2NDFA

Solution nmr structures of af9 yeats domain in complex with histon h3 acetylation at k18
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
141
structure length
141
Chain Sequence
GSHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AF-9
publication title Structural Insights into Histone Crotonyl-Lysine Recognition by the AF9 YEATS Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ndfA00
5IQLA 4TMPA 2NDFA 3RLSA 2L7EA 3FK3A 5D7EA 3QRLA 5HJBA 5HJDA 5IOKA 2NDGA
chains in the Genus database with same CATH superfamily
2OR8A 2LABA 3J8F7 1I82A 3MJ9L 5I8EA 2IAAC 3SQOH 3L13A 3FB8A 4PRPE 1JE6A 4AEEA 3TA4D 4H26A 2B1HH 5HGAA 5C0BD 2VN5A 3RJDA 1TR7A 4NWUL 1X7SA 3ELAT 4XMZA 3C9NB 4KKNA 1FNEA 3FO0L 4U3CA 5A2FA 4G6MH 3BZEB 2KPNA 2IANE 3OAYK 4OSUH 1D5IL 2R1WB 4PV9A 2P5EE 2QKIA 4UT6H 3U7YH 5K59E 3S3DB 5T8IA 3VD0A 2NX5B 5F7BA 4YUEL 3UAJC 5ENWB 3Q5YA 5GGVL 3WEAA 3P77B 6FABH 2ICEC 3FQUA 2HA1A 1KPRB 3FN0L 1V7NL 1E8XA 5E4IA 4EI6B 4OLVH 1G43A 2HT4C 1M42A 3OSVA 1E90A 4FG4A 3R7RA 5HXMA 1IE4A 2IPTL 5D7LE 2XV2A 3T3MF 5EV7A 2EDQA 4OLUH 5AQ0A 5IQNA 1RP9A 5I1AB 4PS7A 1N26A 3KXFA 4OCLC 4FOMA 4XOCA 3OX8A 3NIFF 5AG9A 4QXGL 3IFPB 2BP8A 4BZ2A 1BX2A 1OE2A 3MOAL 4OH2A 4AKOA 3BVUA 4MAYD 4P2RB 4JFXB 1FIGL 3OZ9H 1BOGA 3PL6C 4YL4A 1NFKA 5E4EB 5E8DL 1UXSB 3B9AA 2EDLA 3FFCB 3IDGA 4NKIL 2WXJA 4TS6A 1JZEA 5EG6C 2GSIA 4UIKL 1O6SA 3P3YA 4PRIB 3Q8CA 4JJ5B 5A3ID 2XN9E 4J2QA 1JHKH 1FBIL 2XCMC 2XU9A 1QEWA 1R5VB 4WI9A 4HUWA 5AW4B 1OTTC 2K6WA 1BZ7B 3UOAB 1LQSR 5JW3L 1TTGA 4FXKA 1E27A 5LWYH 3DHJA 2J8OA 2WLJA 3GMQA 3PAZA 4NPKA 4E9RA 2CE6A 2DQ6A 5DHXB 2Y7LA 3DVNA 3D1MC 3MNVB 1YJDL 3HAEB 4Y19E 5IMOA 3UIZA 1UT2A 3QXAA 3EO0A 4YFDB 2V7HB 3QIUC 3MREB 4NQDD 3CAFA 5K9QG 1ZWIA 1S7WA 4FQLH 3RWFA 1RJYA 3DRTA 3QCTL 4FNLH 3VFSB 2F54A 3ZUCA 3E9TA 4FKKA 5ANMB 5L2JB 1CR9H 1R24B 1KBGL 4KJPD 4FQJL 4Y2NA 4ES9A 1PDKB 3EHBC 5HHNA 3QQDA 3Q5TA 2CLRB 1NOAA 2VLMD 1WITA 1L9NA 2D3VA 1ZHNA 3ETTA 2ARJB 1HESA 4G3YH 1KEML 2QR0A 1FC1A 3IE4A 2VIRB 1QA9A 3MV8B 3I6LD 3CDCA 4XB8A 1U3HD 1UENA 4GRMA 4XNZC 1YEIL 3H0TA 5EBLA 1GCFA 4DHLA 2YARA 4F7CA 2ETWA 1VZHA 2NR6C 3SGDH 2M1KA 4N9OB 1MREH 2I26N 5DHVA 1UD3A 4QO1B 5F3HB 1JGEA 1N12A 2QVKA 3BVXA 4BZ2H 4XO9A 1IAIL 1XF2A 1KPUB 5E9DA 1PKQB 3ZKMC 4W9IC 1QQDB 2Q8AH 2HUHA 1Q9LB 2JCWA 3RUGB 2W8CA 4JQXA 4WEMB 3P3SA 1JF1B 5A2IH 1SVBA 4PY7B 2VDLH 4L8BB 3FO9B 2WN3A 3IDMB 4NKDB 1BZ9B 4W6WB 4YZWA 2FO4B 4AEHL 3W5NA 1QYGH 2A6KA 3P9LB 3U9WA 3UX9B 4P2CG 1J1OL 3P30L 4JZJB 2BJMH 3Q9QA 3ZIYA 3BISA 2DJSA 4YDVA 3PAVA 3MYJB 1DVFB 3B37A 5EFIB 2OSXA 4Y4FA 2IDCA 1HAUA 3FUNA 1HZLA 3HOGA 3LN4A 5DFTA 3TONA 2Q86A 4PJIB 1A47A 5JNYB 4C83A 2HTLD 3U46A 5GS1B 3UO1H 2XWXA 1Z1WA 1ID5I 5F0PB 2W9EL 3SPJA 5I17B 4OFQA 3STLB 4M8VA 3V5KB 4RFNB 1W72H 1HH9A 1OAUH 2WO4A 1OZTG 2IALA 5HJ3A 4JPVH 1PZ2A 5CBAA 1NCOA 3C2SA 3QEQD 4M3KB 1QKZH 1FG2A 1FNSL 2QFPA 3NH7H 3MRJB 1YEEL 2FAUA 3OAYH 4C4KO 5DZOA 4W6YB 3W38A 5DZLA 3PPEA 4XCNB 3IDYB 4V33A 3V4PA 5LDUA 2VJ0A 5BZWA 3NTCL 3J7HA 3KPSB 4HIQA 2EH8L 4Z3GA 3ESVF 2PPEA 3NSYA 4QHMB 4HEPG 3SYPA 5D93B 1BSIA 3MV9E 4FA6A 2JNZA 4MJ4A 3K72B 3HE7C 1KNOA 3FU6A 4LVEA 1NOFA 1VPOH 2K9UA 2WKOF 2QHRL 3VD5A 1Z9NA 1ET7A 1XSJA 3SD5A 1G6RL 3OKLB 3WO4B 3K6OA 4QI3A 4RGOL 2EUZA 3RGVC 4IIQB 2X4TB 5HHQB 2XZZA 4O02A 2EDKA 3AUWB 3PGFH 1OOAA 3PWLB 2NSXA 2QHLA 4X7SH 3BT2L 1ED3A 4LEOB 5IGXH 4PJ8B 4Z7OE 4K3EH 1TQBB 3VNZA 3QQ4A 1M7DB 3F7PC 3ZU8A 1NUDA 2B20A 4OZFA 3SODB 1NCGA 4X6BB 4YNYA 5F97E 2QPDB 1EHNA 2P45B 2LT9A 4U49A 3OQ3B 3I3BA 4PJDB 2BY2A 1NINA 3QORC 5DQ9A 5GRVK 2LVEA 4F24A 5IROD 5BUAA 4C4BA 5ITFB 1KN4H 3S35H 2DYPD 4NC1C 4B9FA 2HRHA 1U95A 3QZNA 1DVUA 3IDXH 1BJMA 1H19A 2BCKB 3O4LB 3L2MA 4P2RE 2AABH 4KKQA 1G5GA 5D72L 1YMMB 3S3BB 3FFCE 4LPTA 3B2XA 2ZE0A 5JPNA 1E2ZA 1JPGA 2WLLA 3N1QC 4KHXH 2V6HA 5DMGC 2MCMA 4KX7A 2PXYD 4PRIE 25C8H 3SYAA 3LNIA 2GJPA 4ELKB 4PGCB 2HT2D 1A6ZA 3WFBH 4LGRB 1UD5A 1TENA 2J3SA 1X7QB 2GUOA 1MI5B 3TV3H 3WY4A 4EO5A 5FF6B 3BCDA 4QJ3B 2R2BA 3IXTB 1F8TL 4B97A 3TA3C 4X80H 4NIKB 3CN1A 4YC2C 1KJMA 1PEWA 4YDMA 2CG9X 3V4PH 4I2XE 1NGWB 3L54A 1VERA 4ODVL 3BKCH 3QEGH 3N55A 2NDFA 1NICA 3RU8L 4JDEB 4OLXL 3QULB 5KN5A 1T2QL 2Y7SA 1T4KA 1UFUA 3NJIA 1F00I 1JGLL 1KBVA 4PPTA 1EQWA 3T0EA 1IEHA 3HC2A 4LQFL 3QXWA 2APVA 1JF5A 2ZKWA 4WEUD 3UJJH 3EFOA 2IQ9H 1AZCA 1SEBB 3KLKA 5ANME 1IEBA 1DBMH 5ID1B 4DCQA 1BXXA 1CICA 4P3DA 2YC1B 3GS4A 32C2B 3TN0D 4OD1L 3NACL 2O5XH 2O5YH 1TZHB 2R23A 3EH3B 3IM1A 4I3RH 4G8FA 4MDRA 3R1GL 5LHDA 1XD1A 1JUFB 1NSNL 3HFMH 3MRNA 1TQTA 2RFXB 3N9GL 4DERA 5ES4B 3TBVB 1GZHA 2C9VA 4P4RA 4M1CD 1M1XB 4QRTB 1D2OA 1XR8B 3GMLA 5AB2A 3ULUL 1E3FA 1T22B 3CIQA 5E56A 1AD9A 2CHXA 4TNWK 2FQDA 1I85C 2WO3B 3INUL 3TO4B 4WEBH 1OP5K 1SNRA 5T3ZE 2CUHA 4H8VA 2DLTA 2W0FA 2ZUUA 4JUTA 5EC1B 5GSVA 4R7NB 3CQPA 4K55A 3PWPD 4N8CL 3KPLA 4YEFA 4G9FA 1SY6H 1KC5L 4L3CA 5AOJA 2K78A 3SDDB 6PCYA 3Q0HA 1MG3C 2KH2B 2V5MA 1YYLL 1F2QA 2MFNA 3W9DA 1PKQE 5GQBA 3PWJB 2PP7A 4F2ME 3L6FB 3FTXA 1P84K 4OIIH 5DD1H 3I9GH 4IRJB 5IEHA 3BWSA 2Y6SD 5E8EB 1DQTA 4JR9H 3ML9A 4GY4A 4XNAA 5T3XL 1VEPA 1UA6H 1LWJA 5FYJE 1CPUA 