2NLIA

Crystal structure of the complex between l-lactate oxidase and a substrate analogue at 1.59 angstrom resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
352
Chain Sequence
EYNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTNRDYPFGMPIVQRYLRGTAEGMYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title X-ray structures of Aerococcus viridans lactate oxidase and its complex with D-lactate at pH 4.5 show an alpha-hydroxyacid oxidation mechanism
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
total genus 127
structure length 352
sequence length 368
chains with identical sequence B
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2nliA00
3W7IA 1FWSA 3P8JA 3EEGA 4TIMA 1KTNA 4FO4A 2YYUA 4AWTA 3EX3A 3PAJA 3W2NA 4KWWA 1O5KA 2GJLA 4E38A 2QCFA 4DBEA 3OIXA 2EPHA 4PC8A 4JDBA 1ICSA 4AH7A 5KZMA 1TPFA 2FPVA 3LCFA 2NX9A 4Z08A 1DORA 4UTUA 3NQFA 3QW4B 1EX5A 5LHEA 3EXSA 1M7OA 1H7OA 2I9EA 5AC7A 4OV9A 3PBUA 3TKFA 4O17A 4KKXA 1M5WA 2Y6ZA 1P1XA 3P5YA 2OJPA 4PEKA 3W7CA 1TV5A 4DO6A 1TYGA 4H6KA 3ZR4A 2XN1A 2CLIA 3PBWA 2A0NA 2VC6A 2ZQ0A 5IM51 1RVGA 1JJKA 3KHJA 4UMAA 1F7BA 2B7QA 1SPQA 2G96A 2FB2A 3KXQA 3T7VA 3DI1A 3TA6A 3W7RA 3W7JA 1F74A 3CB8A 5KMYA 3FYOA 2BLEA 5I3HA 5CSRA 1W31A 4MZ1A 2Z0IA 3STCA 3MW7A 4Q33A 1BKSA 2B0MA 3DFNA 1OJXA 4DEFA 2V8ZA 3CM4A 3M5XA 5AHIA 4KFPA 2IQTA 3NM3A 3SSJA 3G0XA 1VYPX 3T55A 2Z6IA 3G1HA 5G1YA 4M7SA 4LW7A 3O6DA 3UWQA 1W5QA 1OX4A 3C2RA 3L21A 5CZSA 3STEA 1N7KA 2V2DA 5HWMA 3W87A 1C9DA 1OX4B 2H8ZA 3UWWA 2DJXA 3P8IA 3M43A 4A2RA 2CLKA 5AYXA 2V2CA 1I2QA 3DH7A 5BRBA 4UR8A 4PA8A 1K8YA 1QFEA 1EB3A 1NEYA 3QMSA 4LS0A 4GC4A 3M9YA 1VQTA 1QDSA 3IVTA 4RZ6A 4E2DA 2ZRVA 2BX7A 1D3HA 4N4QA 1DVJA 2ZZ5A 2VENA 4AMAA 4O50A 2VKZG 1IGSA 2VFEA 3GR7A 2A85A 3G1AA 2CLHA 1O60A 