2NDFA

Solution nmr structures of af9 yeats domain in complex with histon h3 acetylation at k18
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
141
structure length
141
Chain Sequence
GSHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Histone Crotonyl-Lysine Recognition by the AF9 YEATS Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein AF-9
total genus 22
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ndfA00
5IQLA 2NDGA 5HJDA 5D7EA 3RLSA 2L7EA 4TMPA 5HJBA 2NDFA 5IOKA 3FK3A 3QRLA
chains in the Genus database with same CATH superfamily
4A2LA 5C3TA 4PUBH 4ZS6C 5I6MA 1W0VA 3ATFA 1CTMA 3U7YH 1QUNB 2F53D 1E2WA 1V7NH 4Z7WF 1SY6H 3VI4E 4X5PA 3T3PE 1A5FL 3LZNA 3ETTA 5GGRY 4NN7B 4NQEB 5T5FH 3V5DA 4OCRH 2CPCA 1XV8A 1QPKA 2P8MB 3OSKA 3QDGB 4N8CH 43CAB 2H8PB 2R83A 2QVMA 3FC8A 3QEQB 4L0ZA 4YXHH 4P2AA 5D1ZB 1ITBB 5LBGA 3RDTA 3FSZA 3AGWA 2I9LA 1PF3A 1KBPA 4QCIA 1OGAB 1MNNA 2BLFA 3LNHA 4JFSA 2EIKB 1UCBL 3PRZA 1RLBA 1MHPL 2E8YA 2YEVB 3V6OE 3KLSA 2ZPKL 2DAVA 4MSWB 1RUQL 3GRWA 1NC2A 2OSWA 3X11B 5C0IA 3M1CA 4WUUE 3P9LA 4I1PA 2R0WL 1ZOXA 4URTB 1T5WB 1OQXA 2L7UA 4N2IA 1EPFA 4TUOA 3I74A 4GUPB 1YMHA 1SJMA 1QRNA 5FAAA 4FLQA 2WTRB 3QQDB 3WE6B 5L8KB 2VN7A 3RX9A 2J5LB 3BWUF 3HIZA 4KKCC 3ZW3A 1JHLH 4HUVB 2G5BB 5AL0A 2H3NA 5JXEC 3VFTA 1HH9A 1EJOL 4JHUA 4Z95L 5ID0B 1AP2A 1G9NC 2R4SL 2BW5A 2CKBH 3MBWB 1UA6H 4HK0A 2GABA 5C0JB 1I8IA 1KIPB 3MJ8B 4W1TA 3ULUH 3QE5A 3QZWB 2QTEA 5ECGA 5CJXA 2UX6A 3T2NL 4UBDD 4GJTB 5KOMC 2J5WA 5I9QB 5D1QA 2OL3L 1WPCA 4M48H 2EVHA 4N2FA 1L6XA 2IOMA 4NPYA 3RWJA 2AV1B 2Y0SA 3UPRB 4JO2H 1EWHA 4F58L 1NFDE 5F7DB 1DO6A 1EO8L 2DL9A 1ZLWH 1CFVH 4N0YH 3WEXA 5LCVA 4UIMB 4UM8A 3D2UB 5K33A 1HNYA 3OMAB 4LSSL 4TTDC 3FB7B 2AK1L 2V5RA 5KAQG 4UU9B 3I9IA 1N5YL 4DP1X 3CUPA 4IU2A 2PYFA 4JANB 5LGJA 2J88L 3LB6C 4KXCA 2LGNA 3DPBB 4N90D 3L4VA 5HPOA 4DPRA 1BYPA 3RFZB 4W4OC 3V6ZB 3P0VH 2E47A 2NY3B 2VW4A 3WN5B 4GSQA 4LBEA 2WZ6A 1XGPA 2NCMA 2GB2A 2X4UA 3VYPA 2YSSB 3ARBC 4RZCB 4BH8B 5LLIC 1VJSA 4LSPL 4ADJA 2XQYG 3S0PA 4U1HB 2F5AL 4KX8A 4D0CA 2C3VB 3BDYH 1O9ZA 1SLVA 3JZYA 3TTSA 4AYFB 1FL3A 1J1PL 3CXHJ 3L3OC 3RHWK 1HH9B 3VRJA 2JJSA 1J8HD 1N5AB 5JR1H 5C2BL 3FSWA 4M5ZH 3WFBH 4NHCL 2I60L 3AU1A 5DRZA 1X9RA 2H6OA 4HS6A 4MJ4A 1KIPA 4MZIA 1BOGA 3F62A 4OCMC 1J5IA 5EO9A 2PLTA 5JPNC 4FL4C 3M88A 5CNHA 1EAOA 1G7LA 2IWKA 2P5ED 1XTLA 4KQ4L 4ZAKA 1RZFL 5F70A 4JK0D 1G6RL 1WO2A 2ATKA 2EADA 1GVIA 3EXLA 4TSCH 1IGJA 4YDMA 5IMKB 1F6AB 3BSGA 3B4NA 2WLLA 4QRTA 5ERWB 2N01B 1E4WH 3GLEA 4BSVA 4NOBA 4RNRA 2MPAH 5T1KB 1XL6A 1SF5A 4IHOB 5H2BA 1DR9A 5FHAL 4MJ6A 4AVKA 5F2FA 1KFAH 1RZIA 4WW1B 2F74B 2Q8BL 3ULVC 4XP1H 4AUJA 2GTQA 2DQFB 3VA2C 1J12A 1RUKH 2ZKHH 5CBAA 1DDHB 4AMKH 4R5XA 1HCZA 4HIJB 4WCYL 4O2CB 3FRPA 3MLRL 1UXSB 1J86A 1PNCA 3Q1SL 4OGZA 2EABA 3O0LA 5AKTA 5B4MD 4JY4B 4IRSA 1FVEB 4M7LL 1I3VA 5BXFA 4BEIA 1B9KA 2WM0A 2XZAH 3C5JB 4Z7WA 4XCFH 4K5PA 2J6EA 5CN1A 3P0YH 5GZND 1JSYA 2FLRT 4MDJB 5KZCB 3LH2L 4X99A 3P3RA 3O4LE 1RFDH 1TZIA 1J7VR 5F3HA 3NK3A 3OHXB 1QLRA 1XH1A 4K4KA 4LCUB 5D2NB 3UP1A 2EDDA 5GZOC 3X1FA 5LKNA 4OGXL 1AXIB 3W9DB 1OOWA 1Q9KA 4D9QD 3HE7A 4QHKJ 2Q2EB 5AUMA 4F8NA 4PJHE 4ZMWA 5FV2A 1WC7A 3B8SA 3VG9C 1DCLA 2QELA 1UH2A 4G8GB 3OC5A 2XRAL 3SDDD 4KUCF 3BMVA 1K6QH 2V2WA 2ZCKL 3DKHA 4L1LA 5C0AE 1CUOA 1YEFL 3DETD 2UZIL 3ARBD 4QIRA 3GBNL 1ZHKA 3FF8A 2DKMA 3NRPA 1N8ZB 3QJVB 5EORL 3V4VB 2ETWA 4ONFL 2GQHA 1U8KB 5DUJA 2H47C 3QHZH 1E50A 2PKDA 2JQAA 2TSBA 3PLYA 5SWQB 4XE0A 2WN2A 3DIFA 3QUXA 5TDOA 5IBUB 4UINL 4OBRA 5EEXA 1MCRA 2I69A 2JJUA 5KW9H 2AK4E 4KQ4H 5DQJA 3F7VB 1FVEA 2YPVA 1MUJB 1N18A 1KELL 2VN3A 4IIQC 1VFBA 4F8LA 1CT8B 3ARGD 2ICEC 1ODUA 4WGVB 5F7AA 1IJ9A 4HV8A 2OMZB 3WYRA 1NCTA 2D3LA 2IIJA 2R0KH 1RZ7L 1BF8A 4P3DA 4PRBA 1B0IA 4FXGC 4PRID 4NQXA 1DN0A 2GFBA 5F96H 2W0KA 2VW6A 4MD4A 3VTTA 4RWYH 3DRQA 1R47A 2CDEB 1BAGA 1OPGL 4FERA 2AEQH 1DVZA 1CDYA 2LR4A 1TZGH 1CI3M 2ILLA 2A2QT 5EZJB 5F3BB 2XXGA 1CG9A 5CR1A 1BZQK 1DQLH 4KOBA 4FMKA 3H9HA 5HJ3B 1KGYE 3DO7A 2FL5B 4IK7A 2ZF9A 4O2FB 1ACYH 2ADFL 2J20A 4GW5B 4ZMYA 3N42F 2X42A 1G7IB 1Z2KA 1KCBA 3ZTEA 4CILA 2OJ1A 3OZ9H 1H6TA 4XXDB 2YRLA 2J8HA 1HX0A 4RGND 3LS4H 3BLPX 3HS8A 3TO2A 1URLA 3CLEL 4A39A 3CXHK 3O41A 2XXCB 3ERXA 2IH9A 1ZLUH 3RPBA 4M48L 4IMLA 4FXKB 3IU3A 2C1PA 4ZTPH 4NUPA 3MBED 3ZT7A 1A7NL 4K5OA 1JL8A 4O02B 2YD8A 4Q6IA 4EZJA 4PJDA 1SMOA 2VMCA 5C0GA 4HJJH 1NMBH 1KPRB 3HI1B 4JFFA 2CE6A 4L9LB 4OR1A 2R29A 2VIRA 2Y69B 5GGQL 1F02I 2V2XB 1FIEA 5I6KA 2KHAA 2O5ZH 3K4ZA 4R3SB 4FNRA 2CMRL 2P42B 4PY7A 2WP3O 5C0ND 3B2PA 2ZG2A 4LOUC 2NY5C 1HNFA 3N6YA 4ES9A 4OLYH 1A25A 1ET5A 2CO7B 1M53A 5HBBA 3MLXH 4LMQI 2IVFC 3B9AA 2XKUA 2V6HA 3JTSA 1I9EA 1XR8A 2EIDA 3NRQA 3BIKA 2R15A 4C56D 3H2QA 2H1PH 3H3KA 4PCTA 1CL7L 3N50A 1JGLL 4OV6F 5T33L 3QZNA 4KKBD 4QRUA 2VXQA 4YAQB 1JYVA 1DLFL 1N3NB 5SWZE 1A1NA 4ZTPL 3QJUB 5JDSA 4UQ3B 1JPFB 3S37H 4FA6A 4R4ND 3N1PC 1GKOA 1RXLA 1SHSA 3JVGA 4AZUA 2IFFH 1S9XB 4P48A 4DFIA 3SYOA 4XH2B 2X2JA 4GW4A 4E9LA 1IM3D 3FTVA 4XBPB 5IFAH 5SV3A 5F1IB 1DFXA 4X5XB 4AITA 4XMKL 4K7PY 3TCTA 1BJ8A 4ZBJA 3D12B 4XGZA 2UYLA 1BQHA 