2NDFA

Solution nmr structures of af9 yeats domain in complex with histon h3 acetylation at k18
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
141
structure length
141
Chain Sequence
GSHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein AF-9
publication title Structural Insights into Histone Crotonyl-Lysine Recognition by the AF9 YEATS Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ndfA00
5HJBA 3FK3A 5D7EA 3RLSA 3QRLA 4TMPA 2L7EA 5IQLA 5HJDA 2NDFA 2NDGA 5IOKA
chains in the Genus database with same CATH superfamily
5E6ID 3A4FA 3KDMA 5DHEA 3WCYA 3TM6A 1FL5B 4ZMZA 5FB8B 1GRWA 4LCWB 2HKHH 2CHWA 1VERA 1V55B 2A3TA 1NLDH 4TPRH 2ZUTA 4RFOL 1CFVL 3AM8C 4ODWA 4KTDH 3NJFA 4XMWA 5IW3A 4P9HC 1ZLVK 3RWJB 2B5IB 2TSAA 4NXSA 2NMSA 2XWXA 4KMLB 4FNTA 1A1OB 4Z0BH 1FDLH 1EIBA 3RQ3A 4EZMA 1VFOA 3L4YA 4YHKH 4ZOEA 5I73C 4HS3B 2DWTA 5I15H 3VSUA 3QZPA 4YEFA 1KCUH 1KZQA 1OKEA 1RMFH 1SEBA 3UPCA 5ICXB 1DN2A 1KIUB 2OYLA 3WG7B 1RZPA 3Q2CA 5B21A 3QQNA 2ICES 2H41A 1IEBB 5J6GA 1F4HA 3HNTL 1T04B 1YZZA 4FNRA 2VN7A 4AYGA 3T2OA 5L7XL 1ED3B 2I07A 5E56A 1KPRB 4N0YL 4D7PA 25C8H 4Y2DD 3I6GA 3FU6A 2HRPL 3D30A 4Y7MA 3VA2C 2ZP9A 4OCSL 1M05A 3QJZA 3UTZB 4Y7OC 2Q20A 1YNLH 2BSSB 2BIOA 1MHCA 5C6TH 5IW6B 2X4SB 4DUWA 2VCOA 3DOIA 1KXQA 4PJDB 4IS6A 2MQCA 3E0GA 3IDYC 4XNQB 4Y5YB 1UB6B 1ROWA 3X3FH 1KSRA 3QZWA 3EO0B 4LOVA 4XOEA 3PXHA 2KL6A 3GLZA 3LKNB 4QF1B 1SUJA 2CBMA 4QD2E 5D7KE 3V4PA 1J1PL 4GAYA 4KKAD 3RHWK 2IPUG 4NPJA 1M6OA 4UDUB 4KQ4H 2AAVA 1XH0A 4AYDC 3JWDH 4HUVB 2K8QA 4HPOL 1AIFA 3T2NL 1Q9KA 5CLZA 2V5RA 5LO7A 4F9LC 4YXKL 3AG1B 3LEVH 5D96C 1SHWA 4IMKA 4LLDB 1JNLL 2O26U 3S9DB 5CFAA 1NM4A 2DQDL 1RUAL 4QWWD 4OD3L 5DT1H 3X3GL 3SDAA 3QUZD 3ZZSA 5SWQB 3QUZB 5T1KD 2JVUA 2ZUXA 4XP4H 5T1KB 4BK8A 4F2ME 4HGWA 4BKLA 2QKIA 4X6DA 3M17A 4EJ1C 5F6HI 2QSTA 1XIWB 2DTML 1GJUA 4N8CL 4WW1B 3FONA 3KYNB 4HIHA 4AZ8B 4L4VA 3GB7A 2WSPA 3GS0A 4X9IA 1EXUB 3N1QC 3KYAA 1F2QA 3O2DL 5MERB 1JGEA 3FHAA 5DJXB 2OXGB 2FYYA 4KNUA 4OTXL 4GS7C 4TOYH 1G6RB 4LLMA 4RIRB 3DOSB 3M46A 4FJ6A 4ODUB 4YWGH 2Q8BH 4M7ZB 4E0RA 2P43B 2H0FA 3GPEA 3EHBC 4KHXH 5FS5A 3GKWL 5I30L 2APBA 4P2QE 4A2HA 3P9LB 2IEPA 1MQ8A 4XO4A 2JH2A 1G7HB 4PQXA 2KLTA 3HR5B 4P5MB 4ZO9A 3EDFA 4KZEL 1HXKA 3ULUL 3BGFB 5JPNA 4QTIH 4XZUB 1JZ6A 1ZHLA 4BHUI 4KKQA 4IIQB 3TJEH 2B1AH 2JNZA 3P77A 4QUOA 1J8RA 1JNNH 2Q0ZX 1CBVL 3DDFA 4DP5X 1T0OA 3ZE0B 4EOWL 2DM3A 4UT9L 4HUXB 4KK9C 4QJ3B 2Z7UA 4BH7A 4FFWD 5LNGA 1VCBC 4JKKA 4AEFA 2FTAA 1HFUA 3VXQB 5AENA 3W9DB 1T6WA 3EOTH 5INCB 1MRFL 2YD7A 2F19L 4P59H 5HI3D 1L9NA 3WN6A 5IVZA 4WI9A 3DJTA 3PP4L 1DSFH 4FJYA 2JKIS 5FC9A 2FO1A 3Q2LA 1FL5A 3A21A 4Y2OB 4LCWA 3GC3A 3EOYG 3GMNB 2UXVA 4U33A 3G04B 4EF3A 1NCDH 3PJSA 1TMCB 5HGDB 4N0UB 4DSYA 5ABDE 3RWJA 4GQ9L 2PXYC 3BAIA 3CVHH 1A1OA 5AZ2L 4XPTL 1IM9D 1WO2A 2QKSA 4HJ0C 3HC2A 4HS3A 4XN8A 2VT0A 4LPXA 1DUYA 4J6IA 3ETBF 4Y9BA 3BPNB 5ICXA 2IOMA 4KX8A 1FE8H 5EZPA 1IEBA 3MJWA 4LESA 1T04A 4FI6A 1ED3A 4KJPD 1KPRA 5EBMA 5T33L 3UERA 1O6SB 1XGPB 4DPCX 3TA4D 3QXAB 3V0AC 1DVFA 1RSFA 4R3SA 3D25B 3KPRD 3MRPB 2VXUH 3UTZA 3GRGA 2BSSA 3KPRB 4R0LB 3TT3H 3GXDA 5IW6A 2X4SA 1E8YA 2DQJH 5E8NB 4PJDA 2LFGA 3WUWG 1I9JL 4XNQA 4Y5YA 1UB6A 4P5KB 3SDCB 3V10A 1E6JH 1FG2B 2VL5B 3JWOL 4OF3A 1YYCA 3LKNA 4QF1A 5LVEA 2WSDA 4B5EA 1G5GA 1SRDA 2OKMA 2XTJD 2DTSA 1T21B 3DX4A 4E9QA 2XTJB 4DUVA 1LO3H 2E74C 5D5MF 3US1A 1P7HL 2ICCA 4HEPA 2N4IA 1N18A 4HKXB 4UDUA 2G2RA 3ULAB 5B1CA 1UYWH 2AABL 2IG2L 1BVLB 4A7UA 3L9YA 4P5TD 1AANA 4TTDD 4HUVA 3QT2A 2DPKA 4P5TB 1H9VA 3PDDA 1T1XA 4OFPA 2C3GA 5CEZL 3TCXA 5JQIB 2VDMB 3GBNL 4LLDA 5L9DH 4ZD3H 3GMRB 3V5KB 2BIHA 4ONGH 1OAYH 4WNSA 4R2GC 5SWQA 4JFZH 1THCA 3IKCB 4JM0A 2DOCA 2WINB 1IC4H 2ZG1A 2NZ9C 4PCSA 2MEJB 1JYVA 4RMSA 3ZIYA 4CADA 2ICEC 3UO1L 4YBQC 2BIPA 3BLKA 1F4XL 3EYQC 3VFMB 1XIWA 1DQDH 1OLZA 4ZXBB 2NX5D 3CLWA 4XC3H 4WW1A 4XCNB 4OIFA 1VADB 3ULVH 2HJKB 4AZ8A 3ZDYB 4DJMA 1EXUA 2Q3ZA 1BZEA 1CJYA 4HOWA 3GI9H 5FOBB 3KLLA 5DJXA 1HKFA 3OXRB 2OXGA 5T1LA 4RGOL 1RUQH 5KANI 5DZLA 1UWYA 4TNFA 5KG9A 4NP4L 3QYNA 1T20B 1TTFA 4X2UA 3AVEA 1R17A 2VDRH 4HCIA 4RIRA 4ODUA 4WIQA 5EB9A 2IWGA 1KJ2B 2RIKA 2JCCF 1X5LA 3QIBC 5C08E 1NUDA 3RG1C 1QPXA 4GJTB 3BPLB 1L9RA 5HHOD 3P9LA 5HHOB 1G7HA 3HR5A 4P5MA 3MA9H 3HG4A 4ZW5A 4JHWL 4XZUA 5MENA 2P1YA 4X8CA 2EQDA 2F1AA 5I0YA 1CGUA 4G8EB 1K3ZA 3PGFL 3I02B 5LAPA 4HA1A 1U92B 1F11B 4M5YL 4Z7UB 4JRYE 3MOBL 4HUXA 5KSAC 4DTGL 3EXLA 4HWEL 4KQ3H 2ZWNA 5E6SB 4AGLA 4HVBA 2X1OA 1JK8A 1F56A 2FWSA 3X13B 1VPOL 2QPUA 2A9CA 1UB5B 2XWJB 3H9SE 1M7IB 3N91A 1QLEH 3TN0D 3V5DB 2W9LA 3PFQA 4X80L 1HCYA 3VXQA 4PHZA 3D2UD 2ZOTA 3V6OA 3W9DA 3ZKMD 4J3BA 4KH2A 1LDPL 3D2UB 5INCA 1AG6A 4FP8L 3EOBB 4XVSH 2CUIA 4E41E 1YC7A 1O7DE 1BJ1H 1JWUA 1H3PL 5IFAH 1ZMYA 1UD6A 4Y2OA 1M9WA 4N2MA 1BVOA 1QKZL 4F7CB 1P4LB 2Y06H 5HI4D 3THML 5CJXC 3G04A 1QEXA 2IF7A 4LLVB 1RUKH 1WZMA 5HGDA 2GBAA 1OQOA 3GRWL 1N2RA 2PPDA 3KYOB 4FA6A 4FERA 3MCG1 4LPYA 3SYCA 5DC0A 4JB9L 2I24N 1QFOA 3U36B 2KHAA 3MBXL 4GSRA 1KC5H 5IT2H 1BQKA 1NGPL 1JFHA 4G5ZH 3T8VA 4YR6A 3OLEA 4JDZA 1VFBB 2K1MA 2MOQA 2P5WE 2H2PC 3VYOA 3PAUA 