3FOKA 1OYAA 3NEVA 4GXMA 4HNUA 3RF9A 2WQPA 1WAUA 1FBAA 3UXAA 5A8GA 3QFEA 3LRLA 1FXPA 4C1KA 3RMJA 3R12A 4BFAA 4DPPA 3U2OA 2ZRUA 5D30A 3VKJA 1KM2A 3L5MA 1HO4A 2NUWA 3QPYA 3W83A 1XBYA 5D09A 2ISVA 5D05A 4PH6A 4FX6M 1BWKA 2E09A 4QITA 4FNUA 3NA8A 3S1WA 4FHAA 3V75A 5MHBA 5FF0A 1SR9A 4ORIA 4JYEA 4WQ6A 1K7EA 1KBJA 2WPBA 4ML9A 1GTHA 2QCHA 5KINA 4FNPA 1AW2A 2FDSA 2Q8LA 2JBMA 1I45A 3VE7A 2CLMA 3D0CA 3PULA 4N9EA 1AG1O 3S0CA 3GKAA 4MOZA 5J5DA 4UTJA 5AC6A 1FUYA 1QR7A 3L65A 3N34A 3LHUA 2NXIA 2QUVA 3DKJA 1KFLA 1LORA 4MY1A 2FPYA 1B9BA 3UY7A 3TFCA 2Y70A 4XQ6A 5AOUA 3BV4A 2ABBA 4PTNA 3C4UA 1ZCOA 1MEWA 1VHCA 4O8RA 3HIJA 4WXYA 1GG0A 2QUTA 3K30A 3UPWA 2QUUA 3S5ZA 3HGJA 1OF6A 1W5OA 1HL2A 3T4CA 1F6KA 1K3UA 2V30A 2ISSA 5DXYA 3CPRA 2Y89A 3LV6A 1EP1A 4N6FA 5FEWA 3WK3A 4DBDA 4MPQA 4QIUA 5HMSA 4Z0SA 2QR6A 3MWAA 3E12A 4UTIA 1QPQA 2H90A 5HULA 2NX3A 3IRDA 2F7FA 3I68A 3LHVA 1ZAHA 2UV8G 3W2JA 3A9IA 1H63A 4DF2A 1JCJA 4RKAA 1BWLA 4FX8A 3CC1A 2QAFA 3WFAA 3KRSA 1G6CA 5K7JA 4ZQMA 1NVMA 3EXRA 1SFJA 2X2GA 1UCWA 4RR4A 1Q3NA 1K02A 2HS6A 1KLYA 4GE8A 4IX0A 2RDTA 1Z42A 1SO5A 4FNTA 2CLOA 2G97A 1FCUA 3OG3A 1ZHAA 3W7GA 3HGOA 5LNVA 3NPWA 1AL7A 3UWUA 3DFOA 4ADTA 4K6AA 4TMBA 3EKZA 3OVRA 3GLCA 3NQAA 2ZRWA 2PC4A 1H7XA 5DBTA 1KV5A 1TJPA 4NU7A 4GFSA 4ICNA 2E5CA 1T96A 3EXTA 4U4MA 2VFHA 4LV4A 1E51A 4RZ4A 1VPXA 4DELA 3R5EA 1XDMA 1R47A 3CIXA 1JCYA 4LTSA 5LHFA 4UFIA 3L0NA 4XBKA 3UWYA 1QPOA 1F2JA 3VNDA 1JULA 4MZYA 2CZFA 4LS2A 5HUPA 1MZHA 2PE4A 2ALDA 2E5DA 2J9XA 1K7XA 3LHZA 1SO6A 5CKSA 5HINA 4E0CA 2XN0A 3Q94A 4K38A 1SUXA 4NQ1A 5EPDA 3LHTA 2WV8A 3LBMA 3BK0A 2RFGA 1IXPA 2PRLA 1GVOA 2XFWA 3GKFA 4YMZA 5EBUA 3O07A 1DJNA 1Y0EA 3ZFHA 4O16A 2QJIA 3TMQA 4L4LA 1AW5A 3KX6A 2C18A 3IGSA 2J6XA 1LLWA 2FPTA 5CPNA 1Q6QA 2RH9A 2Z1BA 1RV8A 4O18A 1D3GA 2CLLA 