2ARJQ 3GJEB 4HFWA 4RGMC 3WFCL 5IBUG 1TQBC 2AXJA 3O41B 5KYWB 4PJCF 5KYNA 2Z4QA 2K7QA 2R0LL 2X6BA 1R3IL 4X80H 1S7QB 5DO2C 4PUBL 3ESPA 2BOBB 2PPAA 4YSOA 3SCMD 5IESL 2FR4B 4QRQB 5J57B 1ICTA 5IGXL 1H15B 2Z3FA 2ZONA 4NCDA 4B9PA 3QFJE 2DEYX 5EU6A 3SDXF 5GGUB 4R4BB 3IJYB 4YUEH 4FABH 1JRHI 3RVXC 1YECH 3MROA 4I3RL 4TPRH 1CGTA 1LP9B 4KC3B 1DEEA 2H6PA 1V3JA 2AK4A 1RUMH 4Z3HA 1BEYL 2ZSWA 3GI9H 1D6VH 2WQ8A 3DV6B 1VSCA 3D06A 2DWYA 3ZRFC 1HOCB 2YXFA 5EZIH 1JV2B 3L95B 5LWYH 5F6IB 3BRGC 2VWEE 3IXTA 1HDMB 2R2HB 3WGUB 4PS7A 1N10A 4ZQKB 5JXED 1UJTA 2EILB 1BQ5A 4KJYB 4OFYD 3DECA 4TQEL 3QISA 3L4ZA 4ELME 4OT1L 2IPTH 1QRNE 3HLKA 2CKNA 2K7PA 4KK5D 2HLAA 4L4TB 3QJFA 3MR9A 1OKEA 4PS4H 1BJ1J 1QFHA 1RZPA 4U1IA 1J9SA 2BNRD 5ITBH 2HUHA 3ULVL 3DX7A 1ZK5A 5AKSA 3LPFA 3BUBA 3BPCA 1OAXL 1OHZA 5AG9A 3QUZC 1TO4A 2ROYA 3H9YA 3LQAH 3MA9H 1EANA 1JTPA 1MCOH 4FFYH 4FX5A 1GC1L 3OC8A 2DJSA 3LXCA 1TPXC 4NQVA 4AC2A 1JWSA 3TV8A 5CCHE 3B7UX 1TR7A 4L4VA 4TNFA 2YPLE 3KPPB 4J5VA 2ZOLB 1Q94B 4XPHL 4JQXC 4AXWA 1MJUL 2BXZA 3MJ8A 2QGDA 5IROC 3VXME 4Y0GA 5A1AA 3JWDL 4KAQL 3NA4A 3B7SA 5DJ0A 5HY9B 1CXFA 4PJXE 4NENB 1RSYA 3U7AA 1A9BB 2H7WA 3BKJH 2EH8L 2AAAA 3VXSA 1ZWIB 4IDJH 4LKXB 2XACC 5DJXB 4AUYA 5J13B 4QF1A 1XCQB 1IAKA 3GSNB 3B7YA 1UXLA 2IGLA 3ABGA 3D2UA 4KUZH 4ONGL 4FG6C 3IDMB 3HPLB 1P5UB 1ZTXH 4PFEA 2JFCA 1MFCL 4DKFL 4DZBB 4ZMAT 2J57A 1NFDF 3Q1SH 4CKQA 4AK1A 3CC5A 5IHWA 4N85A 5A7EA 5L7XL 4Z77B 5JZ7C 4MD0B 4NKIL 1KEGH 4IRZA 2YKKA 1QSZA 3IAGC 2Q76A 3FMGH 1B90A 4Q0XH 2JCCF 1KTBA 1QPXA 2NTFA 1XSJA 3N44B 3HNTH 2F54A 2XA8H 1FFOA 1WUNT 2EC9T 4XTRD 1BD2D 1SVZA 3FT4B 3KJ6H 5D96B 2WUCL 2AEQL 2J8UF 3WAKA 2EINB 2MQ3A 2O26U 1CFSA 4JGMA 3SKOA 1SN0A 1HHJB 1JUFB 3LRMA 4PCYA 5E5RB 4N2MA 2XIBA 5JW5A 3U36B 2YUWA 5D1QC 4WK0B 1A3RH 4AQ1A 4CL7A 4NQDB 1KF9B 4XCYB 1ZSDA 1WBYB 4BCYA 5JHDA 1XF4B 3QXDB 2HVKB 3SKJH 4JKLA 1P7QD 3QJTB 4XTRC 5EO9B 3FQXA 4DP2X 1NICA 3C9NB 4ZNEE 4XCCL 4UT6A 5GRWA 4PJFB 3EDFA 5EBWA 1JXDA 2XX0A 3NOIA 4DO6A 1AZBA 4BGDA 4GMTL 3N41F 2J1YA 3VJ6A 4P07A 3H2WA 2CK0L 3LRGA 3MUGB 3BEVB 4TUUA 3EGSB 5CEYA 4O5LL 4B9KC 5AW9B 5KBLA 3D9AH 3QBTB 1FE8H 1N64L 5FHBL 1JYNA 3EJYC 1RKRA 5FW6A 4JCLA 1WJ3A 3VFPB 1U8NA 3QUYC 43CAA 4QRUB 1JRHH 1YN6A 2D31B 3LVTA 3BKYH 4DZBA 5EU5A 3NAAH 3B9DA 4O00A 3QORB 4YHIB 5DGQA 1D5IL 1MCCA 2BNQE 2WVTA 5IUSA 2QQKH 2CBOA 5KSAD 2B4CH 5HVHC 4HUUB 3EJYD 3FRUA 4HPYH 2UY6A 5FYJL 2ZNWA 3U6RB 2QKSA 5D7LD 4JO5A 3HBPA 4FLOA 1KLUB 4OFIA 1HESA 5DYFA 3U46A 1PG7L 4U1JA 2FJUB 5IKCB 2Y22A 3HZVB 5IW3A 4UOW0 1CN4A 1DVSA 1EFXA 1LWJA 3MZGB 2EIBA 4LVEA 1WH0A 1T80A 1OW0C 4DP5X 2G5UA 3K6NA 2FUTA 5HGGS 3GLAA 3S3SA 3T71A 3MLZH 3QG7L 1REIA 3G08B 1OAQL 4L3ED 2VAAB 1D5ZA 1Q9KB 2V3EA 5MENE 3ULUL 2DQJH 3A6OA 2Z7ZA 2O5XH 4PJCB 5I1DA 1T0NA 2CKBL 1G7HA 4CC4C 3CTTA 3HNVL 1DQMH 4XRCA 5JOPE 3VFWA 4UTAL 1T66D 3VFNB 4F7EA 4L8SC 1YNTF 3T0VA 1DVFD 3D30A 3N43F 4PJ9A 4WLCA 4FG0A 3P3UA 3JTBA 1B6UA 2HCZX 2B1AH 4GSUA 2AJZA 4QTHA 1SFHA 1FWXA 1OP9A 4LAJH 4AJWA 4R7XA 1Z9PA 3RU8H 5T3ZL 1XIWC 2V17H 3IDYC 2ZNXA 4FJYA 2XA8L 3W9EB 2HKAA 4LASL 1MFBH 2EYTA 2B0SL 2O61B 2YA0A 4QUOA 1HHHA 1F3JB 2QQLL 1JHKH 3L3IB 1PVHA 4WIQA 3SGEH 3VRLE 3AGVA 3KNBB 3QEUB 5JW3L 1RZFH 4MJJA 3SOTA 3LN5A 2OSXA 4GQPH 4MD5B 3HNVH 1CT8A 3I50L 3IYLW 3MSPA 1RZKC 3RLSA 1P69B 2EYRB 2OP4H 2TAAA 5CJ5A 3NH7H 4IBQA 4C8XA 4I9WD 2F53E 4HMDA 4QOKD 3RZCA 4YN3A 4AEHH 4OTXH 4PJIE 2O93L 3CLFH 4TVPL 5EO1B 5CCJA 1CFBA 2QHRH 3GTNA 1ZANH 2FSEA 4M3KB 2GG1A 2DIBA 4M62H 3ZL4H 4PREB 3F58H 3V79C 4JAMB 3AZUA 4KZCA 5E6YA 4UNTA 2VDLL 3OLDA 4CUCA 1FV1A 4M03A 3CFEA 1FYTA 5JLZA 3HUJB 4QXGH 3NFNB 3QNFA 4RNRB 4WV1A 2Y1AA 4OAWA 1KDJA 5DK2B 5I1EH 3T1WA 3U2SB 1QABA 1IE4A 3UBHA 5IEKA 3VXUB 2WCPA 4QNPE 4X8XA 5AL8A 3V5KA 2RALA 4WUUD 1FYTE 1XCTA 1B3JA 3T0EB 4OCNC 3U4BH 3UROR 4Z6AT 5FO8B 5EEZA 3ZDYF 4DKEL 3R1GL 3DYOA 1A3ZA 3L17A 5DD6A 3JV4A 3WLWC 4ZUUB 4U4IA 1QNIA 5JNYB 5KBKA 4P2QE 1XD0A 2PF6A 4DPBX 1SMDA 1IT9L 1FRGH 4GI8A 3RRQA 3UTZB 3BO8A 3QDMA 1WIUA 2WLJA 2BWQA 4ZOEA 4E41A 3MRIA 1OANA 2GEQA 3CHQA 4Y5XB 2J44A 1ZEAL 4HISA 5MEQB 4AQAA 3JTTB 1PEWA 1V55B 4KRPC 3FU7A 4JPIB 4U6XA 3WJJC 3L48A 3E0GA 4KK6C 1UB5B 3WSQH 4KROC 4NXKA 1GCYA 4IGBD 5EULV 3ZQXA 5CJOH 1RI8A 5DA0B 1I53A 4EUPA 1NFDB 1JHLL 1UM6L 1E27A 2X41A 4X5QA 3W11C 1PCSA 3VM7A 1ECYA 1AE6H 5HVWA 5EBWB 1MSPA 3T9WA 2FIKB 5DT1L 4ZQTA 3MCG1 4Y4KB 2HRPL 4GLRH 5JYMA 3SQBB 1JGVH 2D7PA 1E67A 2AV1A 1WZLA 3E2HB 5D1QD 4CNIB 5BV7C 1R3KA 5L9DH 4L1DA 3ZT6A 1RQ5A 3BUYB 3H53A 1S3RA 4B50A 1KXQA 1ITCA 3GXIA 4TSCL 5F21B 2J55A 1SBSH 2A9NL 1NUDA 4YK4C 1U2CA 3DHPA 4JFVA 1ASOA 3RTQC 3TV3L 1NZRA 2BS8A 3MKGA 3L1OH 3NABH 1OF2B 4MCYB 3BLBA 4J6IA 3C09B 4H20L 3STZB 2ZUXA 3L3KB 3BVNB 3MRNA 4LSTL 5CLWA 2MMXA 2YO3A 5ITBL 1T2QH 2VLME 4CSSA 1PJWA 4LBEB 5MI0C 4RMQA 2FEEL 4HYTB 3SIKA 3BSZH 3UFIA 1TEFA 3ZOAA 4QRRD 3GSXB 1GGCH 3VH8B 2A6KA 1EO7A 3VWKC 4YHKL 2X9YA 2QR0A 3RIAK 3GK8L 4Y8AA 1PAMA 2D7OA 4EDWL 2VN4A 1PFOA 1MI5B 1YEIH 1ZRUA 4N9GB 1VAHA 1RIHH 1N5AA 1ZA3A 2GPZA 2A6IB 2BM3A 2R39A 4ACTA 1ORSB 1RJLB 2NUPA 1BQLL 1QTPA 3H9SB 3CH8A 2X53A 5ALBL 2BNQB 5JW4M 3EW3B 5CN3A 1NFDA 