3I9GH 1AMYA 4LCUB 3LEYH 3LZPA 1DTUA 4Z95H 1O6SA 1OAUH 3TEXA 1XGPA 1YQVL 3QXAA 4ALAH 4WSKA 4NQVB 3D25A 3MRPA 4RFNB 1OWWA 4R0LA 1JHKH 3HBPA 4MAUL 2C9AA 4JN1H 2J4WL 3HLAA 5E8NA 4H8UA 4G6FD 3WKNA 4BFKA 4P5KA 3SDCA 4G6FB 4YN3A 5L2KE 3DBXB 4Z3HA 3M8OL 3IMRA 4Y9EA 4P07A 3T0BA 3AU0A 1QFPA 4A7QA 4M6AA 3CMGA 5C8JA 3LPFA 4YPGB 1TF4A 1PZ2A 3V8CA 3KWUA 5JOFA 2UUDK 2XN9D 4HKXA 1G9NH 1MJ7L 1IKNA 4FG6D 4UQ2B 4YDJB 1BVLA 2YWYA 4XE5B 3OMNB 3MLUH 5I8OL 2M2DA 4U6HB 4GB9A 4HW6A 5DVKA 3VX1A 2VL4A 5FHBH 4M02A 2C3HA 2IWFA 4LKCB 2IFFH 3DGDA 1SHSA 1T5WB 3GMRA 3V5KA 1PS3A 4YGVB 2B59B 3R18A 4WI2A 5I73B 2XYBA 3T0ED 1UH3A 3IKCA 5HHVL 4G71B 2WINA 3T0EB 5EPMB 3QGVA 1Z7JA 5JIPA 3C75A 4GKLA 2B39A 1XSJA 4Z1PA 1X5HA 4ZXBA 2UZXB 1MELA 3FQRB 4Q74A 1ASPA 3KH4A 2XTSA 1VADA 3DK2A 1T89A 2HJKA 2P7TB 5LGHH 2E75C 2K4AA 1SMDA 5C0GA 2H5UA 5FOBA 3ILQC 3MRHB 3OXRA 4E36A 1BYPA 3INUL 1A6PA 1L5GA 1T22B 1JRHH 1T20A 4J2QA 2YMTA 4JO1L 5F88B 3IDYB 1EBPA 2VDNL 1KJ2A 3MPCA 1E4KC 1NOAA 4AL8C 1KB5B 1JZJA 3QDJB 3US9A 4TRPH 4HK3J 2GSIB 1ZLSH 2WAHA 1RVFL 2N56A 2DM7A 3CX5J 1R3LB 2X0VA 3D0VB 1UOLA 3NRFA 4JG1H 4OI9A 4AJYV 1EEZA 1KYOK 3OF6A 4N1EA 2ZOLB 3CDZB 4G8EA 4LASH 4O51A 4AXWB 3I02A 1UXWA 4LDCA 5I82A 4LCIL 4PJEE 3RURA 3HVDA 3JWDC 1WEJH 4I4WB 3UJTL 2FL5B 4AQZA 1WS8A 5D96B 1NPUA 4PJXE 5F6IC 1XHHA 3A23A 4WUKH 3X13A 2AQNA 4Q6IC 3T6QC 1YEFH 5TQ2L 1D5IL 2AGJL 3B2VH 2PPAA 5ITFB 3L3JB 2XWJA 1KTBA 1UB5A 4OLUH 1M7IA 5EO0B 2KPWA 2Z1PA 1AH1A 4K71C 1HKLL 5D5MA 1VKXA 2Z91B 3O8XC 3GJEB 1IGCH 1R1CA 4ETYA 3EOBA 1WITA 3G6DL 1X5AA 4UBDD 2X88A 5KSBE 4PJAE 3HMWH 3EGDA 3ZLQC 3FHEA 2NY7H 4JRXD 1TJXA 2BP8B 4JRXB 4F7CA 1CDGA 3C9NA 3WIFB 1BWMA 4XNUL 1NCAH 2X1PA 4MRCA 5AW9B 2G9HA 4NZDA 3NFNB 5G4NA 2J3SA 4M6NL 1IIIA 2RD0A 3NYKA 1FFPB 1I8IB 1VFAB 4GS7B 3U36A 3FB7B 5CIPB 4E9XA 2Q7YB 5JOPE 5EEZA 2EIKB 1KGJA 1X5MA 1I3UA 3LN5A 3EHBB 2ZWKA 4OLZH 5BRQA 1FGNL 2VXTH 4GUPB 3TT1H 5MEOA 1VFBA 1XGYL 4XBMA 3ZTDC 4MNHB 4UM9D 5MEQB 2VN3A 4M1GH 3D39B 4Z6AT 3O0LA 4NPYB 4XR8C 3TCTA 4LVEA 4ZS7H 4ZMQA 3EJPA 2YPLD 4KK9D 3QDMD 4NQVA 3O6KL 2YPLB 1F8TL 1NPNA 3BCDA 5GZND 4XGZB 1V3JA 1RP9A 2HCZX 1RK7A 2R69H 5GGTA 4D2NA 2FO4B 1MAKA 4IKLA 1TQCC 5C0RL 2MSPA 5DC9B 4B9CA 3WKYA 1F90L 1AI1H 4XOAA 3SJVB 2C9SA 5J3HC 2JJWA 3QDAA 5K9JL 3TIDA 1OPOA 4GNKB 4ODVL 3K1KC 4LCYB 3NJIA 2ATAA 2M83A 3U4BL 4IU2B 1W0WA 2R29A 3AXIA 1BCIA 1TFHA 5H2BB 5KYUB 3AROA 2X70B 3BOVA 1UWEL 3COOA 4XNXL 2ZCLH 4U6HA 4OCRH 1GTNA 1RZQA 3RJOA 5HVFB 3AM8A 2PXYD 1G87A 1PSKL 4LSRH 5I6NA 4LKCA 2PXYB 1JS4A 2NDFA 5E6ZA 2DICA 4D9QD 4HJ0D 4MD5B 4LSSH 3ESMA 1GMEA 4AVHA 4YGVA 2ZKHL 3HS8A 2B59A 3CFDB 4KRMB 1L9SA 3HZKA 4XTRD 3SD2A 5TJWK 4ZUTB 2H0EA 2A9NH 4NO5B 4A37A 3HJEA 4OLXL 1FYTD 4QRRD 3FQRA 1FYTB 4QRRB 4WO4D 3D6GA 2P8PB 1D6EA 1R3IL 1NCBH 4WO4B 5IROC 2Y69B 3KLKA 2WB1A 1CIDA 1G7JB 2AEPL 7FABH 3MRHA 1MI5E 4N2HA 1CU4H 5BPPA 3NCWA 4YLCA 4N90D 1H8LA 1NKOA 1T22A 2Y7NA 4ZYKB 3FRPB 1L6ZA 1IVTA 2Y24A 4Q89A 4H88H 4JO3L 5DK0B 4LE8A 1E6OL 2SEBB 3FUKA 1KB5A 3SGJC 3QDJA 2DEXX 5L4MA 4FRWA 2GSIA 5I5JA 2EABA 1A2YB 2HPTA 2VLLA 3D0VA 3VFRA 1OM3H 3UH8A 1U6AH 1NDGB 4K3JH 2ZOLA 2LLGA 3CDZA 3LS4H 4JFXB 4NKDB 5FFGA 1J9TA 2MCPL 4F58H 3RVVC 1G6VK 3BUYA 5DFTA 2ODHA 4I4WA 2FL5A 1PVHA 1TQTA 1P2CA 4F9LA 2LQRA 3BKJL 5JR1L 3C5ZD 4A68A 3MUHL 1HQ4B 3LZRA 4TN9A 1KIQB 3C5ZB 1KBWA 3HBGA 2DLTA 2YUXA 3L3JA 3QPXH 5EO0A 3B3BA 2WXNA 4R2GB 4L0PB 2YIHA 2C8NA 2NZ9D 3CCHA 4FNQA 3DV6B 1J9QA 2Z91A 4YO0B 2ZJSL 2JTYA 1KEML 3GJEA 4EUPH 1EBAA 2ICEB 2NZ1A 2J25A 3R8QA 3T8XB 3O2VH 4JY5H 2DLFH 2Y7SA 3LRKA 4LNVA 3MUY1 4FNUA 3TYFB 1ZTXE 4MA7H 1PPIA 4P3DB 2BP8A 4XCEB 1FG9C 1XQ4A 1IGFH 2ZP8A 4KMTH 3BUIA 4KKBC 2B2XL 3WXVL 2YXFA 2A6KA 3H85A 4WJ5B 3U7AA 1LP9B 3IU4H 4PN6A 3NFNA 3MJ9A 1TETH 1FFPA 4N2LA 5B7FA 1I8IA 1VFAA 1P6WA 3H2PA 7TAAA 4AZUA 3FB7A 2YD5A 4JE0A 4EQ3A 1PKOA 2VJXA 2Q7YA 2BY1A 3S3DB 3QIBB 2JXMB 2VIRA 4GT7A 1D2PA 1FWXA 2LE9A 1MCOH 5E08H 2O6PA 4GUPA 4HLJA 5GSRB 3QYMA 3IF1A 4B0MB 4MNHA 1ACYH 3T9WA 4HK0B 2KI6A 2ZT9C 5MEQA 1KBKA 1RLWA 5D7SH 3EYFB 2H8PB 3D39A 3IAQA 1CLYH 3N9GL 1DVZA 1QLRA 2R8SL 4PLOB 1RIUH 1EHKB 2A6IA 3APCA 4LEOB 3HRZB 5KSAB 4BA0A 5B38B 43CAA 1KTCA 5JXEC 2YKLL 1BAFH 1BFOB 1UA6L 3Q6FB 2FO4A 2OMYB 2K6YA 3NAAH 4M03A 4N85A 4DW2L 4LGSB 4NOBA 5DZVA 2Y7QB 4DETA 1T0NB 3W57A 1GGTA 5AQ0A 2XQBH 3MLXH 3SJVA 5BQ7B 4NC1C 4NWTL 2P26A 3U2SB 3W5NA 4LCYA 5EO9B 4Z7QB 2Y5TB 4TQIA 4IU2A 3WFBH 5CUSL 1HC1A 1E3FA 5H2BA 5KYUA 2X70A 1G1OA 2MPAL 1HJCA 4OCWL 4PI2A 5EO1B 1IB5A 4UMSA 3L4ZA 2JKRM 3GJFB 1K85A 3KYMB 3RU8L 2JV6A 1JBJA 4MD5A 3EXJA 3CFDA 4YSAA 3WHXB 1U21A 4YDVB 5GIRA 5ECJE 4WHTB 2AEQH 3GTVA 3RWEB 1E8ZA 4ZUTA 4J3OC 1YYML 1KELL 1Z1WA 2J88H 5CJOL 3BP5B 4UANA 4RSVA 4B97A 4CN4A 2H2PD 3H42L 3QEHB 5AW3B 5ICZB 3WNOA 5L8JB 2V5MA 1FYTA 1Q1PA 1YAIA 4GW4A 5C07E 3LNGA 1TEGA 5LKNA 1YEJH 1QAWA 3JV5A 2WO3B 2EEXA 4XP6H 4PGDB 4ALAC 1G7JA 2R2EB 3FO1A 3LQZB 2UXTA 5DJ8A 2OA9A 3FRPA 5F7MC 5I8KL 3UTSD 1GOGA 3PG2A 4W9DC 5KVGL 3P02A 2R59A 3KWWB 1CLCA 5DK0A 3UTSB 5EUKB 1QMUA 1JZ8A 4FE9A 4G72B 2HG5B 3KPTA 4GRWE 1A25A 2AJVL 2PPEA 3OKOB 4L05A 3V4VH 3WJMB 1JZIA 4LLUA 