQA 5LB1A 1QATA 5KVGE 4KQ4L 3CZUB 5JW3L 2W07B 1X7TA 3IU3A 1JHKL 1MHCB 3IN0A 1Q38A 1JCVA 3IJSA 4N90D 4N2FA 2R9HC 3QS2A 2VGLM 2W95A 4QKTA 2VDML 2OTWB 3K6NA 1XD1A 5DR5H 1X5JA 3L1OL 4JM2D 2XNAA 4UDUA 4D3CH 4J5VA 2ZXAA 4U1JA 1CU4L 2A0LC 4OZIB 2W81C 4M7ZB 3ARWA 1CXHA 4WDIA 4UNUA 3CZNA 2ED8A 4LRNH 3SBWC 5CCGE 2O6CA 3H0TB 1MJJA 1INEL 2FGWL 2K7QA 4HJEA 1QHPA 1YJDH 2VMEA 1H5BA 1ADQA 1T0MA 5I1GH 4G8GE 2X41A 5AOMA 4OIIH 5EBWB 4OIIL 1TMCB 5J3HC 3KZ8A 2QV2A 2J1KA 4OKVA 4ZSOA 1MI5B 1W72L 4D9RE 4WFFD 4RAUA 1BXUA 5FYJD 1KTBA 5T3ZL 3KYNA 3CMOL 1S7VB 2W60B 1UD6A 1K5WA 4XBPA 2EUVA 2IAMD 4HSQA 2E74C 2X4OB 3A6OA 2FHFA 2VERN 5JW5B 4BBWA 2XWBB 4LEEA 4P2OB 4QOKD 4M8RA 3QIBC 3BE1H 4D0BA 1AACA 3MACL 2CIKB 2Z35B 2XC8A 4Z7VE 3SDXA 1X7SA 2XTJB 4P0DA 4FQQA 1N5YL 4ELMA 5ANMA 1K85A 2VSKB 1ZLSL 3EH1A 3SGDI 3RUGF 2Y69B 1XZ0A 3NIFE 1TENA 2XG4B 3L2LA 3CN0A 2NUTA 2Y07L 3ARFB 4I3RL 2YJLA 3BT2H 3RY4A 3QUYA 4U6YB 1WWCA 5DURD 1ITCA 6FABH 2AXHA 1AO7A 1HOCB 4NKDB 5IFHH 5KS9F 2Z0UA 3B5TA 3WNIA 1AGFB 4Z3HA 3MRKB 1QQDB 3DV4A 1DBAH 4WTXA 3NAAH 2ZUYA 2EXWD 5AW0B 3KLLA 3TV8A 4X4KA 4G9FE 5AVWB 2OMYA 4PN6A 2BOBA 4FX5A 1E2ZA 2LW3A 4HU2A 1G7QB 2TAAA 5C08A 5E2UL 4H25B 4OZGB 4PS7A 4JFFE 4X42A 5HJ3B 2V17H 3UTPE 5B1AB 1OAKL 2UY7A 2DQCH 2IDFA 4MA7L 3LZRA 1NCAL 2ZXWB 1Z9LA 1YCSA 3S3SA 4B9PA 1RFDH 4KMTL 5JQ6H 3MGTA 1JZ3A 1XCQB 1KYUA 2FSDA 3O2DL 3N91A 3QPXL 3QR1A 4XNAA 3RVVD 1Q9LA 3KE0A 1O6SB 3UTSD 3EYVA 2EKSB 5DRNA 1WUNT 2QLVB 2P5WA 2ENSA 3BUDA 3MX0A 4OUUB 2EEDA 4XNUH 5ENWA 5DJ6A 4YSSA 3ESOA 4XCYA 3I9AA 2IAMC 1JSYA 1J8HA 1L3NA 1MPAL 2UX6A 3ABGA 3SDCD 3OKLB 4HJ0D 2NY2D 1NFIB 5A2LH 4J3BA 2XWZA 3VRJB 3RB7A 3TU6A 4WU7B 1BYOA 4AT6B 1I1YA 1CLOL 4NS0A 5C0BA 2LAAA 3DI3B 1MVUB 3IMRA 1J11A 4FZ8L 4AXWB 4PJ8A 1QSFB 3SGEI 2WKLA 2A4CA 4FYTA 3UJJH 3FU9A 1EAJA 1KLFA 2IDQA 1OPGL 1ZHBB 