1GAFH 2PW2A 3MNZA 3L4TA 3B6SA 3WO4C 5FB8B 5FR3A 1IC5L 4LT7A 4GG6F 1OAYL 1PYWA 2AJUH 3ECWA 3NPZB 4EVNA 1EHXA 2NQCA 4I18A 1HDMA 2R2HA 4RAVA 4B97A 1Y1UA 3T0WA 4NAMA 2A77H 1XGUB 3CMOL 4YSTA 3S3PA 1KT2B 3WTWA 4ETYA 1KTKE 5CGTA 5DJDA 5EOCL 3WY2A 4M1GH 5K1JA 1IGFH 3S36L 1I1AD 2G2PA 5E99H 4PPTA 3KPTA 3L1GA 5EPMA 1XB6A 5LGHH 3ZK0A 2E59A 1MXGA 1E9QA 1MCBA 1KJ3H 4YSDA 3QA3A 4K2UH 5IBLC 3STZA 1JZ5A 1DBML 1NBYB 4WI8A 4WK4B 3VXRD 1CGXA 1KV3A 5IB4A 3WS3B 4AVJA 2MKLC 3KPMB 3LRHA 5D7JD 4OF7A 2AJ3B 4KV5F 4OLYL 5C0NC 2EE6A 4G8IA 4M5YH 4X6EA 5KSVA 2FEDC 3FFCE 3HFFA 3SZKC 1I9RH 3UCRA 5HPMA 3MTXA 2FO1A 3VU1A 1TENA 2IH3A 2NXZD 4K71C 4G7RB 3ZE1E 3GK8H 3W0WA 4YK4B 5DQ9B 3PDOA 3GHBL 4YFDB 3IWVA 1XEDA 5B7EA 5DFWH 1VZIA 3EG9A 4PD4K 2R2BA 4AW7A 3FHQA 1JV5A 3L08A 2J5LC 1XGQA 2BY0A 5C07A 3D39A 4BQBA 1BMZA 2TRHA 2MSPA 1M7IA 1ZY9A 3SGDH 3U9WA 1DUYA 2CGRL 3QIBA 5FDWA 3ISWA 4QHUA 3I6LE 4M3HA 1EMTH 2GITA 2OL3B 2WTPA 3BQUA 4HBQA 5CEXA 3C87A 4MKTA 3AB0C 4RIRA 3RJDA 5DLML 3PWVA 3VX1A 4YSSA 2O30A 2XVBA 3VXUA 4LLMB 1CDUA 1BZ7B 2AZAA 1FDLL 3IT8D 2P1YA 4FQPA 1V27A 2EH7L 3TBYA 2Q86A 3S2AA 2JB5H 4JB9L 4BUQA 4OZIE 4ZUUA 2WZPD 4BSJA 1KPUA 1XBDA 3QRFM 4OCWH 4WWKB 2Q6WA 2LAGB 2K6WA 3BH4A 2TRYA 5CINL 1KWKA 3LS5H 4X6EB 2YUXA 2YC1B 3OLGA 1GYUA 1YN7B 3LV3A 3W0WD 3GPEA 5A6MA 3K8KA 4U3XA 2XKNA 3N1GC 5E1IA 5F1OB 4UT9A 4F92B 1T0MA 1HXMA 3T0EE 2HH0H 4Z7NF 5CIPH 2D0FA 2ADIA 1KLGB 4TXVB 2XWTB 1EUUA 4P23D 5AYTA 1GC1C 2BVPB 3AB0B 3V6BR 5J6HA 5HDWA 1ACZA 1XAKA 2CO4A 2OZNA 4XPGL 4BUGA 5C97A 1D9KD 4MA3B 2Y7NA 2ZSWB 5L0QC 3IPFA 5K9QG 3F04A 4M6MH 3GBLA 4LEOA 3VRIA 4CVXB 5BVJB 1S78C 1WLHA 4LMQE 2EEFA 5C8JB 4WHDA 1QLEH 2CDGB 1LE9B 1L7TL 4YDVA 2H2PC 3MJ9H 4KK6D 3SKUD 3O8XD 4QRSA 4WO4B 2DM4A 1J87A 4UT9L 2VSDA 3GDCA 1WFUA 3RY4A 1BP3B 3EH3B 4HUUA 1PD0A 4ATTA 3CDZA 4ZRGA 4FMVA 4MCMA 2HT4D 2MPVA 2PPEA 3QDAA 5DJCA 2LABA 5FKAA 2G4GA 4NO3A 3RILA 4AQOA 1JZHA 1U3HB 4PB0L 1VERA 3PE9A 3RUGB 3LNEA 3JWOC 1QLFB 1H3XA 3L2MA 3L3KA 3ZYJA 4ELDA 3MV7A 2BWDA 2J6EL 3MRPA 4UAOB 5J12B 5BQ7B 5LNDA 2AABH 2IANE 1F18A 4M62L 2HT2D 5ISZA 3U83A 3PNWB 4MAZA 1E90A 4CBPA 4ZUSA 3ZE0F 4RAHA 4CN4A 2YC1A 2AJSL 3KXFD 5C0CA 2NY0D 2YMOA 4MMZB 2V9TA 3PAVA 1Y18A 1CURA 3Q44A 4YVNA 2AJXL 3KGSA 5HYFA 3DI2B 4L4VD 3ECBA 3NJJA 2VDPB 4WU7A 2XWTA 1T0NB 1V05A 4OZHA 5DHDA 2ICWB 4ZJ9A 1PZ5A 5FF6A 2HX8A 4TL4A 3Q2WA 4XR8C 4U4BA 1LK2A 1DANU 3ZE2E 3RZCD 2WLMA 1EGJA 1UT2A 1KCRL 5GS2H 4OD1L 4PTUB 1ADQA 3TH4T 5FB8A 1PG7W 1FG2A 1CJYA 3CHOA 4U0QB 3RDTC 4G1EA 2B08A 4P59L 1F58H 3DYMA 1LQSR 5D1ZA 4JM4L 3B2DC 3HI6H 1C1EH 1XGUA 1F00I 4N87A 3FQNB 3NTCH 5GRJH 3QXTA 4ICXA 4M7LH 3S5LA 3MJ9A 4ODSL 3IB4A 1TMCB 4X6CB 1S9XA 1UZ6E 3BVWA 5T1LA 3ZRCC 3ZXAC 4NGHH 3H9SE 3CK0H 4S1DD 2HPTA 3RPIA 2RCSL 3L3IA 3UG3A 5DD1H 2ZKXA 4YEFA 3PHAA 1YLBB 2VQ1A 4XBGA 4PJ5E 2C7FA 3ARDB 4J3OF 4KITB 1B2WH 1SLWA 5KG9B 3V95A 4PJBE 3TBVA 5K9KA 1OAQH 2P80D 5HGAA 3ZL4L 1TJHL 5JHMA 2AXHA 4YQXH 1UC6A 5LXGH 4X4XB 2Y1YA 1J5DA 3OLEA 4X8JA 1WBYA 4D8OA 4OZ4A 1JPGA 1KIUA 1VKXB 4RFOL 4WGWB 1F4XL 1P2CA 2OTWB 1P9MA 1KBGH 3ES6A 5DS1A 4DN3H 4Z78B 1EJ8A 1A6ZB 3DBSA 3PDOB 3MRJB 2NY4C 4GBXD 1NCDH 1UWXK 2V5MA 3E9TA 3EJRA 5FF6B 3PJLA 5D7JC 2RHEA 4UDTA 5IW1B 1ML0A 2QKIC 2BOLA 3WTTA 2CDEA 1ADQL 2A7BA 2QQNL 5KSBE 2B4CL 5TD4A 3QWRA 5MHSD 1YNKL 4PTTA 1C08B 1F6FB 2DEWX 4YHNB 5M94B 3FFCB 1YMMD 2HWZL 3AVEA 3DX4A 4ORZC 4N2OA 3BAEL 5I23A 2CUAA 2JKIS 3BIBX 3EO9H 5I1HL 4GINA 4JRYB 3FB8B 4YHMH 3BZ5A 3KYOB 1ULVA 4KRPB 4JO2L 4R96A 1A4KB 3AXHA 5IQOA 3AY4A 4YL9A 5DI8A 2CM5A 1KJ2A 1A7PH 4WKXA 4XVOA 2GBVA 5AVRB 2WKLA 1IGTB 4N86A 4PP1D 4PRAA 1K85A 3LKOA 3BXNA 1R4XA 1ETZB 2R69H 2WQRA 1HYSC 5TQ0H 1HZLA 3T0DA 3IKCA 1DVQA 4PS3A 2VLRB 4PW9A 1LHZA 1NDMB 4Y2OA 2CD0A 3WY4A 5SWSD 5CKGA 1KN2L 4TUJA 5DLLA 4CGUB 5E8PA 3QNXB 5JPNA 1UJ3B 1IFRA 2P80A 5E4AA 5KAQF 3JV6A 2P7TA 5DJAA 4TNGA 5TDOB 2WN3A 4HGWB 1THCA 2WBJA 3VNYA 1I7RB 4R3SA 4R0LB 2XUWA 5EU4A 4PHXA 2X10A 2V7NA 1JF5A 2OMVB 3BD5A 3SDCD 2XZQL 2DWXA 3KLQA 1XH0A 4M7ZB 4MS8C 2XY1A 1B6DA 2W1NA 1D6EB 1LK3L 1WWBX 3MGAA 3W5NA 1RK0A 2GSIA 3BHBB 4HPYL 4WK2B 3GMMB 1YG9A 2JTYA 1T04B 1C08A 3E6HB 3VWKD 3UZEC 2BSSA 4MTMA 3GDBA 3PFQA 4X0KA 1KY7A 3PPSA 4ODWA 1KOAA 2DV6A 4MXQD 3VW3H 2V4LA 1R3HB 1WGVA 4GBXC 3FZUC 3GSQA 3C5ZD 1MQ8A 2D73A 2JTDA 4AL8L 5JW4N 5HYSA 4P99A 2VLLB 3GNML 3M6DA 5LAXB 4WHYG 1XH3A 1QFOA 4HW6A 5EBGA 1QNZH 2I27N 4QEGA 2WVVA 3PABB 4NZUL 3KZ8A 1VRSA 1UVQA 5G4MA 1PLAA 2GIXA 1G9NH 4NUJA 1J5OH 5LXGL 3NQIA 1DQJB 3DXAB 1E30A 4FLRA 1FH5H 3ZTNL 2WMPA 1V7MH 3NIDF 4KQ3H 4N9GA 4Y2OB 5AB9A 5E56A 3I3BA 4C83A 1ONQA 3NSXA 2QEJA 1W6LA 4RMUA 5DHVH 1S7VA 3WELA 2QQKL 1V7NL 4FC3E 4ZPVB 1UD4A 2IMMA 3DO7B 4JCWA 1L9SA 3CSBA 5IF0A 2FTAA 1OZUA 1FVDA 1E9PB 1QEWA 2BP5M 1GW6A 3IDIA 3KPNA 2A6DA 5C7XH 4MAYD 4JUSA 3APNA 3VJ6B 3Q8FA 3BUIA 3O0RL 4X7TA 4H1LB 2FBOJ 2ZX8A 2WVSA 3HI1A 4JFFB 4L9LA 4UAHA 4ZT1A 1XSOA 1P5VA 1WHPA 2HSIA 4UQEA 3N44F 4X7EC 2ZX7A 2PCXA 1CC3A 3PQYE 5AZ2H 2BSSB 1PY0A 2KL6A 2XTJB 3QUXC 3EGDB 4XB3A 1H3GA 1KENL 4M7JH 4DQOH 1NBYA 1FAKT 2CRYA 2GCYA 4K2UL 3QAZC 1S7SA 5L8LB 2GJRA 3BKYL 1WSST 2KH2B 1AS7A 