5LBGA 2K9FB 3CFTA 4NJ9L 4L1SA 2IAND 5JXED 3A4AA 3VSVA 1CD8A 4PRNB 2P5ED 4KI5C 3IYLW 3HJEA 2WUBH 1GCYA 4NS0A 5HGBB 2HRPH 5I9QB 1JZFA 1KLFA 1LVEA 2ZUVA 5D1ZB 1JI2A 3QCUH 1DO6A 4PJIE 3VWKA 3AXLB 4ANXA 1ZXKA 5BOPA 2VLKE 4GAJH 4F2EA 1T5XA 4KJWD 5I75C 4ODTH 3KGUA 3HBPA 4F7MB 4NUJA 3OPZL 3UTSA 2O6EA 2R83A 3NUKA 4NKOB 4OZ4B 1NEZB 2VDOL 2AK4A 3MRPB 1T4WA 5JHLA 3INOA 4WFHE 1KACB 2Y1VA 2XTJB 4MQSB 1VB9A 2VDKH 3K91A 3KJ4C 5EN2B 1B4RA 3CH1A 3EGSA 5DEZA 2GY7B 4PJHA 4N2NA 2ODIA 4PJ6A 1Z0MA 5GGRA 5DUBA 4EQ2A 4YAQA 4F33A 5A2JH 1VGEL 2H0PA 4ZTEA 1JV2A 4HPOL 4IBZA 4M5SA 4Y0GA 1CLZH 3IKKA 4YXLL 5CJXC 2BZ7A 5KVGE 2Q7NA 5KVFE 1A5FL 4X6CE 2FX8L 2HN7B 5FHAH 2Z3FA 3RL1A 3WTXA 3D05A 4EDXA 3VWJB 3ES6B 1KTRL 4HHWA 5A3IC 2XN9D 5FM4A 4GXVL 3TEZA 2WW8A 3L3OA 4OZGF 3FS9A 2PPCA 2X4SB 4QRUB 4MNHB 1E4KA 4Z7WF 3T65B 4WI4A 4ZQKA 3V4VA 2YKLL 4I3SL 4RDBA 3F58L 5CP7B 2BC4A 2D0HA 4CSSA 3L1OH 3TCLB 4GO9A 3ORJA 3EUDA 4JVPA 2E7HA 4Y19D 1DLFL 1BPVA 4WSKA 2NUPA 1LO5A 4OCXH 1MHHB 4GT7A 4BKLB 3KPRB 4PJDE 3FW6A 4POUB 2C8NA 1A7PH 2EDMA 2X1PA 4P46A 3ULUF 1MHPL 3GMOB 5KS9B 4TPRH 3VFWA 4UZSA 4S2SB 1OGAE 3T8MA 3CLEH 3L3JA 2Y5TA 4NRZB 5IWLC 2FJGA 5E7BA 1E2WA 3AROA 3QDGB 4UINH 5I1DB 4OAWA 3O4LE 4J23A 5GIRB 1NGYB 5A6LA 3Q43A 1CGUA 3DETD 3II1A 4GKLA 4PGDA 2NCMA 4BFGA 3GO1L 4U6YA 1G7JA 4HFUH 3VFRA 2OXGA 3B34A 1JL8A 4F57H 4UQBA 3ZYOA 3F12B 3GMPA 4N20A 1JNJA 1HT6A 1EO5A 1U3HC 2WBJC 1P4LA 2DQDH 4PJAE 5JHLH 1UT1A 2X1XR 1ZV5A 2IADB 3RBSA 1MI5E 5HBBA 3QQ3A 2RAMA 3O6FD 2OZ4A 4KZCA 1JCVA 2IG2H 3WD5L 2IBGA 2JCCB 5JIIA 2JQAA 3LCYA 4D0BB 5FGBC 1P53A 1QHOA 2HH0L 5D1QC 1I9IH 5FYLH 5C0EA 1MCSA 5I6KA 2R27A 3WG7B 4PVLA 1IGML 2NZ9D 4XP9H 1RZJC 4LOUD 2P42B 5TGBB 4GLRH 3GZKA 4X4ZA 2GEEA 4JKWA 2XIIA 3N1GC 1OGTA 4OBSA 4LIQH 4KXAA 5KYUB 1E50A 1N8ZB 2ZNWA 3RI5K 5D1XB 4BFRA 4Y7MA 2C9AA 2X4RB 1B88A 4YSRA 4J3TA 4X99A 1OP5H 3RL2B 1QWHA 4UI2A 3IFNL 4G82A 5A16B 3C75A 4MMYB 5G4OA 3ROOA 1U93B 4XHQA 1BEYH 1TFHA 4Z7QE 1BVLB 1JI1A 2VXSL 4PJBF 2DZEA 2HTLC 4LESA 3OGCA 4QAWA 1N7MH 2WZPD 1C08A 3WFCL 3R4RA 3MRLB 4IBQA 1MJ7H 2Q7YA 3T3PF 1Z9LA 3O0RH 3AY4A 1UH4A 4ORGB 4IBUA 2GIMA 3N6YA 3QI9A 1IQWH 4LLWA 4Q2ZA 3KM2A 5E0QA 3GC3A 3QBTB 3ZDYB 1L9TA 3L9EA 3LDBB 2WGNB 1BMGA 3AU1A 3K8KA 4KO9A 4WWID 5D7SH 2H6PB 3F85A 2X40A 4HSCX 4WW1B 2XPGA 3S5LA 2UV3A 3CFMA 1OTUC 5B39G 3DX8A 3U2IA 2YN3A 5IT2H 2DYSB 4BSJA 1ZLEA 3MV9D 2PN5A 4KKLC 1S9WB 1P4IH 4XZUB 1U2CA 4XBGA 2AJYH 4PCTA 2ZAGA 4R90L 5B8CB 1E5ZA 2FVNA 4FLRA 2C7UB 4FTVB 2R56L 1GHFL 1SFHA 4PJ7F 1L7TL 4PJFB 2J8HA 1GY2A 4KPHL 2EIJB 2NX5D 1JK8B 1UM6H 4ZAKD 4HJ1A 1XGQB 4XN8A 1HQRA 3QZPA 2K4WA 1AI1H 4XPBH 2GITA 3IVKB 2JVUA 3WXWH 2C9XA 3TBBA 4NERA 5C9KA 1GYCA 1ERNA 4L1BA 2N56A 3VFMA 1MZYA 4D3CH 1XAUA 1XSOA 3MJ7B 5FYLD 3CN2A 3WS3B 2W95A 2WYTA 3W2DL 2J4WH 3MA7A 5TPWL 5KWYC 2E0PA 4UMGA 2W9DL 4QRRA 3EIFA 3BXNA 2VXVH 5KANG 5IROC 2AEQL 1A9BA 5I2IA 2MOGA 5TJWK 3GSUB 1JPEA 1ZEAL 4TMPA 1X5YA 4U4IA 1SJMA 3BT0A 2OR9H 4ESKA 4HMDA 1WAAF 2Z8WC 4P2RD 1MJJB 3D34A 3GJFB 3THML 2ZCHL 1IBFA 4TULL 2C3VB 4PJCA 5D2NC 2EIBA 1PQZA 4O9HH 3FFCD 5IQLA 1F4WL 3AITA 1S7UB 3FH5A 5DWUH 2UY7B 4ERSH 2DWDA 4PRID 4HCRL 1ESOA 1T03H 5I15L 1U8CA 2BNRB 3ALXA 3VD1A 3WS6C 4QHLA 2IH1A 3CC5B 4E9TA 3S2AA 1RZKL 5ISZE 3JSSA 2VR7A 2ZD0A 3VX1A 4CU7A 5ABDE 2K3TA 1X6LA 3MODH 1JGDA 2GI0A 4CVZB 1OARH 4H8WC 3SSGA 1GPOL 3VFTA 1V5JA 5C3TA 1COBA 4YFLI 5J11C 1SMAA 2X05A 1GTFA 4NN7C 3ENEA 4NDMB 2VXTL 3AM8C 2XXCB 1X5ZA 3D48R 5HHXH 3D12B 5INDB 4BQ6A 2XDHA 1F4YL 4WO0A 2XWRA 4YBLB 4P9HC 1YECL 2D7TH 3MLTB 3QUZB 1PYWB 4XCEB 4CA4A 1FVEA 3PNWB 5IHZA 1CIUA 2E4TA 3GRWL 4MA3B 4HW6A 3AABA 3VJ6B 2JI2A 5KS9E 1ZVSB 5CSGA 2ITFA 3DNKA 4YOKA 1DJZA 2FX7L 3KR3L 3KWTA 1R6VA 1DEEA 1T89A 4POZC 3TIDB 4GSDH 2ZWSA 5F1KC 3MRKA 4ANVA 2GABA 3RVTD 1XH3B 2AQ1A 1S7SB 1BM7A 1HXMA 2CGRL 4YXKL 3IF1B 1T3FA 3SDXB 3UL4A 2E7LC 2CUMA 2RB8A 2YGVA 3L5XH 4RVBA 3AZUA 3TYGL 5A43C 4X6DA 5DJ0B 3Q2VA 5JIHA 1MVFA 2L7EA 1YHPA 1A9EA 1R4XA 5EOCH 3MV8D 3OKOB 3JTTB 5IW3A 2YPKA 3AAZA 4OCSH 5T3ZD 2AQSA 5J1AB 3LS4L 1ZTXE 2NY4D 3VGAB 5H37G 1WHPA 2VW4A 3BGAA 2B59A 1T1YB 1IGYB 3DUSA 3GRBA 4XXDA 1KEGL 3K71B 4N1HB 1CDHA 1KTLA 2MOVA 2CXGA 4PREA 5ABZA 1RQ5A 3UAJA 1RSYA 2WIMA 3BPCB 2DQHL 3RVVD 9CGTA 1GKOA 1DN2A 5L0QB 1PX8A 3DRQA 3U1QA 2ICEA 2QQLL 4Z0BL 1BQLL 2Y6SC 1E9QB 3VXTB 2IAMB 3RVUD 3ATAA 4NQTA 5DD5H 3VQLA 4D8PB 2VR5A 4KKAD 5FYJD 1DANT 3DC0A 4MAUH 2QT6A 5HYSB 1CE6A 4LQ1A 2A74B 5D1XE 3TPKA 1YEGH 2PF6A 3F84A 1T2XA 4PH8A 5DO2C 1DVFD 1YN6B 3LXCA 1H0DB 3JTBA 3L9RB 8PAZA 4MX7B 2WYHA 1MCBA 1NCBH 3ESOA 5EBGA 4PJXB 3ILDA 1QAWA 4LP4A 1CXLA 1KYOJ 4CILA 3PL6A 2UXFA 4MXVF 2VJXA 3BZDA 3ZQXA 3SKNA 4MMXB 4LCUA 2V3DA 5D9SB 5IHWA 4BHUA 2A0LD 2J8UB 4RFEA 4WCYL 1CZ8H 3NCCB 1KFAL 2QPSA 3L3IB 2HX8A 4LASL 3L3DA 1TJGL 3BDXA 3ZDYE 5DUML 5CN3A 1EGJL 3QNXB 1NANH 1ZT7A 3P1VA 5AW7B 4AV5A 3UG5A 3HNVH 1AC0A 2OMYA 1T1XA 4HZLA 4L0ZA 1GYUA 2DLFL 3FUJA 5DEJA 5DS2A 5ANHA 3VGDA 4DPBX 3KPSD 3V0VB 3GTVA 4A6YB 3CZKA 2YHGA 1M2OA 3FTWA 4UTAH 4E42A 3CUPB 2PW2B 5DRXB 1LK2B 3HHSB 5IBUG 4W4OC 3B2VH 3QPXL 1GSKA 4FGMA 4CNIA 4Z76A 1QSFA 2YOAA 