4ZI8A 2E86A 5IP4A 1A2YA 1OF2B 5EFIB 3UFIA 1QABA 2XKUA 4OU3A 5C3IA 4IOFC 2J6EA 2BOBB 1G9NC 1RU9L 2B16A 2P52A 4NKDA 4JM4L 1AZNA 5HYJD 1RAMA 2WLMA 2GTWB 2FECI 1NCJA 1UATA 4WVRA 3WTSA 2HRHA 3RJQB 4Z7NE 4C4UA 1HQ4A 5BOJA 1KIQA 1LMKA 2LT9A 1JD7A 3MRLB 4QIRA 4ONFL 4E9WA 5D2NC 1KJ2L 2EEBA 4NZUL 3DIDA 5DMGD 4TSBH 3RBGA 3HE7C 1USZA 4YMPA 4YO0A 2EDKA 4OKVB 3T8XA 1QNZL 3QJHA 1KPUA 4H25A 4X8XA 4KVNH 3TYFA 3FH7A 4P3DA 4XCEA 4E5XB 3REWB 4OD1H 2KDYA 3JTBA 2EICA 2R4RH 3CXHJ 1FZOB 1TZHA 3EO9L 4LEXL 1LP9A 4WJ5A 1X7TA 5C08B 4A2MA 1MCDA 4PHXA 1HILB 4WY7L 4YE4H 2CDFA 4P2QA 3GEFA 1MFBL 2OK0H 4KMQA 4A6YH 1I9IL 2WLLB 1THAA 2ZQKA 4LMQE 1XB8A 3QIBA 2JXMA 1JUFB 1VZGA 2ZYHA 2XOTA 5GSRA 5DMKB 1MY5A 2VW4A 2BSTA 4MHHI 1M42A 4ANVA 1TEFA 4BE5A 4AYMC 3LRHA 4JKLA 5F9JB 3EYFA 2XA3A 2UX6A 3FYIB 2FB4L 4Q8BA 5F8RC 1P4BL 4OCMC 1N9PA 5JPMC 3ML9A 4LEOA 5F96L 5G4OA 5KSAA 5CJQL 5B38A 3FN0H 1RZJH 4O4YL 5F6IB 1HQRB 4LL1A 1BFOA 4Q6IB 3ARWA 1FCCA 2W0FB 3Q6FA 3RAJH 5I1IL 4B9PA 2OMYA 1UCTA 1BJMA 3RX7A 5E9AA 2HAZA 5ID1B 2EDJA 2UY6B 4FGMA 3O8XD 5GZOD 1HL9A 4M7LL 4WFFD 1T0NA 3BH4A 4PG2C 3O8XB 4RGNE 2FT8A 2HLFD 2CIIB 3ZKQD 2ZUYA 3U2SA 1I9EA 5GRVK 1R0AH 3ARFC 4OLEA 3W11C 4Z7IA 4G82A 2BNRE 1INQB 1A6VL 1J5OL 1ZJAA 1PFOA 5CJXA 1L4IA 3LRSB 4R90L 4PYGA 4GSQA 3VXSE 2ZUVA 3H3PH 3T4AC 1F45A 5EO1A 3IETB 4PJGE 4PWKA 3RP1A 2WUBL 3D85D 3GJFA 3RVUD 1RKRA 2ZAHA 2RGSA 3D85B 3KYMA 5EC2B 4K3DH 1HOEA 1UXLA 4FFYA 2P5WB 3NCXA 4G9FE 5GGTL 3WHXA 1ZEAL 3CFNA 3IN2A 2VUKA 4YDVA 1KGXA 3F58H 1NMBL 4WHTA 1AQ8A 3RWEA 1OSYA 5C0AD 4NP9A 3BP5A 1J87A 1EFQA 1S7TB 4Y19B 1FH5L 2VLKE 4J12A 1LO2H 3HFMH 4LEEA 3RKDC 2APTA 2WM0A 3FMGL 2ZSWB 3NFSH 5E0QA 3V7AG 2VOTA 2VDQL 3OXSB 3IJYB 1SVBA 1CURA 4PJEF 1P0SE 2R29L 2Y36H 2WVVA 1AOZA 3RVTD 4Q0XH 3J8F7 4KAQL 2R2EA 4PJXF 3LQZA 5I1KL 4N0RA 2ZX5A 4P3CL 4P9HL 5E9DE 2JJUA 1QBMH 3E6FB 3IEAA 3AY2A 3F7YB 43C9B 5JHBA 3EGXB 1TQCB 2PR9A 3MLSH 4NGHL 3KWWA 3UTSA 2VZ3A 4ZS6D 5JHMA 3AMLA 3U6XA 2HG5A 1A7NL 1C16B 3IWUA 5KSBF 5FDWA 2EH7L 3OKOA 4PJAF 3Q01A 4MJ6B 1OF2A 3FO0H 5EFIA 5I0VA 4U2YA 2DQMA 3L3HB 3QJUB 4GKZB 4CU7A 5ISZE 3MLYL 1HSAB 2DY2A 4N1CA 1UM5L 1LMIA 3A4EA 3WXWL 3A6CL 4GH7B 1ZKAA 3FK3A 1FNSL 4R5XA 4F8QA 2EADA 4CJ0A 1XGTB 2JIXA 4GMSL 2K7QA 3TEUA 2DQUH 3CVHB 3RHWF 2AQSA 3MRLA 3RWDB 2BP5M 5KS9E 2ITCB 1I9RH 5KZCD 1D7CA 4Y2LA 1FVEB 5KZCB 1KB5L 2MTAA 4OKVA 4NDMB 3FFDB 3RIKA 4M8VA 1MHPH 3RGHA 5DJ2B 1DSYA 2QGBA 5HBBA 4PRIB 4GI8A 4JM2D 4NO3A 4QTHB 4E5XA 5IROD 1SDAB 4QI3A 4R5TA 3ZTCC 3AG3B 3QEQE 1FZOA 4I2XE 1M7DB 2DWSA 5C08A 1IO4C 2CALA 4MXWL 2Y2WA 1HILA 5HYEA 3IT8D 4Q58C 2R1XB 3T4YB 2DYPD 2WLLA 2ADGB 3DX8B 4Z7WB 3F7PC 1E4KA 2Z92A 1WHOA 4HFUH 1JUFA 2ZUSA 4IEFB 2VISB 5E8OA 1UWFA 1WZ1L 3ZDZB 2V2XA 4LSQH 4TNVK 5DMKA 2EO1A 4X99B 5ENWB 3AS1A 4YXHL 2EEFA 4K4KA 5HPMB 5KBMA 2BH0A 5F9JA 5ALCL 1MXGA 1QVOA 4X7FC 1F13A 4Y88A 3EYSL 4Y8AA 2NQ3A 3QUML 3FNKA 4AEHL 1CFSB 2V17H 3J07A 3GSQB 2CJUH 3EFOB 3GKZA 1M7UA 2W95A 2IOOA 2IDTA 5F7EL 4TS6A 5EIQA 2CR3A 3A6OA 3MRGA 3MJ9L 4PB9H 4RGNC 4I1RA 5CZXC 1VFMA 1HQRA 4M62H 2YD3A 4Q6IA 3WFDL 2W1NA 4E41A 1KCWA 4B9KC 1DBBL 5ID1A 2JKXA 2XV0A 2AS5M 1GS7A 4KY1L 2H0JA 2CIIA 1OZTG 3IXAB 1NDTA 4G8IB 4BFEA 5GRYA 2Y9RT 1ML0A 3F12A 1PMYA 2FQEA 1KYDA 4J3OF 2QHRL 3SQRA 3ZGIA 2KDGA 5C2BH 4JKMA 1JZFA 1INQA 2MKWA 1H15B 2MQ0A 4NUMA 3ULVD 1QBLH 5FYJH 3VGEA 3U7WH 5KBLA 5DHVA 2VXQH 3JQOB 4UUJB 4HWNA 3MV9D 4F2FA 2F54B 3MV8E 2CK2A 3VQLA 2X09A 4WTZG 1CB4A 3M88A 5E2WL 3O3AB 2K4WA 5EC2A 1AQHA 3HN8A 1AKJD 2D31B 1LO4L 1FHGA 2OL3H 2P5WA 3B2XA 1AKJB 4HCRH 1J8HE 5E51A 5FYLH 4JKPH 4PJ9C 3F65A 5D2LB 5DDHB 5HDBE 3EJYC 4S1SH 3T0VA 4FZEH 3B5TA 1O9VA 5IJCC 5KAQG 1S7TA 3IS0X 4Y19A 3FF7A 2IGLA 1AXSA 3WLWD 1FVCA 3QORC 4M7KH 3OXSA 1K8DA 1VGKB 2H1XA 1PZBA 3IJYA 2HJFB 2AJUL 2N1TE 3FO9B 1FFOA 4HAGA 3QPQD 2J44A 3JT2A 5GJTH 1E8XA 1C5BH 4P4RB 1E65A 3VB8A 3MX0B 5FA4B 3HE6D 3NJVA 4L4TD 2XY2A 4A67A 2CNZA 2XG4B 4L4TB 2VQTA 3P0YL 4MMZB 2G0LA 3E6FA 2QDWA 3F7YA 1FAIH 1MKFA 2PP7A 2G5RA 3E1ZA 2WMPA 1QLEB 4DKTA 3B3IB 3UAFA 2FECL 1PKQE 1C16A 1YRKA 1TYJA 4JZNB 1X5XA 2EUWA 1RHHB 2D9QB 4MJ6A 3L3HA 4RWHA 2FJGA 4F8TA 4FCAA 4FZ8H 5IVOA 1HSAA 1D5RA 2GJ6D 2CK0H 2GJ6B 5IHZA 3DURB 5JW5B 2AK4D 2AK4B 4IGBC 1XGTA 2KH2B 1QI5A 3CVHA 1FN4B 4X4ME 5I1DA 5DFWH 1T66D 2JKJA 4KVCH 1BF2A 3RWDA 3CLEH 3SGDH 2X4OA 1J12A 3U9PH 2VTFA 1G9EA 2X7LB 4MZRA 4P48A 4A2LA 2OZNA 1RJZB 4PJHB 4TUKL 4WI3A 2B0SH 4IHBA 5BCAA 1Q72H 1QYGL 4JUSA 3BO8A 3FFDA 4NDMA 4IBWA 5DJ2A 1MI5B 4PRIA 4EI6B 4CVUA 2J6EL 4LVOC 5D1QD 4HMDA 3PABB 2BXYA 3HG2A 1BMWA 4NUGL 2Y6SC 1U8QB 4QJ5B 2N7SA 4U1SB 5CP7A 2EDLA 4E42B 3CFTA 3T4YA 3PWPE 5FPIA 2P5EB 1NCCL 2ADGA 3DX8A 4FF9A 4HT1L 3QBTB 2Y3NA 4Z7WA 5CSZB 1F6AB 1PD0A 5E1QA 3SDDD 1OK8A 5F9OL 5EEYA 4N8VB 4ODSH 3SDDB 3SGJA 4POZC 4WEMB 2BIIA 4B9IA 1UEMA 2VISA 4NZTH 5HGHB 4TUOB 3MACL 5B39A 2D03H 2QPEB 3F01A 3ENEA 5ENWA 1LEKB 4EDWH 5DMJB 4Z7OE 1NIEA 4IOFD 5HPMA 3MODH 1QPKA 4NFCA 3FXIC 4PJXA 1U8OB 2BNUB 5KANG 3D08A 1VSCA 2E9JA 3GSQA 2CCVA 2APWA 1WH0A 1Z9OA 3UAEA 3GXMA 3MNDA 1LWHA 4C54A 1TJIH 5EEWA 3ZKND 2X3AA 1S7QB 4NXKA 3VTMA 4FQ1H 3NRQA 