4U1IB 3GT6A 2NR6A 2NYYD 3MJGX 4S0SD 1B88A 3IF1A 3CFBB 1GJIA 1Q72H 4PJDF 4Q8BA 3D0VA 5E5MA 3OKOA 3EJTA 4K5LA 1F11B 3BPOC 3P30L 3MLYH 2CIKB 4TN9A 2WWMD 2X44D 2VERA 4I3SH 1IBDA 3PGCB 2YWYA 3PDDA 3GZQA 5HGAB 3NCJH 5JPMC 4HJEA 1IB5A 4XCNB 2GK2A 1MVUA 3ZDZF 4KNUA 1Q9OB 2EC8A 4XMXA 5JIIA 1CD9B 1CFNA 1OWWA 3BH8A 3QUYD 2ERJB 1M7IB 1HINH 3V6ZA 5T3XH 4LCWD 4JDEA 2H5UA 1V3LA 4G71B 4ODTL 1MF2H 1UQSA 3N9GL 4N5EC 4WDIB 1OSYA 3L2LA 1OP5H 3AXIA 3G5YA 4F1SA 1IU1A 1AVAA 3MRFB 2PCFA 2YMXL 3KPQB 2RIKA 1VFBB 1YUKB 4NEHB 3HG4A 3EYUL 3QUML 5I66A 5J0BA 3WTXA 4OFDA 1DUZB 5D71H 4KKZA 1T83A 1X4YA 4QTHB 4K7PL 4P3CL 3P30H 1TYEB 5ECJE 4R7NA 3EH1A 4ZDHA 1S6NA 1TTGA 4QJ5B 2C8NA 3VGDA 2NQ3A 4I5BB 1NLDL 2HX9A 2HP4A 1RHHB 2R1YB 4AH2B 3PUCA 3NIGE 3MRNB 3VQLA 1BD2E 3T0XA 1Q1PA 1N70A 5D2LF 1JPSL 3TBTA 3PV6A 3SY0B 1CXHA 1FHGA 3NJHA 3UTTE 1NBQA 5EZPA 3QI9B 5I18H 4JHZA 4E5XB 3RPKA 1NEZA 4Y89A 3PGFH 2LU3A 3GZKA 4ZSOB 1F56A 2X2YA 4LLDB 5CLXA 3K71A 4HUVA 4OCYL 2ZKMX 5ELIA 3GSUA 3JZ7A 2JJWA 5T5NG 1E3XA 1T66C 3TNNA 4AM0Q 1OAXH 4OZGE 1NMBL 5EA0H 4KK9C 3HUJE 1AP2B 1P4IH 4HK0B 3KPSD 2I5YH 3T4YB 4HUMB 2HJFB 3O0RH 1LEIB 2X1PA 3ZHDA 3ZQWA 4PV9B 5B8CB 3CIAA 3MUHL 3NZHH 2OZ4A 2EEAA 1E5UI 5BVJA 1A47A 3AW5A 5IV2B 2YAFA 3OAUH 5L2JA 3WTUA 5I0VA 1ZHNB 2KPWA 3HRZC 2ZP8A 2J25A 2V0AA 4P23C 3MUJA 2OMXB 4IKJA 4DFHA 1G7MA 1KGIA 2VL5A 4ODWB 3HZMB 1Z0NA 2Y7MA 3BE1L 4U1LA 5CXPA 5EOCH 3JYCA 4IRZL 2XOTA 3OF6D 3NEEA 5D1ZD 1AHWC 5HYSB 3PHOA 3WS3A 2QSCH 2NW2A 5BO1H 3DJSA 1SGKA 4I77L 4NQQA 5DZVA 4UCFA 4HHGA 1X4XA 5GS1A 4G6ML 2P8PA 3BAXA 3GLDA 5K39A 2X6VA 1BG1A 1AZUA 1IRAY 1K5NB 1YQVH 3S35H 2EVFA 2QL1A 1EZLA 4YHZL 3Q6FB 1FH2A 3ZUCA 1J9QA 3JVFC 4CU8A 4U1MB 4OJAA 3K2KA 5FO7B 2CO1A 5HDBF 3Q6GL 1NANH 2VM9A 1PZ5B 3ETBJ 2XBTA 4ENZA 5C2UB 3AG3B 2WAQA 1HILA 2MCG1 4N2DA 4L4TE 5IB3B 5FCUH 3TBSA 5IGXH 2E74C 4GS7C 5F7HA 3T3ME 1A4CA 1WCQA 3G7TA 5E8OA 4H0GA 2V7HB 4GEIA 1W72B 4JPWH 5AVWB 5D55A 3SODB 3ULUD 4J1UA 3FHAA 3DTUB 2FBJH 2VN6A 3QNZB 3IK2A 4NSKA 5B1BB 3VFVA 4X5WB 4IQHA 4JKNA 5J11B 2Q5BA 5K69A 1GS7A 3LEXA 4EEEA 5IVZA 5I0XA 1OOAA 1GJWA 1PSKL 3PL6C 4OLUH 1HSBB 5LAPA 3UJJL 3MRGB 4JPSA 4F27A 4PAZA 5LG1A 1FL6A 4XN1A 1CFQB 2EXSA 1CLYH 3OX8B 2OCJA 3D51A 4E9SA 1GAFL 5SWZA 4L2LA 5DVPA 4FP8H 4WI9A 2X4PA 2DQFA 1QSFE 4ZUVA 3ULAB 4EZLA 3KVDD 1H5BC 3DGDA 2ISDA 3ZE2F 4FMFA 2BDNH 4LASH 5DD3L 5F88A 5GGQH 1XZWA 2ZOTA 3L95A 1X7QA 1IX2A 2QADB 2H0PA 2XT1B 3HC0A 3RUGF 4FAAB 2J56A 2R2CA 3C75A 4MBRA 4NIYE 4YE4H 4FNTA 4M6OH 1HS6A 4KGJA 2WLNA 1SM3L 5IFJB 3ES6B 2CALA 3FONB 5LBSL 5GRYA 5HYQB 5LNGA 2R56H 3K6OA 1LNUA 3F83A 4P5KA 3EYFB 4N0CC 3NJVA 4WHTA 5D70L 5C9JB 4PP2B 2NY6C 5IW1A 3PIQB 1I8IB 4GAJH 4P5TB 2HN7A 3HMXA 4I48A 4LCUA 3HNSH 1J8HB 3MREB 4KJWC 1IC0A 1MDTA 2WD0A 3B2UD 3C8KB 3RAJL 2E9IA 2E27H 1PYWB 2GI7A 4PTTB 3NEOA 4L37B 4U31A 1EFXB 1G9NL 3CDGA 2Z9TA 1P7QA 1SOXA 2DWEA 2AGJL 3K2UH 3MJ6A 4W9KC 2CPUA 4YEEA 4ZFGL 1AFVH 1UH3A 2OI9C 2QHLA 2VAAA 1MH5B 3A4DA 5AKVA 5SWZD 5AAPA 3VX0A 4Z7NB 3SGKA 1J9RA 4P4KC 3WNKA 4HCRL 4Y19B 3UGXA 3IJHB 3OHMB 5T1KD 4AYGA 2Q10A 2PYED 1J0IA 3UZVA 4OI8A 2X4PB 4FQXC 2DQDL 4OZFH 4Y4HC 1GS8A 4S10A 5T3XL 4BINA 4LBAA 4P46A 4PJFE 5F0MB 2XWCA 4YDKH 4WTQA 2X40A 1CLZH 2HXAA 1I4FA 1JP5A 5I9QC 1EEYB 2MNJB 3GM0A 3HPLA 3L8QA 2WQSA 3PJNA 3F7VA 4PJ8B 1GZPB 1IEAA 4XNMA 5JR1L 4JM4H 1S8DA 3F84A 4XCEB 3ULUC 1H3PH 4BK5A 1AGDB 1E28A 1F58L 3DARA 3Q9QA 3V0FA 4L8BB 4KDWA 3WDHA 4QRFA 5GGUA 2W94A 3M1BA 4Y1AA 5F9OH 5D5ME 5LDUA 4PJBB 2CR6A 4XCFL 1BJMA 3DVFA 4KO7A 1LK2B 5F0LB 2V9UA 1JCKA 3QXAB 4AE1A 1SYVB 4AIZB 3SKJL 3INOA 2VDOB 3AG2B 5TQ2L 3UYOD 4N0UE 5IMKA 3HFMH 3ROOA 2VXVH 1U6AH 5F3BA 3J07A 2O4EA 4IRJA 1KZQA 5EEYA 1CG9B 3U4KA 2XJKA 3AAZB 4NAJA 4HWBA 3JUZA 4CNIA 3WTVA 5M95B 1I1YB 2A99A 2KMWA 1TJHH 4G8GD 2B16A 2BC4B 4HIHA 4JQIL 2R1XB 4M4RA 1MRDL 3P3SA 4N25A 3F01A 4KO9A 4GS7B 3BGMA 1RIVL 1NAML 2IQ9H 1ETA1 5LVEA 3T2PA 4OGYH 4CKVX 1WS7A 2AQSA 2Z7WA 4NC1E 3X14B 4HIJA 3S2CA 1AJ7H 2FNBA 2DQDH 4PWGA 3WFDH 3IDGB 2DS4A 3CVHH 4TNWF 3ML9A 2VISB 3C5SA 1SJHB 4IBVA 3APFA 1X7TA 2ENJA 3CCHB 1Q9LB 5D5MB 2XPYA 3H0TA 1YEWA 4LL4A 4AJVA 3FUFA 1YAIA 2YAOA 2YD4A 5ESQA 1UOWA 3HI6L 1KDIA 5AVUB 3LHAA 1UOKA 2AGJH 1S7TB 3K2UL 3LKQB 4I0KA 5JQIB 3LDBC 2HKHL 1CK0H 4IDJL 1F4XH 2G30A 5IW6A 4B9JA 4TNWK 1KTJA 1XGZA 1HCYA 2A6IA 5GQBA 1W6WA 2A73B 2X2IA 4ZTOL 2Z65C 1AZVA 1NCJA 4A6YL 3S5LG 3AWGA 3BFOA 3NZ8B 2NSXA 3U1QA 4W93A 1IAKB 3GSNA 2OM5A 2Y36H 1ZLSH 3CFJA 2NNAB 4G80A 4PRNA 4XVTH 3O8XA 1T1XA 4DEWA 5KYYB 4MASA 5EUKA 3CVHL 5BPPA 4FKKA 1JZIA 5IZ7A 3MNVA 2JH2A 4Q52A 3X12A 4MWFA 1WG3A 2VDML 4P2OB 4JO1H 3IU4L 4QY8A 4FTVA 5CSZA 1OSPL 3KS0H 1NMCC 1PGRB 2Q9OA 4K8RH 1TZHB 1P4BL 5GZNC 3I9GL 4YHPA 2IGFH 5AOIA 5IWLC 4I85A 3GUTB 1ILSA 4NO3B 2QVTA 4JE4B 1BX2A 4J3WA 1B0GA 3MLVH 3BXNB 3SCMC 5J4MA 2DBJA 2MEJB 4JHAH 4BDVB 3WUWB 5DMKA 5ABZA 2CHZA 2UVEA 1TETH 2B2XH 2GUOB 4B96A 1TG8A 1NJ9A 5FYLH 2F8IA 2F8VA 3MAWA 1N8OE 2DL2A 1Z7JA 2DW5A 4NCC2 4JHVA 1T1WB 3ME0B 2OP4L 5H8DA 1S7XA 4PVMA 3T8MA 2R69L 3UJTL 3HC4H 4GQ9H 2IH3B 4L23A 3GBDA 2Q76B 1NL0H 5FV1L 4HKJA 3PP4L 1G87A 3MROB 4PJGF 4UOJA 