2NLIA

Crystal structure of the complex between l-lactate oxidase and a substrate analogue at 1.59 angstrom resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
352
Chain Sequence
EYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTNRDYPFGMPIVQRYLRGTAEGMYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of Aerococcus viridans lactate oxidase and its complex with D-lactate at pH 4.5 show an alpha-hydroxyacid oxidation mechanism
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
molecule keywords Lactate oxidase
total genus 127
structure length 352
sequence length 368
chains with identical sequence B
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2nliA00
2E77A 4FNUA 4R33A 5K4XA 1TTJA 4IMDA 1NF7A 3G3MA 1JR1A 3LRMA 4JTHA 4OGZA 4RJEA 1D3HA 5I3HA 1GT8A 1PCWA 1I2PA 5TBOA 5KZEA 2C0AA 5LSMA 2A7RA 5TIMA 2WO5A 3NM1A 1VR6A 2QCFA 4JY9A 2ZTKA 4WD0A 2F84A 5IM51 4TO8A 5CZTA 4X9SA 1W31A 2EGZA 3H55A 4EF8A 3EEGA 4YXGA 4K39A 1X7FA 3W74A 2B7NA 5LNVA 1RV8A 4DPPA 4LC8A 1KFJA 2DZPA 4J9JA 3ELFA 4K37A 2JKAA 2J88A 2V0TA 3W7OA 3S1WA 2VXNA 3W3OA 3W71A 4OHQA 3E02A 1T8XA 4G1KA 4LUJA 1GVOA 3M5ZA 1C8VA 1ZALA 3W86A 4ADSA 1YLVA 1VYPX 1I2OA 3NA8A 1SR9A 5AB3A 3TQVA 3CEPA 1KM1A 3C2VA 1PV8A 3KXQA 3UWQA 2ZCGA 1W56A 1OX6A 4CQ9A 2YYTA 1TRDA 3KVKA 2AAMA 3HG5A 1S5TA 2E5DA 3SJ3A 4MIMA 1PHWA 3L2IA 5AOUA 1FDZA 3LLDA 2EF9A 3LHTA 3IGXA 5IBXC 2YZRA 2PCQA 4MY8A 5LGXA 2E1DA 2V8ZA 4IXXA 2J27A 1PL9A 1H1YA 4UTTC 3LERA 3EX6A 1L6YA 4OT7A 3MBFA 1WQ5A 3THQA 3VE9A 1G4EA 1Q6QA 3RF9A 1JCJA 3G1XA 4WY0A 2C14A 1OFBA 2ZRXA 4PCFA 3G18A 2QEZA 3UD6A 1XUUA 4IWWA 4KKXA 2ZYFA 2WV8A 4K8HA 3PAJA 4HT3A 4LW7A 2WNQA 3HPXA 2GQ8A 3C0JA 1M7OA 3IEBA 3BPWA 1XDMA 3DGRA 3UY7A 2YXGA 3NQAA 2C3ZA 4DF2A 2Z6IA 4AWSA 3TU9A 1RR2A 1AW1A 1PCKA 5I3GA 5MHBA 1TPEA 3JR2A 1YTDA 3SECA 3STFA 1W5NA 3T40A 5EY5A 3CC1A 4LVDA 5K4ZA 1K8XA 1OHLA 3QMRA 3W7IA 1H62A 1HUVA 4LNYA 2VFEA 4O1AA 1XCFA 5G2IA 4UFLA 2QCDB 1O94A 4RKAA 4MJMA 1CX9A 1A53A 4R53A 5FF2A 3M5YA 2Y7FA 4ZQNA 3TFCA 3O63A 3OBKA 2EPHA 3KHJA 4H4IA 4K6AA 3VKJA 2FB3A 2FPTA 4QJ1A 1LBMA 4QAIA 1F5ZA 1YDNA 2B4GA 4DF1A 3G8EA 1QMLA 4UFHA 4LVGA 1LROA 2VEIA 1IF2A 2RFGA 2HTMA 3P7YA 3OG3A 3QFEA 3O8AA 3GVGA 5AYYA 2F7FA 3GDLA 2NX9A 4S2CA 1B57A 4UTJA 4PEKA 3L5MA 3LHVA 2R14A 4WZHA 4LTSA 4P2VA 1VPXA 7TIMA 3R13A 4JD4A 4GUIA 3C6CA 5HUOA 4MFDA 4AWUA 3I7QA 4O1DA 1TV5A 1P1XA 3M43A 3THAA 1GVSA 3FKRA 3Q58A 3RNDA 3W1AA 3C3NA 3HPZA 1JCXA 1K3UA 3FYOA 4OWGA 3EXSA 1I45A 4FB7A 4JTFA 4NNAA 3QYQA 3W7PA 4XBKA 2Y6ZA 2B7QA 4YWIA 4WJEA 3UXAA 4K7VA 3OVRA 1LBFA 5CKSA 3C61A 1JQVA 3HGOA 3QQ0A 1C29A 3CEUA 3NPVA 3OIXA 3B03A 3SZ8A 1H60A 3HIJA 2Y88A 1OYAA 4ZQOA 3NEVA 3EWUA 4UTMA 3WJSA 4FX8A 1RVGA 3EXTA 1EEPA 1GEQA 1OFOA 3HGSA 4PH6A 3HG3A 3TE9A 6TIMA 3UXDA 3NQMA 4N9BA 4IX0A 4MLJA 5AC7A 3PB2A 3T78A 3EWWA 2OJPA 1X6UA 2RHGA 3S0CA 1L6WA 2NV1A 3GR8A 4NUWA 3BK0A 4RZ6A 5J5DA 5CZ0A 2GVJA 1FQ0A 1S5WA 1T99A 4B5NA 4JTSA 2Y85A 1ZFJA 1KTBA 4AWTA 1LLZA 3G22A 1Z42A 2RDWA 4UTHA 5E93A 4M5PA 1R2TA 4QISA 4Z08A 1TJPA 4GWEA 5J5RA 2V2CA 3W1UA 2ZZ6A 3A5FA 3LXBA 5AC6A 4IMGA 3W73A 4XQ6A 1A5SA 2QCCA 1IXOA 3HGRA 2ZQ0A 2NX3A 3S5NA 2X2GA 4HNTA 3W2NA 4O16A 4GE8A 2JKEA 2ABBA 4DO4A 4UFKA 1BWKA 4D2JA 1ZAJA 3QW3A 1FBAA 4IUOA 1W3TA 4R34A 3DI0A 3G0XA 4MPQA 3LDVA 4LS2A 3UWVA 4PC8A 1JUBA 4XKYA 4RXFA 1L6SA 4FX7A 3W2JA 2OX1A 4FNPA 3W22A 3CIWA 3W1XA 5FESA 3LRKA 3LI1A 5BNKA 5DBUA 2NV2A 3M47A 4NX5A 1ZCOA 2QCDA 1YTEA 5D04C 4UTIA 1GG1A 2J24A 3DKJA 3W83A 1SZFA 3G1FA 3P8IA 1VHNA 3O1NA 1LP6A 3FJ6A 1WDWA 4HPJA 5I3KA 1QPOA 2YR1A 4WOZA 2FLIA 2R94A 1FY6A 3UPWA 3KOFA 3DI1A 1ICQA 1KM4A 5HR7A 2TSYA 2A4AA 3GXPA 1VCVA 3QSRA 2Q3RA 1I4NA 4R7JA 5LZLA 4HN4A 3P81A 3B0UX 1KA9F 2X30A 4M19A 1YPIA 4O1BA 5LGZA 3S5YA 2GQAA 4LU0A 1SO4A 4BFAA 3WFAA 4N4PA 3F03K 1TO3A 2VFIA 1OYBA 2ISSA 5F2MA 3S8HA 1T0OA 4JTGA 1GOXA 1P5BA 4AXKA 3P80A 1F6KA 1IIGA 2HSAA 3UQNA 2DU2A 4AHPA 5FF3A 3EKZA 4AHOA 4E2DA 2B7OA 4JTEA 3MWAA 1FWNA 1XL9A 2GJNA 3GKAA 3HF3A 1TPVA 3CB8A 2O7SA 3TXZA 2VFDA 5F4WA 3V1PA 1X1OA 2CW6A 2Q8LA 3S42A 3U2OA 3R5EA 2GOUA 4O50A 3L5LA 1FXPA 5D05A 1FCQA 1P0KA 4FX6M 1QNVA 4HNUA 3DZ1A 4UFMA 5LNRA 3GXTA 1XI3A 4NJIA 3NGJA 3P74A 4Y9AA 1KM5A 2DZSA 4CNOA 4KWWA 1OFEA 3NL6A 4UMCA 2FIQA 1D9EA 2OMAA 1ZNNA 1TYGA 3MI2A 2V2HA 5LNUA 1W3NA 2CLHA 3EB2A 4GRSA 5FI8A 2ZZ2A 3IIVA 5AHIA 4FNTA 4MZ8A 4O11A 1QR7A 5K7JA 1TJRA 4JX5A 4YCOA 2ZZ1A 5AHMA 4Z1CA 4N9DA 1I2NA 3GIYA 4L4MA 3W2UA 3CTLA 2QCEA 1W5QA 3KRSA 2A0NA 2FFCA 1LZOA 2ZTJA 1M6JA 2BTMA 4MLRA 1IIHA 4NXKA 1K8ZA 3O6CA 4LV9A 3HOJA 3TW7A 4LVAA 4I9AA 1O95A 2W79A 2E6YA 5FF4A 3MP3A 1F73A 4JICA 1SW7A 3IGUA 3SY5A 4Y8FA 1QFEA 4P61A 2NZLA 4GUFA 4TU1A 2EAWA 4O54A 4YL2A 5T26A 3FS2A 4CNPA 3KRZA 2E09A 3N2MA 1R2SA 4FNRA 3C52A 1EWEA 2BWGA 4Y90A 3KX6A 2C18A 4HPXA 3C2FA 3L67A 1YADA 1R47A 3ZR4A 3DHDA 3ZWTA 3A5VA 2I9EA 3NL2A 1VC4A 3E49A 3QSTA 3GXNA 4GUJA 1DORA 2I1OA 4XTIA 1DJQA 1XBZA 4GFSA 1FX6A 2X1TA 3W87A 1FCVA 2ZA3A 5CSSA 4N9CA 4O53A 1LOLA 4FIRA 3U6WA 4Z1AA 1TB3A 4WY0F 3RMJA 4E0CA 1J4EA 4MFEA 5BRBA 1XDLA 3O06A 4WOQA 5FEZA 1S5VA 3ATYA 3OHIA 3NQ8A 4ZVJA 4FNQA 3LV6A 1EP1A 4I7UA 