3C6LD 4PJAA 3VFGL 3U30C 1JSYA 5D2NB 4YEEA 5DFVD 3C6LB 5EH1A 4HQQL 5JO5A 2AXGA 3HE7B 3RL2B 1GJWA 4WTWA 3H55A 2ZOKB 3QPKA 5F7LB 1D9KC 2E9WA 4TVSa 5DS8B 5EOCH 3CVDA 3IXAA 1K4CA 3EF4A 4OJDH 5CD5C 2OP4L 3F64A 2QFPA 3RDTC 3IFPB 5JW4N 5D7IE 1CFNB 1X5IA 1HIMH 4HXBH 5LGJB 5ILTL 4UUJA 4FKKA 3WDHA 3MGTB 2F54A 4YHYB 1LO0H 3VD4A 1RZGB 3MLTB 1NLBL 4RBPK 2AC0A 3CFEB 2G30A 1QTPA 2D31A 4JDEA 1J86A 4JR9H 3K7UA 5CN1A 1XSIA 3B9EA 3UACA 4GRWF 2HLEB 2HH0H 1OCOB 5D2LA 3GIZL 3QVAA 3CDGB 1XB6A 4OM1H 3GBML 3VD3A 3IFLL 4JFTA 4WWPA 1HX0A 1JTPA 2NY1C 1JDDA 1SOKA 3BQUC 1LNUB 3QFJE 1HXYB 4MJIE 3MLZL 4YXLH 5I1EL 4YDIL 2XA8H 1VGKA 3BJ91 1F4YL 4MDRA 5DJAA 1NOLA 2P42B 5IWLC 4Z7NF 3QH3B 2EYTB 1JF6A 5DXWA 4OD2A 4PCTA 3FN9A 3MX0A 5FA4A 5C09D 2DQFB 5JXEA 5J1AB 2XG4A 4UAOC 3GXPA 4GG6E 4RAVB 5C09B 1RZJC 1N12A 3UP6A 1CFBA 3FULA 4UIMB 1TVBA 3HHRB 4LOFA 5DC2A 3T6ZA 4NI6A 2W81C 5EU6E 4FFYL 3V0FA 3C6EA 3W39B 1OGAE 1JWSB 3VI3E 1XH1A 3OKNB 4F9PC 4EBQL 4WTXA 2B1OA 3WY1A 1GJIA 1MVUB 4ONHB 1WE5A 1N4XH 4A38A 4O02H 1RHHA 1W8NA 3CV5A 4X5RA 3ARFD 4TLKA 1BGXL 1HAWA 3ARFB 4R8WH 1WS7A 4PI0A 2X0UA 4XMVA 2RCSH 1WWCA 3CK0L 2QQNL 4JO4H 3FAWA 4MWFB 2YLHA 4F8PA 1ZVYA 1BVZA 2GJ6A 1OTUC 3BKYH 2Q7NA 3BKCH 3DURA 5DEFB 2C3VA 5JA8B 3B5GA 3EDEA 5AL8A 5F7AA 5MHSD 4DNLA 1Z0MA 3EJZD 1RZKH 5A1AA 3CXFA 4U05A 5IQLA 5CHNB 5I76B 3SOTA 4GMTH 2RTTA 1PG7W 4NCDA 5CBAB 1MI5A 1XGQA 3V0VB 5E6RB 3G9AB 4EI6A 4LDOB 2FHCA 1MFCH 3NCEB 1Q0XH 3EFDH 3F2LA 2ZPKL 1ZHBB 3PABA 3S37L 1S9VA 1U8QA 1IKFH 2P28B 4U1SA 5EU5B 5ACMA 2BSED 1W9XA 1KBGH 4KTDL 4E42A 4FMKA 4PB0H 5B8CB 4AIOA 3EH4B 4NBYB 2P5EA 4HJTA 5BS0D 5LDUA 4ZFZB 4J3TA 1FDLL 5CSZA 1F6AA 2VLJE 1B9ZA 4N8VA 3RIAF 3FQNB 3LKOA 4R26H 2OSXA 3OHMB 3ZZQA 5BVJB 5I15L 2CKBL 5HGHA 1KCUL 1RMFL 4X5QA 4EDXA 2I27N 4F92B 1LEKA 3LHPL 2EDEA 3UZQB 2Q1EA 4OM0H 4J4PC 4EUPG 2BNUA 5TK2A 3IGFA 1FL6B 1HXMA 4PJGF 3MGAA 2HT3D 3WKQA 3B7RL 1QRNE 3OLIA 3OSKA 4IBSA 1G7PA 1XR8B 4JKNA 2CKNA 4BBWA 4FC3E 2XPYA 4DKEL 3CZSA 5EORH 4XOBA 5C6TL 1KTRL 3SKJH 1YN6B 3G5WA 3FUMA 2YAQA 1I1AC 2ED7A 4Y16C 5D2NA 3X3FL 2XZQH 1DBMH 1EZVX 1R75A 3UABA 4OZFG 3HE7A 3RL2A 4AL8L 2ZOKA 1HH9A 4ADJA 1B3IA 3L4CA 3UZVB 1FLTX 1BREA 3ZL1A 3IFPA 1MZZA 1KG0B 2VQ1A 5ACLA 1CFNA 2XFGB 4XCYA 5AOJA 3DHJA 5LGJA 3NSDA 2RQEA 3MO1B 1S2EA 3JWDL 3MGTA 1U93A 1RZGA 3MLTA 3MXVH 3DNKA 5IEHB 3CFEA 2F53E 2UY7B 2WJ5A 4G9DB 2ESVB 5L4JA 2XPZA 4IRZH 2AVFA 3ZQWA 1U8NB 5F97E 1DZBA 4QPEA 3D0LA 1EJ6A 4OT1H 1EDHA 5AZEL 3T04D 2I69A 5GRJH 4BQ6A 3UAJD 3ECQA 3UEZA 4YL9A 1VZHA 2BFVH 2VN4A 1LNUA 1HXYA 5FFLA 2A73A 1T2JA 2X0WA 3E2HC 1NCOA 4XXCA 1KN2H 1S46A 3CSYA 3Q2VA 1EFXB 1NGQH 4J6RL 4XBPB 3T2LA 1R9FA 2Z6FA 3GI8H 2G3ZA 4NUJB 3SBWA 3KVPA 5D8JH 1C5DB 2G0KA 3EBIA 3M45A 5JPMA 2H2SC 3QRFM 2H6PA 4KNTA 3P11L 3TJPA 2AZAA 5CZXD 4MS6A 2DQFA 3K3QA 5J1AA 3RY6C 4RGNB 1W6WA 2XNAB 5J56B 5KS9F 4UIMA 5EBLB 5BW7C 3CFKB 4P5SA 4BA8A 5CGMA 2X6UA 4XXDB 1JWSA 1MFEH 2Q8BL 1BBJB 3OKNA 3MU3A 4RBPH 2IMMA 4L3ED 3OWRA 4XNYL 4YHML 1IRAY 3IFNL 4ONHA 5I66B 4EUPB 2AQTA 3VXSB 2JB6B 5IOKA 3K0YA 2WXIA 1E9PB 3ARFA 1AS7A 3L13A 3CBKB 4ZFFB 2VUOA 1NDMB 5SV4A 5C0EB 4QTIL 4MAYA 4H8HA 4HIEB 3IN0A 3DYMA 4MWFA 3ZJAA 5JMRA 1GOHA 4FQHB 1LK2B 4G2AA 4IJTA 3T4AA 3VGGA 4R97C 1X5ZA 5DRNB 1DUZB 5LBVA 4RA3A 3RUGE 4JPKH 4LRIC 4OFVA 1B0IA 4PJ9D 4TUUA 3DRTB 3TONA 2CM6A 3AQZA 3DWTA 3AQYA 1JDAA 4PJ9B 1JZ5A 5DHDA 1GIGH 5FA3B 5I76A 5J8OA 1IAMA 3JTTB 5I1AA 3FT9A 3CX5K 1WISA 2W38A 1ERNA 4J8RB 4BK5C 3QG7H 4Z3GA 3GUTB 3V5HB 3PHQB 3HNSL 3QORD 3SGEH 3I85A 4DCQA 1VZIA 3UTQA 3QORB 3ELAT 3BISA 3V0VA 2XT1B 5BRZD 4XNDA 1DSFL 2BVOB 5J4MA 3SCMC 5BRZB 1CYXA 4ZFOB 2A74C 1MAMH 3QAQA 4BGLA 2HUEA 3CDCA 3KCPB 4PP1C 1NCDL 5EU5A 5AVRB 3OM3B 5EUOE 5FUCE 2R2BA 2ZKMX 4YHPB 1XTLA 5HJGA 3CVHL 4YL4A 3HW7A 1XBRA 4FQ2H 3T3PF 5SWSE 5J12C 3MRNB 5D71H 1GZPB 3FQNA 4GOSA 4BEIA 2ZP0T 5BVJA 3LNEA 1SNRA 5DQ9A 2IH3B 2IC2A 4ERSL 1FE8L 3UZQA 1Y07A 2XWDA 2V6HA 3IWVA 1R3JA 5CLXA 3PJNA 4NQED 5GPRA 1K4DB 1DJZA 4NQEB 4S1DD 4Z3JA 2NUTB 3HS9A 2VZSA 3ISRA 1O7VA 4IGBD 1H19A 1XR8A 3LIZH 5F1NA 4NM4H 4IGBB 3ME0B 4E9SA 3TZVD 3FB6A 2CZNA 4KY2A 5HDBF 1ZV5A 1YN6A 3KHQA 1VHPA 4HUWB 3KMDA 15C8L 2BSDA 5CP3A 5BJTA 3MUGB 1L9OA 4S11A 3SGKC 4KNQA 3BRFA 5EV7A 1UJTA 3LMJH 1EV2E 3UZVA 3ZE2B 4N5EC 5I23A 5DZJA 1LO3L 3UBGA 3FHQA 4A2EA 4LVOB 1KCVL 2FZ3B 3KGSA 4ODTL 4W93A 3L5WB 1NGZA 3GQFA 2RR3A 4YFDB 3N41F 2UY7A 2ESVA 1A0QL 4Y5XC 4PJ8C 5D1XE 4C8XA 4BE6A 5L9DL 3O0RL 4I3GA 3P4LA 3FSZA 1U8NA 3P30H 1EHXA 1OAYL 3OZ9L 3SBRA 1BD2D 4GG8B 4KK6D 4JFZL 3M1CA 3NQKA 1IC4L 2P9RA 4ZUUB 2OSLA 3ILDA 5E1IA 5DU7A 3RZWA 4JRLA 2WBJD 1EFXA 4XBPA 3WNPA 2WBJB 2B3IA 1C5DA 4BINA 1DBKH 1I7ZB 3QUXC 5I8CB 2F58H 1CF8H 4NAMA 3T3PB 1G4RA 2WNXA 4K5MA 3TEWA 3FQYA 5ANMB 2XNAA 4AUUA 5EBLA 2FJUB 3CFCL 3E7JA 3VWJC 1KWGA 3U30B 2A4CA 3NIFB 5T1DH 1V27A 4KX7A 1IMHC 1BBJA 4PS7A 4C56E 1D9KD 4RMVA 2BNRA 4MB3A 4FQPA 1D9KB 5I66A 4D0CA 3OG6B 7PAZA 4WRLA 2JB6A 3VXSA 4A66A 1KPVB 4PJGA 1F4WH 2ZKWA 3RDTB 4ZFFA 1NDMA 3I6KB 5C0EA 1N59B 4WK2B 4AH2A 3VI4E 2QSCH 4HIEA 1CLZH 5KVDE 1KCSH 4R4ND 3BAJA 1L6PA 4G9FA 2OPCA 3EJCA 1MWAH 4F80A 4FQHA 