4AEEA 4HCFA 4YUEL 4PN6A 4FABL 3EG9B 2PMZA 4Z7WB 5E2UL 1RZGA 4DP0X 2G2RB 2EYRA 1K4CA 4KKQA 4PRIA 4C56E 3MJ7B 1AQKH 4P5SA 3TCXA 1FL5A 3GMPB 3TJPA 4BHUA 4N4YB 1FO0L 4XPAH 4IBZA 1AGEA 3P4OA 4AIEA 1UCBH 2NYYC 2AW2A 3MNVB 1M56B 1AH1A 4YDLB 1JK8B 3T2NH 1AGCB 4QKTA 5BS0A 3F65A 4X9HA 1T1ZA 5BQDA 3DOSB 3L1FA 5ISZE 3TBTB 4U6HB 2Y7OA 4L18A 3EYQC 3LH9A 4F93B 4KMTL 4MGXA 2G9HB 1QW9A 3PCYA 1DZ0A 1BZOA 2AQPA 3AREB 4ODHH 1TVBB 4HEPG 5DMIH 1IM3B 1MIML 2JB5L 4H88L 3BJLA 4AEIH 5AOLA 1JZEA 1ECZA 3ZT5A 3KPOB 1VACA 3ZIYA 3VB8A 1OK8A 5EC1B 1TUPA 5ADPH 2J73A 4IHBA 2OBGA 2ZWKA 4NPJA 1GZPA 2ZOWA 4GRLC 3QORA 5EOTA 2BP0B 1FZOA 2VDQB 4ZODA 5KSBB 5JMRA 3AXLA 5KEZA 1F4HA 4XPHH 1BIIB 1JGDA 3X3GH 4L8BA 1FVDB 1QEWB 1R17A 2L0DA 3WIIL 3BO8B 3VFMA 2XTJC 3TYFB 1VDGA 3SBWA 1CLYL 4CGTA 3SDYL 3MRKA 2YXVA 3HR6A 4N2CA 2L4OA 4FQ2L 4UDUB 5C0BE 4FHKA 4DP6X 2NY1C 1A0QL 4HEME 4W9LC 1A02N 3NIGF 3MLWL 4IS6B 3QRGL 3UAEA 3K8LA 3NMEA 3EGDA 4MX7B 1YC7A 3VH8G 5KVDL 1PY4A 3KWVA 2UZYB 1VADB 4E0RA 3ULVE 1A4KA 1QAWA 1YEHH 1T3FA 2VR7A 1MPAH 1TO5A 1WP6A 4XP9H 2Z92B 1ZXQA 3S4SG 1W16A 3KPOA 4JM2F 3HC3L 4KTEL 2Q8AH 5IJKC 4PJEB 3Q8CA 3TH3T 4X9YA 5F3FA 3MV8B 4KO5A 5TPWH 5HYJD 1GPOL 3FAXA 4QXTB 4U1GB 4JDTL 4XT1C 4MLSA 1CU4L 1QEXA 2F08A 3TZVC 3VGAB 4ADGA 5I8EB 1G7QA 4Y2DC 2GBTA 3MNWA 5EEUA 4XPFL 2V3DA 2W9LA 5FA3B 3RTLA 4NZ8A 2IXQB 2WTOA 4X5WA 1E7UA 4OT1H 1UGKA 2X1QA 5BRZB 3TO4A 1QRNB 4JFYB 2GKIA 2PXYB 5ALBH 4RX4D 1UM5L 2DIJA 2XV6B 4KXDA 4ZO7A 1XO8A 5I0ZA 3U6XA 5DZLA 2A1WL 1KGUA 3CZSA 1J11A 1I85C 3DMMA 5DQDL 5DD5H 5HVFB 1QKZL 3B9KA 3V6OC 5BO1L 1E4HA 4XOEA 3S5YA 4HKZB 3CD4A 4YHKH 5GGSA 5CU5A 2VCOA 4LHUB 5KW9L 2VQUA 4R5VA 4CVWA 3SYQA 3TVMC 5I6XC 3S37L 3G3LA 3I3EA 2VUOA 4KVNH 4AWJC 5B38A 2HT3D 2X7LB 4LARL 5D4QA 3L7EB 3E1ZA 4PJEE 1SQMA 3GJFH 3TT1H 1SJEA 2YPLB 1BXAA 4TSAL 5IMMA 5LQBL 1LE9A 4AW4A 1P7KB 4GEJA 4N1EA 3WIHH 4A7SA 2SEBA 4KWUA 2HTKD 3BX7C 1JS4A 4NKOB 5C09E 2CRMA 2WO2B 2UZIH 1V3MA 4ZNEA 3MLXL 2XWRA 4BDVA 2JIXB 5E8EB 4KUCD 1ZT4A 2PCPB 3U1SL 3V0VB 4PJEA 3F12A 3VFOA 4FDWA 3WEOA 5FGCB 4YDJB 3U1SH 5I18L 1NC4A 1ORQA 5C3LD 2CMRH 2WNXA 4OJFL 3ILPA 3LEVL 3QCVH 4X4XA 2BFVH 4K3EH 1QFPA 5AKRA 1UURA 2G0LA 4EDWH 2VERN 4LOEA 1YYCA 3NIFE 1D5ZB 1AI1L 5EHFA 4LB8A 3U6XS 1D2PA 2A6DB 4AENB 2QSTA 1F13A 4LARH 3I02B 3TIEB 3BUPA 4ZMXA 4Z18A 3F5WA 2FJFA 3MCKB 1C5CL 5SX4I 1YO4A 4TVPD 5T1JA 5EN3A 4M02A 1I7ZB 2MTAA 3ECQA 2DI9A 3BIAX 3MMEA 1H5BA 2QMKA 4LKCA 4RMSA 3MUY1 3OZ9L 4Z3GA 2MTPA 3S37X 4G8FA 1EMTL 1JERA 1ZGLM 2YXMA 4OF8A 1ZMYA 3OKLA 3I50H 3VI4F 3QHTC 4RSYA 5BJTB 4KXAA 4M00A 1ZXKA 3WJLA 2BP8B 5CSBA 4ZAKD 1PG7X 3FT2B 5E5UB 5C07B 1NCNA 1HHHB 1FG2B 5C0AA 3RNQA 3S88H 2AEOA 2EO9A 2HX7A 1O75A 3RIKA 4ANWA 1FZKA 2W88A 2IC2A 3U4EB 2ADYA 1F1DA 4HQQL 5JXAH 2OMWB 4NO2A 5KSAA 3ATEA 1DQDH 4L29A 1HL5A 3BH9B 25C8L 5T1DH 2QR0B 3SE8L 2HFGL 3WNPA 1AO7E 4U33A 3EO0A 3I2CL 1D2OA 1C12B 4U1MA 3J8F7 4R2GD 4JY5H 2MRYA 3QIWD 3SPCA 4Y2DB 5AOJA 4AQ1B 2FLMA 1MCKA 3TBBA 3QJHB 3E3QC 4G83A 3HC4L 1Z9LA 3LMJL 1HQ4A 2LU4A 2VC2H 3BYTA 3IMRA 2VDNL 4RDBA 5ES4B 5CFAA 4HXBH 5DMGD 1IM9B 1BF5A 2GJ6E 3ZHLA 4RZKA 1H8LA 3P9LB 1K8DA 1A6AA 4PJAF 4OLWL 1JDAA 1LO5A 2Y6SC 3HHMA 3R0NA 3CX5J 4FFZA 4L3EB 4W4NA 5E99L 5IT2H 5F9JB 1CVSC 1VKXA 4JDVB 2CLZB 4P2RD 1JZGA 3UTOA 1RJYA 2VLJE 4U7KA 3DX6A 3FRPG 4JO4H 4MJID 2ATAA 3KPLB 5LUMA 1FL6B 2F68X 2UUDK 4XXCC 1A8ZA 3FQ1A 4QTIH 1L6ZA 3MRJA 3OGOE 4ZS7H 3UC0L 4BQ9A 3WJMA 4J3OG 2JLLA 5I75B 3T77B 3BRDA 2X6AA 5DHEA 3K0YA 5AAWC 1I8AA 3RI5K 4ZUVB 1QW8A 3WIIH 1JNJA 1NDGA 3LZFH 4KI5D 3SDXB 4KO6A 4GKZB 4PJ5B 3BGFB 3T6XA 2O5ZL 3HBGA 5GS0H 2C34A 3VQ2C 2B9BA 3C6LB 3EYOB 3H0TB 2NX5E 4NYLB 2CQVA 1I1FA 1AACA 5F7DA 4ZTOH 2J2ZB 3G6JB 1L9NA 4J2QA 1CCZA 4W81A 2G2NA 5ICXA 4ANUA 5IY5B 3BQVA 2F1BA 3CPLB 1DL7L 1YPZA 4XC1L 1FC1A 4N3TA 2YGPA 2NZ9C 4Y16D 4K8RD 7TAAA 3HR5B 1IL1A 3JWNG 1YY8B 1T4KA 4XB7A 3OXSB 4OFPA 2I9TB 1E7VA 1RJZA 3O3UN 1LEIA 1BQHB 3W0WE 1WBXA 2X70B 1DJGA 2DI8A 4M9OA 3I3DA 1IM9A 4ZO6A 3AWFA 2VXTH 5HI4D 2DM2A 1WBZB 2BINA 2NYZA 3TV3H 4WO4C 5HVHB 3QXUA 1AMXA 2JK5B 3OR6B 3HCVB 2DWEB 3O6MH 2BCKB 1LP9F 4A7GA 2BY1A 2FO4A 1KBGL 5FLUA 1Y18B 1HJCA 4TUKL 1R3KB 4MNGA 2IAMD 1VPOH 3D52A 1WTLA 2AEWA 3VSVA 5BOJA 2E6PA 5DFTA 1IARB 4OZHB 3B9KB 1QSEA 5SV4A 3V8OA 5DC2A 3FCTA 4AKQA 1MWAH 2X0VA 5DURB 1IAIL 5EEVA 2B1AL 3ILQD 1IC4L 5D7IA 3TF4A 1LD9B 4X9IA 3REVA 9PCYA 4DP4X 1NDGB 3SDXA 2FK9A 4NKIH 4N5ED 1A4BA 1FVCB 2JV6A 2OXHA 4WVRA 2J1KA 4YDIH 3B8YA 1S9KC 4A7TA 2WWKT 4R84A 3X3FL 4CVUA 1U3NA 3CZJA 2R8SH 3Q2VA 4EDXA 4DPAX 3BT2H 2EIZA 2TSAA 1XCWA 4JY6A 1NSNL 3IGAA 1MLCB 4MVBD 2ENQA 3FRUB 2F0CA 2PP7A 2MCMA 5I73C 5CGYD 2AJSH 4APXB 1I8MB 5CZXC 4GIOA 2WBKA 5HGHB 4NNPL 3B5TA 3TPUB 3LD8C 5CCKH 4F7CB 2V7HA 4CSPA 1TVDA 4HIXH 4IGBB 4GG6A 1WBZA 4XCCH 4HD9A 1EIBA 4LP4A 1QWHA 1LE5B 3MHZA 3LPPA 2VABA 3RGVB 4DP8X 1WAPA 3TXAA 4PBDA 1WCBB 1WK0A 2I7SA 1NKGA 1JK8A 2VXVL 1QSED 1MHEB 3AY4C 3D6GA 3HJEA 3GLZA 4F9LC 3QR2A 4Y4KD 4K9EH 2A4EA 2DQEH 3C2AH 3HAEA 2CBPA 2QT6A 1OGTA 4XWGL 4O58L 5CO1A 3DUUB 4Z7UB 4AQ8A 3FK3A 4TVSa 4OVVA 4JQIA 5F3HB 3UAJC 4AIXA 4Q4IA 2E7BA 3JTSB 3ZVVA 