3BW4A 2ZZ5A 1G6CA 3FKKA 3O05A 2V30A 1U5JA 3IIPA 3ABOA 5F2LA 4DEFA 4QITA 1EPXA 4K36A 2UV8G 1VLWA 1JCYA 1SO6A 1H50A 1V5XA 3BGJA 1PVNA 5LNWA 1WA3A 1AL7A 3MMTA 4QSHA 1I8JA 3TW6A 1OF6A 4Q32A 4CCCA 5FF7A 3GK0A 4CCEA 1VS1A 2JGYA 4GUHA 3ABQA 1SW0A 1FWWA 1MSSA 4RZ4A 2GVGA 5EBUA 1A5CA 5U7SA 1GPWA 3MYOA 4JY8A 6ALDA 4AMAA 4O15A 5H91A 1BTMA 4TMBA 3QH2A 4N2YA 3QEZA 2H3BA 3PVFA 1RQEA 1OX4A 1K7XA 4AHQA 1K7FA 1HO4A 3CT7A 1VRDA 3QJAA 3USBA 1B4EA 1Z44A 5CPNA 4Q33A 3G1YA 4I7VA 1J5TA 5D33A 1LOQA 3DFSA 4K8EA 1LLWA 3CM4A 3W1NA 5C6MA 2DZVA 1W54A 4IOTA 1OX5A 1ALDA 3O6DA 3HJZA 1TMHA 1OFQA 1FXQA 1WAUA 4Y96A 3W2LA 4EOUA 1WYIA 1IXQA 5KZMA 3STGA 3MP4A 5U4NA 1SFJA 3LM7A 5IBXA 1P0NA 1HL2A 3IIZA 1Z41A 1OK6A 3Q37A 2V5BA 3W75A 3DU0A 3WJWA 2PRLA 4UMAA 3W76A 1FDJA 2E68A 3UNDA 5CPMA 3IGSA 3VE7A 4XZ9A 1OG0A 2V81A 2JBMA 1GG0A 1VCGA 4O1CA 4W9TA 5LKYA 4A2RA 2P10A 4MJZA 2TRSA 4DPQA 1AL8A 2OZ0A 2P0OA 1Q6OA 2W6RA 3G0SA 3I7RA 3BVJA 1FUYA 1P4CA 1GTEA 1C9DA 3B04A 3HQ1A 4A21A 2Z1BA 3QPYA 3M16A 1L9WA 3A22A 1XKYA 2DORA 2Y7DA 3TJXA 3MJYA 2VFFA 4MZ1A 1OF8A 1LRNA 4CLMA 2WSYA 3KAOA 3L9CA 3HG4A 4M6PA 3GDMA 3M0ZA 4M7SA 3RLUA 5CZJA 1ZY9A 4RV8A 4RXGA 1UUMA 4C1KA 5EA9A 1H7XA 2CLLA 4LC6A 5DLCA 1GVRA 5DXXA 3EWYA 2QDHA 4ICNA 1ONRA 1KM3A 1I2QA 5FEPA 1F2JA 3EX3A 4GUGA 5DCDA 1NSJA 4ZMGA 1ZAIA 5KINA 3UWZA 2OCZA 2VELA 3W7RA 1NAL1 3CWNA 2PE4A 3B05A 3LCLA 4NXSA 5F1VA 1BEUA 3IRDA 1VZWA 3TMLA 3NNTA 1PE1A 2Z0IA 2QCMA 3NL3A 5HNRA 4RK8A 3LBCA 4HSOA 3LV5A 2VENA 4O13A 4LV4A 1H7OA 1XFBA 4LUIA 2A7PA 3VNDA 5G4EA 1HFBA 1BKSA 3WJYA 2Q3OA 4FXRA 4OV4A 3N2XA 1R46A 1TQXA 1GJPA 3ZFHA 1KFEA 4JTTA 1G67A 1WOAA 3GAYA 4FHAA 1EIXA 1H7WA 3SI9A 1VQTA 3W7NA 4ONVA 1Q6LA 4GXMA 5F1UA 1FWTA 3PUOA 4ALDA 2HS6A 3UWUA 2CLEA 2YFNA 1LOSA 3L65A 1SO3A 1IXPA 3W85A 2NUXA 5LHEA 1LRTA 3M5VA 1TPC1 2RKXA 3T7VA 4JTJA 1HTIA 2NWRA 3W72A 2CLOA 3GYEA 4A3UA 4YLWA 2CLFA 3MHUA 3L21A 5DXYA 2J9ZA 3W9ZA 2KZHA 2BXVA 3MUXA 4ADTA 1FWRA 3W7QA 3F4WA 2A1YA 2WSQA 4DO5A 1GYLA 2FQIA 4NZJA 1SFLA 1XBYA 2P1FA 3DFTA 1W0MA 1MEHA 1KFKA 1KFCA 4N6FA 4UNLA 5I3IA 4NJHA 5CSRA 3UYCA 4NJGA 3P8JA 1KLZA 2FPYA 2QF7A 4NJKA 1DHPA 1JUKA 4IPJA 2QCNA 1QOQA 3NL5A 5DY2A 3G1HA 4O10A 1F74A 2Y70A 1KM0A 3S9YA 3RK8A 3LX9A 1TCDA 1NFBA 3DBPA 1BWLA 5FF0A 1QWGA 3DXIA 4XUGA 3W7MA 1TTPA 4BWLA 3DH7A 3TSMA 1Q45A 3T4CA 2YW3A 2FJKA 4BF9A 3O07A 1GWJA 2WQPA 5HJLA 2J6XA 4ML9A 2O7QA 2Y7EA 4ZQRA 1KBIA 3C2RA 2A6LA 3BGGA 1OFRA 2RH9A 2VFHA 3LHZA 4PL1A 4BI7A 4A29A 2YFOA 1W1ZA 1WX0A 5AHLA 1L2UA 2ZZ7A 3FA5A 4ZQPA 4JEQA 1G4PA 1WOBA 3TJLA 2ISVA 3MI6A 3PM6A 3W07A 3NPUA 3BLFA 4S1FA 3TCEA 4HHPA 1N7KA 5LHFA 3TROA 1OVDA 3VI2A 4NT0A 3W1PA 4RZ5A 3PG8A 4FEZA 1JQXA 3P61A 3HB9A 1ADOA 1F7BA 1OJXA 5EMUA 4O57A 2YX0A 1H61A 4TR9A 1T96A 3STEA 3L66A 4JN6A 5CG7A 3K30A 5F2GA 2C1HA 4KFOA 1G7UA 3KVJA 1OABA 1OYCA 4BI6A 3QM3A 3A21A 3W7KA 3NQFA 1GYNA 3TK7A 3QPZA 1KBJA 3LBMA 3NQEA 2BSLA 4FNSA 4EF9A 2ZRWA 4UTWA 5D2TA 1XXXA 1MO0A 2X1UA 1SO5A 4IJBA 4ZL1A 3W1LA 3NQ2A 1VYSX 3SIZA 1UBSA 2XN1A 4DXVA 5AC8A 3BG3A 4HNVA 2XFWA 1YPFA 3MP5A 5HUPA 4YCPA 5D03A 3LTYA 4GBUA 4O52A 1DJNA 3BW2A 5E1QA 3TXVA 2ZRZA 3R12A 2ZA1A 3I6RA 2WPBA 2DZXA 3IVTA 3W88A 1SSDA 3NPWA 4X2RA 2CZ5A 2QUUA 3QMTA 1AG1O 2VEMA 3N3MA 3G3DA 4JIQA 1H7NA 4FXSA 4X3ZA 1NF0A 5D2WA 4UTTA 1K7EA 3HMJG 1UB3A 2XN2A 3LRLA 2GJLA 4EWND 4O19A 2H8XA 1A5BA 2ZFAA 4AVFA 1TRIA 2E5BA 2FDSA 1RD5A 1QO5A 3TDFA 3CHVA 5C5YA 4K38A 4IMCA 5HINA 3NR0A 3P60A 1B9BA 2A2IA 5D2XA 2QR6A 3GKFA 3NQVA 4FO4A 2X1RA 4NQ1A 3H54A 4UIOA 4XBSA 4JTKA 3W6YA 2QCHA 3AO0A 2BLEA 2TMDA 1KFLA 2EHHA 3EWXA 3EX1A 4MYAA 4PTNA 1TQJA 3IVUA 4JX4A 3MO7A 3BLEA 3PY2A 3M7WA 1H5YA 4RX0A 3JRKA 3D0CA 3PF3A 3S6DA 3LHYA 3BG5A 3TR2A 2TYSA 2QUVA 3U8GA 2FPVA 3E9AA 3S1UA 1AW5A 3UZJA 3FJLA 1QO2A 2V2DA 2VFGA 3E12A 2ZZ4A 3A24A 4HIBA 1VHCA 4CQ8A 3INPA 2V9DA 3B0VC 1M5WA 4JDBA 3HBLA 2NUWA 4IPIA 2X1SA 3TC6A 2XN0A 3P5YA 4JYDA 3TH6A 5C54A 1OX4B 1MZHA 3WK1A 1VLIA 4O4VA 1TIMA 2QCLA 4IMEA 3OVQA 3E0IA 4MKNA 4NX0A 1H7PA 5HR6A 4JIPA 1UJPA 4MY9A 4WUIA 2H3DA 1VGAA 1H7RA 3S1XA 2QJIA 2DJXA 2DP3A 3L0NA 1XBXA 3W7HA 2DJLA 4IMFA 2J9YA 5FEXA 2D73A 2G95A 1O5KA 2OT0A 1YDOA 3MYPA 3TUUA 1LYXA 1ZJIA 2I14A 3PBYA 1RQHA 2NX1A 2NXHA 2VKZG 1V7YA 5AHFA 2A6NA 1XC4A 2QAPA 4MUZA 5C2XA 4C1LA 2WNZA 3CWOX 3NO5A 5D30A 4HNNA 1RZMA 1ZHAA 3EWZA 4X22A 1W5MA 5CZSA 4LS0A 4HKPA 4XTDA 2Q8ZA 2WSRA 3PG9A 1Q6RA 3SGUA 3LHUA 1KLYA 2B7PA 4JTUA 4JX6A 3A23A 5KMYA 4NNBA 1KW1A 1GZGA 3C56A 2RDTA 2E6AA 1UCWA 3QW4B 5CPOA 1B3OA 3PSVA 1J2WA 3EX2A 1I2RA 1WBJA 4WXYA 3GAKA 3BARA 1QPRA 4A2SA 5G5IA 3P67A 1Q3NA 2GUUA 1AMKA 1FCBA 5A8GA 4AAJA 5D09A 4N6EA 4O0ZA 3LCHA 3N14A 3N9RA 1YXCA 1VJIA 3N19B 4M7TA 3N73A 3FOKA 3W7JA 4JGDA 2Y7GA 2YSWA 1LRQA 2YCEA 3ATZA 3Q2DA 3NAVA 5D02A 4GJ1A 1A50A 3G8RA 3G1DA 1TPFA 3TQ0A 4UCGA 3UY8A 1EP3A 1W8SA 1OK4A 2H90A 3NM3A 4O12A 2A21A 1LTDA 2CZFA 3YPIA 2QUTA 4BI5A 2C15A 4O8RA 1JULA 3B06A 1XUZA 3TFXA 4LWWA 3GLCA 2H6RA 5TQLA 3W7LA 3GNNA 3TC7A 1JRBA 1AK5A 5EPDA 1W3IA 1OFAA 4UR8A 4TX9A 1WBHA 1TPDA 2J9XA 1CW2A 3BW3A 1ZAHA 4RR4A 5C55A 3DFNA 3RFAA 1OFDA 5G2HA 2ZZ3A 3LXCA 2V5LA 1VH7A 3ABSA 1TPWA 3G0UA 3NDOA 2WNNA 4DBEA 