1LK2A 2HVJB 5D72H 3HC3H 2XI9A 5CWSB 5DRNA 2R0WH 4KQ3L 3I50H 4IRJD 2DW5A 4H2AA 3E9UA 4A6YB 1G9MC 4W4OC 4Y4KC 1QQDB 3L5JA 1MCKA 4LPTA 4PJ9A 1MFVA 3ZTEA 1ZJBA 1QLEL 3NVQA 5FA3A 4Q4EA 5DMYA 3LKSB 4Z7OF 3AAZB 5I1LA 2FGWH 1I8KB 4J8RA 1OL0A 4LCCC 3GUTA 3NCYS 3LH9A 1TFPA 4ACTA 2NY1B 3BQUB 3AG2B 4X5PA 3QORA 2BVOA 4AIEA 5T3ZE 5EDSA 1WWAX 5IFAL 3CHQA 4IMLB 3HI5L 3S5YA 2GQHA 3NJJA 5SX4I 3P4MB 3GNMH 3KCPA 4CMHB 1YVLA 4W9LC 4IRSC 1RUKL 1A6AB 4UAOB 1Q0EA 4I8DA 3OTTA 2BNQE 1I8MA 3O6FC 4HIJB 3VD1A 1JJUA 4PBXA 3T3MB 3HG1E 1GZPA 2KLRA 3AJ7A 3OKEB 4G7YL 1HHKB 3RILA 4QOKE 3WNMA 4NB7A 3U9UB 3VCLB 2IH3A 3W0WB 1FQ9C 4QMEA 1OP5K 1TTAA 2B1HH 2YD1A 5D7IF 2HT2C 1OSPH 4K7PL 1A66A 2WWKO 3KYKL 4K15A 1K4DA 3X14B 5LN8A 2WAQA 4UILH 4W6WB 2NNAB 4ZPVB 1T1ZB 3B6SA 5TTRA 1OAUL 2NUTA 2EIJB 5KS9A 1DO6A 4LAQL 1HJBC 1KEGL 3PQYD 3VXOB 3HAEA 3ME0A 3PQYB 4FHJA 3MCLH 3V7MA 1ORSB 2DIBA 1NC4D 2ZTBA 2VM3A 2AJ3B 3VRJB 4ADIA 1NC4B 1RZKC 1BQLL 1MFDL 4HUWA 3K5RA 2NTSP 3P1VA 3MUGA 3HKZA 1YMMD 2ADJB 3V6ZB 5ADOH 4TVUA 2ZKXA 5B4MC 2CO3A 2FWLB 3CXDH 3GMPA 3EGSB 1K2DA 2QSQA 3QRGL 4L5FH 1Q0YH 4BZ2A 1ZIBA 4OF7A 5DJCB 4HJSA 2VR6A 2XN2A 4PYHA 1G9NL 2EUVA 2FZ3A 2YMOA 3VFSB 1E0OB 5EA0H 3BXNB 2IH1B 2NT1A 3MLUL 4ZUWA 2A4ZA 4GG6F 3L5WA 3VG9C 1YYLL 2NNRA 1IQWL 1BM7A 2EE6A 1R46A 2W0LA 3NCJH 3FS9A 2LGNA 4JJ5B 1V54B 4X7EC 2ARJB 3VI3F 4P99A 1EMTH 2IFFL 2H32H 3PL6A 3S4SA 5CGTA 2O4EA 4GG8A 4PUBH 1ZTXL 4WZ9A 1UJ3C 2QADD 1XZ0B 2E76C 3FTSA 2AITA 1EHNA 4QYAA 4ZUUA 5AOLA 3LEXB 3NIDB 1A3QA 2FH6A 4JPIB 4K55A 2XETA 4H0LC 2ZONA 1S7WA 3V0WH 5BO0D 3ZDXB 2WTRA 4OI8A 3R0NA 3ARBD 5HD8C 1XX9C 1MW3A 2OMZB 3RFZC 2MTPA 4H7VA 1DQTA 4G7VH 4H5SB 1CXKA 2FD6H 4PREA 5ANMA 3S34H 4Y16D 1JRHL 4JHVA 1KFGA 2BC4B 2CUAA 2DBJA 4Y16B 4RGMC 3JXAA 2H0PA 2WLNA 1YG9A 4TVPE 5TFSL 3I9PA 1D9KA 2BCMA 3SE3C 2WYZA 3GSUB 2XQYK 1ZANL 3UJJH 5LN4A 1KPVA 1OW0C 2ZG3A 1ZLSL 2PWDA 3RDTA 4EZKA 4EXKA 4PJFB 3IXTA 3GHEH 4OSUH 3MKGA 4LASL 4KKCD 3C2AH 4LLWB 5TH2B 1BW8A 1NWOA 1CDUA 1MIMH 5CWSA 4YX2L 1WRFA 4KZDH 1S78D 1EZSA 4A6YA 5FF6B 3R1GL 4KI1A 1QQDA 4MJIB 1JHLL 1TYEB 1YEFL 1Y6MR 3OD3A 1EO8H 2H3KA 4OLUL 3RNQB 2X4PB 2HUHA 1IC0A 3AAZA 3LZNA 4MVBC 1MDTA 1I8KA 4LARH 3SKOB 1RXLA 4WJKB 2Q2EB 1IGCL 5FIEA 3BQUA 4N8UA 3WE6A 1DANT 3E2HB 2OJEB 2WBWB 5AKSA 1RZFH 2NY7L 2FK9A 1A9EB 4F8NA 5FLUA 5IWLA 1IM3B 1N10A 2A6JA 3BRGC 1F3JB 3C8KB 5ESVB 1PKQA 5KBKA 2YARA 3PNWB 4P04A 3UEQA 2WCSA 1DJYA 2XVBA 4OQTH 3UC2A 3GSNB 1MREH 5IQ7H 3DJRA 1GPOL 2IDSA 5E23A 4F9PA 1S7RB 4PW4A 4MJ2A 1LEGA 3NTCH 5DQJB 4ZRGA 1OAXL 2ZXQA 2C9VA 3AB0B 5L6YH 4GY4A 4K7PY 1U8MB 2VXTL 4Q97A 1HHKA 1W72H 3B2UC 4JL1A 2MCAA 3W0WA 5BMFH 3TT1L 3QWRA 3M7FB 3UIZA 4HUUB 2NQCA 4FLQA 4RMUA 1I53A 1JPTH 2BS71 2H9GB 3CXHK 3X14A 2NNAA 2IALB 1T1ZA 4ZS7L 1JI1A 1MIEL 2VDLB 2G75B 2DAVA 4NN7C 2WV3A 3VXOA 2LTQC 3ASWA 3T0DA 1LILA 1NEPA 1ORSA 4DP1X 2AJ3A 2WY3B 3VRJA 1NC4A 3QHFH 3FZUD 4IDLA 4NO0D 2OL3B 5F2FA 4PCYA 1AJ7H 3CUPA 1WFOA 4G43B 4ECNA 1RP8A 3ZSSA 3SE4A 2VXSH 2ADJA 2X6AA 1KENH 1ODAA 3GT6A 1CE6B 3PAZA 3EGSA 3KLHC 4IBUA 3ARTA 3BIAX 3RY5A 3VXUD 5DJCA 3VXUB 2GCYB 5DR5H 1H6EA 4LXFA 4P0DA 1ZK9A 4HJEA 2YUWA 3SCMB 3PWPA 3O4LB 2A74B 1OP5H 3VFSA 2IH1A 4UNIA 3JVGC 1FZJB 4NFBA 1DQKA 3MRCB 4H8WH 2BSRB 2E7CA 4NENB 1XCQB 4JJ5A 1M2VB 1N3NB 2F6AA 2ARJA 2FE0A 5I1HH 2D3LA 2YAFA 4PS3A 2WYHA 2QTVA 1GHFL 2UZIH 1J1OH 5J12B 3BSGA 1D5XB 3MJ8A 4U3CA 3IVKB 12E8L 1OQXA 3HKFA 4RZCB 4NO2B 2EYSA 4L8CB 3CN1A 5B3SB 3UDWC 5JQ6H 3LEXA 1RHFA 4GRLD 3TV3H 3JBG7 5I9QB 2J12B 4JPIA 4J4PA 1PAMA 3TBBA 1SEQL 3N06B 1N7MH 1V7NL 2BOCB 4HOZA 2XBTA 4FMVA 1CYWA 3NESA 1NCBL 2BZCA 2XWRA 4C83B 1C5CH 4WWKD 1B4RA 2OMZA 1NCHA 1OSZA 4P57B 4WWKB 2WLYA 3RUGF 4H5SA 2KT6A 3NOIA 2FLBT 4JMNA 3UZEC 4DGYH 1I1AA 3ZPDA 4NKMA 1BYNA 4PJ7E 3OZLA 32C2B 4UI2A 5D7IA 4PS8A 4X8GA 5F8QC 1SXAA 3CLFH 3C5JB 3VDBA 4X9YA 3QJXA 3GSUA 1CICC 3GFUA 2H26B 4RFEB 4YZWA 2J8UE 4MA3B 4BUHA 4JY6B 3VH8G 1U6AL 2F53B 4NQDE 1XDTT 2CBQA 4F58L 3LS4L 4AYBA 1OOWA 4X80H 4LLWA 5EUOF 3U0PA 5FV2A 1QFWH 4LRNH 5TH2A 1DVYA 2QPDB 4YHIA 1JD9A 4YDKH 1UEYA 4XHQA 2CHNA 1V5JA 4Y5XB 4PJ8B 5FF6A 1RL1A 1T5XB 3BIKB 1T3FB 3FSAA 3LZFH 4MJIA 3QFJA 3KD4A 4MNQD 5EEUA 5CGBA 3RNQA 2X4PA 4P8QA 2CLRB 2YMXH 3OWEA 4D9RD 1JL8A 2CUMA 5E03A 4I7ZC 4UOQA 3SKOA 5DQDH 3BD4A 3SKMB 1YEHH 2H3NB 3GSOA 3MV7E 4AYEC 3QJFB 4KUCF 1E90A 1IZKA 3JSSA 4X6FB 4AMWA 8FABB 2OJEA 4TSCL 3QDGE 4KZCA 1WFIA 4PRHD 1CE1H 4GG6A 3SEPA 3FPYA 4L0YA 1CTOA 1JE6A 4JQIH 2DQIH 1A9EA 1RV6X 4MA7L 4OZHE 1PD1A 3GSVB 4U6TA 4ZPTB 1IGFL 3QUXB 1IM3A 1OGAA 3BWAB 4H2CA 3C8KA 3RY6A 3PNWA 2DJMA 1M71B 4FQXD 5BW7A 1AE6L 2ZUWA 1E4XI 3VWJB 5ERWA 1BQSA 1F1GA 3APMA 3AITA 3GSNA 3QG6B 4FQXB 4ZK8A 4WSGA 1S7RA 1TJGL 2YC1A 3CHOA 3LJ3A 5DQJA 1DR9A 2I7SA 4FLSA 1U8MA 1WYJA 1MCOL 4EI5D 5E08L 1MW1A 1A14H 1ACYL 3PNRB 3UG4A 1E4JA 3HI6L 3BAYA 4XB8A 5D7SL 4AQ8C 4K8RH 1CLYL 2IALA 1RIUL 1PX3A 2CO1A 2CMRH 3E1F1 3HUJB 3ILPB 4UZSA 1NAKL 1IGYA 4MGXA 1NUGA 4B27A 2A9ML 2IPKB 3VXME 4R4FH 4Y4KB 4LRIA 2OL3A 4U1NB 4JKWA 1BAFL 4WJG3 4HCRA 5HJDA 3UMTA 5CN2A 4G43A 1Q4NX 5MI0B 3EYOA 1CLVA 4GO9A 1CE6A 4LCCB 3HG0A 4BK5A 2XQBL 