1X5XA 1QUNA 4BDVB 5AYUH 1YPZF 1F3RB 2WINB 4OF0A 1IC1A 4FTVE 1E9OA 3QIUA 1T5WB 2X4QB 4PJFE 1AO7A 3MRDB 3OL2A 3HC0A 4PJGE 3Q48A 5C86A 2GHWB 3KL3A 3BIBX 4Y2LA 5LGJB 4GXUN 5DZPA 1RUQH 1A6AB 4AV0A 2A9MH 4KRPB 4PRBA 2B2XH 3X12A 1VZIA 3C5ZB 4PJEF 5HDBB 1U3ZA 4K2UH 4OF6A 4PJ8D 4HUVA 2IPKB 3NN8A 1QO3A 3NIDE 3UABA 1QFWL 1FUNA 2CJ3A 5J4MA 2XT1B 3KBPA 3ABMB 1U4FA 1J0YA 2VLLA 1ZHKA 3NRPA 4P3WA 3S3PA 5K93A 1IE5A 3MBWB 1FORH 3P02A 2NY2C 2BP0A 3PUUA 3KYKH 3BZFA 3AVEA 4HWBL 2WM0A 3DSFL 1CD9B 3S8FB 4U0QB 2OK0L 3V52H 1ZV9A 1BHGA 1WBXB 3SO3B 3VYPA 2Y7QA 4QDGA 2GJZB 4J3OF 2YD3A 3O8XD 3D85A 4B3VA 5DGRA 2ZWZA 4KVCL 2NR6A 1BP3B 3ZT7A 4EEEA 2IO5A 5E00B 1PLGH 3O4LD 1XGUB 3ZTJG 5GGRY 1L9QA 1CF8H 1XGTB 2EDEA 5JHBA 3GS0A 1JV5A 1W0WB 2WCPA 4DGWC 3LS5L 4M7ZB 4W6XB 3PV6B 1UZGA 1XL6A 1FZOA 1SJHB 5IJBC 2CHNA 1BFVH 1K5NB 3O6KL 2HFEA 1AYRA 1USQA 1JXJA 3G6DL 3DYOA 1JGIA 5C7ZA 2OTUB 4FQIL 3ZGHA 2VMDA 3WFHB 1MEXL 1MI5D 1T1WA 3AG2B 2FJUB 2QTEA 3EO1B 1WFTA 5HDQH 4DPAX 4HU2A 4M93B 4G42A 3MLPA 1XB6A 4QRPB 1ECYA 4GRLD 4X7DC 5AB1A 3UMNA 1KXTA 1A3RL 1B4JH 5EO9A 2ATPB 1B3JA 2EH7L 1X9QA 2OZNA 2XY1A 2WWKT 5DHEA 2BNQA 4LSRH 3MJ8A 1Q72L 4YPGA 4KY2A 1CLYH 5HYQA 3UADA 4XB3A 4YZFE 1I3RB 5TH2B 5CP3A 3QNYB 1BLIA 3TO2B 3ABKB 4FABL 3BEWB 1D9KC 4HV8B 2JB5L 2BZDA 1FO0A 4HULB 4H2CA 1RMFH 3MUGA 5L7XH 3HZMA 4ZFOA 5BO1L 1XF5A 4NZDA 1AHMA 4AKQA 1AXSA 2Q6WB 4W4NA 3VUAA 4P5KA 4Y1AB 4ODWB 2NXZC 3Q6GL 5EZJB 4K94C 1OXYA 1G7PB 4FN0A 4Z3FA 3OR7A 5ADPH 4MNGB 3W39A 4R6UA 3BSZL 1ASOA 3BFQG 3BW9B 4YK4C 3MLWH 4FKHA 3TO4D 3HE7A 4AEIH 3LZFL 2I9TA 1R3JA 1MJ8L 5IKCB 1LO2H 4FNRA 4G43A 4K3JL 1CG9A 4QJ4B 2YQ3A 3AADB 3RGVA 1CDUA 2Q2LA 1QFHA 4PMEA 4NQUA 4UQ2A 4HIXH 3OM3B 1WICA 4Q6IB 3R19A 4I4WB 4R8WH 3LV3B 1K9TA 4LEXH 5EEYA 1KIRB 1UOWA 4MVBC 4U3SA 5F9OH 5C9JB 1LEIA 2NSQA 1HEHC 3GBLA 1DCEA 3DIVA 1DQJA 4KROC 1U8MB 3QO1B 1X5GA 2P49B 1TETH 1RK0A 4FP8H 3QORA 1QHPA 4YHPA 4ZAKC 5T1DH 2I60L 4H0GA 2ZOLB 1LEKB 4I0CC 4FQCH 3LN5B 2WJ5A 1FF5A 5D1ZD 3V6FA 2FR4B 5D7JC 5F1NA 4N0UA 3U0WH 1JZIA 4LOEA 4BFFA 5F21B 1IFHL 2ISDA 3DX3A 4PJXE 3R8BB 4YDKH 1IGTA 2EEAA 2VWEE 1PZAA 1AQKH 1NAMA 2BVOB 2EDNA 2BNUA 2JE8A 4YHLH 3M46A 4L1TA 5CWSA 4XMPH 3S4SB 4ZNEE 4K8RD 4L1DA 1KB3A 3F7VA 1E3XA 4LHUG 1Z3GH 2AZUA 2EYSA 3T8XA 4M7KL 2CLZB 2DTML 4X5PA 5HGDB 5E24E 5F9AC 1HYRC 2XTJD 4HOXA 4OGZA 3EDFA 1IBBA 2G5UA 5B1KA 3VRJB 3L1FA 5K9OA 3MKGA 2P7TB 3SQRA 4EMZA 3RPBA 5BMFL 1FH5L 4YSSA 3SY0A 4JG0L 3TA3A 5MENA 1RIHH 3B2UD 5IMMA 2PLTA 1N19A 1MY5A 3ULVH 2ZSWB 1I7RB 4N0FB 1WBZA 4BINA 2YMTA 4MXWL 1ZE3C 4JHWL 4QYAA 1P5VA 1RUML 2X6MA 4X5WB 3VWJD 4UNVA 3R0NA 5IZ7A 2EP6A 1DVXA 1K2DA 3T1FB 4TVPH 3LEVL 3P4OB 1UXWB 2IH3B 5EBWB 4JFDB 5IR1B 1HAWA 2FIRT 1KUMA 1OCRB 5DFVD 3QJHB 3V8OA 4RAHA 3CSYB 5E6RB 4KUZH 1XO8A 1VFUA 5HDBE 3ZKND 5I8OL 2EVHA 1NKOA 4H5SB 5FWRA 2D8KA 3WTUA 1U8QB 1YCSA 3OF6A 4M1GH 4NSKB 4UQIM 1UM5H 4O5LL 5IB4B 4MS6A 3WAJA 4OUUA 3NFSH 2BDNL 2VXQH 3BKMH 4RDQG 3VXSB 2ADIB 2Y22A 1QG3A 3KPRD 4LLMA 4CJ0A 1S5HA 1SLVA 2Y36H 4GG6F 1I85A 3CDZA 4QKXB 3T6XA 1BAGA 3MHZA 5I6MA 3RGBA 2Y3AA 4XI5C 4YSUA 3QDGD 5CJOH 3EW3B 4F15B 3GI8L 4Z7AA 5MI0C 1IAKA 1Z7JA 5L2KA 3SE8H 1NUFA 2R1YB 2NNAA 1E43A 5L8KB 2AV1B 2EVGA 1SQ2N 1CI5A 4KV5F 4U1KA 5CO1A 4XMWA 4C59B 3UG3A 4HX1B 3GSOA 3SDCC 5IOKA 4PVMA 2NY4C 1HL4A 4Z7VB 3IS1X 3P4NA 2YUVA 1ZGLA 4QRPE 4F8LA 3Q3GB 1MFNA 4QEGA 1KBBA 4FFZA 3IJHB 4NBXB 4YDIL 8CGTA 5EEXA 2XBDA 2KHAA 1DVZA 4HK0B 3WFEH 5CZVL 1EV2E 3ELQA 4C58B 1FNLA 2G60H 1I8MA 4WUKL 3OXRB 4EUPA 3BN3B 5AVRB 3RVUC 3RX5A 3LAFA 1OAYH 1DBAL 2Y72A 2IWKA 3UXFA 4XH2B 3HI1B 4Y5YB 3POCA 2ICWA 3TNMA 1UM4L 2ZPKL 1QTPA 5D1XD 4OIAA 1J1XH 3VFOA 1PLCA 2EUVA 1U0QA 4IMKC 2LLLA 4F27A 4JNXA 1YJDC 3ZKXC 1AOHA 1WZLA 2XFGB 4KY1H 5HP5A 3L3HA 1K3IA 4Y1AE 4ZMLA 1Q94B 4XODA 4XAWH 1HZHH 2XA8H 3HR5A 4MNGE 3VX0A 3BP4B 4GBXB 4S1DC 4ZNCD 5CJXA 1RZGA 4RMQA 3HR6A 3OKKA 2GSGA 2K0RA 43CAB 1E40A 3QT2A 3RWIB 2HFFA 1YQVL 2F6AA 3EDJA 5EU6B 2O6FA 1RULL 3EOAA 1TT6A 5LBVA 1KULA 5AW2B 3QUKA 5KJ4A 3GKWH 3MLYH 4M1DL 2WLMA 2BLFA 3SOBL 1PU0A 2JJWA 1KF9B 4UILL 3X1GA 3VXPB 5AKRA 1ZJBA 3I9AA 4MASA 4QHKI 3ZMEA 3TEXA 3BZ4B 1T7ZA 5KTEL 2GSMB 4LLQA 1YRKA 3HTLX 4N87A 4WJ5B 3GJEB 3QZOA 5I16A 2I5YH 2AJSH 4WAFA 2EIZB 2KBGA 5K9JH 4FTVD 3WO3B 1MRDH 5E1AB 1KLGB 3DOSA 2WIIA 1VLXA 1MQKH 4XPTH 4ZD3L 5IQOA 5F3BB 5BCAA 2WZ0A 1VACA 3GXNA 4M7LL 4XE0A 4QRSA 4AVKA 5GRWA 4UB0H 2BVEA 3HW7A 2PYEA 5EDXA 5IWLA 1E4WH 1OCWH 3B1TA 4K0OA 3UYPA 3WXVH 4Z7NF 4U7SA 1WS7A 4AG4H 3DMMC 3GSRB 1SM3H 4OJYA 2KKQA 3PXJA 4N6RB 1Z32X 2WVVB 4NZTH 5EO0A 1SDYA 1PZ5A 4JX0A 1KXHA 1U6AH 2VLJA 4BA0A 1FL3A 2HJFA 4RNRB 1QBLL 4G80A 3MA9H 5CSZB 1U3HA 2WBJA 4ES8A 3O8XC 5DC9B 2RR3A 4P5RA 5CM1A 4DEPC 5J5EA 4R4FL 3QC6X 2R7EA 1S7VB 4OF8A 1S5IL 1MELA 1H3UA 2A6JA 4C56B 1F3JB 4HD9A 2CBQA 4XTRD 1UJ3B 4PV8A 3V6OC 4ZUTB 3ILQD 1B0IA 5AUMA 5FGBA 3IGAA 3MFFB 5D1QA 1N70A 5AOZA 1NFAA 5E2WL 3P54A 1MCFA 4NQXB 2XKNA 2BNRD 5C0CB 1AGCA 5DZJA 3H9YA 4U1MA 5DQDH 5EF2A 1KZYA 2FH6A 3QEUA 2IV8A 1LO3L 5FYKU 3IBOA 1TZ8A 3RNQA 3T71A 3P0YH 1BV8A 2GFBA 1F4XH 1I4FB 1DQLL 1I9RL 2BHUA 2CO1A 4RMSA 3T2OA 1F58H 