2WKJA 3M41A 5AHEA 4DBDA 3DAQA 2AGKA 1YDVA 4O14A 2V82A 4EIVA 3TV8A 4Z1DA 3ZS4A 2A7NA 1LORA 2ISWA 2HS8A 3TAOA 4POCA 5ABTA 4JXCA 2C13A 2PURA 4L4LA 5I3FA 5K2ZA 1SZNA 1X8FA 1OFPA 1WXJA 3MBDA 1S3HA 2CWNA 2E6DA 2B0MA 4AH7A 3C8FA 4UUIA 1O4UA 4OBTA 3LB0A 2NUYA 4DO6A 1ME9A 2GPTA 4RCXA 1RQBA 2Z2UA 5AHNA 3H53A 3R2GA 3W84A 3NQDA 2ZRYA 4TIMA 2WOQA 1YXDA 3NZRA 4U4MA 3QZEA 3P62A 3DFPA 5I3JA 2NLIA 3WK2A 2GVLA 1KTNA 5CPLA 1DOSA 1KM2A 1DBTA 1THFD 1F05A 4H6KA 1LBLA 3GNDA 3I68A 4N4QA 2R8WA 1LCOA 1MEWA 2G97A 2ZDRA 2ZA2A 4O18A 4ORIA 3I7SA 1MEIA 3E96A 1SUXA 4LRTA 5G1TA 1WV2A 3W23A 2C16A 3PR2A 4OE7A 3SFKA 3LI0A 5E0KA 3GZ3A 3TX9A 3TAKA 3W7DA 4WQ6A 3RU6A 4ZQMA 3EWBX 1MXSA 3G24A 4KFPA 4CCDA 2H8ZA 2RDUA 1ICSA 3GR7A 2YPIA 2VEKA 3PBUA 5EYWA 3NQCA 2Y63A 3P82A 4ZZ9A 3QF0A 4PL2A 4UTLA 4PA8A 4LY8A 2ALDA 3PBWA 3CQ0A 5K9XA 3BV4A 4U28A 3PUEA 5BMXA 2G5WA 4JNMA 2W0UA 2C19A 3G1AA 1EUAA 2ZRVA 3PSWA 3CPRA 3KVLA 1AW2A 1KTCA 1G7VA 1HG3A 1KFBA 3GDRA 5AFDA 5FEWA 3PWAA 2ATSA 1K8YA 3KRUA 2Y89A 3DFOA 5BW6A 1UUOA 5D2YA 3T44A 3EXRA 4O28A 3LLFA 4I7WA 2IQTA 4JTIA 2VEPA 4O17A 3ZWSA 1EA0A 3PB0A 2C6QA 3MHFA 4OU1A 2QAFA 4E38A 3M5XA 4KFNA 4LS1A 2YW4A 3C2EA 3UZ5A 1JUEA 3TMQA 2QJHA 3PBVA 4MOZA 4QNWA 1Y0EA 3UWWA 1TTQA 3AJXA 3NQ7A 2DZUA 1PS9A 2YGYA 4O0KA 4AF0A 2PRMA 1TV8A 4AF0B 3F1QA 4IX2A 5HULA 1TV7A 2CLMA 2E6FA 2BZNA 2JKPA 4BR1A 1QCWA 1ML1A 4QIUA 1E51A 4XWUA 4IGHA 3W7CA 3IIOA 3SGZA 4JS3A 5HWMA 1NEYA 3FIGA 4GC4A 2EKCA 3W7GA 1DL3A 4LT9A 3C4UA 4GNJA 3LGEA 5EKYA 1RPXA 3LCXA 5F2IA 1G4TA 2CU0A 3MHGA 2NXIA 3S1VA 4PODA 3W1RA 1GVFA 4NNCA 5F4SA 3WK0A 3LTPA 3WJZA 5D32A 3Q94A 1SW3A 1M7PA 4QNEA 1JCMP 1K02A 3G1VA 4IXHA 3CLMA 4S2BA 1W5PA 1YXYA 2NXGA 5AYZA 3QC3A 2Z6JA 4ORMA 4UTUA 3TNOA 5KSWA 5G2WA 3GDKA 1W37A 3NYZA 1G4SA 3P5ZA 3S5ZA 3W7EA 4H3DA 2A85A 3O6YX 1JCNA 3LHWA 1QAPA 1JRCA 3TKFA 3SR7A 2GQ9A 1EB3A 4WXZA 3GB6A 5K9CA 1H51A 3L0KA 2CLIA 1SZEA 2A5HA 1IXNA 3OVPA 3B8DA 1U83A 3OEXA 1D3GA 1KV8A 1GTHA 4AEOA 1DQWA 4Z1BA 3IVSA 5GVJA 2JGQA 3QQ1A 2BX7A 4OQVA 2ZRUA 1H1ZA 5HWJA 3KVMA 1HO1A 5DN1A 4UXDA 3GDTA 3TA6A 1YYAA 5HMSA 1EX5A 3KFTA 4O4WA 1SZGA 1PHQA 4TMCA 3LTSA 4IQLA 1SSGA 4YMZA 5G1YA 1LM1A 1H63A 3NZ1A 1KM6A 2E5CA 3FFSA 4JDYA 5EL1A 1B4KA 3W2MA 3LXAA 4BWLC 1K03A 3BLIA 1QOPA 3QMSA 3CIXA 4QM1A 1A5AA 1CI1A 5G4WA 3R8RA 5BOOA 5LNSA 2CLKA 4BK9A 5DCBA 5D38A 3W1MA 5H2ZA 3NPXA 3UPBA 3ABRA 2R91A 5BMWA 2VOMA 3TSBA 4OV9A 2Y62A 3IIXA 4AB4A 3JS3A 4N9EA 4LOCA 1EP2A 4K7YA 2ABAA 2QDGA 2WJZA 3O16A 3N34A 4UFJA 3NVTA 3RLVA 1TPH1 1TPB1 2YDAA 4ADUA 3DFQA 3FYPA 4MYXA 3NQGA 3F4NA 3MI3A 3LCIA 5KZDA 3MW7A 3WK3A 3PS7A 4N02A 3TIMA 1KV5A 4DELA 4NU7A 2PRHA 3CU2A 4HSNA 5AYXA 3EX4A 3NXFA 3FEMA 4WX2A 5AN7A 3GX9A 1FWSA 3PULA 1EUNA 3HPSA 3LOTA 1FDYA 3STCA 3M9YA 1JCLA 3V75A 1N8FA 5DELA 2CZEA 2FTPA 1TREA 5K9DA 4FIQA 1F76A 4Y6GA 3HG2A 2DZTA 5D2VA 1SU5A 1F6PA 2Y61A 3G1SA 3DKLA 1R2RA 3VFLA 3DENA 1G69A 3B4UA 4M6VA 4UMBA 4ZQCA 1NVMA 4DQWA 1ICPA 2QKFA 3WJXA 3P84A 5L9FA 4JR5A 1N55A 1TPUA 1R30A 2NWSA 4NZFA 4UTWC 1XBVA 4RLIA 4CNNA 1FCUA 3S5OA 3L68A 3T55A 1O5XA 4FF7A 3SW6A 2VC6A 5DY3A 3TSDA 2HMCA 4UNKA 5F4XA 4EVZA 4KWVA 1Z48A 3W1QA 5HQEA 4MZYA 4NVTA 1DKWA 3L0GA 3DHFA 1GQNA 1DQXA 5DBTA 1VYRA 3FLUA 2X16A 1DV7A 4CQAA 1ME8A 5HWNA 4UC5A 1EWDA 1QDSA 5CGQA 2LLEA 4MY1A 4MVAA 1XM3A 4UTKA 4PFMA 4UR7A 1SQ7A 5KTLA 1PIIA 4JTLA 4A22A 4DF0A 1DVJA 4JYFA 3I65A 3L5AA 2PC4A 1IGSA 1UASA 1JVNA 3R89A 3IV3A 4UFIA 3M44A 3LCFA 5DCEA 3NG3A 5K3VA 1TTIA 1ZENA 3A9IA 2CFFA 4QQ3A 5D37A 8TIMA 2CZDA 4M6QA 1JJKA 4XKYB 2TPSA 1X1ZA 2YYUA 2FB2A 1GVQA 3W2KA 1QPNA 3NOEA 3PUDA 3BO9A 1VCFA 2QJGA 3OA3A 4WY0B 3EKLA 3SSJA 3UWYA 3LCGA 3C2OA 3BG9A 4Z0JA 5KITA 3TQKA 2ATMA 3ANYA 3NQ6A 4E2BA 1LDCA 1ME7A 3W1TA 3W70A 1TSIA 3QRHA 3VCRA 2G96A 1O60A 3LCWA 5L6UA 2DZWA 3M6YA 4JYEA 3O15A 2JK2A 4Q4KA 2AQWA 4LVBA 3PC0A 2ZBTA 3HGJA 3N9SA 1W5OA 3HO8A 1QPQA 2QCGA 4LRSA 2OT1A 5SWUA 4LVFA 5A5WA 1SPQA 3M1ZA 1YTKA 4NJJA 3B0PA 4Z0SA
chains in the Genus database with same CATH superfamily
4R33A 1I0BA 5K4XA 2YLAA 4IMDA 1D3HA 1P6BA 4MDPA 1PCWA 5KZEA 2C0AA 4LYRA 1R0MA 4M1RA 3VDBA 3CV7A 2ZTKA 4JY9A 2F84A 1HP5A 4X9SA 3H55A 1XS2A 4K39A 1X7FA 1W9PA 1RV8A 1KFJA 2DZPA 1W17A 1IT0A 4C6EA 3W7OA 1YQ2A 3M46A 1ISVA 2CESA 2YDQA 3PZTA 4XZMX 4C90A 1W1IE 2VZUA 1BWVA 3LENA 3WQ8A 4ADSA 1XIGA 1V3IA 3NA8A 1SR9A 5AB3A 1MUMA 1I0DA 1WCGA 3TQVA 3UWQA 1PV8A 3KXQA 1R3SA 4PR4A 4CQ9A 3SJ3A 3KL3A 3QHNA 3V36A 1F3EA 4K68A 5JIPA 1CDGA 2EF9A 2RDXA 5IBXC 5LGXA 4AZBA 3WELA 3VABA 4OBRA 4EK7A 3RF9A 1CBGA 4NZ5A 1OGGA 2C14A 1OFBA 2E25A 2ZRXA 4WDXA 4PCFA 5DT7A 1W9UA 2DDXA 4U5IA 4ZODA 4KKXA 1HGWA 2ZYFA 4LW7A 4LCRA 4AZCA 3AS1A 3ARZA 3DX5A 2GQ8A 3UY7A 3NQAA 4DF2A 1AVAA 1E6XM 4AWSA 1XRVA 4AZ6A 3FX4A 1TJ2A 3STFA 1F3TA 3T40A 2P3EA 4CU6A 4LVDA 1VP5A 4ZFMA 3QMRA 1PXGA 3W7IA 2OG9A 3N4EA 4O1AA 1GOMA 1XCFA 1O94A 3VX1A 3E5PA 3LLXA 1CX9A 4KEUA 4WEVX 2VNCA 4R53A 1XRTA 3M5YA 1J0YA 1H09A 4KCUA 4ZQNA 3EOLA 3LSBA 2FB3A 4OZOA 2Q8XA 4HHHA 3CBWA 1YDNA 2O55A 5ABFB 3DDMA 4AEFA 2E0PA 4LVGA 1LROA 1IF2A 5C2CA 1J96A 3GXIA 2F7FA 1B57A 3L5MA 4A8RA 4P2VA 1VPXA 4WF7A 4CKQA 4ZB0A 4AWUA 3I7QA 4WHBA 5BU9A 3M43A 5E9XA 