3MLXL 1DLHB 1GY1A 3V52H 2NLJA 4Z7VE 1KCBA 4J8QA 3SCMA 4RLDA 3O4LA 4XVUD 2A74A 2CG9X 3MLWL 3C5XA 4MCZB 3HG3A 3MRCA 4KTEH 4NENA 4QAWA 2EVFA 4JVWA 3L2MA 5C7XH 1XCQA 2FEJA 3RVXD 2X5PA 3O6FB 5JHLH 4J2XA 3VNZA 1ID5I 2HA1A 1D5XA 1A7OH 2COVD 2EXYC 2CNYA 4DO6A 3IVKA 1JZEA 2AEQL 4L23A 4RZCA 4JRYD 4L8CA 5TGBB 4O02B 2J1XA 3IDGB 1QSZA 4JZOB 3I75A 4BZ2L 3VI4F 2XXFA 3GTTA 1X7SA 5CFHA 3S35H 1NMAH 2BOCA 3SHSA 4QRQA 2WVTA 1JZ2A 1KJ3L 1OAJA 3ARSA 4LNRB 4XP6L 2CAKA 3P3SA 2WLZA 4P57A 3IMUA 4HSQA 3CFQA 3FTWA 5J0BA 1ZVHA 2PNDA 3PWUB 5ES4B 1D3CA 1ZE3H 1YNTB 3P9WB 4FQJH 2GTQA 4MMXC 1FP5A 2D7OA 2IGTA 1N64H 2FO8A 32C2A 3SGKA 4PGCB 3TA3C 3ZTNH 3C5JA 2YK1H 4GXFA 5T5FA 4DVRH 1L7IH 4B60A 3S36H 2H26A 4RFEA 1X5FA 1NIFA 4WW2C 3GMMB 4JY6A 2BVUA 2F53A 3AGWA 3QEUB 3ZO9A 4L29A 3IRZA 5D7LB 3ASOB 4D9LH 3P2BA 3VG9B 4UTBH 4XC1H 3MBWB 1UT9A 4UQDA 2YGPA 1H9DA 4ZFGL 2X44D 1CVSC 4Y5XA 4PJ8A 3BIKA 1T3FA 4QRFA 2H7WA 2WK2A 2BLFA 2DBLL 2H45A 2VSKB 5K39B 3MROB 2CLRA 1L3NA 1RPKA 1HTYA 4G8GE 1UJ3B 4TSBL 4XO5A 1HEHC 1NKGA 2GI7A 3A3YB 2FX9H 3SKMA 2H3NA 3QJFA 1DQQA 2MKLC 4LLYB 4ATTA 8FABA 2LU7A 2FSDA 1P9MC 2KKQA 4FX5A 4KVNL 4FJZA 3CQFA 5L2KD 4AYID 4ZPTA 2DQ6A 3QUXA 4FNPA 2A9BA 2NXZC 4W70A 4WFGD 3RFZB 2HN7A 1C08A 3GSWA 4OF0A 1FJ1B 1H6FA 1QG3A 3VWJA 2OK0L 3QG6A 1GGBH 4XPGH 4A6YL 4RGMB 1MCPH 4CSZA 5IUSA 1CD1A 4PIBA 2X53A 3H4FA 1KDIA 4OBRA 1SYVB 3IDXL 2IBBA 4G11A 4RMRA 3HBZA 1XCTA 3UTTE 1ZT4B 4APQD 2R9HC 3WKMH 2C9XA 3NCFB 4HISA 1FIEA 3TTYA 2ZNWA 1JPSL 4NCC1 5EZLB 4S1RH 2ATKB 3IDJB 2YRBA 3NEOA 4DAGL 3CFBB 3ILPA 3WIIH 1YNKH 2VB5A 4HOMA 5AYTA 3FN0L 3KPSE 5A2AA 1RZJL 4W4OA 4Y4KA 4MFHA 1T4KB 4U1NA 3RAJL 2YSTA 1I82A 1I8LC 4XWOC 5DZ9A 3BZEB 2ZXCA 4C57C 4MVBD 4Z3IA 1SN5A 1Q9LB 3MUJA 3T65B 1AO7E 4YSEA 1TZGH 4IKKA 4LCCA 1MJ8H 1LTXA 5C0BD 1DLHA 3O4OC 1QTSA 2QDVA 2XIBA 5C0BB 2F8OA 2PTUA 2W0KA 3TFKC 2R83A 5D93C 2NY5L 5EUOA 1ET5A 5C0ND 1H3VA 2HVBA 4D3CL 4XNZC 4PD4J 5I1CL 1QZ1A 4FTVE 4WEUD 4IRSA 1A64A 2FJFA 2VLRB 4Z76A 1XMEB 3DVFA 1E2ZA 2PPCA 4X5XB 3NG5A 1OPGL 3O6FA 5TDPB 1ZV9A 3SPCA 3F58L 3VJ6A 1HZHH 5TGBA 4O02A 3R8BB 4PSRA 3IDGA 4L0ZA 1MRDH 3D1MC 3MJ7B 4JZOA 4U1IA 1LO2L 3HFML 3NFSL 3HB3C 1A8ZA 5TF0A 3BWZA 4HGMA 5BZXA 1ZT1B 1RIHL 2HFFB 3AS0A 2Y36L 4IW4C 5A2LH 3Q06A 2GHZA 2I9LB 1YDPA 1A7PH 3RWGB 4K3EH 4Q0XL 4UB0H 4NN7B 2LTQB 2IPUK 2C3WA 4XN1A 3PWUA 4ZX4A 4OLYH 5A6IA 3RTQC 5HJ3B 3HR6A 3VXTB 3WU1A 3L1OL 5CEZE 1YNTA 4JQXC 4RMTA 4Y4FA 4XAKD 1BVKB 3KL3A 3MLSL 3LSOA 3K2UH 1JF1B 4NQSA 4PGCA 1TNNA 3EJSA 2OCCB 4EAEA 4XMTA 3KLHD 3F5WB 1LLAA 1UM6L 2BZDA 4Y1TA 1KT2B 4KUZH 3II2A 3GMMA 5KVMC 1LEIB 4AYFA 3OR6B 3TESA 4H8QA 5T3XH 3F6LA 5D7LA 5BVPL 2FBJH 3B43A 4XMLH 3MXWH 1R5IB 3MBWA 1CTNA 3NQIA 5KVFH 4Z7AA 3VRIB 2DQUL 4QT5B 1WFNA 1QACA 5AKVA 2Z34A 5DCCA 1MCFA 4W1TA 5K39A 3MROA 5LHDA 1OB1B 4LPUA 1OCZB 1UJ3A 4I9WD 2QVIA 3CHPA 2OS7A 1N0LA 3QIUC 3MRMA 1G7IB 4LLYA 1VDGA 1E4XL 5FCSH 1X4ZA 2X4RB 4J7RA 3ESUF 4P5RA 5GRUH 5A2FA 3WS6C 1OT2A 3U9WA 4URKA 1XR9A 3OJVC 5AYQA 4C56A 4UIKH 1KGCD 5C9JB 3RFZA 5AL0A 3ROOA 2ZXAA 3WBDA 1FJ1A 3DVGA 2OM5A 1QEWB 4OGZA 2B9BA 4AEIH 2XY1A 4HPYH 1AGDB 2B14A 2GJJA 3WIHL 3QB7C 3KJ6H 3J27A 3M1OA 3SO5A 5CLYA 3VI4A 1BZ7B 2Y23A 5FKAA 4L4JA 4WHYG 4LVHC 4LSQL 3CNKA 4ZTPL 2ZG2A 1OW0A 4OF6A 1ZT4A 1ZIAA 4YE0A 1JAEA 1T7YA 3CZUB 3L5IA 4QHUB 3D69B 3DVNB 3TO4C 5IMKB 5EZLA 5AYUH 2ATKA 3IDJA 2QVMA 1B2YA 2AAAA 3S0PA 5GS1A 3HG5A 1J0ZA 4KI5E 2DD8H 1PDKB 2ROYA 4GXVH 1GC1L 5D6CB 3RA7L 3QUHA 4V11A 3QEGH 1AGFA 2IAMA 2RHEA 5D4IA 3IDUA 1UKSA 3GSNL 2A9DA 3BZEA 3HZYB 2A99A 3GZOA 3ARQA 1Q9LA 3T65A 2W9DH 2YRLA 4R4BA 4Q4IA 4ELMB 4LLQB 5C0BA 3U4KA 1JTTA 2BJMH 1RH8A 1L0QA 4PJCE 5DD1L 1N6UA 5DURD 3CFJB 5C2BL 5HHXH 5DURB 4UQAA 2NPLX 1J8SA 2VMEA 3ZE1B 1QBLL 5FYJL 3U7WL 5GGRB 2VDLL 5A43C 2VLRA 3H9YA 1JZ4A 2DIEA 5E2TH 4QOKA 3VGDA 4CN6A 4M3HA 4ZMLA 5TDPA 3LZOA 4PJ7F 2OL3L 5FYLL 2A0LC 3JYCA 4HCRL 4LIQH 2Z35B 4P2RD 5KYXB 2DQEH 3HI1B 4P2RB 2O5ZL 4XAWL 2J8UF 2X3BA 2J56A 2DMKA 3MJ7A 1URLA 1E27B 4BQBA 2O1AA 3ZIMA 4MLSA 1I1RA 3TTSA 4MCMA 5DMIH 3IGAB 5EIIG 2HFFA 4FCHA 4K8RC 2BY0A 4CVXB 2I9LA 3S37X 2BXZA 3QI9C 4QLRA 1MWAB 4WW2F 5KTEL 5E5RB 1EHLH 5A40E 1EO7A 5GRVL 3S8FB 5HJBA 5GJTL 1C5BL 5DUJA 1MCNA 1AVAA 3D48R 3OX8A 1MY7A 1BF8A 2GT9B 5HJ3A 2EIDA 3UGXA 4ZNCD 3VXTA 1FAIL 1FFQA 1BVKA 1Z9LA 3OQ3B 3LNFA 4OZIB 2CHDA 4FFZH 1NBZB 3REVB 1P5VB 2MCG1 1XTMA 4C59B 1LVEA 5K9QI 3QUYC 3DTUB 2B15A 4XP1L 4GUCA 1EEUA 2P24A 1E2VA 5A2IH 4HC1H 3FB8B 4OZHF 5DYFA 3PDGA 1KBBA 1Z5LA 4FZ8L 1JPFB 2WN2A 1UWGL 4DPRA 1WBXB 5C9KA 2BDNH 2CK0L 1R5IA 2OMUA 3BVUA 5JLZB 5IMLB 4WGKA 2V37A 3TVMC 5DS1A 4ZMNA 3VRIA 4OIBA 1FLRL 4MJ5B 5HY9B 5EWIH 4QT5A 1XH2A 5FYKH 2EXYD 4KVCL 3CLEL 5E00A 3HS0C 1OB1A 3BHBB 3T6WA 3UDWA 5T5FL 2B0SL 1NICA 2QFRA 4RDQF 1G7IA 3HBQA 2YR3A 4ZBJA 2X4RA 4LL9A 1HCFX 2PP9A 3FUIA 4HP5A 2R1YB 2ZCKH 1F1AA 1A3LL 1D5BA 3CSFA 4X6DE 3NZHL 3VGAC 1F0LA 5IHUL 1R24B 2ZCZA 3LIZA 1TO4A 2YLKA 4OLVL 3UZEA 1QBAA 1SN0A 3BIBX 3DGGA 3AQXA 5E8DH 1I7UB 1ZE3C 4MMXB 4ABQA 4BH8A 2ZUQC 1BZ7A 3TA3B 4ZOAA 1HNYA 4XP5H 4OZGE 2X2YA 3CN0A 4KXAA 4WWID 1CICA 3B5HA 2N1KA 4Z7VF 2D03L 