1H60A 4TX9A 4O53A 3SFKA 1QO2A 1RZMA 2ZZ3A 5AN7A 3L0GA 2Y7DA 4JS3A 2B7PA 1ICPA 2EKCA 1H62A 1P0NA 3USBA 2F84A 2H3DA 1JRBA 3A24A 4QNEA 4MYXA 4ONVA 4R34A 3DFQA 3PUDA 1ICQA 3GB6A 4AHQA 4MY9A 4IJBA 1GT8A 4H4IA 2JGQA 4UCGA 1NAL1 1OK4A 1F05A 2A7PA 4Y9AA 1EIXA 4UNLA 3ZWSA 3NR0A 5CPOA 1JQVA 1OYBA 3QZEA 1OFAA 3LBCA 4RXFA 1RQEA 3LTPA 4NNCA 1W3NA 5F1VA 3W1XA 4NXSA 3C2VA 3TR2A 3LRKA 2QJHA 4TMCA 4N2YA 3H54A 4JD4A 4GUIA 3TW6A 1O94A 4ADUA 2E6DA 4GUGA 4Z1AA 3W7MA 4ZQOA 5AYYA 3B0UX 3ABQA 1W5PA 3N14A 3CEUA 1B4KA 2E77A 4OT7A 1LOLA 2AGKA 1TCDA 4L4MA 1TO3A 4UC5A 1S5VA 1DV7A 3JS3A 3O1NA 4X2RA 1ME8A 4QSHA 4P61A 1XKYA 3RLVA 4N02A 1TREA 4JICA 4LRSA 3E02A 1Q6RA 2QCMA 3FJLA 4IMEA 1DBTA 1G4EA 3INPA 4JN6A 4RXGA 3IGUA 4A29A 5H2ZA 3PB2A 2BSLA 1SW3A 2Y88A 2WSQA 3I7QA 3KFTA 1JVNA 2FB3A 5C2XA 4X9SA 2GVGA 2HSAA 1G4TA 1G7VA 3BVJA 3STGA 1YADA 1A5CA 2BZNA 4MFEA 3THAA 3LCHA 4ZQRA 3R13A 3WJXA 4GUFA 1RR2A 1YXYA 4AF0A 3ABRA 2ZYFA 3HGRA 1TPB1 5C6MA 4IXXA 3HPSA 4AF0B 1HG3A 1B3OA 5FF4A 3T44A 2A5HA 4Z1DA 3W2KA 4OWGA 1WOAA 3G1FA 3S5YA 4Y96A 1FXQA 1OFOA 3G1DA 2A2IA 3Q37A 4U28A 3NQDA 5G1TA 4NUWA 3CHVA 4FNRA 2GJNA 6ALDA 1HTIA 3LI1A 4ZQCA 4NXKA 1CX9A 2VXNA 5HUOA 2V82A 3CT7A 1RD5A 4BWLA 4PFMA 1W56A 2RKXA 1L6SA 1ZJIA 1R2RA 4MFDA 3LCLA 3PC0A 5LNWA 2YYTA 4O0ZA 4POCA 3MP3A 1TTJA 4UMBA 4GUJA 4NJIA 1VC4A 3QSTA 5EA9A 4MYAA 3DAQA 1GG1A 4AWSA 3W72A 4UTWA 3M16A 1A53A 4UMCA 4K7VA 2FTPA 3ATZA 2V5BA 4JX5A 1SW7A 3TW7A 4S1FA 1WA3A 3LCGA 1DHPA 3P7YA 4ZZ9A 4ZQPA 3B0PA 3W1NA 3W7HA 4WXZA 2QCNA 4Y6GA 3QMRA 5BMWA 2VELA 2E6FA 3DI0A 3GAYA 1FCVA 1UBSA 1GVQA 3A21A 4UFKA 2QCGA 3MYOA 1XC4A 1VCVA 2W6RA 5H91A 3DHDA 3M41A 1TTPA 4FIQA 3Q58A 1SZGA 4JTUA 4O12A 4LU0A 3W84A 5LKYA 4K7YA 1IXQA 1FWWA 2OX1A 4AWUA 2E5BA 2QEZA 2A1YA 3W7KA 2WNNA 4MLRA 4TO8A 3M5YA 1A50A 3W7PA 