4AC1X 3FKRA 3RNDA 3MCMA 2HRWA 3V5CA 3TW9A 3C3NA 1V0LA 4E5TA 1ITXA 4B5UA 4JTFA 3QLLA 3W7PA 2VX5A 3ZYZA 3C61A 4OKDA 3QZAA 1JQVA 3HGOA 1C29A 1M3UA 3OIXA 2OYLA 2Y88A 3NEVA 4UTMA 3HGSA 1GEQA 4PCPA 6TIMA 2BHUA 4IX0A 4PTXA 5AC7A 3VC5A 3T78A 2YZ5A 3EWWA 2RHGA 1L6WA 3GR8A 1Q7MA 2WPGA 1V7AA 4KCWA 1ZFJA 4GCAA 4AWTA 4IIFA 2Y5EA 2GZXA 5E93A 3ZJ6A 4M5PA 4QISA 4I9TA 4Z08A 1UKOA 4C6PA 4FOKA 3BXWA 3M0IA 3TA9A 5J5RA 1EPVA 2X7VA 2W67A 3AMDA 4D8LA 2FVLA 5C7VA 4LYQA 3W73A 4OTKA 1IXOA 1GKQA 3CIVA 3HGRA 3VIJA 4DNMA 3GG7A 1XIJA 2X2GA 3N3TA 4IGSA 1Z69A 4O16A 3KBVA 3NSMA 1ZPTA 4UFKA 3SRHA 2R9RA 2WM0A 1DIDA 1T5AA 5F7UA 4WKHA 1JPHA 1W3TA 4FXFA 4R34A 1PIFA 1A5LC 3LDVA 4LS2A 3ZJ7A 4PC8A 4XKYA 2PDYA 3CJPA 2J8GA 4C6JA 1RBLA 3CAQA 2Y5JA 3UJSA 3CIWA 2F2KA 3W1XA 3AS3A 1JYVA 3H4XA 3EEZA 3W81A 3ITGA 2XIQA 1YTEA 2Z1SA 1G94A 2A3HA 1QNOA 2J24A 3DKJA 3W83A 2FZNA 1T8QA 3G5EA 5HXMA 3WH9A 3U48A 2V3GA 3FJ6A 1WDWA 2V6AA 3MSYA 5I3KA 1MFVA 3OLDA 2R94A 5E70A 3BWWA 2ZX6A 3OOQA 3UPWA 4GI4A 4NZ4A 1U1HA 3GH4A 1VCVA 1K8CA 1JZ7A 4PTMA 4NSBA 4H9XA 2ASHA 2GGGA 1YBQA 1HW6A 1KWKA 3A9BA 3LQGA 2QPSA 4M19A 2W3ZA 5LGZA 3ARVA 1SO4A 3WFAA 1V03A 4C6CA 3A47A 3N1AA 3CMGA 3F03K 1BVNP 1OYBA 3ZT7A 1YBQB 2A3LA 2PF8A 5F2MA 1TR9A 1H0GA 3IJIA 4AXKA 3ZLHA 1IE7C 2OPJA 1IIGA 3VGGA 4AHPA 1KRCC 4AHOA 4E2DA 2B7OA 2VC9A 3CK5A 4B4HA 5JXQA 3MWAA 1FWNA 1W8GA 4CEXC 3GKAA 1J0HA 2ZX7A 3HF3A 1TPVA 2WNWA 3CB8A 2J7DA 2VFDA 5F4WA 3V1PA 1X1OA 1P6WA 3CYVA 1PDZA 3U2OA 2ZUVA 1JAKA 2JEQA 1E0VA 3BE7A 3BDKA 1L6FA 3L4UA 1XI3A 3NGJA 2X41A 1KM5A 4CNOA 1RP9A 1AJZA 4KWWA 3VNIA 1OFEA 2G3FA 4UMCA 2Y0FA 2FIQA 4U3AA 2WZTA 3GVWA 1C8XA 4J3XA 2IUZA 3CQJA 2ZX8A 2JIWA 4ZB2A 2ALRA 1QUMA 4MZ8A 5JH2A 1TJRA 4S3GA 2ZZ1A 2XFRA 4YPJA 5LIWX 3GIYA 4L4MA 1OC6A 4LUYA 3RILA 1ISXA 3WLNA 3R1ZA 5A3HA 2W5FA 3KOWA 1JAEA 3BTNA 4IP5A 4PCSA 1DXEA 4MLRA 4PUMA 1K8ZA 4LV9A 4C6OA 5A6BD 3VTRA 3WDRA 5JU6A 2W79A 3GG1A 3TP4A 4NKCA 3GHUA 3URAA 1J12A 2NZLA 1SJAA 4TU1A 1BFNA 2J7GA 1V6TA 4L7ZA 4OFCA 3FS2A 1RH9A 2I16A 3RIKA 1CIUA 3CUFA 3DN5A 1VEMA 4NYUA 4XD5A 1FWDC 5HPCA 2QPXA 3C52A 4Y90A 4ZE4A 3C2FA 4GYJA 3L67A 1YADA 4C6KA 1UR1A 3DHDA 3ZWTA 2VJXA 3VIPA 1XF0A 1FHVA 1XIHA 3E49A 3QSTA 3GXNA 2PDMA 1PEZA 4TVDA 3PTKA 2EJ1A 1M53A 3K4DA 1DJQA 4LPCA 2NLYA 2ANUA 3ABZA 4HU4A 3I3DA 4GXPA 4GHRA 1HT6A 1AODA 1QVBA 2ZA3A 4ML4A 1LOLA 3U6WA 4JZ5A 4Z1AA 1QW7A 4WY0F 2Z2BA 1UKQA 2UBPC 4MB5A 1J4EA 1KXHA 3WSUA 4JTAA 3GTHA 3KOXA 3O06A 1NH6A 1S5VA 1U1UA 3NQ8A 2PWGA 4E2VA 5DMLA 3LV6A 4DJEC 1W32A 5CSUA 3RRAA 4D6DA 5AZ0A 4RNJA 5LA2A 2Z1XA 4LUTB 5I7GA 4DEFA 4RUBA 3TNBA 4QDMA 4QR6A 3BGJA 3KLKA 1I8JA 4MNMA 3TW6A 4GACA 3SIMA 3AROA 5FF7A 4KGLA 4GUHA 3SQLA 1MSSA 2J7FA 3CPUA 3KS5A 1XD0A 2FTWA 5EBUA 1A5CA 5U7SA 1E3ZA 3WBEA 1GNXA 4GY0A 1CB7B 1E43A 4AZ7A 1BTMA 5D9PA 1DTUA 4LJ3A 4N2YA 3LUTA 4WDUA 2H3BA 3RU8X 3BZJA 4GFIA 3USBA 1B4EA 2J75A 1R9ZA 5XIMA 5M5DA 2PI6A 1QI0A 2F61A 3O6DA 4PRWA 2GVYA 1FXQA 9XIMA 4NY2A 4PMNA 1X7IA 4LYKA 4EOUA 1ZCCA 5KZMA 3MP4A 1XLEA 3LM7A 4YTUA 1QNPA 1P0NA 2J6VA 1Z41A 2V5BA 1GGOA 5FJJA 4UMAA 4JFWA 1FDJA 3UNDA 3NUKA 3K5XA 2F9RA 1OG0A 2V81A 1GG0A 3O7UA 3GIQA 3UESA 2P10A 5BZAA 2TRSA 1GQIA 3PNZA 2J66A 5GJNA 2P0OA 3ID7A 1D3CA 3I7RA 1GTEA 4J40A 1S2AA 2Z1BA 3M16A 1L9WA 3PZNA 1XKYA 1TMLA 2DGAA 3MJYA 2VFFA 2VRJA 3QV8A 2IMRA 1OF8A 3GDMA 5D9OA 2PDQA 3RLUA 2BDQA 5CZJA 4C1KA 5EA9A 1AZ2A 4AMCA 5DLCA 4JIIX 3QR1A 4ICNA 1OCBA 1ONXA 2AKMA 3CGTA 4DUOA 4JKLA 5DCDA 3CWHA 1EC8A 2XM1A 3UWZA 5KINA 3TYEA 3QXBA 2OYMA 4FMVA 1NAL1 1VENA 1MNZA 2WLYA 3TN5A 4PBEA 5C9UA 1BEUA 2FZMA 3NNTA 1PE1A 2CITA 2QCMA 2CKRA 4HSOA 2VENA 2RAGA 3UGVA 3IJ6A 2WXDM 4M29A 4Z1YA 1HKMA 4E8CA 1BKSA 3W01A 1IEVA 1XYAA 2XFYA 1IWBA 4GY7A 2Y5SA 3ZFHA 5IHSA 1G67A 3HMCA 2WKLA 4KS0A 2F2HA 3LK6A 2QHAA 5A69A 4RDZA 4GKLA 3E0VA 3NEHA 1Q6LA 4LXFA 1FWTA 3F5LA 1WZAA 2HJPA 2ZOXA 2BY1A 3FDGA 2CLEA 3GU9A 4E2OA 4QJ4B 3UJFA 5FSEC 2NUXA 2ZADA 3M5VA 1XYLA 1TPC1 2RKXA 4GZEA 3T7VA 5KETA 4GMEA 5BRPA 1KXVA 3MMUA 2ACUA 4LBUA 1FWCC 2ACRA 1ZP4A 3GYEA 4I3GA 1LWJA 3CL8A 4A3UA 3WUBA 1L0PA 1ZGDA 1VRXA 3KBWA 4V27A 4H2CA 3UERA 3NZPA 3L21A 3C0SA 5CAKA 2J9ZA 1B2YA 2KZHA 4IL0A 4AD1A 3F4WA 1UWTA 4DM2A 4WKAA 3SB0A 1MEHA 1JL8A 5I3IA 4HA0A 4NJGA 3S47A 1KLZA 3RM8A 2FPYA 1DJZA 3PHAA 4IPJA 2QCNA 3ZSTA 3G1HA 1UUQA 1F74A 3S9YA 3RK8A 1TCDA 3UR5A 3DBPA 1BWLA 3KOZA 3ZXWA 1J6OA 5HJXA 1XYMA 2E4TA 3DXIA 4XUGA 1KKRA 1TZ7A 5BCAA 4BF9A 5HJLA 3WNNA 1NWRA 5CEWA 4ML9A 4ZQRA 1B0IA 3C2RA 1B3ZA 1UIPA 3HV8A 1P0DA 3NURA 2HPIA 1V8EA 3U5UA 5AHLA 4S3FA 3SUUA 1W1VA 4ZTYA 2HXUA 3TJLA 1Z9AA 3W07A 3SM0A 3BLFA 2GJXB 4HHPA 1N7KA 4OBSA 2HEJA 1XIBA 3PG8A 2YL9A 4KERA 4XZIA 1JQXA 3TOPA 2L5HA 5T91A 2OO0A 1OJXA 2I5GA 3AJ7A 4J27A 3STEA 5CG7A 3FXYA 1D7FA 4O8AA 1OYCA 3VNKA 2ZUWA 1E40A 3NQFA 4DWDA 3H6OA 3QPZA 1CXIA 4EF9A 5D2TA 3VIFA 1MO0A 3GTFA 4IJBA 1E9YB 2VX7A 2PWDA 1VYSX 4C6NA 1VF8A 4WGHA 3PANA 5AC8A 3B9NA 1GW9A 2FYMA 3R11A 2PAJA 2FDMA 3W53A 1O6IA 3W26A 2P5NA 1REQA 4I9MA 4YCPA 4YTQA 4GBUA 2ZRZA 3R12A 3IVTA 2GWGA 1UMYA 1SSDA 5H8PA 1A5OC 1RSCA 4X2RA 3AISA 1Z89A 4H9VA 2QUUA 3SUVA 2VEMA 4DZIA 1S2CA 1EF3A 3HMJG 1UKTA 1UZ1A 4OVXA 5JVLA 