4GRLC 4OLYH 4WO4C 5GJTH 2AMGA 2AFNA 3BH9B 3D7PA 1EJ8A 2QJDA 2MQGA 2DKUA 4L4VB 4O4YL 1BF8A 2V17H 3NAAL 5F93C 4JRYE 1J8HE 5TQ2L 1EX0A 2ZKYA 3C6LB 3ZHKA 3WIIL 2YAHA 1E6JL 2Y6TE 3QUZD 5M7QA 2YXWA 1MFBL 4NUQA 3VXSE 1L7IL 3WDHA 3NCJH 4CGUB 4OLZH 4FEMA 5HGGS 4XNXH 1QTYT 4PR5B 4DKEH 4N8UA 2NNCA 2OMVA 4FZEL 4LP5A 1RVFH 2EXWC 1UWYA 1ZA6A 3NIFB 3KGSA 4UF7C 1HHHA 4HKBB 4UNTA 2AQTA 2GC7C 4A6YH 4OZHA 3S36X 3GEFA 2IJ0C 4NP4L 4XNQA 2GI7A 3RE0A 4G8IB 4MA7H 5HPOA 3L4CA 3ZDXF 1UWFA 2WP3T 2ZXEB 3G5YB 1URIA 3AB0B 1IC4H 3EG9A 1FLRH 3JUZA 1I8KA 1DLHB 4WGWB 4XC3L 5SX5K 1TSHA 1EZLA 4IKIA 4Q56A 1KSRA 3U6RB 3D18B 5KSUA 4ATWA 1SN0A 4XN7A 3AT9A 1JGUL 1N67A 1YEFH 5J9PA 1WWCA 1B0RA 3LQAL 3GYRA 1CFQA 3OMZA 3WNJA 4LNRB 3C60C 5B3NA 5C7XL 2PWGA 2XN1A 1D7CA 2F8IA 2ZKXA 4ZX5A 4FXLA 2WCGA 1AP2B 2DOCA 5T5FL 5ESVB 2CUAA 2WSKA 3FO2A 1JDCA 1MLBA 2XQBH 4X6EB 5TFSH 3TEWA 3IU3A 4PP1D 2NY3B 2A6IB 2WB1A 3DTXB 4BEIA 1QBMH 3D69B 4J6IA 4TTDD 5I1LA 2CRIA 4Q52A 1RZ7L 1EHKB 4Z78A 2FBJL 4BQ9A 1MWAA 4UDUB 5C0IB 1TCRA 3QJFB 3DJRA 4ZW3A 5IJKC 4D9RE 1FDLH 3EYQC 3IU4L 1JZ5A 1N2RB 5IROA 4G8AC 4NWTH 3O11B 2YPLB 3FU0A 4BD4A 1BZDA 3NCWA 2IQAB 1I3GL 1M57B 3FQNB 4W81A 3GXTA 3OZLA 1AGEA 3BDYL 4J4PD 1FP5A 5EU4A 4LVOB 1KY7A 2VQTA 3TWCL 5D2NA 4DO5A 4K8RC 9PCYA 3K0YA 5T1JA 1JPFA 2R59A 1MH5B 2IDSA 1GGCL 2JKNA 1NFDF 2KDYA 3DPDA 2Y07L 4OFPA 5IQ9A 3HG1A 5EU6E 1WA0X 4YQXH 4TLUA 3WS6A 1TQCC 5EPMB 3OLIA 3ZHFA 4NQEE 4YS4A 1BQHG 4A7GF 3GXPA 3QIWB 1PZUB 3WYRA 1RCYA 4K3DH 3EGDA 3VXQA 3H42L 1XXDC 4Y88A 1MCIA 2R0LL 4MYPA 1CVSC 3B2UC 1X5LA 2R1XB 3EFDL 2NZ1A 2P8LA 3Q2NA 4PHXA 4ZUVB 1WIPA 5C08A 3AM8A 5DJCA 1MAML 4TYUA 1N0XH 4ZFGH 4BWTA 3MRHA 4LSDA 1JYNA 1AS6A 3BAYA 3IJ7A 1GXEA 4JPIB 3MO1B 4ZT1A 4F7PB 5D55A 3WAKA 1QOKA 4O2FA 4CSTA 4Y5XC 4DP2X 3DUUA 1ZVNA 3ILEA 4PRAB 2OX5A 4Y9FA 2Z34A 3AQDA 4QF1B 4YHKL 3DROB 4KRPD 2ZYHA 3UBXI 3C5ZD 3CXDH 3S96A 5F89B 1MHCA 1N4XH 1YNLH 5DK2B 5DQJB 1C16B 2FYVA 3D3VB 4JY6B 1TPXB 15C8L 1B3IA 2VSKB 1T0NA 5LNEA 1RURL 3RY4A 2E7LA 1M6OA 3MZGB 1EA9C 1TJHL 3QUYC 3FZUD 1QD0A 3UZVA 4J7RA 4S1RL 5DSCA 4HIPA 4EOWH 1HI6B 3RY6C 1AXTL 2G75A 4JN2B 4UT9A 4U1LA 2D2CC 4I0PB 3BJLA 1R0AH 3HB3B 4KK9C 3LXBA 3MNWB 4UV4H 3NABH 4GXFA 3PWPA 2AJZA 3MGTB 3NYKA 4Z7UF 4XBMA 1CLOL 3KGTA 2R4SH 4L37B 2FO8A 5I6OA 4G8GE 4YIQA 2WGXA 3UJTH 2MTAA 2J73A 2YRZA 1X7TA 3NEOA 1CD1B 3FH7A 4PRPA 1HK6A 3PWVB 4E9XA 1WC7A 3REVB 2NLJA 5C0CE 1MFDL 4AM0B 4JFYB 4ODSL 1BREA 1OO2A 1BXVA 4G6AD 5DRWB 3U2JA 3HMXA 1EVTC 3VXNA 1ZRUA 2R0ZL 5LAXB 2EIDA 3RAJL 3S3CB 5D4JA 5ESAA 2Q8BH 5FEBA 2A9CA 2P5EA 5J3HC 3LNFA 2XG5B 4QRPD 4YHML 1WH0A 3HZKA 3NFNB 1WT5C 4IW4C 4M6MH 4NZRH 4OQTH 3DHMA 4WGKA 2FSDA 2FWSA 4I9XA 5L9DH 1KGCD 2E27H 2YA1A 3G5ZA 4YE4L 4YHZH 5IM7B 2EEBA 2YGOA 4AOFA 3NJFA 4NNYB 5D2LF 5FM5M 4KQ4H 2R8SL 4APQB 3CFQA 4XNYH 2O5ZL 2CJUH 3L7FA 1P84J 5SX5H 2FL5A 5D7LA 4U6HB 4ABQA 3QDMA 1BDYA 1KGWA 1PD1A 2QELA 4P2QA 3GZPA 2R9HD 4LARL 5SX4H 5DZAA 1BXUA 2I69A 2FWLB 4HS8H 4C4UA 2H5UA 4GPVA 1RFDH 3MGAA 5KAQG 3TZVD 4JO2H 1IZKA 4TOYL 4FQPA 4Z8FL 1QR1B 3HPJA 4Y1AD 2VSDA 1AD0B 2ZYIA 5IQ7H 5KEZA 1KTJA 2ADJA 1X4XA 1MCOH 1EMTH 1NBZB 2WXPA 3WBDA 1IGFH 4W4OA 2AQNA 1GS8A 2H9GB 4UOW0 3L5IA 5F3FA 2QMKA 4GMTH 4KKBC 1UWEH 3GZOA 3HKFA 2XN9A 4EBQL 1YMHA 3HLAA 5JW4Q 3ECQA 2X4OA 3B43A 4M61A 5AB9A 5HYJB 3TFKD 1ITBB 2VDQH 4XBEH 3LH9A 4LBEB 4JFQB 3IDJA 3HC4H 3CZUB 4ISVB 3JWNC 2EO7A 2CIKA 1DEDA 3AG1B 5I1JL 2DI8A 2PO6C 3WJLC 3WDIA 1O9VA 2P8PB 4PV1C 1R3HA 5IB2A 3D08A 3MLVL 2WNXA 1CXEA 5CINL 3D9AL 4Y19A 4NO0B 3HFFA 3JV6B 4MZRA 1P9MC 1PZ3A 1T0MB 4XNMB 3C5JA 3E2HB 3IWVA 2ZF8A 4NYLA 3HBGA 3E8UH 3LEYH 4UU9A 3LYRA 3CSTA 4IJ3C 1OGPA 3WOVA 2YPLE 3H1ZA 4NO2A 3FQXB 5LKNA 5DF0A 4ZMNA 4YDLC 1IM3A 5FFLA 1GC1L 2E74C 1IGCL 2ZCLH 3QXDA 2W0PA 1QLFA 3VMNA 4PG9B 3ARQA 5ALBL 5LBSL 1Q9KB 1ZD6A 5DVPA 4OZIE 3FFDA 1VHPA 2NYYC 2X0UA 5DJZB 5LXGL 1J5IA 5DUPL 1YAZA 3QEHA 5E2TL 2CDEB 2MPAL 2X28A 2A77H 2EE0A 2HP4A 3ZTEA 2FB4H 7TAAA 1BVKA 3GK8H 4HDIB 4N2HA 1IM9A 3HUJB 3K5RA 4X50A 1G6RB 4PS4H 2E4FA 4IOIA 3EO9H 2N7SA 1RL1A 4P2OC 4DW2L 4D7PA 2JFCA 4X4KA 8FABA 1HYSD 1NAKL 2XBTA 4GFTB 4AYFB 4RSYA 3FQTB 4OU3A 3WNMA 3H3PH 1SJVA 1KIQB 2D7PA 1LEGB 3FQRB 1WYJA 1LO0H 4XC1H 4GAGL 1QLRA 3UZEC 2LU5A 4CW1A 2JI1A 4H44C 2QV2A 4JFDD 1FYHB 2GKIA 1D9KA 2VDRB 4I8DA 4NJAL 1JNNL 1NUNB 2OJEA 4IK7A 5IVXB 4R0LC 5CILH 2EADA 4AV4A 1VFBB 3SPGA 3ILPA 2OCCB 4L9LB 3LRHA 4ZUUB 4LHJB 1T0PB 2XKSA 2VABB 2W65B 5CGYD 4R3SA 5TF0A 1BF2A 4JREB 4BCZA 3WJMA 1J8HD 1QATA 3CCHA 3JV5A 4N0YH 3RP1A 5D96C 3FRPB 2L4OA 1HC1A 5BJTB 1CS6A 3EOTH 4AGQA 1BBDL 4X6FB 1YZZA 1H3PL 4MJ6A 5AVUB 3BFOA 1DQDH 4TQHA 3VXSD 4ZODA 4MDIA 5LDSA 5IVOA 1HQ4A 2DQMA 4PBVC 5EOCJ 2YFOA 4R26L 3N91A 2ZKMX 2QEJA 3C08H 5CZXC 2LQRA 5ICXA 1DN0B 3ARDB 2HKFL 4LU5L 1E2VA 3PY9A 5IW6A 1W8OA 4DTGH 3HCVA 1UZ8A 1H5BB 5IBLC 4Z7IA 2ZKHL 1EAQA 5EZOH 4BH7B 5ADOH 2L7UA 3SGJC 2JXMB 5C3IA 3EYSL 2YMXH 3WTWA 3DA0A 4UIMA 2W80C 1BCIA 1KDJA 4IOSA 5J12C 2HJLA 3H9SB 5DVNA 2ZWLT 5BUPA 3I02B 1HXKA 3VU1A 4XP5H 3FQYA 3MV9A 4BV1A 2BCMA 1LP9B 3F83A 4K5OA 5F7DB 5KW9H 2VR6A 5I1GH 2YAEA 3QG7H 4WTZG 1TZGL 