3VU1A 4F24A 1T1WB 5CBEB 4KI5C 4XE0A 4YPJA 3DVNA 3MODL 4XPHH 4UNVA 5LBSA 4U6YA 3QQ4A 4DGIH 3N5AA 3RJDA 5CF3A 2OFQA 3ZR5A 1HH6B 5JW3H 3PY9A 1PDKA 5D6CA 4TLUA 4MBRA 3B2MA 1F42A 3BESR 4BUQA 3RGVC 2LVCA 3OPZH 3E9TA 2H32B 1I7RB 1ZD6A 5C07D 1IBGL 3Q8FA 3H56A 4OJFH 1B90A 2CA3A 1I8AA 3B9AA 3PJLA 3RNKB 2BVTA 4ELMA 5EOCL 4LLQA 4QHLB 3DXAB 4PVLA 2VM9A 5L2JA 1MRCH 3CPLB 1YEKH 3L7EB 3MV11 5IEKB 3CFJA 3DUHA 2FNBA 4DUXA 2Q87A 1S5IH 3ZUCA 4DOHE 1KGWA 1IGMH 4LVNC 1NBVL 5GGRA 2NXZB 3TWCL 2YGVA 2Z1KA 1WCBB 2EC9U 2LR4A 3QA3A 5JIDA 1LO0L 1YSOA 5M7QA 4N0FB 4LCWE 2GTZB 4V1DD 4UV4L 4PGZA 3VD9A 1G9ML 1QSEB 1R4XA 4OAWB 4V1DB 5KJ7E 4DGVH 3ECUA 4ZODA 4P05A 5KYXA 2PABA 3D51A 2QGDA 3HI1A 3KXFD 2O5YH 4YFLF 3MLRH 3TCLB 4F37K 1BYOA 5FO8B 4OM1L 4ZOCA 3KXFB 5BNXD 1PCXA 2R9HD 1E27A 5JQHC 1G43A 1BVNT 3PDOB 2YPVA 4YXLL 4AQ8A 2XA8L 2IQAA 3IGAA 5LAXB 4HUNB 4FQCH 3S6CA 4HUMB 3GS4A 4KRPC 1X4YA 3WEMA 3CGTA 2V7HB 3ETBJ 2FVNA 1BQHB 4GRMB 3MRQA 1MQKL 1TZAA 1L9MA 2A83B 3DUSB 2I60H 4QR7A 1E5ZA 4CSSA 3PV7A 4L9LC 3G5YA 4R7DB 2DQHH 1QFUH 4OZIA 3E3QE 5ICYB 2D7PA 4PWIA 1OP4A 3DPDA 1MFAH 3REVA 1JXFA 4GP4B 3VO0A 3Q5OA 4PJDE 3TFKD 5AW2B 1JYXA 1N4XL 4O02L 2AI0H 4NYLA 1SBSH 3N44F 5E95B 5D93B 2OSWA 3FB8A 3HEIB 4R8WL 4UV7L 3TL5A 5L4IA 1JPFA 1KGUA 3E8UH 4JO4L 2X6VA 2AXWA 1S5HB 4JVPA 3U0WH 1TYRA 1WBXA 4XNZB 1TLKA 2P49B 5JLZA 5DD0H 3BKYL 2ZWZA 3BKCL 5IMLA 3H3BC 1RZ7H 5DUMH 4DEUA 4UT6H 1XZWA 2FEDC 4MJ5A 5DVOA 3VWKD 1RZKL 4LPVA 4FN0A 3HN5A 5KJRH 3G08A 4U1JB 1CVRA 1H0DB 3K8KA 1O9ZA 1IBZA 3Q6GH 1F4AA 5KJ4A 1Q38A 4XX1E 2XZAL 1W72B 3OPUA 4Y9FA 2V8MA 4ONOA 2HT4D 1CDJA 3HB3D 4DKDC 4BFOA 3HB3B 3B56A 4HK3N 4NKOB 3WN5C 1GAFH 3X1BA 2R1YA 1G5AA 4ZMWA 3SYQA 2KBGA 1K6QH 2CRYA 1R24A 3DJZA 2ZICA 4PJ7A 3BMVA 4KC3B 5BUAA 1SMAA 3W38A 3NBNA 3RTQD 1XGRB 3ARDD 5LUMA 2I7OA 5DUBA 3ARDB 3RTQB 1GY2A 3NIGB 5C71A 3U46A 2AQQA 1YCSA 3HAEG 4MMXA 5AVSB 4L3CB 2X4QB 3N85L 4U6VH 3MV01 4Y4HD 7CGTA 3DJ9A 3TA3A 2HFTA 4H44C 3D4CA 3HA0A 3L1FA 4R26L 5HHPB 5F9DC 3BQVA 4MZ2A 1E2WA 3MSPA 3QCTL 3O2WH 1T1WA 4JFOB 4PJ6A 4WW2A 4ICXA 1WGOA 1CS6A 3TIEB 2A77H 2EIZB 2LVEA 1IBFA 4KKLC 5IIEB 2QPFA 3GMQB 3QULB 3SDXF 3AC0A 1KCRH 2A1WH 2HWZH 4NAJA 1HH6A 4JFFD 1BBDH 2G4GA 5CGYD 3ZU8A 4JFFB 5AKRA 4CKVX 1NEZB 3QIWC 1PL3A 5EORL 4AW7A 3VTTA 2VR9A 3MV7A 3ZE0E 3QQ3B 1I7RA 1ONQB 1NSNL 1NC2D 4IK6A 5BZDB 4G7QB 1NC2B 2XYCA 1DBML 3P3TA 4H0GA 2WXQA 1IGIL 2YZ1A 4ZSOB 5KVDL 3RNKA 3U1SH 1BEYL 1I3GL 3QIUB 4QHLA 3DMMC 3DXAA 4OB5L 5F1IB 1T6VN 1CGYA 5T5NF 2KLSA 3S4SG 5E9DD 2KZBA 5E6IC 3L7EA 3NRPA 1P9MA 1S7VB 3GGWB 1N5AB 4LGPB 3A24A 3P69A 4H13C 4DVBB 1Z5HA 2R2HB 4N0FA 3O41B 2DLIA 4X4YB 2GTZA 3HJ0A 4XPAH 1K9TA 1A6WH 1BX2B 4XVOA 2CGRH 2GSGB 5DSCA 5BRPA 5KVEE 1QSEA 4OAWA 3ZT6A 4PG9B 1SJHB 2IGFH 4JX0A 4N0UE 1KN4H 3MRBB 5IJVB 2D3VA 4U1KA 2R1WB 3U2IA 3ETSA 4DN4H 4LP5A 1HINL 3KXFA 4LVHB 5GRJL 3VW3H 3KNBA 1CXHA 5GS0H 1RPUA 2R56L 2BFVL 2YJQA 2VN5A 3DA0A 3A6BL 3PDOA 3WTUA 1LO5B 3TO4B 1DFBH 3CZGA 1KN2L 4Y2DC 4LSUL 4P3WA 5MP6H 2WWNA 2R0LH 2YD8A 4BSWA 3LS5H 2V7HA 3ZL4H 3D18B 5D8JL 1BQHA 1NJ9B 5TDNB 4GRMA 1G1CA 3VAEA 1SXZA 2IBGA 1RK1B 3H0TB 4I3SH 4A04A 4GAAA 2A83A 1AZUA 3DUSA 4XI5C 2EDWA 4TTGA 4IBQA 1A5FL 1I8LA 2UYLB 1YEEH 3KPRE 1VACB 2VWEC 4M43H 1SYSB 5GJSH 3QEQD 1KJVB 1MCQA 4GIPD 1BIIB 1SDDA 4FTVB 4JJOA 4KFZC 4PJ5D 3SDXB 4PJ5B 3KM2A 1U2CA 8CGTA 1D6VH 5PCYA 3F3HA 3Q1SH 1S5HA 2WXOA 2XTJE 3KR3H 3APFA 1GSMA 5JUEH 4HALA 5H94B 1UA3A 3VFVB 4G42B 2ENSA 2Z7WA 2DYSB 1CDYA 2EUZA 1HEJC 2P8LA 1SOSA 5IY5B 1T1YB 2YOAA 5CSGA 4R6UA 4NAQA 4F8LA 4ZW7A 2A0LD 4GAJH 4OQTA 4PJIB 3QCUL 4AQEB 4JPKL 4U1JA 1H0DA 3JWNE 3QUZC 4IQHA 4JGNA 4DPBX 4L9DA 4NJ9H 5IJKC 2VNCA 4IOIB 3QG7L 3BVDB 4XBGB 4NZRL 1NCWH 2NY2C 3BT2L 1AXTH 4CN1A 3EW3B 5DVPA 4UT7L 4NKOA 4NM8L 5D7JD 4G6ML 1JPGA 3QI9B 4KI5F 5FHAH 4XMPH 4N87A 1E5CA 1X9QA 1JMXA 1L7TH 5CO1A 2APXA 1XGRA 3RTLA 5ADPL 2NX5E 4JFED 4R7XA 1SY6A 3ZDYE 4JQXA 2XVKA 4KRLB 4XPFL 5D71L 3MRJB 3MHZA 3DHUA 3O81A 1EA9C 4NOFA 5HHPA 1ZHNB 4PJCF 3D4GA 4F5CE 2WWKT 3BGFC 2Z93B 3CIQA 3D05A 1B0WA 2EE3A 2OW7A 4RX4A 2FUTA 3TIEA 3F7QA 2EIZA 3FQTB 1CO1A 2ZX9A 5IIEA 1TQSA 3GMQA 3QULA 5HHOE 3BN9D 3PHAA 2IJ0C 4YHOL 4HWBA 4W9EC 1EGJH 3BE1H 3UPAA 3DX6B 1G7QB 3MRDB 5BO1L 2EYRB 2PWEA 5E2UL 3LIZL 4JFFA 3TVMB 1RURL 4G8GA 1NEZA 4NM4L 1OVZA 1BV8A 1VJSA 4Z7UE 2PO6D 4ABVA 3TNMA 1P4UA 3QQ3A 5IK3B 1ONQA 1WZAA 5TF1H 5BZDA 4LOEA 3HS0B 4ZDHA 5EF0A 1AR1D 1MLBB 5AW6B 4ZSOA 1AR1B 4MD0A 3SBPA 1Z9SB 2V3DA 5HI3C 3QIUA 1K72A 2XZCL 3EF7A 2XACC 5B1BB 4CBPA 3IE4A 1VIWA 4YFLI 2GSMB 2HX8A 4RNRB 5LBSL 1ZS2A 3WS6A 4HCGA 2VDKH 1MLCB 3CN3A 3L3OC 4PMEA 3PFUA 3VGAB 1Q9WA 1N5AA 1WAAE 3QWOB 4FABH 3H9HB 2R2HA 3ABGA 4L8SA 4N2GA 3O41A 3MBEA 3DPBB 4X4YA 1BECA 2ZWYA 5EBWB 3D12B 2GSGA 3S5LA 2ZOUA 3FU0A 1SJHA 3NCYP 3QR1A 2ZUQB 3MRBA 5DVLA 5IJVA 2F5BL 2OJZH 2R1WA 1TZOA 3CSPA 3W3BA 2WPGA 1I8UA 1ZAGA 3UC0L 4WEBL 2UVEA 1T03H 3RPKA 2C7FA 2ED9A 4XCFL 5EEVA 3FFOA 3TO4A 4DKFH 2F68X 3QO0A 4KJPC 3KPSA 3C08H 4MKTA 4TNWK 4KXCA 4G6AC 2HSIA 4K0OA 1ETJA 4GAGL 3MMEA 1LQSR 1NJ9A 1DBKL 5TDNA 1J9RA 2OQJB 3D87B 2F58L 1CF8L 3BDBA 1RK1A 3H0TA 5DO2D 