3QZWA 4P5TC 3L5XH 3BDXA 2A4ZA 4RGMC 3C6LD 3U46B 4FEIA 2ZKHH 4KDTA 1UXWA 4IRJB 2ARJQ 3CFDA 3I50L 4U7MA 4JY5H 4OTXH 1CICA 4CU8A 4KK8D 2FJFB 4DGVH 1Z0MA 1QRKA 5FOBA 2FWUA 4F9PA 2GW5A 5EBLA 4RFOH 3KPRA 4WRLA 4RFOL 1I8KB 5L6YH 1AGEA 3GMRB 2V9TA 4W9HC 4X6DA 4YSAA 4K4KA 1CT8B 5K9KB 2W65B 2EIZB 3BQUC 1KV7A 1YEIL 1GHFH 2LLGA 4WI0B 2H3NA 2NR6A 3UZQA 1K2DA 4F15B 1E6OH 2WBKA 3SCMD 2Y3AA 1U91B 3EFDH 5DUPL 4TTDC 4NN7C 4OV5B 3HHSA 4O2CA 4WHCA 2HUEA 2EDTA 1VSCA 3ZGHA 6FABL 4WY7L 2LLLA 3JBG7 4ORZC 1BXAA 4EN3C 3CXHK 1V7NH 2AK1L 3O6FB 4G7QB 43C9B 1LO3H 1X5FA 2PUQT 4UT9A 3W2DL 3PFQA 2V6HA 4AQ1A 3JVGC 5CJ8A 4R2GB 4L37B 1KLGA 2XWJB 3R4DA 3MRCA 1KULA 1AH1A 2GJ6A 4K5NA 4BWTA 1RZ7L 3L6FB 2BOBB 3HE6B 3SEPA 2AC0A 3GSNH 3O9WB 5IFJA 1AR1D 3A4AA 1A9EA 3D33A 3RHWF 1G1OA 3O8XC 1A7QH 1HS6A 2O6DA 4HJTA 3NFSL 4H13C 3VI3E 3R0NA 1YC8A 4R84A 2NNCA 3JUYA 1QFWI 2VH5H 3GIZH 1CQKA 1NUDA 4LAJH 4NFBA 3WKMH 1YEDB 3ABLB 4NRYA 1A6TA 1RULL 5IIEB 2J43A 4MLIA 2OJEA 4LAQL 1IM9D 5JMRA 1KB5A 2IDTA 3AMKA 3M7FB 5D1QB 3WEXA 1JV2A 2OZ4H 3SDAC 1SJEB 3HS9A 4GO6B 3ZRCC 5FA3A 1H3GA 1I9RL 1AC6A 4ZPVB 2CJ3A 2PO6A 2FGWH 2N4IA 3MV8B 3PUCA 3EOTH 3UPAA 3CPUA 5A7EA 2Q2LA 5DRXA 1BMGA 4HAGA 3RVTC 2VL4A 1D6EA 1NBQA 4UWQB 1H15B 2P1YA 1OLZA 1OV8A 2WBXA 2Z0BA 3FTWA 3RWHA 2X4RB 1KPRB 1QBLL 1IQWL 5BRZD 4G43B 1AGCA 4XWGL 4JJOA 2X3BA 3PWVA 5K9JH 2DEYX 3BMVA 4L1LA 5IEHB 4R97C 2HT2D 5G5DA 3BYTA 5I15H 4OGXH 3KYOA 1FYTA 1I9IL 2G5RA 2GI0A 4XP4L 5FKPB 5AW2B 6PCYA 3WLBA 5JHDA 3IJYA 5ETUA 2VDRB 1L9NA 2WVVB 1L6ZA 4X7SH 5DRZB 3VDAA 2WQRA 2HVKA 1AJ7H 3L4XA 4PPTA 1IGFL 3NP3A 5T33H 2PABA 3BGAA 3WAKA 4ODUA 5E1IA 5TE6H 4N8CH 1HTYA 2FLBT 4WI0A 3V0EA 1IKFL 4Z7OE 2PXYD 5K59F 1T0NB 2VUKA 4MWFA 1TCRA 4HWUA 3QJRB 2NNXA 4E5XA 3PNWA 4ZS7L 3B9VA 5EIIG 3WNOA 5FW8A 5KJ7E 1EHKB 1BV8A 2R23A 3WN5B 3B2UC 2FUQA 3ULSA 