3LKPB 3EOBA 4NT6A 3C9NA 4HH9B 2WMPA 4RMTA 3ZVVA 3L4YA 2Y1YA 5E5UB 4MTMA 2CA4A 5H94B 3L4UA 4N5ED 2WXFA 3MRBB 3TIEA 4AQEB 1I3UA 1KCBA 1VFMA 3C12A 3GINA 3I74A 3LOWA 4ZAKA 5FO7A 3ARGC 4WI5A 2HMID 1INDH 3WE6A 5E99L 1P7QA 4UOZA 2P8MA 4WFGE 1F18A 3QAZB 1RZKC 4ANWA 3GMMA 3KAAA 1GOGA 4JG1L 1AANA 3CFEB 3F6IA 1R46A 3H54A 4QTIL 5JW4N 4WQOA 4R97C 3BI9X 3ZO9A 1AGFA 4RZCB 3BAJA 2AEWA 4HPYL 1U8PA 2Q2EB 4ZK8A 3S36H 1NBVL 4D9RD 3BSGA 4F58H 1PIGA 2ENPA 3OXSB 3A6OA 1U8HA 4TLKA 2DB8A 3CH8A 5F7NC 2AXFA 1Y1UA 4LNVA 1C7SA 5CR1A 3RFZC 3FDWA 4UV7H 2VWEC 5EU7E 2VC2H 4LLUB 5ACZA 3FCSB 4GBXD 5DJ6A 1R47A 1VADA 1L0XA 4HEPA 1JGVL 4OLWL 3T4AC 1IFRA 5JHDE 4JDTH 4O02L 4I5BB 5E4OA 1NLBL 1U36A 2X2UA 1P7HL 4QR7A 1UOLA 2V9UA 4IYKA 3F7RA 7PCYA 5EU6D 5FS5A 3RILA 3N40F 5C07A 4M5YH 1YVLA 3QWOA 2G2RB 1R5VA 2JIXB 3MJ9A 4NQED 1RLBA 4BZ1A 2AJXH 5HYJE 1A21A 5FDWB 5C2UB 3WTSA 1U58A 3LB6D 1CIDA 3F2LA 4ZUWB 5MEOB 4I1RA 1IARB 2UZYA 4NNPH 4ZS7L 3H3BC 4DP0X 1A4AA 4I2XA 4HLZH 4EN3B 2OMNA 1ACXA 2G3MA 1MCWW 3U7WL 2PYFB 2CDGB 1S7QB 4G1MA 5DJXB 2AC0A 2V7HA 2VDOB 4PBDA 2EIKB 2BMKB 3IRZA 5KVDE 3GLAA 5LCVH 4ZFZB 4ODUA 1NGZA 1TTCA 3T2NH 2C3WA 4CBZA 5EB9A 5IQMA 2IBZX 4MWFA 5ANMA 4QNPF 1U33A 1TQSA 3BIKB 4PJBB 2P5WA 3G3LA 1PDKA 4G8EB 4LCCB 4FNPA 3GSQB 1GOFA 2FGWH 2ENYA 2V4LA 3FRPG 5F1OB 5FHBL 3CDGA 3X3FH 3TPUB 2UY6B 4BKTC 1A7OL 4TQPA 3JWOL 1HSBA 1ETJA 2DM7A 3BD4A 3FU3A 4WTWA 2ZWNA 5DC0A 1QNZL 2H1XA 3WHXB 2EDHA 4JDZA 3OC5A 3HUJE 3LPOA 4LMQE 2R0KL 3QG6A 2B4CL 4HJIA 3EDEA 4I18C 4PB9H 3SDCA 4WTXA 3PYCA 4Z95L 2GEQA 2F5AL 5CAYB 4XP6L 3BH8B 4N0CC 5C0RL 4H7VA 1CXKA 5FYKL 1OLLA 3SKUD 2AV7B 5IBTL 4YHYB 3C2AH 4M7ZC 1JNHB 1PKQA 2ZXAA 5AYTA 4F2MA 2WSDA 1K8IB 1EFQA 4LL9A 4M8QA 2VDMH 2ESVB 3UTTB 3GGWB 5BV7L 2O93L 1OANA 5C0CD 2CU9A 4D0CA 1NH6A 4XNUH 3QR0A 4MQTB 4TRPH 1A7NL 4WHYG 3WN5C 4D9QE 2JKTM 4GW4B 4B41A 4APXB 2VNCA 3FTVA 1NCDH 5E1GA 4YHIB 2YMOA 3WNNA 4G7QB 5IVXE 1MHEB 1DVFA 1HHJB 1R17A 3QVAA 4IMKA 4FI8A 4OB5L 3KPOB 4L4VD 4UNUA 2WKOA 1QSEE 3K2UH 3NGBC 3C6LD 3ETBJ 4NWUH 1WFMA 2XPZA 2VLKA 1J5HA 4NN6B 5JNYA 4GKNB 2H3KA 4F3FB 4H25B 1BFOA 3FO0H 4TN9A 5CZKA 5B4MC 1F0LA 1D5IH 3NCMA 1UKTA 1NANI 4FJZA 4YUEH 4KTEL 5LB1A 5GGVH 1HHKB 3ZE2F 4UOW1 2WLZA 4GKOA 4KXZH 4KVNL 4UAOC 4HVBA 2KT6A 1AQDA 1D5MA 3DX6A 3FN0H 4GIAA 1V7NH 3TZVC 1RKRA 1ZK5A 2QPFA 2SEBA 4A2FA 4Q9RL 2VDPB 1HFUA 1QI5A 2WWKO 2IPTH 4UM9D 4Z23A 1WD8A 4XCFL 2ZXBA 1LP9E 3CSPA 3NT0A 4HHGA 2A83A 2CQVA 4PMFA 4TUOB 3ESNA 5ICUA 4X6CA 3RPIB 4IBVA 3MNMA 4JRXB 2ED9A 5GRYA 3W9EA 1MFAH 3IMTA 4QXGH 3OHXB 3MOAH 4U0RB 3VGEA 4FQ1L 4UM8A 5KYWA 4ELMB 5C92A 1TTUA 2PCPB 4Y5VB 5HHQA 4NM4L 1FIGH 5ILTL 4MCYA 2BOCB 5E8DH 4BH8B 4M5ZL 1GZPA 3FT3A 4DFHA 4ZSOB 3CHQA 4LEOA 1IU1A 1DDHA 4LDLB 4QWWD 2NY3D 4UIKH 1OK8A 2N1TE 3DMMA 1FBIH 2VAAB 5F1IA 2BVPA 1IB5A 2X41A 4N90E 1LO4L 1F4HA 4XPAL 1ZVHA 4FG6D 4HC1L 4AGMA 3KLLA 5DRZB 4XP4L 1WZ1L 3PFUA 2VH5L 4H1LG 4ZYKB 1OGAA 2YPLD 4FQQA 4GAYA 5HY9A 5CU9A 1PBYA 3O8XA 4PN6A 1YJDH 5MERB 3IKCB 3N2JA 1DVSA 4KITB 5EDSA 2ZSVA 3DVGA 3V6OA 1THCA 2J20A 5BQDA 3NK4A 3QCTH 5D1ZI 4POYA 3V4VL 1KCVL 2HYMA 2E76C 3L17A 3QJSB 5FCSH 4OIFA 3NEXA 2EE3A 4JFTA 1A6VH 2XPYA 3HE6B 1KBGH 4PTUB 3FPYA 5FIEA 4PJAA 1W0VA 3C09B 4FQJH 1IIIA 2EVFA 5DRNB 2X5PA 3IETA 1D5XB 3QIWD 5E94B 5AAPA 1ZIAA 4XT1C 3LNGA 5DYFA 2E46A 3HRZC 1T04B 3IXTA 1EEZB 5F0MB 3LH2L 4B9IA 3PHAA 4GRLA 4WO4A 1HYSC 1KEMH 2PCFA 1N10A 1HNFA 4DESA 2XG4B 3D39B 2RH0A 3P69A 3LKQB 3WGUB 2O1AA 1XCWA 4I9WE 4DWHA 1YEIH 5DK0B 5ABAA 4KZEL 3SCMB 4WFEE 1C5CL 2IGFL 2FEEI 3SKMB 3V95A 5BZXA 2CKBA 3DTUB 4HAGA 1IAIH 4EIUA 1GYWA 4R4BB 3DK2A 3TESA 4B9CA 2X4PB 1FL5A 2HTKC 3P0VL 1NIEA 3MRRB 4BSWB 1QP1A 2HG5B 1GA2A 1OF2A 4L8DA 4AEHH 4QOKB 2HFGL 2ZJSL 1YSOA 2OZ4L 4RX4A 1J1OH 1Y18B 3V9EA 4M43L 1FZKA 2Z8RA 3BGMB 4KK8D 3BAEL 5AVQB 5K39B 1EO8L 4OFKA 3TH4T 5CD5D 5CIPA 4EAEA 4Y2OB 2KL6A 5C09E 3H4FA 4HKXB 3HB3D 2P26A 3I6KA 4WGVB 2COVD 1ILUA 1XGYL 3WDJA 3C60A 1L6XA 2WJ7A 2EECA 1PD0A 4RRPM 5E1HB 4B3EA 5DJ8A 2FHFA 1K4CB 3UPCA 3GPEA 4EF3A 5C1MB 5E8PB 3L6FA 5E6IC 5A6IA 3LQZB 1G7MA 4G1EB 4JY5L 2ESVE 3EDDA 1YPZB 3UTTE 5AW8B 1X5HA 4JVWA 1J8SA 4AY0A 5HYFA 4BM7A 1FNSH 3BHBA 1CT8B 4PJHF 1YEEH 4BA8A 5DI8A 3NFPA 3SPIA 1J9CT 1ORQB 3FUMA 4QHNA 3NBNA 4N5EC 4N8VB 5IJKA 3NTCH 4PJEB 1DVQA 2YA0A 4HBCH 1JPTL 1NDGA 3A23A 1DP0A 3OTTA 3PDOA 2I07B 3B2DC 3BPOB 3MQIA 3NEEA 2HMIC 3ZMRA 3EYVB 2FEDD 3G5VB 4LAJH 4EZLA 4WFGD 4KK6C 3LVEA 2QHRH 4HALA 4TUJA 1KDIA 2VMFA 4TNWF 4Z7WA 1FFPA 4GAFB 2QQNL 4APQD 4HFWA 1G6RH 1J1PL 4RGOH 4BK4A 5I0DA 4YWGL 1XIWB 3GNMH 4I77L 5KSBF 3LIUA 4L8CA 4IHOA 1JVKA 1O7DE 2VDNL 2VKWA 3IJYB 3QJQB 4GRWB 4NKQB 1T80A 3BT2H 3KWWA 3MMEB 1K8DB 3TBWA 2OXHA 5I0XA 4LT7A 4PWIA 2IOIA 1U8NA 5FV2A 1E42A 3MBEC 3UDWC 5E6ZA 1QBAA 5JORB 1MPAL 5B39A 2OQJB 4FL4B 3V9FA 5I66A 3L3KB 3JV4A 3G6JB 3VFUA 3BP6A 4JFEB 4NBYB 4Y4KB 4WNQA 5JHDD 4B96A 5FGCE 1GRWA 1M9SA 4JRXE 1A9VA 2B5IB 4N85A 3C8KB 2EDTA 1TZIA 5CIPH 3I6GB 3A4DA 5K9KA 5ISZA 5HYJD 4M4RB 4ELME 3GSNA 1F6AB 3BUYB 4YGAB 4Y5XA 5I6LA 4CDHA 3T65A 5D72H 2CDFA 4OIBA 4QYOA 4HGWB 1SHSA 4JKKA 5E8NB 2ADFL 1DTUA 3PGCA 3WIFA 