1AO7A 3VM7A 1QSFD 5A16A 4XVJH 1DCLA 3CVIL 1QI3A 1QSFB 3RGVB 3BGMB 1A6UL 4PRPB 3U7YH 4ZNEA 4HH9B 2LLLA 4U1MB 1VACA 1T7VA 4HAKA 4OUUA 5F7HA 1SYSA 1KJVA 5IHHA 1ES0B 1BIIA 1XB3A 4NC2B 1G9HA 3L45A 1WF5A 2JELH 3NMEA 3OAUH 4FTVA 3SDXA 1N0XH 4AVKA 4JFHD 2XQ0A 4ZX3A 5FUOL 2YPVL 4X6DF 4K3HA 2LFEA 2XQYA 1CLZL 2MOVA 1X7QB 1KCSL 4WSJA 1CYGA 4F2EA 4LVNB 3WS3A 2CIKB 4I5BB 4G42A 3MREB 1ETZB 4GP8B 1CXIA 5EIVA 2Q10A 3PPEA 4P9ML 2J5LB 5D72L 3HC3L 3SODB 1T1YA 2BRRH 3WMPA 2CO7B 3I50L 4PJIA 4K9EH 3DRQA 1KYFA 4AQEA 3NACH 1KLGB 4J3WA 4OZGF 3T08A 4OUOA 3LAFA 5CEYB 3NJKA 2FGWL 4IOIA 4XBGA 4LHUA 4WU7B 3ISWA 3C60D 3V4UH 3T0EE 3O3DB 5HDQH 3C60B 3R06B 4JFSA 5FW7A 5ACZB 4KRPB 1GGCH 3QI9A 2O61B 1HHGA 3BFOA 3TOPA 4QRSB 3TWYA 2AV1A 1JTOA 3RWCB 2IDUA 2BIQA 3QUGA 3BP7A 3P3YA 4NWUL 1OAZL 4BZ1H 2JJTC 3ATAA 1LWRA 2OMVA 4PFEA 5IQOA 3ARYA 4L9LB 2EJ1A 4N2KA 5CLWA 4FL4C 2FIKB 4UDTA 2HFGH 2MNJB 4K23H 1PG7H 3MRJA 2IBZY 1SJVA 4XPBH 2DLHA 1F1DA 2CM5A 2GUOB 1ZHNA 1KY7A 3MUZ1 3QUYA 3FUNA 1NZRA 2IPTL 1FNFA 5I8EB 2Z93A 3O9WD 1JCKA 2AJYH 1U30A 2Q3AA 3QDJE 4QXTB 3ET9F 5FKPA 3FQTA 4JG5A 2V5TA 2XX0A 4WUUD 4RFOH 4EI0A 2NY0D 4G8FA 4WUUB 2PW2B 5CILL 4UILL 5AB2A 4PW3A 4YVUA 3UL4A 1LM8V 5I19H 1MNNA 1V7MH 1XXFC 2EYRA 4X7SH 1J5CA 3HRPA 3TVMA 4AV5A 3AREA 4ELKB 2FHBA 3MCLL 3PWVA 5H37G 1UCBH 3B8YA 4FFTA 4WGWB 3VFTB 5IK3A 3TN0C 3BWUF 2VYRE 3HS0A 3CPUA 2IMNA 5FM5M 2RFXB 1RK0A 1XSOA 4ODHL 3ZKMC 5ADOL 4RSYA 1H8NA 1C9SA 1Z9SA 3MLVL 1DQLH 5JHDD 5L7XH 4L5FL 1B9KA 4N0YH 5JHDB 2DMCA 1Q0YL 4OJEH 4PP2A 1W8EA 3WN5B 2HRPH 1HI6B 5EU6D 4RNRA 1MLCA 2X9XA 4N6QA 3S3SA 3PV6B 2R27A 2JWYA 2PCFA 4OJCA 2NR6D 2L04A 3H9HA 3P9MA 3DPBA 1XEDA 4JRXE 4PW9A 4ZO7A 5EBWA 1A7QL 1ZTMA 4AKQA 1L3WA 2OJ1A 1UURA 4PJDF 3GXFA 1A4JB 1J1PH 3LZQA 1CGTA 1G1KA 2QQKH 2VDPH 1MF2L 2EO7A 1S7UB 1G7MB 1PQZB 3FFCD 1F18A 2YWZA 3FFCB 4IU3B 1SHXA 5GGRY 1IAIM 3I2CL 4HPOH 5T3XD 4NKIL 2DL2A 4B53A 1LK3L 2V5YA 3V0WL 3QUKA 4EN3D 2OQJA 2NSXA 1KULA 1JNLH 3D39E 3QIWD 2BP3A 2DQDH 3QIWB 5EMYA 4NPKA 3S34L 2C1OA 3QWNA 3VFUB 3RGVA 1HWWA 2BCKB 3BGMA 1WA1X 4PJCA 2YPLE 5DHMC 1UT2A 4PRPA 3L4TA 1XF2B 3ZKSD 1H3UA 2C9UA 4HH9A 4U1MA 1A6TB 1ADWA 2WTPA 2XFXB 3CAFA 4KDTC 4TULH 5BZWA 1QA9B 1JN6B 3M1BA 3SOBH 3DMMD 2ATPB 1PZ5A 3V0IA 2DTMH 5J1SC 2VJ0A 1FV1A 3DMMB 3UMNA 1OD9A 4N8CH 3FUEA 3UJJL 2GY5A 5E6IB 2P8MB 1CDHA 3SJVE 2Z31D 4FG6C 4N8PA 1Y6NR 4X98B 2X10A 2VLJD 1X7QA 5DGRA 2CHXA 4OSUL 5I6OA 3DTXA 2D3JA 3BH9A 3MREA 1ETZA 3C2AL 4OTXH 4PRDA 5HI5D 3STZB 3K8MA 4QRPD 1UUSA 5DO8A 1DDHA 3O3BA 1A1NB 1CGWA 3HN3A 1JGUH 35C8L 3GKWH 1JNHB 5I30H 3L6FA 5E5MB 3PPSA 3WTTA 1I3VA 1Z66A 1KLGA 4RAHA 5FAAA 1BMZA 1RI8A 2H3XC 1EO8L 3I3BA 3T0EC 5CEYA 3ULUH 3QR0A 3SY0B 2BHZA 1QRND 2ZKYA 4LARL 3ZX1A 2AXFB 4WU7A 2WC7A 1MCWM 3MR9B 3W1ZA 3U48A 1CBVH 5F3HB 4N2DA 3LNIA 3WJLC 4Y2DB 5ACZA 1N5YL 2O61A 1E42A 4QHMA 2ILLA 3RWCA 3EG9B 1RUMH 2E7MA 2XZZA 4MQTB 1FYTE 4QRRE 4HX1B 4XI5D 5CCHE 4GUQA 3ZE0F 4PWEA 5KW9L 2CHZA 3NJHA 2V9RA 4L9LA 3VMNA 4AGOA 5EF2A 2FIKA 4OQTL 1MAJA 3S8GB 1MCIA 3X11A 1MRFH 2HFEB 1IBDA 1DEEB 2GUOA 2BVEA 5DTFB 1T0PB 3KGRA 5I8EA 5BMFL 5IQ9B 4Z3FA 5CZKA 1ADQL 4WKXA 1VEPA 4N2AA 4QXTA 2V8LA 3U82B 3FU7B 4LFHD 4N2FA 4ABUA 1GVIA 2XPGB 3WGUB 5J1TC 4FLRA 4XMZA 3HNVH 4FHBD 3DK0A 4QHNA 1AZRA 1EHAA 2PW2A 3WDIA 4X9GA 2EDYA 1ZPUA 5AZ2H 4ELKA 1VRSA 3CQPA 4DZBB 4BD4A 1J18A 2G3XA 4KDWA 4XXWC 3CTTA 5E70A 1FFTB 3VFTA 1SY6L 4QRTB 2JE8A 1AJ7L 4L8DA 5IQNA 4MDJB 5A2JH 3ZHDA 2NY2D 1RUPL 4UBDC 3BC9A 2NY2B 5T33H 3OKDB 4UF7C 3EDKA 1DCEA 5AVWB 3WN5A 1A9VA 3PCYA 4LK4A 3ZZLA 1EAOA 1JYNA 1KLUB 1SFHA 3CH8A 4H8VA 4P2AA 4P2OD 4HWBL 3FT0A 1PEWA 4N6RB 5E6UB 3VYNA 3U2JA 1I9JH 4QJ4B 4OZGA 1MCLA 1QI4A 2BMKB 1JXDA 5D4JA 1A1MB 1LP9E 1W91A 3HHSB 2QT6A 5I1HL 2CR0A 2VGLM 1J1OL 4JFPB 5DEGA 5C0FB 1A4JA 1GGIL 1TCRB 3QCVL 1QUPA 3MTXA 1TLMA 1FZKA 4GSUA 5DD5L 1S7UA 5KSVB 3QC5X 2CDEB 1HE7A 3K80A 3SE9H 1OB0A 4G6JL 2DLEA 4QNPE 4J3XA 3TV3L 1WP6A 5CEXB 5CCJA 4PD4K 2BIMA 5DZPA 4JE4B 1YEDA 1ZPLA 5BZZA 1F58L 1TVHB 1AKPA 2Y4SA 4HJJH 5E24E 2MWCA 5GZNC 4PTTB 3D52A 2VAAB 3K4AA 3VFUA 3CC5A 5FYKD 4CRPA 4I87A 2BCKA 4LLAA 4PRNB 5CINL 1BFSA 3PUUA 1XF2A 4PPTA 1A6TA 4JFDD 4KK8C 1XD1A 1QA9A 1JN6A 4JFDB 3EJRA 2WVSA 1JZ3A 5E1GA 3CLFL 3FU8A 3NEXA 3TS8A 1AS8A 3DMMA 1WC7B 1WAPA 3G6JB 1BDYA 5E6IA 2P8MA 3MZTA 5FB8A 1AC0A 3FQXB 4WI6A 1D7BA 1K8IB 3WTYA 4J23A 4CVZB 4Z8FL 4Z0XB 5SWSD 4X98A 1J10A 3N2JA 3L3OB 4PRAB 3S35X 4EVNB 4Z7QE 2MMXA 4NP4H 4UOW0 3D33A 3STZA 1XMWA 4HOXA 3ZDYF 3WFCH 3DIVA 2YGOA 1URIA 1EJOL 1A1NA 3GHBH 1IM9B 4YHNB 4ANXA 3LZFL 1JNHA 1AHKA 5E5MA 1HYRC 1CFQB 4CILA 2I9TB 1CMOA 4B3EA 4YZFE 4XTRC 3A22A 1KIUA 2XWCA 1OV8A 4BZYA 4LBAA 3SY0A 5ELIA 6TAAA 1IEHA 1UC6A 2UV3A 5DQDL 3S3CB 5HYQB 3PGFH 5HGAB 3S36X 2AHIA 4M5YH 4G6AD 3W2DH 3MOBH 1FIGH 4Y2DA 4WO4C 5IFHL 5TE7L 4DTGH 4HWEH 2DQIL 4N26A 2Y6TE 4G59C 5D1ZC 3EG9A 1E5UI 3ZQXA 4Z7UF 1VPOH 4JHAL 2BVQB 4HX1A 3MDJA 2DWYA 3SPHA 2F7IA 5A2KH 1FNEB 3FCGA 3EO0A 1LDPH 5J13B 3Q8EA 3QFGA 5KEZA 2HFEA 4U0QB 1DEEA 4OZ4B 3OAYK 5DTFA 1H3PH 3CSTA 4PU2A 3ZMRA 3UTSE 1PLAA 1NBYB 4L3FA 1QKZH 2WXGA 3FU7A 2QHLA 4UCFA 4JCWA 2XPGA