3FQNB 1KTRL 5EMYA 1SXZA 3E8VA 2VR9A 4GW1A 5IR1B 3QZWG 1PMYA 1YMHB 3LXBA 5A2JH 2HH0H 4X7EC 5DQJB 4O2FB 3TF4A 1P7QA 2AXFB 3BXNB 2ICWB 4NDMA 1JDCA 5LBGA 2R29L 4R4FL 1PQZA 1V27A 4JHVA 2R29A 4LL4A 4IGBC 4UU9A 4AM0B 3IDXH 3R19A 3GT6A 1VAHA 4P57B 4QAMB 4GG6B 3HMWH 4NP9A 4ZAKD 2G2PA 3AUVA 1J5DA 1LK2B 4WUKH 5AKTA 3U25A 2XWTB 5GRZA 1Q72L 3HZKA 5BW7A 4LCWA 3FU0A 2DOCA 3MLRL 4TUUA 4AK1A 1L3WA 4FTDA 3KXFD 3GBML 4J3UA 2CMRH 4S1DD 5DT1H 2VXQA 2GEEA 3PWPA 2F08A 4Z7WB 4HHAA 3A24A 5AL8A 4NO2B 1M6OA 1I1YB 2VQTA 4JN2A 1BFSA 1CD1A 4UM9B 3IPBA 3DIDA 3QR2A 3RIKA 1MRDL 1Y0LB 4A6YA 3PHQA 4KFZC 5E99H 4FI6A 4JDEA 4WSKA 4WWPA 4AL8L 4Y16B 3PV6A 2ZWKA 1MCKA 2F1AA 4Z0XA 1FWXA 2OMWA 4F3FB 3QCUH 4N28A 1C5DB 4Y16C 4RESB 5AYUL 3WU1A 3JWNH 3OLDA 1UFGA 2AJVH 3MC0A 2DLHA 4XH2B 2HG5A 3UG4A 2EO1A 1NAMH 2HJKA 1F0LA 3P30H 4UINH 4WJ5A 4YDLB 5I6XB 2Z93B 1TSHA 1UOVA 4HJUA 2DJUA 5I17B 3HAEB 3UBFA 3HE7C 2W0KA 4LBEB 2DYRB 3EFFA 4L8DB 3C5ZD 4WTWA 1HHHB 3DARA 2M2DA 3MBEA 1JVKA 3WTSA 3TBSB 5BNXD 1VCAA 1X9RA 2JXMB 1HHIB 4KTYA 4C59B 1KEGL 1QRNE 1DJWA 3QARA 4J8RB 2RQ8A 2E75C 1KJ2A 2BFVH 2VLJB 5D2NC 2CO7A 1A14H 1X5YA 1V7ML 3ULVD 2XFXB 3ASNB 3MUY1 1MCPL 1TETL 3MJGX 3CCHB 1CF8H 2XTLA 3FT0A 1KOAA 1IT9L 4QRSA 3WHE0 1XDTT 1IVLA 2EAEA 4RETB 4ZTPL 5FX3A 4XBEL 4XE5B 1W2KT 4PJXB 1A4CA 5F7EL 5SX5H 2PR4H 4ANVA 4QTFA 2WLMA 1GGBL 3VXUE 4R4NC 3SDXB 3NJJA 4CVZB 5JXEA 3DJTA 3EDDA 5DYFA 4IDJL 4K8RH 2BW4A 4OT1L 3C60A 4QHKJ 1GOFA 4K7FA 2Q86B 5F9JB 5KJ4A 1FYTB 4ICWA 3VWJB 3OV6A 3PAZA 4PS8A 5DO2C 2IOOA 4PGBA 2JB6A 4GAYA 4N6RA 1MAJA 5EF0A 3NVQA 5E4EC 1YMMD 2DQTL 4PHZA 2PP7A 4JDTL 4K71B 1JPGA 3TPKA 4FA8A 1TUPA 1P5UA 3B56A 3FTZA 1MFUA 6TAAA 3BVUA 1RJZB 4TLKA 1RUAH 4CNIB 1NINA 3TIDB 3M6DA 3Q8BA 2H4EA 4M7JL 4YSQA 4IM8A 1KJVB 4HK0B 3GMPA 4GS7C 1YNKL 2CHWA 4H0GA 4HEPG 1NCHA 4YDNA 4ZZKA 