4WI0A 3I9PA 3BVWA 4OF5A 5DJDB 2A9NL 5KSAC 4AEFA 5ICZB 4U1HA 2O6CA 4NO0D 1MNUL 2P3YA 5J6SA 2ITCA 4WHDA 4JFFB 2OSYA 4K5NA 1MCKA 5I1CL 1LJMA 1NC2A 3QUYA 1YY9C 3IPEA 1QZ1A 1CXHA 4ZFFB 3WEXA 4Y2DC 3MLSL 1F8TH 4LLVB 3RY6A 1XX9C 2ICWJ 4U1SA 4HKZA 2OMUB 4ILDA 4S2SA 1AGBB 1N59A 2VR9A 2WK2A 3NESA 4ODVH 4TQEL 1CGSL 2BP3A 4EN2A 4OLXH 4Q74A 1KCKA 3ZR6A 3MPCA 4X9FA 1T2QH 3F7QA 4X8JB 4CN6A 1L5GA 5CR8A 1JGLH 5E5MB 5LGKA 4P3CL 4AUYA 1DJWA 3ARFC 3C6EA 4LQFH 2DWEB 1HKLL 3WIHH 4ZTOH 1KG0A 2G9HA 1ZA3B 3NPSB 4JGJA 4BUHA 4PW4A 4LLDB 3KPNB 4P59L 4CVXB 4OD1H 1S4IA 3NACH 5CGBA 4Y4HB 4ZZFA 3JTSB 1NSNH 3LZQA 3N9GH 2Z7UA 4HJ0D 4YDZA 1QTSA 2GJRA 2ZXWB 1AACA 1WT5A 3VSTA 3ZZSA 2GT9B 2VMCA 4L0PB 3ULUH 1IEAB 3D39E 1HH6B 2VITA 3CFJA 2J2ZB 3INUH 5T5NF 4KRLB 2CM6A 4IS6A 5JW5A 5F9JB 3KCPB 5JPMB 1NCCL 2C4XA 4N8CH 2PR4L 1KC5H 1KMGA 2VLRB 1F1AA 1U8KB 3M17A 4KTDL 1YYLH 5D1XA 1NC4D 3KYMB 3RL2A 1QI4A 1U8IA 3DGDA 4EPSA 1U93A 1T6WA 1WFOA 2F53E 3PGDB 4LEBA 4PJ7A 4N25A 5T3XH 1JWUA 2IDFA 1ZY9A 4YR6B 1G7QB 2ED6A 4WKZB 5F8QC 3RQ3A 3TYFB 1RJZA 4NJ9H 3KLDA 1BD2E 1NGXA 3SQBB 5J56B 1VEMA 4DVRH 1IKFL 2P46B 1BAWA 4UZGA 4IDLA 2DMCA 3EZJB 2WOYA 2FJHA 4AT6B 2W07B 3VRIB 4D7BA 2Q76B 4JHZA 3ARDD 3L4VA 1CDJA 2PTTA 5H37A 2J55A 3O3BA 1AR1B 1FZJA 1I1YB 2UYLA 3AW5A 4WY7L 1CLCA 1LE5B 4XBPA 2A4CA 2WANA 3O2VL 2Z0UA 2XQYG 2VDOH 4WUUB 3H9SD 1YEWA 1SN5A 4FFYA 1OE3A 2VYRE 1WFNA 2PO6A 3IMUA 3O9WB 3WJLA 4OF7A 1JK9A 4IBTA 5HVHB 4O2EA 3VSUA 2C7UA 4U4BA 1P9MA 1YEDB 1XZ0A 1UCBL 3PNRB 1A6PA 3K2KA 1A4JA 4LVNB 4PJFA 3T77A 1RZ8B 4PJGA 1YNKL 5I1EL 4HPOH 5TF1L 4U3XA 4YXLH 3RWEA 2GQHA 3HS0C 4FZ8L 1SHWA 3MBXL 4TNFA 3LD8B 1HNYA 2OCJA 2FX8H 5BQ7B 2BPBA 4RQQB 3VXOB 5I6NA 5I8CB 2WP3O 2W5PA 1GGUA 1DQML 5FKPA 4XRCA 3VD7A 2XIBA 4GXVH 4N90D 3V0WL 4D0DB 4Y16B 4UQ3A 4PVBA 4FG6C 4GG6B 1G1KA 2Y5QA 4NO3B 1WQVT 4R7VA 2YKLH 3G5XB 4I3SH 3CFBB 4GRWE 3DV6A 2VJ8A 4KXDA 1X5MA 2AXGA 4F7EA 2QV4A 1NDMB 1E3ZA 4O58L 5CEZL 3B6SA 4PWJA 1I1AC 1KWGA 1OALA 1DUYA 2OTPA 4P2OA 3DJZA 5TD4A 3G6JE 3U0TB 2VL5A 3DXAE 4Y1TA 5AW1B 2IMNA 2BW5A 3AS3A 1MHPH 3F05A 1JWMA 5T3XD 1FFNB 3KCWA 3T6WA 4EKJA 3D33A 5IVZB 4E0RB 1N64L 3GB7A 3KM1A 3UZEA 3TV8A 1A1NB 2JIXD 5CUSL 3F6LA 2OMXB 1ZT1B 4IIZA 5HDLA 5B1AB 3B9KD 3OMAB 3MCKA 1T20B 4R0LA 2YZ1A 4X6DF 3GO1H 4JLRB 3ARBB 5EOTB 1CXIA 2R29L 2VTFA 2XNAB 3ISYA 3LSOA 4OD2A 5FO8A 3GMNB 3PHSA 3UZQB 2VISB 4EN3D 3JWNH 3LQAC 2DIEA 3VYOA 2DI9A 3ZSSA 5INDA 4I9WD 4JFFE 4UWQB 1ACYL 1DE4B 1PYWA 4KJYA 4U1NA 4WFED 4P48A 4NZUL 3V0FA 2KZBA 3IBEA 3D51A 1PY0A 3WD5H 1OWWA 1ZHLA 4MMZB 5T1KB 4J8QA 1OY3B 2R2HA 4Z5RB 2HH0H 4BIKA 2WBKA 2BS71 1FWXA 3EDKA 1P5UB 3SPCA 1OPGL 1IGMH 2DQEL 1XH3A 3T8VA 3X17A 1J9TA 3PWNB 5BZDA 4U2YA 1TYJA 3BFWA 3SGJA 1AQHA 1NMAL 1U3JA 3A21A 3UYRL 3VXUE 3RVXD 3LRLA 5I1HL 2XYCA 2B0SL 3LHPL 4KK8C 5CD5C 2GAZB 1X5FA 3IFNH 3MX0A 3KL5A 3MRCB 4MB3A 4XO8A 2AANA 1ZLUK 1EVUA 4M62L 3UTPD 4IGBC 4DZ8A 4JO1L 2VXSH 5MP6L 3NDYE 2PWEA 1H8OA 2X10A 3DURA 3ARSA 4IOFC 3D2UA 4BWUA 3ARGA 1FO0L 1HJBC 4HA1A 1WFUA 1Y7VA 3ABZA 1OP3K 3Q1EA 1BGXL 1DUZB 2ESVD 2E56A 3SY6A 3UTTD 2TAAA 7CGTA 3FCUB 4YFLF 1HEJC 4ICWA 1YYML 4GKSB 1MCWM 1N0LB 3LHAA 3QQ9C 3GHPA 5F9WB 1J11A 1LD9A 2C9RA 2WTRB 4NHUA 3FRUB 1KCUH 4OR1A 4MJJA 1H0DA 1DQQB 4A2DA 1QW9A 2R2CA 3HMWL 1AZBA 3DDFA 4W68A 1Z5LA 2FEDC 2AJ3A 1ZKAA 2VKXA 5GSRA 4M8UA 3P4MB 5FO9B 5CJQL 3W0WA 3RFZA 4AIOA 1MCLA 4IU3A 4LE8A 4R90H 1AYOA 1CDCA 1Y07A 3B9EA 5SV3A 3U6XS 4Q97A 2R56H 3FT4B 1GHFH 3RWHA 1L7TH 2WNGA 3KGRA 3T4AA 2FT6A 1PPIA 1WPCA 1URLA 1X5JA 3IAGC 2ATAA 4FFVC 2ICES 2CK2A 4NFDA 3H2QA 3QH3A 2ZG1A 4KMQA 3LKNA 1AZUA 1IGIH 2X6AA 1D3CA 2CO2A 2H2PD 3CU7A 5B7EA 3U4KA 5IMLA 3PHOA 1JFQL 2YAFA 4KKCD 1EFXB 4P5TB 5D4IA 4G9DA 3KNBB 1ZAGA 4IQHA 5D5ME 1B6UA 4ENZA 5EU7C 1MVUA 4IEFA 2H4EA 5HI3D 4MNQB 5TPWH 3HHSA 3OB0K 5A2CA 1JXGA 4XO3A 3OVUB 4JRXD 4BDVA 4LRNH 1TLMA 4JPWL 1ZEAH 1FV1A 1BQRA 3US0A 2FDBP 3N42F 3N1MC 3MRDA 1T66D 2IOOA 1NAML 3TBCA 3THMH 1JJUA 1WWBX 2ZCHH 3RZWA 2APTA 1Z9OA 4TULH 3PQYA 4X5QA 1GVIA 1XHHA 4PLKD 4OVUA 1SBSL 2RQEA 2WY3B 2XVBA 2YR3A 3CJJA 4ZFQA 3ZLQC 4J39A 1F4WH 4WV1C 5FUCE 4PJ5A 3BEVB 1JN6B 1U8JB 4HCRH 5I15H 1B9KA 4IBYA 1BG9A 1RZKH 2FGZA 4AXWB 1FN4A 3O3AB 3P2BA 4LHUA 1PCXA 2CCLA 1C5DB 1GPOH 4S0TD 2Z0BA 4I18A 2Z31C 1N5AA 2DWSA 3KYNB 1KJ2B 1Q0XL 1E5CA 1KN2L 1HDMB 2VXTH 2XWTB 3WFZA 2LAGB 2IFFL 5EEZA 1OTSC 1ND0B 3H7BB 5I76A 5FA3B 1XGUA 1F4YH 4H20L 4FFWC 43C9A 1YECH 3BWAA 2OW6A 1I1FB 3PE9A 4BUQA 1QNIA 4Q9CA 4GB9A 3GRWH 1FYTE 5GPRA 3W82A 2DLIA 3FB6A 3O3DA 1V54B 4ZOEA 4LRIC 3KR3H 2GY5A 1Z5HA 3HE6D 4L5FE 4X7FC 2IBZY 5KYNA 4L4TB 3WN5A 5C0JB 3F04A 1M7IA 4HQQL 4YHNA 4LKXA 3MJ6A 2CGRH 4YXKH 5EF3A 4HJ0C 3KWXA 3TYGH 4EJ1C 4BFOA 2D31B 5CJ8A 3EXLA 1RHHB 4ONOA 4LCWB 4AE1A 4N2DA 4NLHA 3D39D 3BYYA 1UB5A 5I82A 4J3OH 2YEQA 3LS4H 5GZOD 1A6TB 1GOHA 4AIEA 3F64A 1CFSA 4LLYB 5SX4I 3SCMD 4JB9H 2FSEB 1UQSB 1Z3RA 4KNUA 4XHJC 3VXMB 4ZW7A 1KEGH 1V3LA 3E3QE 3GSVB 2B16A 4KUCF 5FCUL 3QPKA 4OM0L 3A6CL 4NCDA 1BJ8A 1DQIA 4X5LA 2D2OA 2DQHH 2PMZA 3KMDA 1MCPL 4A55A 4HIEA 1ZLUH 3BPLB 4Z0BH 3VI3F 4HF5L 3ZKSD 4ADGA 2DTSA 1BQLH 3E1ZA 1WJ3A 