3ECVA 1U93B 4BZYA 1Z32X 1TQTA 5GGRB 2ZJSL 2VUKA 1E6OH 3KWWB 1KGCE 1A14L 1K4DB 3EDKA 3MXWH 3PNWA 4BRVA 5AW5B 5ESVA 3GMNB 2AQ3A 3QNXA 1DQIA 1I75A 1HL4A 4FFWC 3JYBA 1WZ1L 4AYMC 4WTXA 1TJIH 4YXKL 3RKDD 1LWRA 3RVWC 3SJVD 1AKJD 3KYOA 1IQDB 4DO5A 2BWIA 4QRRB 4WI4A 4WO0A 4MSWA 5C0IB 5KS9E 4R0LA 5LNEA 3TNNB 4F57H 2VKWA 3D09A 3BVUA 3QEUA 1WT5A 5CM1A 3ESOA 5DRNA 2GVYA 1UZ8A 1IGTA 2YBRA 4K3JL 1MI5D 3VFSA 5SWQA 5B8CA 4XZUA 3BD4A 4Q2ZB 1T1YB 5L4IA 4HUWA 1HXKA 3F7KA 2BNQD 2EDOA 4HZLB 4XNBA 3MFGB 5JXAL 3O9WB 1MZYA 1KBKA 3G04B 4PJ8C 5F7KC 3FB5B 3CVIL 1U8LB 5EU6D 1FZJA 4P2OA 3FO1A 3PQYB 4UM9D 2CLZA 5IM7A 1IVLA 1Q38A 4E0RB 4LCYA 2OL3H 1CYGA 3BUYA 4HWEL 3KYMB 4HF5H 5H94A 1A6UL 3KPRB 4MMXA 3WO4B 3DX8B 4FQXB 4Y4HB 1QD0A 1EDQA 5F1SA 3QJQB 2YSTA 1EHKB 4JN1H 7CGTA 1MJJA 2W59A 4PR5B 4BV1A 3S96B 4CMHB 3QORC 4PGDB 4P9HC 1TCMA 3CFMA 3KLAA 4LNVA 3WNMA 1ZHBB 5HDBB 1AD0B 3MLZL 3BLKA 3EOYG 3PWUA 1KCSL 1QBAA 4L3EE 4NZRL 2G0KA 5E6RB 5D6DC 5KANG 5HHOE 4HJ0D 5EUOB 4LL9A 1D3CA 1YNLL 3VXRB 3ETBF 5EZJA 1DVUA 2F2HA 1TF4A 4WAFA 3WLBA 4U7MA 1I1FB 3PAUA 2B9AA 3MRBB 4LFHD 3PF2A 4L9LC 3L54A 1DJYA 1JDDA 4UYQA 4XO3A 3L4YA 5E4IA 1CLVA 4ALAC 2NXZB 5BRZA 4G6AC 5EOQL 1JZ3A 2F8XC 3MNZB 2DYPB 4BH7A 1YEGL 4PP1C 1DYZA 4U1JB 2AXFB 3C6EA 1Z9OA 4WU5A 2ZXEB 4LSSH 3IGLA 2W0FB 2FBRA 3TBVB 1PPIA 4JPIA 4U6XB 1TT6A 2Z6FA 3BZ4A 4Q6IB 2HVJB 1EVUA 1ES0A 3IS0X 1DSYA 2HG5A 3PWNB 3I9PA 3MLYL 4QXUH 3VI4B 2VAJA 4D7PA 1RK1A 5F1KC 3GXPA 2OFQA 5E00B 4GKLA 2A6JA 3NIDB 5L4JA 3CLEH 2K0RA 3ZDWA 3CMOH 4ZOBA 4A2EA 2IO5A 1TVBA 1B4LA 4UDTB 1T6WA 5JIPA 2COQA 2XZZA 5I76A 4LSUL 5ILTH 4NKMB 3ARFD 4L8DB 3MV7B 2NX5D 3K6IA 3SJVE 4C4BA 4F2ME 1H19A 4KX7A 1TJMA 1UXMA 2W9EL 4H44C 5E1QA 1M9SA 4JL1A 3L4UA 4LZKA 1DQLL 4PJXB 4WWKD 4KTGA 1BDYA 4LSVH 1RV6X 5E6IA 4JZOB 1SHXA 4F1ZA 1RVFL 2VZUA 4ZXBA 4JDTH 4OJYA 3QDJB 3KBHE 4EZMA 3CFCH 3CX2A 4NNXB 4K3DH 1LO2L 3S98A 1UWEL 4MD4B 2OTUA 2OK0H 1B4RA 4LRIC 2O6PA 1WD9A 4NWTH 4PJCE 2YGVA 5EOQH 2YQBA 2VRKA 2MH4A 5JIMA 1WAAF 2BOCB 3D39D 2X5PA 3K72A 2ITDA 5KVGH 4J3SA 3RVTD 4U6VL 5K9QI 2PP8A 1R5WA 1HZKA 5IB3A 1INQB 2BFGA 2XWBB 4NI3A 4A37A 2IALB 1INEL 2CJTA 4Y9EA 2BVQA 3KDMA 3TJEH 3BZDA 2ADGB 2NCEA 2UZPA 4PJFF 2NNRA 4GI9A 5D7EA 3FCBA 3ZHFA 3VCLB 3IJHA 4K7PH 3PABA 4P3CH 2DQIH 2F8OA 2EICA 4W6WB 1U8QA 1J48A 3HUJA 4TVUA 5DLMH 3V10A 1I1AA 2UXGA 3EAKA 1TEGA 5IB5B 4LLQA 5DUMH 5I30H 5ID1B 3WMQA 3OKDB 2PYEA 3E3QE 4KY1L 3LRLA 4PRPA 2YEQA 1L5GB 3VI3E 4AQEA 3QYNA 3O6LH 4FXKA 3EUUA 4CC0A 4Q97A 1EBAA 1KTDB 1QI3A 3MV8A 4HC1A 5F9DC 5HD8C 4I4WA 5C6TH 1H6UA 1U4FA 1GOGA 4ZI8A 5CP3A 3O6KH 3K91A 5K9OA 2B39A 3A6BH 3VD1A 5DZJA 1MAML 1IV8A 4V11A 4OLZH 1DFBH 3WNLA 1SJXA 4KH2A 4LPWA 3B2VH 4NS0A 1UWFA 5DVLA 1BVLA 1ASQA 1UFUA 3Q2NA 3CWGA 1ZHLA 2EKSB 3FXIC 1QPPA 2B77A 3GIZL 3VFSB 1FJ1B 4LPCA 4P23A 3X1EA 4PG9A 3VNZA 2KYIA 4RESB 2HFTA 4WSKA 3HZVA 2H2SD 2QLVB 3QWQB 2YOAA 5DC0A 1I3UA 1PIGA 4FADA 1F4AA 2E7LA 3T77A 1MFAL 3RX8A 1FHNA 1T20B 1EXUB 5C0BA 4RVBA 2QQQA 1OIOA 4JRYA 3WN6A 3IXAA 5KSAC 1TU2A 3TA3A 1YJDL 1RLWA 3TWCH 5IF0B 1BSIA 1T03H 1SDYA 5L6YL 2YRPA 2DKUA 5EFIA 2ZXBA 2Y6SD 3TESA 3RBSA 4XBEL 3WNJA 3WU1A 1NGZB 4JRXE 1F6AA 4M7ZC 3IF1B 1BMGA 4R83A 2Q8BH 1CU4H 4PGJA 4PGDA 2ZP0T 3SDAC 3CIQA 1Y0LB 3ORJA 3UZQA 4DVRL 2ZAGA 3LXBA 4OF5A 1G5GA 3CN4A 3EH5B 5CCGE 4DGIH 3ALWA 1A9VA 4U2YA 4YGVA 1OTUD 4PM1A 4MJ2A 2E7MA 2WXKA 1ZS8A 4HHAB 3MN8A 5TTRA 1KSRA 3TO2B 3QO1A 1BCIA 5EUOF 2C3XA 5FA4A 5I16A 3IVKA 3EJZC 5CSGA 2Z91B 4CRPA 1GA2A 4MA7L 1NGWB 1OB1B 1SOQA 1VENA 3EADA 5J5EA 2BK8A 3DROB 3F7YA 3DLQR 1U9KA 4ETQA 1FFOB 2A73A 2KBGA 3KPQA 2OULB 1EO5A 2FWOB 3QR1A 4M5ZL 3WFBL 2R59A 2IFFL 4NZJA 4G8EB 3C8HA 1J0KA 2QQLH 2AQNA 3LPGA 3IRCA 3K3QA 3WN5C 1EX0A 4HCIA 2QLYA 2P43B 3VXRE 5DUPH 1ZPUA 2KKQA 4IS6A 5PAZA 3QZPA 3GINA 4MA8H 4X6FB 5C7ZA 3GJFK 5C0BB 1CE6A 1TYRA 4M8QA 1I7UB 2E7HA 5LBSA 4Z7UF 3D05A 1HH6B 1YMMB 2PP9A 4Q9QL 4UTBL 5A2AA 4PJ7F 2ZUUA 4YHLH 4J4PD 3BQUD 3IJ7A 4JRYD 2BZDA 2DB8A 4DK3A 1L9QA 3BEVA 2MOQA 1BX2B 3NCYS 2DKSA 3TM6A 2EEDA 4NN5B 2N1TE 2NZIA 4QRSB 4XP1L 5KYUA 4RFNB 2FJGB 3ILDA 4ZMPA 1X6NA 3MRGA 1EZVY 1HWHB 2XVKA 3DVGB 1U8NB 4P4RB 1D7BA 1ED3B 2AI0L 3ASWA 4H8WH 2OQJB 3ARFA 4NKDB 1WYJA 4XOBA 3MRLA 3KPPA 2DDQL 4H13C 1DL7H 2P5PA 3DX3A 4M43H 5LGJB 1L0QA 3DX9B 3BW9B 4JPKL 3EFOB 4PLNC 5FM5M 4HSQA 3LS4L 1KXQE 4P06A 3RWGA 4E41D 1UFGA 1IKNA 1M9WA 3KPMA 1PG7H 3C5ZC 5CJ8A 5EV7A 1K8DB 4CDHA 3PV6B 1AGFB 3L5HA 4PLJD 3STLA 4DKEH 5CAYB 5ISZB 3AT0A 2A9CA 1X5GA 4J8QA 2PO6A 4NFBA 5I1AA 2P52A 3D50A 3T2LA 4WW2A 2IPUK 2CLRA 2I60H 4G72B 1KBVA 1XTMA 2APTA 2VLKA 1A7PL 4P2RE 2G9KA 4P3DB 4DERA 4XNDA 4B41A 5AYUL 3APMA 3PIQA 2XWBA 3VWKB 4XNZC 1GGBL 4E9WA 4MCZA 3MBEC 1CICC 1C5BL 3NZ8A 1OHQA 2DJ4A 3DIVA 2H26B 2MOGA 2OYLA 1BYOA 3L7EA 3VSQA 4S1QL 5SX5K 3QIBB 5I5MA 5J56B 1MCQA 4K15A 1E4WL 4R97B 4YNYB 3UTPE 4ABUA 2XN0A 4QHLB 1WDAA 1YDPA 3WKML 5IJVB 3QT2A 5IMOB 4D3CL 3ASOB 1KMGA 1W2KT 1KN2H 3ARSA 4RIRB 5DA4A 1A7OL 2ICES 1IQDA 3HS0C 4N8CL 5KVGE 4D8PA 5FWQA 1UKTA 1FLRH 4NQEA 4NRYB 4Y7OC 3E8UH 1XF1A 2WYTA 3CZNA 2D8KA 2HRGA 3SDCC 1Q0YL 4MQXD 5BV7B 4QCIB 3WFHA 2VZSA 