1UB3A 3I6TA 5AC4A 2GJLA 3VNMA 1SZRA 2EEXA 3TDFA 2XGZA 5C5YA 5D2XA 1EFZA 4BEUA 1PKLA 4DJFD 1PZ0A 1WXZA 1NDVA 4NP7A 2UY4A 3SEPA 1A5UA 3W6YA 3OTRA 4C6MA 1TZ9A 3BOFA 3KOYA 3A64A 2EHHA 3EWXA 3EX1A 3LPGA 4PTNA 6XIAA 3PPGA 4X0NA 4DWSC 5JBEA 1KKOA 1TA3A 4PMVA 4RX0A 1FFQA 1Q65A 4INFA 2TYSA 4ZO7A 3U57A 1PX8A 3S1UA 5DO8A 1ZBKA 3E0WA 1OT2A 4KF1A 3E12A 3F4DA 2PLMA 1EHAA 4XG1A 3RGTA 2NUWA 2G8ZA 3BMWA 1RCXB 4JYDA 3TH6A 1MZHA 4DXKA 4EPKA 2QCLA 3OVQA 4NRSA 2BGSA 2MANA 3ZM8A 1UJPA 4MY9A 5LA0A 1Y65A 2VUNA 2H3DA 1LT8A 1VGAA 2QJIA 5EMKA 2ZXBA 4GQRA 1SVDA 3NO3A 2DJLA 3VILA 2J9YA 2D73A 2NVAA 4IUGA 1LYXA 3TUUA 2I14A 4US5D 4L9ZA 5AHFA 2QAPA 2Z4GA 5C2XA 2WK2A 1ITCA 1ZHAA 3RJXA 3SRKA 4DBSA 2FH6A 5CZSA 4HPHA 4QDPA 3PG9A 3LQLA 4J3TA 4DUWA 4LUSA 1NP2A 3LHUA 4RV3A 1D7KA 1TV4A 4C6FA 4JTQA 4NNBA 3WL0A 2BBFA 1SJCA 1K9FA 1P48A 3E2RA 4M8UA 2Z00A 3KBMA 3N04A 4IPLA 4DUXA 3PSVA 1WKEA 3RO6A 1CLVA 3Q4DA 4AX7A 4F4RA 2VTFA 3GAKA 3BARA 3Q45A 3P67A 5A8GA 3BOLA 1R8LA 1XR2A 1VJIA 4L9XA 3N73A 3W7JA 4M56A 3R79A 5A8QA 2YSWA 1P6CA 3Q2DA 3NAVA 3G1DA 4L80A 3UG4A 1EP3A 1GOKA 1KRBC 3JZUA 3ZMRA 1ZS2A 1R3YA 2CZFA 2JALA 2QUTA 3A4WA 4BI5A 3BLLA 3CO4A 1UD3A 2C15A 2DT3A 1GONA 1R3QA 1KR1A 3MSGA 3NGFA 1WBHA 1TPDA 1UWRA 3BCFA 3GXMA 5C55A 3W27A 2ZZ3A 3MUY1 5AY7A 3LXCA 1E70M 1I1XA 2VZVA 2HZGA 4DBEA 3M41A 2TODA 3N2CA 2C1IA 4NF7A 1FVPA 1OSEA 1M9HA 3HFTA 5HQMA 2V82A 1RHCA 2IPFA 1LORA 2W92A 4POCA 1B3VA 1QWKA 1OD8A 1TWSA 9XIAA 5K2ZA 2W27A 2G41A 3I10A 1UMLA 2PTDA 2D20A 1S3HA 1A3HA 2CWNA 4I6KA 2YBVA 1SMDA 3LB0A 3FSTA 2A3EA 4FOJA 2CBVA 4DO6A 2GPTA 8RUCA 1EJWC 4B3LA 2Z2UA 4UOZA 3R2GA 5AECA 5HBFA 2ZRYA 4W87A 3TTYA 4JQ1A 3P62A 1UZ4A 2NLIA 3WK2A 4R27A 2KAUC 1ENUA 1NOFA 1ZBWA 2R1LA 3FNDA 4NZCA 1CLKA 2R8WA 1LCOA 1MEWA 2G97A 4EE9A 4O18A 1SUXA 3IARA 5G1TA 3AXXA 2C16A 4U3CA 3RX4A 5E0KA 3TX9A 2WVSA 4ZQMA 3EWBX 2OWXA 2H8ZA 2FHFA 2YPIA 2VEKA 2INZA 3PBUA 3RPMA 2WMKA 1VPQA 4PL2A 4QHRA 3CNYA 2X0SA 4QBXA 1C3FA 3CQ0A 3WQ5A 1XH0A 4V28A 4U28A 5C0QA 1C92A 4GD0A 4TXEA 2GJXA 4B9YA 2C19A 2ZRVA 5JBFA 1TX2A 3WNLA 3K8LA 1JI1A 3PWAA 2ATSA 1K8YA 2Y89A 1OM0A 4DVOA 3T44A 3EXRA 1E6RA 2WC4A 4I7WA 2VEPA 4JL1A 1KGUA 3K1DA 1XLAA 2QAFA 4KFNA 4MNKA 2WW5A 4X0VA 1PTDA 1YMYA 3ITLA 2Z1WA 3NOYA 3EA2A 3VOIA 4QNWA 3UWWA 1US0A 2DZUA 1RCOB 4O0KA 1EJVC 2PRMA 4AF0B 2BOEX 3ES7A 3WLLA 3WQFA 1KCXA 4QE1A 1D2KA 2CLMA 2JKPA 1UWSA 4XWUA 3D3FA 4PTWA 3IIOA 4L1GA 2CZVA 3SGZA 1A0EA 3FIGA 1FKXA 1PAMA 2EKCA 3W7GA 3C4UA 5EKYA 4D6FA 3KBSA 2NXIA 2HBVA 1ZTVA 4WIWA 2XPKA 3W1RA 1VFHA 5F4SA 3Q94A 2C91A 1SW3A 1M7PA 4H1ZA 3NIYA 4FLSA 4QNEA 3LU2A 6REQB 2I17A 3GC4A 5EMJA 3H2CA 4Q3MA 4IXHA 4D8ZA 4S2BA 2DQWA 4EPEC 2DW6A 1PO9A 5CJ5A 2Z6JA 1DWFM 4H9YA 4AC7C 5KSWA 4BQ2A 3VOHA 5FA5A 5ABHA 2DQXA 2R1MA 4HP5A 5DMYA 2A85A 3O6YX 5BROA 2GQ9A 2OX4A 4WXZA 4ZXOA 1MXDA 2WANA 2DSUA 5A6BA 4LF2A 3VIHA 2A5HA 3B8DA 4LB3A 3U7VA 2PDKA 4EXBA 1D3GA 4P5UA 3ZVIA 2WC3A 2D24A 1DQWA 4GVIA 4Z1BA 3IVSA 3JVAA 3NZGA 3W4RA 2ZX5A 2BX7A 3AWNA 4GX9A 2DT0A 5DN1A 3GDTA 2WZHA 4XZHA 3TA6A 1OCNA 3KFTA 2PWFA 1KNWA 1SZGA 1J01A 3V3WA 4IQLA 1E0TA 1SSGA 3UCQA 4EXQA 1ESWA 5C9XA 3UCCA 3NZ1A 1X6LA 9RUBA 4KIRA 4CU8A 5LXXA 4DHGA 7REQB 4A3HA 1XISA 4DM1A 2IKJA 2YDRA 5EL1A 1JEZA 1K03A 1Q7ZA 2VWTA 4ES4A 3CAVA 1JYXA 1RP8A 2HVMA 2PTWA 2UY2A 3UZWA 2X2YA 4BK9A 2WJFA 2ZC1A 5DCBA 4ZR8A 1ZBCA 4ZOCA 3SQSA 3W1MA 3UPBA 3ABRA 2R91A 3WUGA 5B7ZA 3RLGA 3JS3A 4N9EA 3WFZA 5FJUA 1KXTA 4CD8A 2ABAA 2QDGA 4DI9A 3ZJKA 4ACZB 3OU8A 4JAWA 4E6MA 3KWSA 2WJZA 3O16A 2NQJA 3NVTA 3RLVA 1TPH1 2NW0A 3QV9A 3I3BA 4FR6A 3BQ5A 4X60A 3FYPA 3AS0A 4MYXA 1W6TA 4W85A 3MI3A 3SBFA 1JYWA 3WK3A 3T0CA 1OQFA 1WB0A 4DELA 1BHGA 3KE0A 2PDCA 1REQB 4CQDA 2WZIA 1A3WA 3FEMA 4XZLX 4WX2A 1J5SA 1EDGA 2XVPA 1V51A 3GX9A 1EUNA 4JFTA 3LOTA 4H00A 2WWDA 2UY5A 4PB3A 3WX7A 1TREA 5K9DA 1F76A 1V3KA 1AQ0A 3AIRA 4Y6GA 1MUCA 7ODCA 1R2RA 1RALA 3DENA 4M6VA 3B4UA 4UMBA 2IW0A 1NVMA 4W84A 4Z2KA 3P84A 4LEQA 4JR5A 4HA4A 3VOJA 1FCUA 4S3BA 1GORA 3T55A 4AUBA 4PMDA 5DY3A 2HMCA 3W1QA 5CZKA 5HQEA 1J6PA 1CXHA 4A3QA 1DKWA 4BS0A 3FLUA 3BV7A 4F0SA 2X16A 1DV7A 1B30A 3SCOA 4KPLA 3BANA 5HK4A 4S3CA 1UR4A 1Q6FA 4TX6A 2PGFA 4MVAA 1XM3A 5HNTA 4PFMA 4UR7A 2QDEA 3PNUA 5CC3A 1PIIA 3VX0A 4WJ8A 2XSAA 3CHFA 3R4IA 2YB1A 4B91A 5CBJA 1JVNA 2IXUA 4ATWA 3LCFA 4NG3A 5DCEA 2V67A 5BU6A 2CFFA 4C7FA 4NL1A 1L6GA 2BGNE 1V6WA 2QMJA 1XLGA 1X1ZA 2X1IA 1GVQA 5CLWA 3NOEA 1W1YA 3PUDA 2P53A 3BO9A 3UGRA 4IISA 3WNPA 3BJTA 4FOUA 2VCCA 3LCGA 1XYCA 3CASA 3TQKA 2ATMA 4E2BA 1OC5A 1TSIA 3N6HA 1M68A 2G96A 3CV6A 1O60A 3M6YA 4Q4KA 4PTDA 3N4AA 5LIKX 3NZQA 4LVBA 2VR2A 1ITUA 3N9SA 3T9PA 1XLJA 3TWBA 2PLJA 1W5OA 1Q2SA 4Y9PA 4B3KA 1V3LA 3DG3A 2OT1A 1K6AA 2YL8A 3M1ZA 1ODZA 3T09A 4NJJA 3OGVA 5HAOA 2IS7A 5CJNA 4IIEA 4UQCA 4CD4A 1NF7A 1DJIA 2OQHA 3VM5A 4OIFA 3W37A 4RJEA 5I3HA 3AZRA 3MUAA 2YCKX 2A7RA 1MRAA 2WO5A 3NM1A 4WD0A 2QCFA 1P43A 1A5MC 2XH4A 4XO7A 1KGWA 1VEPA 3H70A 5CZTA 4KT2A 4QX4A 1W31A 2XGBA 2EGZA 4A3RA 3EEGA 5MKGA 4YXGA 4L4PA 3I4EA 3CL7A 1NARA 1FH7A 4L5ZA 4Q7BA 3ELFA 3WNKA 3H2MA 4W93A 3LD5A 1SR0A 3AOFA 4XZNX 3MVIA 3W71A 6CGTA 4OHQA 1QBAA 4IMAA 3BQ6A 4G1KA 4H19A 1FWHC 