5CLXA 4M7JL 5LXVA 3TZVA 2I9LA 5KVEE 2CRMA 3B3IB 4QOKD 4Y1AA 4HWBA 4K71C 3VG0L 3VGBA 5J6GB 2VRQA 1Q8MA 2WXKA 5JIQA 2DMHA 5DMJB 2BK8A 4LKCA 5SWSB 1ZT4B 4MNGA 1MF2L 5C0DB 1NFDB 1OP3H 1D2PA 2D0FA 3LRSA 3MRGB 1YEJL 4FFZL 4L9DA 1ZPLA 4HHAA 4NPYB 1WTLA 2CM5A 1CFTB 2ZG2A 3BUDA 1FGNL 5ITBL 5AWNL 3RTLA 4EI5D 3BVNB 1TITA 1E28B 1HOCB 3AREB 2H47C 1DSFL 1ADQA 3BPNB 4UMSA 2FT7A 3T4YB 3JUYA 5KYXA 2RBLA 2NNFA 4KH2A 5ID0B 2E5EA 3P73B 1WIOA 4LASH 1TJGH 5DUMH 4MSWB 1EGJH 1D5ZA 3C5SB 2WD0A 1S2EA 4F7TA 3IDUA 1Q1JL 1PGRB 1HXYB 4UDTB 3U9UB 3QO1A 2OTWA 4GOSA 5IB1A 1INQB 2DLFH 3RKPA 3S3SA 3D8MA 3VXRA 3W57A 5E5RB 3RZCB 1HILB 3H6AA 2Y5EA 2ZOLA 1LEKA 5CEXA 4DP7X 3EF7A 4HLEA 1OK0A 5IFAL 4KO7A 2VE6A 3QPXH 3DOIA 3UERA 3S37L 3SPVB 4GUPA 4S1QL 5EZLB 1G9NL 3BDBA 2P1YA 4U1GB 3PUCA 3STZB 3SKOB 1UWXK 3L16A 3HLKA 4HUXA 1MFCL 4MCZB 5GISH 1NIAA 1XGPB 3OB0H 4QXTB 1XIWD 1H3WM 4X0KB 5C6TL 3A0OA 4WW2F 1FNAA 1P4UA 2X1QA 3CXHK 5GS0D 2F7RA 1XCTB 2DKMA 2W0LA 2WAQA 2QMJA 1QFWH 2LGNA 2NY6B 4G7YL 5DT1L 3HRZA 2UX7A 3BSZA 4CSPA 4HWZA 2X87A 2O26U 2B7DT 3K1DA 2B1HL 1KLUB 3K8MA 4ODHL 4TSBL 2CIIA 2NY0C 1PLAA 4GS7B 1IIKA 2AQ3A 2ZSWA 1LILA 3DSFH 4HWBH 3N44B 2OK0H 4U31A 5HSFA 3M7FB 3JWDL 1AHWC 5DDHA 3B8YA 3QUHA 4G6ML 3QARA 1PG7L 2W9LA 4UTCA 2JJVA 3ZRSA 3ZE0B 4KVCH 4AITA 1J12A 4GW5A 4DUWA 4A66A 1ODUA 3PWUB 5BRPA 4HIJB 5F88A 4X9BA 4F5CA 2JV6A 3DI2B 3VFNB 5HHVL 3ZMNA 5EUKA 3QJHA 4W9CC 3B9KC 3BLBA 3LS5H 1N3NB 2PCYA 4BCYA 2EDDA 5BRZB 2ZXGA 4WNSA 5DZ9A 3KDPB 3CVHB 4EN3C 2NQCA 4NCC1 3I75A 4NSKA 3O41B 1J8HA 3O6KH 4JRYA 4S0SD 5HDOA 3K4ZA 3G6DH 1NJ9B 4PGJA 4ZMTA 4JFFD 4FQIH 1XCQA 1MEXH 2W81C 5E7FA 3QDJA 5ICYB 1I3VA 1AIFA 3G08B 1IX2A 2ERJC 5C2BL 1KV7A 1Z9SB 2ZCKL 5C0ND 3MCG1 1EDYA 3GRGA 5C0FA 5CSBA 5IUCA 1A3RH 1CGWA 1E65A 1S6NA 2EH7H 4L29B 1GIGL 4AGLA 3F5WA 3MRFB 1Q72H 1G9MH 1L0QA 1RZJL 2XRAL 3FU5A 3MLXL 4FQXB 2CO6A 3TL5A 3TT1L 3RX9A 2E7CA 4PEEA 3TBTB 3GEWB 1TFPA 5IEKA 3V79C 5J6HB 4J2XA 2MEJB 5C0AE 4FABH 1K72A 3B83A 4MJ2A 5E6IA 2JB5H 3RTQC 3TC9A 4G7VL 1P7KA 1MAKA 1W8NA 3A6BL 2AP2A 2O6PA 2Z93A 3F7LA 2BSTA 4XN9A 1LE9B 4L4TE 4OGAD 4Y4HD 5DTFB 5FYJU 2WQSA 2DMKA 2NNXA 3Q6GH 3CHXA 2F1EA 5IJDC 4LCWE 4HMCA 5SWZB 5H35B 2Q3AA 5IMKA 1ID2A 2X2HA 1WAEA 3BSZH 4MBRA 1E8YA 1DQVA 4N28A 2OI9B 1R34A 3LZFH 3VG9C 4P4KB 4N2LA 3OXRA 1JBJA 2H26B 3D25A 1MJ8H 3PJNA 4AK2A 1XB3A 1KTCA 4K3JH 4FNLL 4ZZKA 2K7PA 3VXME 1T7XA 2QFRA 4J3VA 4OFDA 3QJTB 4R2GC 5K1NA 1GW6A 4M6NL 2FJSA 3LMJL 3RIAF 1NQBA 3CZEA 1WO2A 4MB1A 4OV5B 4JDVB 3RNKB 1GJWA 2YFNA 3MBEA 4KH9A 3UDWA 2EYTB 4KDVA 1F2XK 3MROB 5DS1A 3N1PC 3BP4A 4L3EB 2CAKA 1S9VB 5TE6H 3UC0L 4OKVB 4Q9QL 3LZLA 1R3IH 2VMEA 3G04B 3OSKA 3SHSA 3P9MB 1O7VA 4CADA 2I60H 3QIBB 2C4FT 3WUWB 1FVCA 4YSDA 5C0GA 1GYVA 4BRVA 1O7DC 2R2EB 4ONHB 3KLHD 2Z92A 1SRDA 1AR1D 1TMQA 3CVDA 5ETUB 3ZQ9A 5FPIA 1IFHH 4NQEA 3NP3A 2IXQA 1XV8A 4M5TA 2AMUA 4KKCC 3JWOC 1YC8A 3IJ8A 4OD3L 2DIBA 4X4XB 4XP1L 1MWAL 1KOAA 1S7TA 4WUUD 4YE0A 2FIKB 5IB3A 4IKKA 5HI3C 4HJJH 3BP7B 1G7IB 1SJEB 5EO1A 1D6EA 1F4AA 2DTMH 2OP4L 3QW9A 4M7KH 1KCRL 4WJ5A 5KSAA 3T5WA 2EIZA 5ESQA 1YUHA 3IAQA 2BJML 1UWXH 2N1KA 3BSHA 3JVGC 3O6LL 4FRWA 4G71B 5I8EB 5EF0A 3V0AC 3S9DB 5BMFH 1T66C 2QGDA 3FB8B 2VCOA 3BYTA 1FH5H 4U05A 4Y2DA 5JDJA 4I48A 4X4ME 4JG0H 5IB5A 4H26B 1GR7A 1KGIA 2BP5M 4CN4A 3GF8A 3WEBA 3WTTA 4MXWH 2ITDA 1FNEB 3RURA 3UO1L 3NSXA 4JHWH 5TE7L 3OJ2C 5GXBB 4PV9B 5AZ2L 1XF4B 2QKIB 2VB5A 1KB5L 1JMZA 1OAQL 2AAVA 3LEVH 3TJHD 2PWHA 4ADIA 5B3JF 2ZNXA 4Y16D 2R15A 1OCCB 4A67A 1A66A 4AUJA 1JTOA 4JZOA 3CMGA 1GKEA 3HZYB 3ATEA 5DHYB 4RNRA 3GXFA 2AGJL 3FQUB 5GS2D 2Q3XA 3Q2WA 4NO5A 2E86A 5TDPA 4F8PA 5I8OH 3Q8BA 4OGYL 4E5XB 4DKTA 1BQHA 4P9HL 1DFXA 3VO0A 5EA0H 2Y0SA 3H9HA 2BDNH 4CSZA 1ROCA 4YSCA 4G8GA 4OJCA 3II2A 3JQOB 1FYTD 2YSTA 7FABL 2XJKA 3OX8B 2CBMA 4B7IA 4X5RA 1BX2B 4BSVA 4OZHF 1E8ZA 1GJUA 5D4HA 3ZE0E 3CZNA 3FQWA 2QVTA 3C09C 3L81A 3GI8H 4P23C 3NIGE 2MNJB 1BOGB 2HAZA 4M6OH 4KMLB 1KYFA 2GJ6E 4JO3L 2VDLB 1IC7L 3IDGB 5E4AA 5KUMA 1T83C 3UAAA 3GMRA 4H8PA 5LAPA 2MWCA 2FATL 1TSRA 1QEXA 3ARBD 3OMNB 4UNIA 3SGEH 1Y0LA 2GSIB 3BH9A 1O6SB 4OJEH 1PZBA 5EIQA 4UQ9A 4PLJC 2F58L 4XMKL 3TVMC 3BMWA 3QO0A 4HUWB 1INEL 3RVWD 1V7ML 4AI7A 2Q9OA 4FXKB 3CBKB 1M9WA 3QUML 2Y7NA 3CVBA 3GMQB 5IJCC 3HIZA 5DYOA 5T1KD 3DVNB 2X6UA 3SE9L 4YDIH 2N3JA 2G9KA 4HKBA 5IMOB 4LAQL 3CSGA 3HS9A 3QXAB 5CZVH 3ZE1F 2DQCL 4RSVA 5CLTA 2AABL 4G11A 4WUKH 5I0YA 4JJHA 3C5XA 4ZTPL 5C6WH 2CO4A 3QC5X 1ZWIB 1S7WB 2JH2A 3HMXL 1DBAH 1RJYB 3DRTB 5L8JB 5LLIC 4JGMA 2H45A 1UM4H 4UM9A 2ZPKH 25C8L 1JHTA 3GM8A 1J0IA 3LH8A 1AY1L 4GIOA 1WG3A 2C3GA 4FXGC 3AUVA 4NQDE 4J1UB 5HHNB 2BOLA 2Z8SA 3QQDB 1J0JA 5D7IF 4PJ9C 1VFOA 5DMKB 4EI5C 1ZHNB 5CCHE 3KPQA 4WNJA 1P0SE 2J43A 4BFIA 1BAFL 3V8CA 3OR6A 1TMCB 4DP4X 4J6RL 5C71A 3EFFA 2B8OT 4YSEA 3C6SA 2FLMA 3Q01A 3OKMB 2ZOKA 3HS0A 5FGSA 1U91A 4GRMB 3H0TB 1AKJB 4FNQA 5EBLB 1A65A 2AVGA 3RRQA 1YQVH 2VLME 5DA4A 1RULH 2YA2A 2DI7A 5AZEH 1JGEB 1RJLA 1AQ8A 5E9DB 2FH8A 4M1DH 1EZVY 4V11A 1DBML 2LTQB 4S0HA 3IJEA 4B95C 4UILH 3WJJC 3DPBA 5E95B 2O5YL 1FQ9C 4YDJB 1CK0L 4KVPA 1SDDA 5KTEH 3NZ8A 1KBWA 