5EU6E 1B9ZA 3SYAA 4M43L 3Q7JA 1G9MH 2JKJA 3ZYOA 1H3PL 2HLFC 3D07A 4EJ1C 5CBEB 2Y5TB 3C08L 3NZSA 4MZ3A 5AW1B 2X4TB 1LO4H 2BX5A 2QSQA 3KJ6L 4YDNA 1CBJA 1VA9A 3K2MC 1ZVNA 5FUZL 3NPSC 3RU8L 3ESVF 2QPFA 1X4ZA 1ZCRA 5C0GB 2VDNH 4P9HH 2XKNB 1OGPA 2VLMD 5HYIA 1CGSL 2JCCE 2VLKB 3FN0H 4JFFD 1KBWA 1AHMA 2WKOA 1CYXA 1ZDQA 2FLBT 2ZKWA 3CK0L 3WOVA 4FI6A 4Y5XC 4G5AA 1LK3H 1UUSA 4A2HA 5I73B 3EJUA 4OCWL 4KOCA 5HI3C 3KLDA 3MRMA 3BIKB 3N42B 1DJSA 4ZFGH 1XGRB 1IAOA 2ICEA 4HIPA 3TYGL 2EECA 2ZPKH 1E4XI 4LPXA 3GB7B 3QQ4B 32C2B 4Q6KA 2EE2A 1B2YA 3RGVC 1IFHH 1NPNA 1YDPB 4H25B 4YQXL 4Y9BA 4FXGA 5KVEE 2PWDA 1O5DT 5H37G 2EIZB 5I8KL 2DMKA 1RPQA 4M8UA 4PJAB 3QDHA 1G94A 1TQBB 5FUOL 3T3MB 4N26A 4UIMA 4BSWB 2CXGA 3G6JF 3R4DA 2QKIB 5J8OA 3CN2A 1NFKA 1X5YA 2NX5A 1GZHA 4QT5B 3V9CA 5EF1A 5HGHA 1BVOA 3NZUA 4PRAB 5E2JA 3X14A 1JF1A 4JQXA 4IKKA 5D7SL 3DIFB 4S1RL 4BZ1A 1AG0A 1VACB 3DI3B 3QUMB 1AGBA 4LAQL 4DGYH 2EC9U 3UBFA 1G7QB 3LQAL 3ZYIA 2IQ9L 5T1MB 3MNWB 4JN2B 4JPWL 3EHBC 4HMCA 5TK2A 3OJVC 4KNQA 3L5XH 3CCHA 4LCWB 4ENEC 2LLLA 5E51A 5HYJE 4LLAA 3FFOA 4MA8L 2FR4A 1JOIA 5AYUH 2PXYA 8PAZA 2FWSA 5CSZB 3SGJA 4TKWA 3ECBB 2FT8A 4HS8H 4GAYB 5FYJH 3F00A 1IQWL 2PCYA 4JHBA 4DP7X 4WRLA 3C8DA 2WXNA 5IT2L 1YNKH 2CK0H 4R4BA 5HGDB 3VGAC 5TQ2H 1ZGLA 1N26A 4PSPA 1KIRA 1UB6B 4BFRA 2V5YA 2DLHA 1QOKA 3EGXA 5I76B 3IM1A 4D0BA 3IFNH 2DIEA 4MA7H 3AROA 3LSOB 4R4FL 2W5PA 2NW2B 5FO9B 5D72H 3AM8C 4CA4A 3SE9H 4UV4L 3HRPA 4UUJA 4CVZA 1BZEA 3WHXB 3QFJA 4G42A 4MB4A 4OB5H 5DJYB 3D69B 5I15H 4A2GA 5MP6L 5IBTH 3V0HA 2PPFA 4UT6H 3VXTA 3QJOA 3SDXE 4M3JA 3V7AG 5I1LB 3M8OL 1G7PB 3FN3A 3FTZA 4IEFB 5C71A 5KTEL 2ALAA 1QYGH 2IANA 3HOGA 2H2SC 3A24A 4PB0H 4F7TA 2FZ3B 5B39A 1QATA 1CXEA 3FT1A 2JKNA 4XNYL 5EUOE 3VD9A 2FYYA 3GUFA 3Q8BA 1T21B 3QW9A 4KTEH 3DC0A 4WEMB 4O2CA 4TSBH 4FQ1L 4OD2A 4NRZB 4NWUL 4A2DA 3I75A 4J1UB 3NJNA 5I2IB 4KTDL 4F91B 2GJJA 3QHFL 4JKWA 4Z7AA 1UD3A 1ONQB 4ONGH 4MB1A 4ZD3H 4G6FB 1GS6X 2Y1VA 2ZWSA 1MFVA 4L0PB 3KYKH 2DQMA 3IGFA 3TCLA 5FCSH 3CFNA 1CZ8L 1JGUH 1W0VB 3R19A 4PJHB 2IDQA 3HMWL 3AQDA 1QMUA 1G9EA 3I85A 1OWRM 4OD1H 2VO8A 4YPGA 1T2XA 4ODUA 5AD0B 1NUGA 3QXAA 4EN3C 3VU2A 3OKDA 5DQDH 4FTVE 5KBNC 5K59E 1AR2A 1FL5B 3VXQB 3LKPB 3NYKA 4BE5A 3VXSE 2YD6A 2BHZA 3R4RA 4NZUH 1EJOH 3GMLA 5AB0A 1C5DB 3ARZA 2FHCA 3MRCB 4HK3N 2BY3A 5IOKA 3L16A 1ZLWK 2AXGA 5TK4A 4PIBA 5AZUA 5KUMA 3AREC 1M6OA 3LKQA 4N1CA 1C12A 1XDTT 4JM2A 4Q6YA 3LXUX 1ZLVH 1FGVL 5IMMB 4OLZL 2F54B 1E9QB 3RDJA 4YZWA 1ETJA 3O6FC 2P46B 1FAIH 2YMXH 1BQHG 4Z7QB 2M8XA 1X7SA 3WKYA 5TE4L 2A5UA 5JIQA 3MO1A 1DQKA 4HJTA 1CDBA 4HU2A 1EXUA 4GSRA 1OB0A 3OWEA 1FZOB 4LDCA 1U3HC 2FGWH 5DO8A 2VDKB 2CUMA 4XODA 3TT3L 2Q0ZX 4XBMA 4Y5VC 1RK7A 2F53B 3MRRB 4JFEA 2F19H 1BEYH 1QHQA 2P8LA 3GI9L 5CMAB 2EIMB 1FH5L 4JE0A 3V5HA 1G1KA 2EE3A 2EE9A 4PRBB 4NXSA 2WJ7A 4Y9CA 4NQSB 1JGUL 1G84A 4MXVE 2R2BB 4XO9A 3QDGD 3VXNB 1EEUA 1AIFB 3RY5A 4FLSA 4WV1B 3QEQD 1WEJL 5DFVC 1BVNP 3JWNH 1CD1B 4AMWA 3L3DB 1NGYA 1H5BB 1VCAA 5TFSL 3VXQA 1CPUA 4R7DA 3SGEI 3T0EA 1FFQA 4DUWA 1XQ4A 2DH3A 5B4MC 3RVUD 2VZ3A 3VDAA 1MCDA 5CKAA 5FOBB 5HJ3A 2AXGB 4KKAD 3Q6FA 1QSFD 2P49B 4LP5A 2BIPA 3UTQB 4MA1C 5CGMA 1MJ7H 1AXSA 1PNDA 1T6VN 3CFCL 2F61A 3ESNA 3IDNB 3TU6A 3UIZA 1DTUA 3GSOB 1ANUA 1RZGB 2GC4C 2X2UA 3EBGA 3CDFA 3F7LA 3ARDA 1AGBB 3S3DB 1TSHA 2C1OB 4PWKA 3IJ8A 4GQRA 4I0PD 2LFGA 3QS3A 2QHRL 3X1NA 3UAJD 1A3LH 1UYWH 3RE0A 2DLEA 4WWKC 3TEYA 1D7DA 2W9EH 3FB5A 5GGSB 4NUMA 1INQA 2XN1A 5DUBB 4U6VH 1KN4H 1OAKL 3OG4B 4HG4J 3RYMA 4PV8A 3C60B 3IU4H 4HEMA 4POYA 1A7OH 1KWGA 4JFZL 3PUUA 2X4NB 5ICYB 3G5WA 5T3XE 4W9JC 4XX5A 3HZYB 3GSNH 5SWZB 4Y4FA 2Z31C 1AQDA 5EBMB 1JHTB 3D2UD 5L2KE 4MA3A 1UWEH 2LAAA 2AKRA 1KTLA 5T5FA 4LP8A 1YEIL 2C9AA 1AD0A 4ZOCA 5DS8B 4XP4L 1HYSD 3LKSB 4MJ6B 1EQWA 5CP3H 3QCUH 1N2RA 2NY3D 5EIIB 5MENA 2ATPB 3V8CA 1WFNA 4RA0C 4E9YA 3UDWC 3AFLA 4PJGB 1DDHA 1RHFA 4CADB 3PGFL 3FONA 4BKLB 1MIMH 4H88H 4AEIL 3L3GA 4P5MB 3NT0A 4PJ8D 5CP7A 1IKFH 2YAQA 2I85A 3D4ZA 3Q3GB 5ICUA 1N4XH 2P8PB 2NUTA 1XB3A 4YDZA 4GUPA 3ATBA 3NJXA 2VXSH 4KKBC 4HEPA 3G9AB 3RWDA 5JOFA 3QIWA 1G1CA 1QLFA 3ZTNH 4F7CA 3LQAC 4XAWL 2Z93B 1MREH 3HRZA 3KPSA 4NN5C 3VFTB 4W70A 4JFWA 3GMOA 1BLIA 3GFUA 3QULA 5D9SA 1DSWA 1YPZB 1FFPA 2XQBH 5EO1A 2ZUWA 4J39A 4TULH 1C7TA 2PWEA 1GSMA 2BP8A 3L45A 3RKDC 1EXGA 3HE7C 4MLIA 1NUNB 2GJZA 4G70B 3RIFF 4DAGL 4IRJD 5B1CA 1EBPA 2RACA 4EVNB 1B2WL 3C09C 1KYUA 3LNFA 3MOQA 1EJ6A 3BDBA 4I9XA 2W60B 1X9UA 1BW8A 2HFFA 2PTVA 2AXWA 3WBDA 4HLZH 4QHLA 1VLXA 4NPYB 4XN9A 2FJFB 4TSBL 1P84K 4U1NA 2DJUA 1MLBA 2N7BA 1KT2A 4R7VA 1MFUA 1C16A 4QXGL 4YBQC 5GSVA 3HG0A 4AGNA 1FPTL 1UG9A 3D85B 1RIVH 1MWAB 1HVXA 3OMZA 3UTTD 3CZEA 3V4VA 4NQTA 4QRPD 1OCWL 5D7JA 1OD9A 3AY2A 1MFDL 1BXVA 5K1VA 2YEZA 4IJ3C 1MW1A 2DLFL 2OW6A 2ZCLL 3AUWB 4DGYL 1CQYA 4PW4A 1IEBB 1TMQA 4UQDA 4WENB 3REVB 4WWOA 5E6ID 2AJ3A 5C0FA 4IIQA 2VOTA 3EOBA 3HZKA 3PXHA 2VXQL 1S9VB 1FCGA 4LCCB 4K8RL 3K1KC 4ZUWB 5CUSH 1E5YA 2I26N 2ZYIA 3DX6B 3K4AA 3DJ9A 1I8LC 1LNUB 2BO0A 4P5KB 1I8KA 1WFTA 3FQUB 2FJSA 1S7RB 4HPOL 4NQXB 3CX5K 1PIFA 3H3BC 3M07A 1S7VB 2VDRB 4I48B 1HXYA 4R26H 4C57C 1MFDH 