2OJ1A 1JI2A 1ZVNA 2PPEA 1JL8A 1UC6A 4P2CG 4N1EA 2MCPH 5ID1B 1JUFB 1T0MB 2G9HB 4QRFA 1NPNA 1FNAA 1A4JA 1W72B 5FA3B 1PJWA 1ZDSA 5ID0B 5SWSB 2WZ6A 4Z0XB 1UCBH 3RJOA 4N5EC 1VERA 3TN0A 3GJFB 1KPVA 3GK8H 1CXFA 4HUXA 3TTYA 4OCWH 5T8IA 3I9IA 1HL5A 2YGPA 2JQZA 5KVDL 2VDPB 4DKTA 2ZP8A 3ARTA 2V3DA 2NUTB 5E23A 3S9DB 2G60H 4HS8L 3VAEA 5GRJH 1GPOH 4PLJC 3OKKB 3GXIA 4JHZA 1EXHA 2YQ2A 4IMKC 5ELIA 3UMNA 4HLZH 5I8EB 5HYJB 1U8IB 4HAFA 1XR9A 3B9DA 2D4DA 5BQ7B 4XVTL 1JNHB 1NCCL 3FSZA 3H42L 5CBAA 1KGWA 5J9PA 4TLUA 2PWDA 1TKWA 4G8EB 1G1YA 5ISZA 3F00A 3G5VA 4DHLA 2F7IA 3ALPA 3MPCA 4DGVL 4FFTA 2PCYA 2PXYB 2Y72A 3O6LH 3EJTA 2YFNA 3TEXA 1NCWH 4C57C 4NQEA 4LL9A 3OKNA 1EMTH 1F2QA 4UV4H 4U6HA 4F5CE 1UD4A 1SJMA 2ZG1A 3X2QB 5CGYC 1UM4L 5IW6A 4YHNA 1XGUB 4YLQT 4JZJC 4NQCB 2GSGB 4QXTA 2X53A 4EI6B 4APQC 1QTPA 4TV3A 1MFEL 3V4VA 1E30A 1C5BH 5I1IL 3MXVL 3BH9A 3MXWL 5IQ9B 4M56A 4A1RA 4ZS7H 1ZV2A 4PWFA 5IB3B 2OSLB 2WN3A 3L7FB 1QWUA 2HKHH 1U8HB 3DV6A 2B2XH 1B4JL 4DQOL 4X6DB 1X4YA 3ROLA 3OAUH 3JWNG 3WFZA 2WXQA 4YDMA 3QCVL 5DXWA 2QDVA 3GTNA 1BW8A 2HLFD 3HZ3A 2ZOKA 2IPKB 4OZHA 5IY5B 1UWEL 1SJHB 5GGUA 4I0KA 4PJHF 1FFQA 3GLAA 4GQZA 1F56A 3ATBA 2HKAA 3BFQG 4R7XA 4ZX3A 2WO2B 1CD9B 4AW4A 7PAZA 3L4TA 3GMPB 1VFAA 4P23C 3UBGA 4OGXL 2F58L 1TZIB 2HAZA 3CN3A 3I6GA 4PJDB 3JV6B 5AVUB 2O5YH 4Z7VA 2OXHB 4XWGH 1QABA 5GHWH 3SY0B 1J0IA 3QPXH 1UKQA 5I26A 4HJ0C 3UGXA 1YEFL 2VR3A 1P5UB 3RILA 5ICZB 2JI1A 4HXBL 1JV5B 1BYNA 1FJ1A 4CU6A 1I53A 4HZLA 4MMZC 3QAZB 4IIQC 4YBQD 2AQ2A 1YEWA 3DLQR 2W0PA 2Z7YA 1AR1C 4PSRA 3B34A 5GS0L 1NCIA 2MWCA 2FECI 3P9MB 4OLUH 1U3HD 4PJCE 3GO1L 3ARDD 5F9OH 4BFBD 5HXMA 4QOKA 1E3FA 1M3IA 2ITFA 3K5RA 5D1QA 5D1ZC 3WEXB 1CLZL 1NC2B 3KJ6L 5GS2D 4PM1A 1O6TA 4X6EA 3ZHFA 2ICEA 5DK2A 3HZVB 4YHYC 1N9PA 5F89A 3NRFA 3PL6C 1JS4A 3HCVA 2NUPA 2ENQA 3BGFB 4RGOH 1O0VA