4RRPG 1HINL 4TSCL 2DEWX 1NEPA 2XWBA 1I1AA 2O5NA 4Z18A 4Z3TA 4OZIA 2C9UA 4L3EE 4N2EA 3FU7A 4YDVB 5GGUA 5EUOE 3NSJA 4Y4FB 4ZD3H 4GW1A 3BGFB 1MH5A 1LWHA 4M7LH 1F42A 1L9OA 2Q86B 3UFIA 3QJUB 5JQIB 4C83B 1ANUA 3U46B 1RERA 4E5XG 1UJTA 4HWEL 1K4DA 4HCGA 3WNLA 4CRPA 1EFXD 4P5TD 3MV01 1HH9B 3WTVA 2R1XA 2IALB 4MNQD 5HJ3B 2HT3C 1XXFC 3DOHA 4H2AA 1M05B 3LRKA 4TVUA 2V3FA 1QBLH 4N3UA 4ZOCA 5CBAB 1TUPA 2VERN 1FG2B 1XSIA 2RCSL 4Z7UA 3PV7A 1BWWA 4PYHA 4X8GA 2AXHA 3V4PB 4JAMA 3MO1A 3VI4F 3QWQB 3D4GA 4R4FH 3O3EA 5T5FA 3IFLL 2ATKA 1S5IH 2CLVA 3QUXD 5FECA 3GXUB 4AIXA 3IGFA 2EVJA 3FQ2A 2H2SC 1NLDL 1KNOB 5AZUA 4RZKA 1T6VN 2WBXA 3V4UL 1QUPA 2YBRA 4Q4EA 5E2WH 4AQOA 1R75A 2WOBA 2Y25A 1CDIA 3RDTD 1NCHA 2FJFA 4FYTA 3MLUH 4BCXA 4XWGL 1LO3H 3ML8A 1SHXA 5K59F 1RZFL 4XO5A 2J1ZA 1ED3B 3N41B 3FU8A 1DQLH 1I9RH 3OKDA 3QI9C 4MHHI 4OVVA 2EZ0D 3TBYA 2CBOA 2AQRA 3LVTA 3Q1SL 3QQ4B 4JHAH 4O4YH 3BP5A 4WJG3 3NAAH 5AL0A 5I71C 4OZFB 1WP6A 1NIDA 1U8OA 3CLFL 4YNYB 5TQ2H 3V6BR 5D2LA 3WIIH 4IGBA 1N5YL 2O61B 3CQQA 1E6JH 4K15A 4CMMA 5IF0A 4RGMB 4L37A 5LUMA 2XICA 5J7CC 1MFBH 1U42A 2YQBA 5DQ9B 1L7IH 3WEOA 3PDDA 1IKOP 3X1FA 4AVIA 4ALAH 4AGOA 4ABVA 1ZGLM 4FADA 1J9RA 4J28A 1P1ZB 4FX5A 3CWGA 1U95B 4JFZL 2K1MA 4U1IA 4X7CC 3BKYH 3V2AR 4NP4H 4DP5X 4L4TD 3U1SL 1RK7A 1WZKA 5EIIG 2YK1L 5JPNB 2X89D 2WLLB 3LY6A 4WRLA 4LCWD 4BFNA 1UADC 4JZNA 1A6ZB 4I0KA 3AMLA 3GQFA 1JGUH 2ZP8A 4KMTL 2WTOA 3CMOL 2GUOB 2A38A 4A63A 3AWGA 3LQAH 3MXWL 2J1YA 2KLRA 3BN9D 2IF7A 3VXMD 1NA8A 2ARJQ 5C7XH 1KJMB 3T0WA 1JHLL 3POHA 4FCAA 1E7UA 5T5FH 3ZQWA 4N2BA 4UINL 3D07A 2C7FA 4R4ND 4V1DE 4XVSL 5KN5B 4IHBA 3RWDA 2F19L 2AJVL 3RLSA 2YWZA 5GJSL 1T4KB 3T0EB 1AD0A 1RZ7H 2G2PA 2BIPA 4F57L 4BYHA 2FBJH 1D7BA 3EFOB 1JD7A 1VSCA 4RGNB 3V0EA 1IEBB 4L1LA 1PSKL 5BV7B 4DCQB 1CICB 5JHDA 4P3DB 5EZIL 3IU4H 2BRQA 4H88L 5KG9A 2WLIA 4WTZA 3D4CA 1LM8V 4PSPA 2R23B 4PY8J 4PVNA 4G8FB 3ROLA 3VFPA 3MRNB 3OAUL 1I3GH 4LCIL 3SJVA 2EDWA 4OFYD 3O2DH 3BDYH 2YXMA 3O3UN 4P4RB 4QXVA 3ARED 4AMWA 2BSDA 3GBEA 5FYLL 3D30A 5CGMA 1AD9B 5AG8A 1H3TA 3TWCH 1ZCRA 5DEFA 4WV1A 5GSVB 3GLDA 2P8PA 1UASA 1RIUL 2Y07H 3KPLB 4G9FB 3MC0A 4L3CB 3W1ZA 4MBOA 2GVYA 5E9DE 3W9DB 5DMYA 4RAVA 3HA0A 3OQRA 4L3AA 5L88L 4GKZA 3H42H 3UYOD 3RZCD 2D9QB 1EJFA 2R0LH 3QSKB 4HETA 4NENA 5IEHB 3BQVA 3EFDH 1FZMB 4LF3A 4CVWA 2HVKA 2Z31A 3CC1A 3FQXA 4M3JA 1P6WA 2BY1A 2BOBA 5FUCC 1MAMH 3QISA 3Q05A 2KQNA 2G3NA 2ZG3A 2YD1A 5HGHA 3RB7A 4BZ1L 1R5IA 2EACA 1A7QH 4DSYA 2KZWA 2WXQA 4HIIA 2CDEA 4C47A 4L3FA 3PCYA 3VWKB 2ILLA 2QDVA 4LRIA 4YHKH 3KEHA 4HDIA 3UBXG 2O4EA 4E9YA 2H3NA 3QHZL 4MKMA 3GM0A 1DBBL 1PZSA 4NUJB 15C8H 2PTVA 4IDJL 4RAUA 1RURH 2AK4B 1G7HA 2QGEA 3SYQA 1TJHH 4JHBA 3QPQC 2B1AL 3QR2A 4GQQA 4MQXD 1H6FA 1ZLVH 3UPAA 4DKFL 4A37A 1AXTH 3ECBB 3CBJB 3CH1B 3EGSB 4ZS6D 4PJHB 2QQKL 1WEJL 1FCGA 1YNTA 4GEIA 1CL7L 2E9BA 4MZ3A 4WK2B 5GGRB 4YAQB 5DUBB 4AZ8A 1UM6L 1JV2B 5CCJA 1UUNA 1CLOH 5I5IA 2H0EA 4LCYA 2GJ6D 5C8JA 1NC4A 5DWPA 2DLEA 5IVXA 3NA4A 3K2MC 2H41A 4FLOA 2MMXA 5BRZD 3WXWL 4NZ8A 3RL1B 5DU7A 4EDXB 5I23A 3FC8A 4ZMVA 2VQ4A 1FJ1A 4PU2A 5F96L 2JKWA 5F7LB 1QSEA 3ET9F 4C8XA 5T3ZL 4TTGA 1MFDH 3FRPA 3NCYS 4ODSH 2X1WL 1II4E 2R0ZH 2J44A 4CVUA 2XZCL 3QK0A 2ZYRA 2JB6A 4ZQKB 3VRLE 2EIEA 3E3QC 1J86A 4YHMH 2BC4B 2JK5A 2M8XA 3PHQA 1WS8A 4XN1A 2ZUQC 3BQUC 4NI6A 5B38A 2HPTA 4JHUA 1MIML 5LBSA 4BFBD 4Z7OF 3P0GB 3SZ6A 1LO5B 4FQXD 4YE4H 5FYJL 1DBJL 1EBPA 2IWFA 3IFOA 4YO0A 4JKMA 2DN7A 3APMA 4O9HL 1KJVA 4P46B 4NOBA 2R8SH 2O5ZH 4A7QA 2KLTA 4KO5A 2ZQKA 3FYIB 3L3JB 4MDJA 4NIYE 2YOCA 2MKLC 2VM3A 5F7DA 4LARH 2FJGB 1AFVL 3X14A 5F0JB 3LKPA 1OL0A 2EO1A 4OAWB 2Z1KA 1AC6A 1MCEA 3IN0A 3LNDA 3QZWA 4NNXA 5HJBA 1DBKL 1UXMA 4TOYH 4U6YB 2WXRA 1G7JB 2DLHA 3CLWA 4AQEA 3VFRB 2OXGB 2VL4A 2Q0ZX 3GMPB 1W15A 3JYBA 3WCYA 1EHXA 1YY8A 3CPUA 4P4KD 1A3QA 1S9YA 2A99A 3QQ3B 4EXPX 1X5IA 4IRSC 1P2CA 2DQGL 5B4MD 2F18A 1ADWA 1CFBA 1E4XL 5DJYA 3D87B 4RZCA 5F9WC 1IC0A 5C0EB 3IDIA 3DX9A 1EEUA 3GBNL 3KJ6L 1F1GA 5KVGL 1FC2D 4QHUA 5I1JH 2X4NA 5KVFL 3OXSA 3K74B 3MLVH 3QFGA 1DDTA 4JFOA 2AS5M 2CMRL 5CINH 3D9AH 3HKZA 3FB5A 4K3GA 1RZIA 5JOEA 3T0EE 1WUNT 1IMHC 4ZXBC 3QP3A 5IHHA 1WTGT 4L3ED 4G5ZL 4RGNE 4HIHA 4X99B 5EBMA 1M53A 4WIQA 2EIMB 4ACPA 1AHWA 3GHBH 4EI0A 3QIBD 2JKIS 3MOBL 3CFKA 1RUKL 4DJMA 1Q1PA 5DK3A 1GC1H 4WI6A 1IGCH 2ZOUA 3OGCB 3F3HA 4XZ4A 3SB3A 5ALBH 5LBSH 3CHRA 4QTFA 5FW8A 2C9QA 4ELDA 3ZDZB 4PCKA 3B9KA 5LXGH 5MEOA 3NPZB 5DUPH 5E2TH 2MPAH 4LLWB 4Q2ZB 1A1MA 3RG1C 5ALCL 3RWGA 4EN3A 2BY3A 4JPKL 4NHCH 3R8QA 5I73C 2CDGA 3AU1B 3EXJA 3QWNA 2NT0A 1TO4A 3TT3L 2BMKA 2XPGB 4NRYA 4B53A 2EDYA 3D09A 5FOBA 3DX8B 1FL6A 3HC3H 3QUXC 2AHIA 4WHYH 2LW3A 2W88A 1UA7A 4B50A 4DW2H 4H1LA 1QPKA 1NAKH 3NJMA 3NQIA 4XPFL 3ECUA 4FQHA 4S1SL 4XBGB 4PGBA 4MQ7A 4EZJA 4S11A 3EJJX 4GAGH 3GSWB 3T9WA 3RDTC 2VO8A 3ATFA 3TU6A 2DEYX 1IKNC 3RTQA 4NAJA 2ZWKA 4NJAH 1JNNH 1HQRB 1R5WB 4AH2A 3WFDL 2ADGB 2H6OA 4Y9CA 1SYVA 2QADC 5C09A 4PJIF 1KTDA 5C70A 2N0MA 4L1HA 3VFMB 4E41A 1JZ4A 4HJTA 1E7VA 1XBRA 2LAAA 2NX5E 1GJIA 1IZJA 3BC9A 1ZS2A 4UTAL 1O5PA 1BBDH 2ALWA 3MA7B 1H3PH 3MGOA 1EK3A 1VENA 2K45A 2QSCL 4QRRB