3FS9A 2JJTA 3P77A 4B0MM 2F53A 2Z1KA 3HE6B 4XMVA 2IQAA 2J1WA 4N0CD 5GGVL 5GS3A 5ACZB 4Z78A 4OLEA 1TTBA 2EO1A 1OLZA 1E4KA 1UM4L 3OMIB 1QHOA 3BJ91 4XMUA 3LH2H 4OGAD 1K2DB 2XNAA 3PWVB 4TL5A 2EDHA 3S9DB 4S0HA 2P8MA 2JJSC 7FABH 3OLIA 1CI5A 1F6LL 3D0LA 3FUNA 5DO2D 3FU6A 5INDA 1MCWM 4TYUA 3WLBB 3ZGHA 3M17B 3BEWB 5BV7H 4JFFE 2X9WA 4GFXA 4RAUA 2YARA 3RWHA 4UV7L 4KROD 1SM3H 4XC1H 4NP9A 5GGRA 5GJSH 3ZHKA 3T0AA 2XWZA 4WJKB 4FQLL 3S34H 1L0XA 4JFPA 3HI5H 4N6RA 1L7IH 2W65B 2WXIA 5FC9A 3B34A 3E80A 3I6GB 4HGKC 1T0MB 4FNSA 3FCSA 4OZGF 1N12A 3ARPA 2OS7A 5JZ7D 4YDJA 3U7WH 3TA3D 2VN5A 3RWFB 4K94L 3FN0L 1TZIB 4PBXA 2D0HA 1XF2B 1SEBA 1JZ2A 1XSIA 4OCSL 1IIIA 4LOFA 1D5RA 1NCWH 1N19A 4MJIE 4PLKD 4W4OA 2F7OA 2VLJD 1SBBA 3FU8A 4ZS7L 2HB0A 2YUVA 4OIAA 5EWIL 4RAVB 1HI6A 2OMVA 5DMGC 4QGYA 1OLLA 1U8HB 4EAEA 4H5SA 2WZ5A 5IJCC 1JHTA 3S5ZA 4OAWB 4AGOA 4AMXA 1K2DA 3OMNB 3US0A 4HS3B 2ZXAA 3T6QC 2GEEA 4ANVA 2BVEA 2OXGA 2Y07H 2DY2A 3PP3H 4FCAA 3QJXA 4D9LH 4ZFOL 1CFQA 3O6ML 2ZXWB 1J5HA 1FN4A 2X3AA 4G8GE 1D7CA 1T1WA 1ESOA 3ME0A 2VR5A 2X4QA 4V1DE 2EIJB 5GS0L 1IGIH 3V4PA 1FZMA 3MBEB 1LDPL 4KMQA 3WUWG 2KZKA 2CO6B 2OR7A 4JFDE 1W8EA 1TTRA 1NIDA 3ARGA 1H0DA 4HKJB 4IKIA 4TV3A 5F9AC 3U7YL 3KHQA 3CN0A 1J0JA 4P05A 3BUDA 2G75A 1MWAL 4M6OL 4MHHG 4JFQB 4E5XA 2FWOA 3V4PH 4NBXB 1UATA 4URKA 4ATWA 1NQBA 5EZLB 2P5WA 2B59B 1FNHA 2G3NA 3GSUB 4HJ0C 3RX7A 3FFCA 5DVNA 3T8XB 2QPSA 3EFDL 3ZY7A 4Q0XL 2XFXB 1FO0A 2VLJA 3MTRA 5DMYA 1XF2A 1H6FA 5KJRH 3MFFA 1UENA 1GTFA 2AAVA 5H35B 4IBYA 4ONOA 1MRCH 3CFDA 4LCWE 2YK1L 1YSOA 1Y6MR 4ZFFB 4DK6A 5DVKA 5AOMA 5I1DB 4L5FE 1QR4A 3OVUB 4X7TB 4AYID 3WO3B 4MWFB 3BAIA 4DCQB 3L4CA 2BNUA 5LBSH 4P57A 1MHEA 2ZG1A 1C16B 5FX3A 3K6SB 3VD5A 2Q3XA 3ARVA 2JLPA 4FHJA 4TVPE 4OQTL 3H6JA 5I74B 3QEQA 4E36A 1YHPA 4OJCA 4X7SH 4K23L 3BPCB 4BD4A 3HNSL 1E4XL 2HJLA 3BUQA 2R7EA 2BDNL 5DJ2B 2BFVL 4JMNA 2AV7A 4RWHA 2G3ZA 2ZWYA 4NQEE 4P8QA 3FRPB 4UQAA 4PGCB 4DW2L 4Z7VF 5DFVD 4KKRA 2Q3ZA 3HPJB 2HT3C 4FL4B 2RGSA 2JVUA 4DKAA 4OFVA 1P7HL 1U95B 5AAMA 4AM0B 5AB2A 1HTYA 1AANA 2FX7L 4MAYA 3AT8A 1Q1JH 3QDGE 2V2XA 2XTJE 3MX0A 3UERA 3IJEA 5BRZD 1NDTA 4X4YB 5C0RH 3TS8A 5AWNL 3PGCA 3Q9PA 4HQQH 4JO4L 4NFCA 1OGAE 2PXYD 4ICWA 4I2XA 4R4NC 4WSGA 5JORB 4PS4L 3CVHA 5BO0D 2ARWA 3DJRA 3ZIMA 4Q4EA 5LN8A 2OTUB 5D1XC 5E8NA 5FKPB 1CFNB 2YA2A 4Z7OF 3WLWD 5LGKA 4P4KB 4AG4H 4N8VB 2MNUA 3BESR 1NMAL 5FO9A 2YMTA 3Q01A 4N9OB 5ACZA 5AUMB 5HXMA 3A4FA 3AS3A 4TTGA 2JJVA 4KHTL 5IQ9A 2F1EA 2X4OA 4RISL 2VM4A 3OSVA 1LEGB 4EZKA 1G9HA 4DN4H 1P84J 4HIIA 4MNGB 1MJ8L 1BFVL 1RZKH 2DTSA 1R3LA 4NI6A 2Y7QA 5JHLL 4TNEA 3RVTC 3A23A 3CFKA 1VEMA 3K5RA 1JZFA 4F9PC 2J1XA 3GTVA 1O7SA 1E2VA 3QJSB 4OCXH 2B1OA 3M8OH 3K2IA 2OW7A 3CE1A 2OTPA 3ATAA 3A4EA 3IDIB 4W9EC 2AEPH 2OXHB 2VH5H 5CIPA 2IPUG 1OXYA 4ZUSB 2I07A 3EOTL 4BK8A 2L7JA 3MV7E 3K6FA 4UV4H 1UJ3A 3U1PA 3CNKA 1GYAA 3ZDXB 5ESQB 4QRAA 2OMZA 4PV8B 5ENWA 3JTTA 3L7FA 1KCUL 1A8JH 3WKNA 1NC2B 4K5MA 1KV7A 4G3YL 3T6VA 1CLCA 5C0CE 3NPSB 5DZ9A 4ODVH 2A83B 4FQCH 3G6JE 4GQZA 2H6PB 1FGNH 3IJSB 4UT6L 4WZ9A 3VA6A 2DWSA 4LL1A 1FJ1A 1KXHA 1UKSA 1U93A 3FSOA 3V0IA 1KB5A 3O4OB 4UQBA 4WFGE 1K9TA 4KK5C 1XGRA 3K5SA 2K6YA 4PJ7E 5AVQB 4ZMLA 4ZAKB 1UTDA 2UZXA 2WOYA 3FU0A 2VDQH 5C07D 1ETB1 4JQVA 5TDPB 1R1CA 1E8WA 5C0AD 1L9OA 1MRFL 3L4XA 5C0JA 2GTWB 2WQVA 4FXGB 4XMLH 1S46A 1U8JA 3LEVH 3QCVL 4XOCA 3SDYH 4OJEH 4QY8B 1KB5H 3QRLA 4Q56A 4IOIA 4UT7L 4DEPC 1SLUA 3PWPE 3L3JA 4NZTH 1QQDB 5A7BA 3KMDA 2D4DA 2Y6TE 5CD5D 2VL5B 3RFRA 1YRKA 1ASPA 2GTZB 1BVKA 2IWEA 3S3BB 5CEZH 1YEJL 4XN8A 4R2GB 4XMKH 3QIBC 4BWUA 3U46B 4KQ3L 3FQYA 4JLRB 4NQDD 5IEHB 1I3RA 3L6FB 2DQIL 4W9HC 5T1MA 4AG4L 1RP8A 4PRHB 4XNUH 4X6DF 4FKEA 5L2KA 1S9WA 2BJMH 4UI2A 2KZWA 2XV3A 2NY2B 4X8JB 5BZZA 1A2YB 2Z31D 4DN4L 4BZ1H 3ILQC 3CQPA 4HDIB 4QRRA 2YOCA 3L7FB 4PCSA 5KVGL 1HSAB 3F3HA 3KCPA 4XN4A 1NGQH 2X4UB 1KJVA 5AOKA 1MVYA 1N0LA 4OCSH 3T08A 3VXMA 2FB4H 3T04D 3TO4B 1M1XA 5LB1A 5DWPA 4AGMA 3B6SB 2HYMA 4DW2H 3BP7A 4LXFA 4QWWC 1MCNA 3POCA 1IFGA 2NR6C 4JRXB 2F5BH 2WV3A 4NJ9L 3QDGA 4XHQA 1QG3A 2LLNA 1UZ6F 2ESVA 3K72B 4KFZC 1XD1A 4YDVB 2XWJA 3JXAA 4ALAH 3LEXB 2DWTA 4OBSA 3HAEH 1GPOH 4B5ZA 1PDKA 2R4RL 1VFAB 3IJ9A 3UADA 4GUOA 3IMVA 2EVGA 1GW0A 1T1ZB 1QTYT 3UTQA 2DQGH 3C6LD 3N9GH 1PY9A 1F3JA 1M7UA 3DHJA 5D7LB 1RU9L 1QQDA 4FTDA 5H94B 5HSFA 3PWJB 4KK8D 4JPVH 4Y2DA 1RZJL 3KBPA 2H9GA 3HLAB 2JKXA 3M1OA 2E6QA 4Z5RA 2K8MA 1DBMH 4F8OA 2UYLB 4W9FC 1U91B 3QA3B 1KEML 1OTTC 2KI6A 3N41B 4L5FH 4LLQB 3VMOA 3ZRSA 2R29L 4FNLH 4WSJA 3SE4A 5A2JH 3DVGA 1EK3A 2VDKH 4MNHB 1MG3C 5E5LA 4DK5A 3FB6A 2EEXA 4KY2A 4YSPA 1S7RA 5DWUL 1AR1C 2V33A 1FUNA 1WWAX 3BCDA 3DSNB 4BWWA 2AC0A 2WINA 1MFEL 3UMNA 4BFNA 1WCBA 3BW9A 2GSGA 4OD3H 1JFQL 3NSYA 1OCZB 4XNAA 2YJLA 4L48A 3T3PB 5D7HA 1DJZA 3WIAA 3LKRB 1HSAA 1SZNA 3R1GH 5JHDE 4LDOB 4XWGH 2P28B 4RMWA 3MRKB 2EXWD 4OI7A 3DMMD 4I89A 1BOYA 4HALA 3B9KD 3BP7B 1TTAA 4J23A 4EQ2A 1JHKL 1T5XA 2OMUA 3QJZA 4XXWC 4L37A 5DURD 1VFUA 3U0PA 4UU9A 4K0OA 1AZRA 1IUZA 2GITB 2OL3A 2G4EA 3H8NA 4WF7A 1T20A 4CU6A 4F8QA 1KJ2H 3LZQA 5HHMD 3BCFA 1KB9K 3O6FD 4HMEA 4OI9A 1YPZF 3QZBA 4DN3L