3GDBA 1C8VA 2Z2AA 2PCEA 3RX3A 4UTFA 1YLVA 4OJYA 3C3UA 1AUSL 4DO7A 3T0AA 3CEPA 1KM1A 3ORWA 4B5XA 3T2OA 2YYTA 2VHLA 2I5QA 4Y2WA 5XIAA 1V0KA 4MIMA 1PHWA 4AZIA 3L2IA 5AOUA 4NASA 2D2JA 4BEQA 3OYZA 4XSMA 3IJDA 2GDVA 4MY8A 4FS9A 2BHZA 3WBAA 2J77A 3C0QA 1GW1A 3T8QA 1H1YA 2GWNA 3LMYA 3WLOA 1WQ5A 2GUBA 2P8BA 1Q6QA 4I5RA 4HNLA 1UOZA 4KIEA 1JCJA 4JTCA 4XD6A 5JQ9A 1EOMA 1LQAA 3G18A 2QEZA 1XUUA 4MG4A 2OXNA 1NWTA 3CO8A 4GK8A 3M4HA 2WNQA 3VZXA 2YXOA 3EGJA 2AAAA 3IEBA 3BPWA 5A6TC 3URBA 2C3ZA 2Z6IA 2EPNA 1IT7A 2VURA 1XFCA 3QKEA 3S2MA 3CC1A 1I1WA 1UR3M 4MKSA 4AXNA 1EGVA 1N8IA 4Q8VA 1M1BA 4JNYA 4UFLA 2X05A 4RZBA 3A4AA 4PMYA 2J62A 2Y7FA 3GW0A 5BXRA 1VJZA 3O63A 4AZCB 3ERPA 2F8QA 4H4IA 3VKJA 2WCGA 4KGJA 2H9AA 5C71A 3BZGA 1LBMA 4D6JA 1F5ZA 3VKKA 3HV9A 1GUVA 1E5NA 1QMLA 1IEIA 2BVDA 1Q6EA 4ZSUA 2RFGA 4PE8A 2HTMA 3VUPA 3GVGA 5AYYA 2OGJA 2OU4A 4UTJA 2R14A 4WZHA 2ISDA 3AIEA 5BXSA 1Z6KA 3GXFA 1QATA 3MQTA 1GVSA 3L7RA 3HPZA 1R38A 4I8DA 4JQ3A 3FYOA 4OWGA 5DEZA 4FB7A 2DEPA 3AMCA 4DLFA 1J8VA 3HN3A 3QYQA 4JBRA 4XBKA 4FR1A 3TLQA 1TG7A 4V2XA 1US3A 4WJEA 4K7VA 3CTTA 5CKSA 4EXAA 4L9YA 4JQ2A 3QQ0A 1MQRA 3CEUA 3UNTA 3NPVA 1CGXA 3EB3A 3O0KA 2FHBA 3OIHA 5I23A 4C6QA 2PZ0A 4ZQOA 4FALA 3IUHA 2NQLA 3TE9A 1A47A 4N9BA 3VOGA 1R85A 1BG4A 3KM8A 4RPPA 3BICA 3BK0A 3BCDA 4RZ6A 7A3HA 2GVJA 1FQ0A 4JTRA 1B90A 3LN3A 4B5NA 1Z32X 1AD1A 4JTSA 3WNMA 3WEMA 4Q8MA 1Z42A 2Q09A 4L65A 1VEOA 4UTHA 2XDFA 5BWAA 1VFOA 4ROPA 3EOSA 4GWEA 4E4FA 4E8GA 1XIFA 3W1UA 2PLCA 2ZZ6A 1DQUA 2Z28A 3LXBA 4MDOA 1JZ4A 5AC6A 3CAKA 3VKCA 2ZQ0A 4H6QA 4S3EA 4HNTA 1T6MA 2VT0A 5IFPA 2VP8A 1QNQA 2ZWZA 2JKEA 1VKFA 2ABBA 4DO4A 2HVOA 4DZ5A 1A0DA 4Y9NA 5HJYA 1PX3A 4GYKA 3UA3A 1LUCB 4UR9A 3G0XA 4H8UA 3UWVA 2FGBA 3CHDA 3W2JA 1HJUA 2PWEA 1S1PA 2Z25A 3SN1A 3J7HA 3L4YA 4A8NA 1K77A 4PN2A 5BNKA 5DBUA 3HURA 5D04C 4UTIA 2EO7A 1GG1A 3O0FA 4L6HA 4GQBA 2W62A 1T40A 3O1NA 1XHGA 4US6A 4BQ5A 4US5A 1FHLA 5AZ1A 3SCWA 1DJYA 5BWFA 2YR1A 1UPPA 1FY6A 3KOFA 1ICQA 1KM4A 5HR7A 2A4AA 3GXPA 4D6EA 5E6YA 4CQCA 4IP4A 4MADA 3SURA 2DFAA 1KB3A 1QK2A 4JIRA 3WQGA 4R7JA 5GNZA 4HN4A 5LZLA 3P81A 2V69A 4O1BA 2VGBA 2GQAA 4BFAA 4N4PA 2VFIA 3BLDA 1BYCA 4S3AA 4LBSA 4RE3A 3FA3A 5H8MA 3S8HA 4LY4A 2R1KA 3R0KA 1O66A 3P80A 3APTA 3OBAA 2VOTA 2OEKA 3EKZA 3H24A 3PTQA 1MW3A 2OR2A 3BLOA 1K9EA 2P76A 1CXKA 3B9AA 3NYDA 4LYPA 2TAAA 3SCNA 1XH1A 2O7SA 2Z26A 3TXZA 2CW6A 4KESA 4D71A 4ZCWA 2VWSA 2FMNA 3S42A 3D47A 2GOUA 4O50A 3L5LA 1FXPA 3MMDA 1P0KA 3TCSA 3DZ1A 4XIAA 4H9ZA 3P74A 3ICJA 5CBIA 5HMFA 1HVQA 1D9EA 4GZIA 3WLTA 1PZ1A 2ONEA 5LNUA 5FI8A 3IIVA 5AHIA 3IK2A 4O11A 5K7JA 2WWCA 4YCOA 2VX6A 1VIZA 1E6SM 3V4BA 1I2NA 3W2UA 4J35A 3CTLA 1W5QA 2A0NA 2FFCA 4C5ZA 4M24A 3AHZA 3O6CA 5EBAA 5CG0A 1JDCA 3GO2A 4I9AA 3MTWA 2E6YA 1F73A 4JICA 3PZ9A 3T07A 5I07A 4IG2B 2QPUA 4Y8FA 3CV2A 4AD4A 4O54A 3KRZA 2D2GA 3GFYA 2C18A 1JYNA 2V5CA 3WN6A 1H4PA 2I9EA 1BAGA 5TNVA 1SGJA 1XLKA 1DORA 3VGFA 1XBZA 1FX6A 3W87A 3EA3A 5EB8A 1W3JA 4N9CA 1QHPA 1RA5A 2PBOA 1WAWA 4GI9A 1AMYA 3AXKA 4L1XA 2BGQA 2ADAA 3K13A 3OO2A 5BRBA 1KRAC 1XDLA 4AVOA 4WOQA 5FEZA 3ATYA 3OHIA 2VCBA 4FXJA 1UHVA 3N11A 1EIBA 5CC5A 3II1A 3U9IA 1EP1A 4PUJA 3BW4A 5DFAA 1G6CA 3FKKA 2V30A 4XB3A 3WBWA 1EPXA 2UV8G 1H50A 1V5XA 2J13A 2X40A 5LNWA 1AL7A 2PS2A 1SYTA 1OF6A 3MO4A 2CBUA 4CCCA 5CCZA 1BVZA 1SW0A 3T42A 5CPTA 1EKOA 4NZ1A 4IIGA 3VA8A 2OWWA 2BY0A 3SCVA 5HPOA 3S2NA 6ALDA 4AMAA 5H91A 2IPJA 2OSXA 3M0JA 3GTNA 2D69A 1JI2A 1P7TB 1Z8AA 4DBWA 3CT7A 1QI4A 3QJAA 4JKKA 2REQA 3G1YA 1J5TA 1LOQA 3DFSA 1LLWA 3CM4A 3W1NA 2GJRA 2XWDA 2D0GA 1OX5A 3ISIX 4Y96A 1TFVA 3W2LA 1TIWA 3PZGA 4DZAA 1RA0A 3THUA 2PWHA 3QR0A 3TQPA 1SFJA 4NIRA 3CV1A 5IBXA 3IIZA 3FAXA 2ZXDA 3DU0A 3W76A 2E68A 3VE7A 5CPMA 3IGSA 3T0BA 4XZ9A 4YTRA 3K4AA 3PZIA 3WDJA 1ELSA 4MJZA 5HA7A 2R1PA 4GXWA 1R7OA 4AD0A 2W6RA 3PJUA 3HQ1A 3B04A 4A21A 4GINA 3PFMA 3OLEA 3A22A 4KW2A 3BL3A 5A8OA 2X0HA 5DANA 2DORA 4EAYA 3F2CA 3R8HA 3RAOA 3TJXA 2HQAA 5EFDA 4A3YA 3ZOAA 2G3NA 4CLMA 2VZSA 2DH3A 3L9CA 4J3SA 4RE2A 2QUMA 4HPNA 3M0ZA 4M7SA 1ZY9A 1UUMA 1H7XA 1MI3A 4B9ZA 1TV2A 3EWYA 2PD5A 1E0XA 1SM9A 3T1GA 1I2QA 3R94A 3EX3A 1NSJA 1EQPA 4ZMGA 2WCAA 2VELA 2PE4A 3LG3A 1VZWA 3E2VA 2Z0IA 4QSFA 3ZR5A 4RK8A 4O13A 3LV5A 2G3IA 1FWAC 4PMZA 1C9WA 5AYBA 3V0UA 5G4EA 3BGAA 2PC8A 4FXRA 1UOKA 2OGYA 3N2XA 1ZJBA 5FOOA 4ZSTA 3PK7A 4JTTA 5CQ1A 3CQHA 2BHYA 4FHAA 1EIXA 4EACA 1H7WA 4DRSA 2WVTA 4ZFCA 4ONVA 4GXMA 5F1UA 1POKA 4XVEA 3DFHA 3PUOA 1GK8A 1FA2A 2V38A 3GHSA 4OOZA 4EWJA 3CYJA 2XH7A 1JF5A 2YFNA 4LAMA 2ISFA 4PMRA 3SSZA 4GIEA 1CGVA 2CETA 1SO3A 5JH1A 3QPEA 4RNHA 5LHEA 1TV3A 2BOGX 4CD5A 1UP2A 3OZYA 1HTIA 2NWRA 2QV5A 2EPKX 1BXNA 1BTCA 3VAVA 2XFFA 3CQIA 3AYRA 4CN4A 4GYPA 2BXVA 3HPFA 1FWRA 3W7QA 1I75A 3HJEA 1AH0A 4DO5A 2ZWYA 1PWMA 1XBYA 2P1FA 3UG8A 1JDAA 4LEFA 4UNLA 4NJHA 3TVAA 5FJOA 2WVVA 4H8HA 3IJQA 3P8JA 1LT7A 5DY2A 2XVNA 5EGRA 1GHSA 1KM0A 1NFBA 1E9ZB 2OEJA 1QWGA 3V5OA 3W7MA 3TN4A 1Q45A 5IDZA 4FPSA 2FJKA 1G5AA 1GWJA 5I02A 3N2OA 3TN3A 4MF4A 4NI3A 2O7QA 2Y8UA 3BMXA 3LHZA 4JL2A 1W1ZA 4MNLA 1X96A 2ZZ7A 4QEEA 3VYLA 5I00A 1WOBA 2V3EA 3KP1A 3MI6A 2PTZA 4MAVA 1JIBA 3NPUA 1XYBA 4W88A 4QXIA 3W25A 5LHFA 1OVDA 1EJXC 4RZ5A 1EJRC 1TVNA 1ISZA 4RDVA 4LALA 2EG7A 3BAYA 2Q71A 3CQKA 1F7BA 4O57A 1OADA 2YX0A 1E1FA 1T96A 4TUFA 1UZDA 4JN6A 5F2GA 4TOQA 4U33A 3KVJA 1NOWA 2PU0A 2OKOA 2XG9A 4H41A 5A2CA 5M3WA 4HOZA 1T41A 4UTWA 3QHMA 4NAFA 3V35A 4JCMA 3SQMA 2VRKA 3LY0A 4ZL1A 3W1LA 4IFRA 4PCNA 3SIZA 3UR8A 4DXVA 3BH4A 4HNVA 4MWAA 2XFWA 1YPFA 4EANA 4ICMA 4NILA 3U2CA 5D03A 2GSHA 2OODA 4JPGA 5E1QA 3I6RA 2PDHA 2WPBA 2R82A 2DZXA 2FZ8A 1GQJA 1IT8A 1TZZA 1E56A 3UW6A 2HPMA 1ISYA 2I7GA 4JFUA 1BF2A 3G3DA 4JIQA 4FXSA 1K7EA 5HATA 4P8XA 3E5BA 4O19A 3WQCA 1XICA 1MNSA 1A5BA 1HIZA 3TR9A 2ZFAA 4A8IA 5D9NA 1TRIA 1UKSA 1RD5A 3TZFA 5A1AA 3CHVA 4IMCA 1B9BA 2A2IA 2QR6A 1LJYA 4GVGA 3GNOA 3BSHA 2PBGA 2HROA 4PFHA 5AC5A 4XBSA 4P7LA 2QCHA 2XHYA 2BLEA 2CERA 1KFLA 1Q6CA 1LL6A 2QV4A 1QHOA 1TQJA 3COTA 2CC0A 4HCHA 1XLMA 3BLEA 2VDHA 3PY2A 3JRKA 4J3UA 4IM4A 1GZJA 2QUVA 3U8GA 4S23A 1DWHM 1AW5A 1DYSA 3FJLA 5EMMA 1QO2A 3UZJA 3GVVA 2VFGA 1GJWA 2PODA 2W4XA 4CQ8A 3AU2A 1FH9A 2V9DA 1F4AA 2GSJA 4JDBA 4J5NA 4EP8C 3HBLA 5D9MA 4C6DA 3N12A 4E4UA 1PYMA 1NDWA 3P5YA 5AKQA 5C54A 1P7TA 3WK1A 1U1JA 3DBNA 1W2PA 3AAMA 3QHOA 4MKNA 2VYOA 4JIPA 3PFRA 1Q13A 4WUIA 3OW1A 4LAKA 1H7RA 2FHCA 3S1XA 3GSMA 2DJXA 3BC9A 3K2GA 4RE0A 3W7HA 1AA1B 4PBGA 3KUMA 5TF0A 5FEXA 1O5KA 2OT0A 1UWQA 3MYPA 1K70A 3M0MA 3I3EA 1UH4A 1HL9A 1ZJIA 4P8WA 3PBYA 3RN6A 1H5VA 3ANVA 1V7YA 2UWFA 2A6NA 5KZ6A 3VDHA 4YHGA 4B2DA 2VI0A 2VCAA 4BCEA 5I24A 3RX2A 3M6DA 1RZMA 2VVSA 4HN8A 1BD0A 3LEPA 2FGZA 4GO9A 4HKPA 4XTDA 2Q8ZA 3JU2A 1LL4A 2J78A 3GVRA 3KZSA 5LXEA 1E71M 1OZQA 3IANA 1KLYA 1T7LA 3C56A 5CGMA 3WLKX 3V0TA 2RDTA 4DUVA 3WF4A 1CYGA 4URIA 1DP0A 3S46A 3N15A 1V6UA 3DIPA 1MWOA 4GGHA 3BLKA 2FJUB 5A8NA 2JFEX 1I2RA 1WBJA 2CBJA 1SJBA 1MYRA 4TVCA 3VO0A 3ZT5A 1BYDA 3GUGA 4DJDA 1GZ1A 5D09A 1FCBA 4AAJA 2DSZA 4LH8A 4O0ZA 3FHQA 3LCHA 3VD5A 3N14A 4M7TA 3FOKA 3GIPA 2AOSA 2YCEA 4AYSA 1HKVA 4GJ1A 1JGIA 3TQ0A 4UCGA 3UY8A 1W8SA 3NM3A 2IKHA 4O12A 2A21A 1LTDA 4AIEA 2CEQA 3YPIA 4H9UA 1YX1A 2Z1KA 3MDUA 1JZ8A 3GHTA 4AY8A 1AZ1A 4JFVA 1DE5A 3B06A 3TFXA 4LWWA 4HTYA 3KCLA 4Q4PA 1YE4A 2H6RA 3W7LA 1IWAA 3GNNA 1JRBA 2GK1A 4AW7A 1O7AA 1OFAA 4TX9A 1QPKA 2J9XA 1CW2A 3B4YA 1VFUA 1J0KA 5G2HA 3TJ4A 2V5LA 1OIFA 4YIWA 3H2NA 4CCZA 2WNNA 2VD9A 4B90A 1KC7A 1CNVA 2E8ZA 4O14A 3TTOA 2WHLA 4EIVA 3QR3A 3TV8A 5FJPA 4YVXA 3VCCA 2DSKA 1RJRA 4ILSA 1SZNA 5GPRA 3W29A 3UU0A 1XIIA 1XCWA 1CB2A 3QZ6A 2EQDA 3MBDA 4HU3A 3RPTA 4AH7A 4BKNA 2NUYA 1NFPA 2DVXA 1Q8JA 2WKGA 5AHNA 2VC5A 1XLHA 4HBKA 1HJQA 3WDPP 4U4MA 3QZEA 1OD0A 3SCTA 1DWAM 1KTNA 2PDBA 1KM2A 4GI6A 2Y8VA 1DBTA 3I68A 2QYGA 1J0IA 3E1F1 4HJWA 2DUXA 5HDRA 1QU4A 1FH8A 2IKGA 4ORIA 3S2CA 4IL2A 3E96A 4LAUA 2QNEA 4RNIA 2BXYA 3WLQA 2HV5A 4ZBCA 2GDUA 3AIVA 2OELA 4IT1A 3GZ3A 3W7DA 3RU6A 3B8IA 1MXSA 3G24A 6TAAA 1DWIM 3GR7A 4XK2A 1NY1A 3PAOA 3RUBL 4UQAA 3NQCA 2ACQA 2Y63A 7TAAA 4C6IA 3QF0A 4H9TA 4PA8A 3TYZA 2PZNA 4Y8EA 1PTAA 1E4LA 3ONCA 3BV4A 2WHKA 1K1DA 1UD8A 2XVLA 3PSWA 1AW2A 3KL5A 5CC7A 1G7VA 3OHMB 5ABFA 1Y7VA 2EXOA 5BW6A 4XKMA 3LLFA 3ZWSA 3WLRA 1EA0A 3M0XA 8XIAA 3WFLA 2YW4A 1UJQA 2QJJA 3C2EA 2ZX9A 5HNNA 3TMQA 4MOZA 4EPBC 4H6RA 1FP8A 3AJXA 2XUCA 1V3HA 3S3GA 3BMVA 1TV8A 3BAJA 3F1QA 4IX2A 2GFTA 1MDLA 1TV7A 3QGAC 1HKWA 3WBYA 4DAIA 2E6FA 1QCWA 4KEVA 1PKYA 1E51A 2FVMA 4HNOA 4IGHA 4JS3A 5HWMA 2INEA 5AYIA 1EOKA 4L6DA 1OCQA 4GNJA 1W3KA 1Q6DA 3LCXA 1G4TA 4R7WA 3MHGA 3S1VA 4GVHA 3URQA 2XISA 3IJ9A 2BG5A 4IGNA 4L64A 3WK0A 3WJZA 4ZA0A 1AJ2A 1K02A 2NVCA 3G1VA 2XWEA 2ZVIA 3KW3A 1E55A 2HCVA 1W5PA 4FAMA 3PBGA 5AYZA 3KTSA 3QC3A 3W82A 1YW1A 5G2WA 3GDKA 1W37A 2WSKA 4RNFA 1G4SA 2AL2A 2DSWA 3WD2A 3RR4A 4U2ZA 4H3DA 5B80A 5DMMA 1JCNA 2ON3A 1QAPA 5CAHA 1U5VA 1EB3A 4ZGYA 3GB6A 5K9CA 2G0WA 1SZEA 5I6SA 2W63A 1IXNA 3OVPA 4UQ9A 2WZMA 1TMQA 4BF5A 2FTYA 1BGAA 1GTHA 3WF1A 4M81A 3PJTA 1R3VA 4AYGA 2Y24A 2G3JA 5IDIA 4V33A 2B31A 1X8CA 3OVGA 3N2TA 1S2WA 4OQVA 1H1ZA 4AZ5A 4GQQA 5HWJA 5ABEA 3KVMA 3VK5A 1P1MA 1BLIA 3Q67A 1HO1A 4GZJA 2QMKA 3VIMA 5C7HA 2PD9A 3PJWA 3EPOA 4HOWA 4ERAA 5A6MA 3ARWA 2IQDA 4JDYA 3WQVA 3URNA 3W2MA 4MUPA 1QOPA 3CIXA 5M03A 2AGTA 1A5AA 1CI1A 3VUSA 3R8RA 3F5KA 3WEZA 3L4XA 3WF2A 2XSBA 1CGTA 1UC5A 3GBDA 4R88A 2VOMA 2VQTA 2Y2WA 2Y62A 2WMFA 3IIXA 4DY1A 1QXLA 4YYFA 4K7YA 3N34A 2XINA 1XIMA 4OECA 2E9MA 1TPB1 4ADUA 3DFQA 4DJED 5I09A 2VGIA 3NQGA 3F4NA 1PSCA 3IJ7A 2P88A 3WEOA 4N02A 2VX4A 2ICSA 2ZE3A 3TIMA 2GDQA 1GVIA 2PRHA 3CU2A 3EX4A 1HN1A 3NXFA 5AN7A 3HPSA 2QUNA 4GIAA 3STCA 3M9YA 4J28A 4HHLA 5LIUX 3C0LA 2CZEA 2FTPA 2JE8A 3IJ8A 4HQVA 1BQCA 4S3JA 1SU5A 1F6PA 2Y61A 3G1SA 3DKLA 1IR2A 2EPMX 4DX3A 2QKFA 1EGZA 1XQLA 4QS6A 1DIOA 1N55A 4F8XA 2NWSA 3WUFA 2QDDA 3B8SA 4R9OA 2WMHA 4CNNA 3S5OA 4BJHA 3RO8A 4QJ3B 1UH3A 1TWDA 2VUYA 4FF7A 1J79A 3SW6A 1R6WA 2VC6A 3VGBA 5F4XA 4EVZA 4KWVA 4HYVA 3D46A 2NQ9A 4JKMA 2FGLA 3M0YA 4PMOA 2VQUA 4CQAA 1GOQA 1ME8A 4AIOA 5HWNA 4DJEA 3MDWA 1QDSA 3WQWA 2LLEA 2DIJA 4GYFA 1IYXA 4V15A 5DQPA 1PDYA 4IQJA 3L5AA 3IK4A 1UASA 3TYUA 1JXJA 3FA4A 1J11A 2D2OA 4K8GA 2WHMA 3A4JA 1OG6A 1BPLB 3HQNA 4HB7A 2YBTA 5HQLA 1ZJHA 3NG3A 5K3VA 1ZENA 5A6JA 3A9IA 4QQ3A 3UG3A 8TIMA 2CZDA 4M6QA 1RXOB 3IAPA 2TPSA 4LAOA 1QPNA 5FACA 1VCFA 2QJGA 3QN3A 2QLYA 3W38A 1Q8AA 3B97A 3C2OA 4Z0JA 4M1BA 2X42A 3WH7A 2HNHA 2PP0A 1LDCA 3QRHA 4MM1A 1QNRA 1NFGA 3CPGA 3LCWA 4JYEA 1DJHA 3O15A 1YPXA 3PC0A 2ZBTA 2YA2A 3UR7A 2GJPA 4H83A 1RLDA 1TJ0A 5SWUA 4LVFA 3WQOA 1SPQA 4C1NA 2CZ5A 1WE5A 4FNUA 1G0CA 4J3WA 3GFZA 1JR1A 4CVWA 4JTHA 4OGZA 1GT8A 2XSXA 1VFFA 5TBOA 5TIMA 1VR6A 3PZMA 1DXFA 4X63A 1XIDA 3UPMA 5LNVA 1HF6A 1ZU8A 1XPGA 4K37A 1US2A 2EPLX 1JCTA 2V0TA 3W3OA 3UXKA 3C5QA 3LSCA 3E02A 3P6LA 2VM8A 1T8XA 3BSGA 3UFYA 4LUJA 1GVOA 3MKKA 3O6AA 1FFRA 1ZALA 4PUUA 4ZE5A 1MQPA 1J18A 4H8NA 4CGTA 1I2OA 4LFYA 3TN6A 4Z2HA 1FHDA 1WP6A 1MUWA 4W8BA 3NSNA 1EJ7L 1OX6A 2C8NA 4JTDA 1EHNA 2FFIA 1TRDA 1GEHA 2AAMA 3CZJA 3HG5A 1TR1A 1J2BA 3VKDA 5J04A 3TWAA 3IACA 3P14A 1UA7A 3NFUA 2YL5A 5CSYA 2E9LA 1FDZA 3LHTA 3IGXA 2YZRA 2PCQA 2E1DA 2OB3A 2V8ZA 2J27A 1OGSA 4IXXA 5CXPA 3T8LA 5BXPA 3VDCA 3FK4A 1HZYA 1GVEA 3H4GA 4DJFA 1J9YA 2QQ6A 3LERA 3EX6A 5GJMA 1L6YA 4OT7A 3MBFA 4IGMA 1G4EA 2D2HA 4KCVA 1H1NA 4WY0A 3DECA 3DHUA 1S46A 3UD6A 2WV8A 4K8HA 5DF0A 4XAYA 4HT3A 4ASTA 3HFYA 2DPEA 3CXOA 3R8GA 1NU5A 3VZZA 1JFHA 1XDMA 1BSIA 3QKZA 1H0IA 3FY1A 4HZ6A 3AI0A 5I3GA 1PCKA 4J3ZA 4HMNA 1TPEA 3JR2A 1ECQA 3SECA 3T0DA 1GJUA 5K4ZA 1K8XA 1W1A1 5I5RA 3GU2A 4Q4OA 2HVNA 2G4JA 3AWOA 2ZUTA 2V68A 2QCDB 1RY0A 4MJMA 4UBPC 3GRIA 2IKIA 5FF2A 1AQMA 4QE4A 3OBKA 3ARXA 2FPTA 4QAIA 4P7OA 1HJSA 2I9UA 1HGYA 4IHCA 4I5UA 1QI3A 5CGTA 1E6ZA 4F9DA 3KCJA 2ZXQA 5LA1A 3P7YA 3O8AA 1YDYA 3GDLA 2NX9A 4S2CA 7REQA 2BOFX 7TIMA 4HD5A 5HUOA 3C6CA 4MFDA 4PB5A 3TTQA 1FTXA 4O1DA 1P1XA 4HU0A 4AIUA 3UZXA 3THAA 2PUZA 3W1AA 3KHDA 1QTWA 3EXSA 1HNYA 3VD4A 4NNAA 4GC3A 4WSHA 1H41A 3BAIA 2W91A 3OVRA 1LBFA 2GVEA 2WLZA 3W00A 3WLMA 4BQ4A 4TQTA 2CXEA 4A8LA 1H60A 1W1B1 1OYAA 4I6VA 4CEUC 3UP8A 3QY6A 4FX8A 1RVGA 3EXTA 1OFOA 1BF6A 1R7AA 3WQDA 4M80A 3WQEA 4YNGA 2AL1A 4W4QA 2OJPA 3S0CA 4NUWA 5J5DA 1CT5A 2XIOA 1T99A 4PUEA 1DTNA 1F61A 1FWBC 3G22A 4QCEA 3MUZ1 2PDWA 1R2TA 1TJPA 4DAFA 2PDGA 3A5FA 2E40A 3FXGA 3FJNA 4IMGA 4XQ6A 1A5SA 1X39A 2WC7A 2NX3A 4IQDA 3W2NA 1FOBA 4GE8A 1ZAJA 1UYQA 3K8MA 3CL6A 1FBAA 4IUOA 1JD9A 1LUCA 1TWWA 4B5SA 5A6SA 3K8KA 3R10A 1JUBA 1RK5A 1L6SA 3BAKA 5TD4A 2OX1A 5A2AA 5REQA 4JQ4A 4YYCA 4XISA 2NQZA 5FESA 1DE6A 3LI1A 1E1CA 4PYSA 1MQQA 2NV2A 2XIMA 1W3HA 3TYAA 1FRBA 3WF3A 4ECLA 3ZZ1A 2DT2A 1SZFA 3RLHA 3G1FA 3P8IA 1LP6A 3WMSA 4PMUA 3RYSA 2EPOA 3SY1A 4F2UA 1QPOA 4KRUA 4WOZA 1JPDX 4KQNA 3EWCA 1NP0A 4FK9A 4JN8A 3QSRA 4QP0A 4NZ3A 1YIXA 2AQOA 1Q2RA 1VD6A 1B31A 1I4NA 1YNYA 3B0UX 2W9MA 2X30A 3PN8A 1P0BA 1YPIA 4W7VA 5D4YA 1S38A 3S5YA 4LU0A 3WH5A 1PZ2A 1TX0A 4C6LA 3WKZA 4B16A 1TO3A 1B1YA 3UXLA 4UB9A 4AX6A 2D22A 1T0OA 4JTGA 1XYZA 2GLKA 4JHZA 2PGEA 1QW9A 4DJDD 1F6KA 1EX1A 1KBKA 3ZSSA 7ENLA 4JEJA 1VFSA 4JTEA 4WJXA 3N18A 3SRDA 1EGMA 2GJNA 1JDDA 2O0TA 1EBHA 4ICCX 2Q02A 3PZQA 3EDFA 3R5EA 3VMPA 4IZGA 4JHOA 4HVXA 1ODUA 1FCQA 3U2EA 4Y9OA 4FX6M 1QNVA 3AMLA 4HNUA 4P7NA 2YLLA 1E4MM 4IIBA 3FVDA 4EAMA 2DW7A 2DZSA 1IR1A 4HK5A 2GGIA 2YDSA 1RCQA 2QS8A 3NL6A 4BF7A 3WLSA 4KBXA 4XV0A 5H1WA 1A80A 2OMAA 1ZNNA 3MI2A 2V2HA 4LUSB 2CLHA 3EB2A 4XZBA 2EKGA 4GRSA 1R87A 4FNTA 3RM4A 3R58A 4WLCA 4Z1CA 1XGZA 4HZMA 4MB4A 3JUGA 4N9DA 4KH2A 2E8YA 3KRSA 2ZTJA 2INFA 3REQA 1M6JA 2BTMA 1R5YA 3PTDA 1IIHA 3AMGA 3B9DA 3VD9A 4H9MA 3DC8A 2I57A 3IGUA 1AJ0A 4XIMA 1A49A 4P61A 4GUFA 4GABA 4P8VA 4KRZA 5FIPA 1V02A 2E09A 2DUAA 3N2MA 2X8RA 5EMLA 4QGCA 1XC6A 2WM1A 4XAFA 2BWGA 1TE1A 3CUHA 3KX6A 3ZR4A 3GTIA 5FJRA 8A3HA 1VC4A 3E74A 2OKTA 4XTIA 2V5DA 1UROA 1BYAA 3D3AA 4KWOA 2PTYA 4OUEA 3B9OA 1FCVA 2WJDA 4FIRA 1RPKA 1TB3A 1A0CA 2BMBA 4ZB5A 1EF2A 1IZJA 3P0WA 4MFEA 1IV8A 1IZKA 4DN1A 4G7FA 1E72M 4ZVJA 3V0SA 4F0LA 1RBOB 1U5JA 3GS6A 1U30A 1PB0A 3EOUA 3PPCA 4K36A 1VLWA 1JCYA 1SO6A 1E4NA 4KEZA 1NELA 1ISWA 2GSEA 3AHVA 4PZVA 1WA3A 3MMTA 4QSHA 1I6NA 1WXYA 3H2FA 3O2LA 3WH8A 4QQUA 4IJRA 1S1RA 3AMKA 3GK0A 1FWEC 1VS1A 3VIOA 1BG9A 3SGGA 4Q8WA 3RCMA 4Q8OA 3C8NA 1S2TA 3PJXA 2CXGA 1JF6A 1GPWA 3MYOA 4Y7EA 4R3UA 3VDAA 4E3TA 2PSNA 3VVGA 4TMBA 2BV9A 3QH2A 1C8QA 2FMOA 3BUVA 1Q4WA 3IRSA 1RQEA 3O3RA 1K7XA 1TJ1A 1K7FA 3HPAA 4F0RA 5D33A 1PPIA 5C6MA 3L4VA 2DZVA 4IOTA 3AS2A 1A4LA 4O1EA 1OFQA 2VD8A 3CZ8A 4FLRA 4F3HA 3APYA 5BXTA 1CXLA 4Q4QA 4AY1A 4AISA 1ZLPA 1XSIA 2QGHA 3STGA 2OOFA 1XV8A 5U4NA 3KZPA 4CNTA 1BGGA 2PA6A 1HL2A 2NT0A 2WAGA 1OK6A 4K1GA 4PRRA 3T05A 1TVPA 1V6VA 4P7QA 5E0FA 1TUFA 4NI8A 4O1CA 4W9TA 4WK9A 1WZKA 3RCYA 3G1RA 4DPQA 1KBBA 1ZQ5A 3ZR6A 4M3PA 3CZGA 3G0SA 3BVJA 4O0QA 1CCWB 4L6OA 5I06A 2FZDA 3QPYA 1HKIA 2GGEA 1KGXA 5E5CA 4MWAD 2Y7DA 1S2VA 4KMQA 1F9CA 4MZ1A 1LRNA 3KAOA 3HG4A 1NTHA 1QJWA 3CH9A 5H6HA 4RV8A 4RXGA 4KWUA 2CLLA 1X98A 5FEPA 3P93A 3LZ3A 4GUGA 3EMZA 3GBEA 3V18A 8XIMA 2DZAA 2E67A 3W7RA 2YOCA 5IXEA 3CWNA 3H7UA 5CH9A 3LCLA 4NXSA 4G1NA 5TAOA 5KEZA 2DT1A 2POZA 1VFLA 5F1VA 3ARTA 3IRDA 2BY2A 4D6IA 3NL3A 5HNRA 3AU6A 3LBCA 4LV4A 2OEMA 1H7OA 4PSPA 5B7YA 5LYRA 4LUIA 2A7PA 3F5JA 3VNDA 4PEEA 1HFBA 2Q3OA 1QW8A 1R46A 4D1IA 4HYWA 1Y5XA 1GJPA 1WOAA 4C1NB 1XSJA 3F4CA 1VQTA 1WO2A 5JIWA 1EDQA 4Q7NA 4ALDA 2HS6A 3UWUA 2WVVB 1EJUC 3L65A 2OTDA 2YIHA 1WKFA 1IXPA 1LRTA