2GQ8A 5DLCA 3C2OA 4O14A 2EHHA 5J5RA 3P62A 3GZ3A 4QISA 5LNUA 4HT3A 1G7UA 3M47A 4JTFA 2RDWA 3LXCA 3HO8A 5HR6A 3O8AA 3ABSA 1GOXA 3P80A 4P2VA 4LUJA 4JTLA 3NQVA 4O57A 4Z1BA 4DPQA 1J5TA 5LGXA 1KM3A 1XI3A 4OV4A 1DOSA 1L9WA 3NOEA 5F1UA 4A22A 2W79A 2YGYA 3NQMA 1C8VA 2V2HA 5AHNA 3AO0A 4EF8A 2B4GA 2ZDRA 1PHWA 4JTJA 4JTGA 4O4WA 3TSMA 3MP4A 3LHWA 2ZCGA 4N6EA 3IIPA 1FCQA 3TXVA 4IUOA 5EL1A 1LOQA 3G1VA 4CQ8A 4JTEA 5D02A 1VHNA 4K37A 4UUIA 3O16A 4WOQA 2YFNA 5I3IA 1JUBA 4K36A 3BG9A 1TPVA 1OFRA 1G69A 3OA3A 2ATMA 1PCWA 4K8HA 5DN1A 2O7QA 3IGXA 1X1ZA 2DZXA 2VFIA 3CU2A 2X1SA 1P0KA 4LVDA 1TV7A 4CLMA 5IBXA 3W71A 3LI0A 3B8DA 3NXFA 5EY5A 4IPIA 3TAOA 3NPUA 1GVRA 1MSSA 4ZVJA 4NJHA 3HGSA 4LV9A 1ONRA 1L6YA 3PG8A 3BW2A 3WK2A 3HG4A 2VOMA 3CIWA 4O54A 1EEPA 4QNWA 5K4ZA 2FJKA 2HMCA 3FKRA 1T8XA 4K39A 4UTTA 1GPWA 3O06A 5DELA 3EX1A 1EWEA 2P10A 3DFSA 4O1DA 2HTMA 2OT0A 3MHFA 3EWBX 5EKYA 4EIVA 3B06A 3GDTA 2CWNA 3W7EA 3UXDA 1IIGA 2JKEA 1YXDA 2WKJA 1ALDA 4MVAA 1I2PA 5U4NA 2YFOA 5CG7A 5K9XA 5K3VA 5HJLA 2CU0A 4JTHA 1MEIA 2QJGA 1KFEA 3W2UA 3QEZA 2X1TA 3FEMA 3LGEA 5KZDA 2JGYA 4JNMA 4RV8A 4R33A 1AMKA 1ML1A 2J24A 4MZ8A 1YXCA 4NX5A 4O11A 4NZJA 4O1CA 3P84A 4MUZA 2ZA2A 3DGRA 1SZFA 1EA0A 1TB3A 1KTCA 3PVFA 3W76A 2GVJA 3M0ZA 1LBLA 2X30A 4DO5A 3BARA 3DKLA 1OFEA 2YW3A 2A6LA 1KTBA 3A23A 5HNRA 2NXGA 5D32A 3PM6A 5CPLA 1TRIA 5C5YA 4BI6A 2RDUA 1TQJA 1KFBA 4YL2A 5BMXA 4LOCA 5FF3A 2Y62A 1OVDA 1V5XA 5DCBA 1ADOA 3EWUA 1NF0A 3MI2A 3TC7A 4CNNA 3BG5A 4LS1A 3NZRA 4NNBA 1H7WA 4HIBA 2I1OA 5HR7A 2CW6A 4JTTA 4HSOA 3SGZA 3KVJA 2I14A 1TV8A 4GJ1A 4B5NA 2ZRXA 5D03A 3TU9A 1RPXA 1LTDA 3QPZA 4FX7A 4JX4A 3DENA 4N4PA 5DY2A 1C29A 3NL3A 1QMLA 1WBHA 1W3TA 1N55A 1PL9A 1GJPA 4AHPA 4IMCA 2KZHA 4BR1A 3SGUA 4R7JA 2VEPA 1TTIA 4BWLC 1KM0A 1TRDA 5AB3A 4QM1A 4HNNA 2YX0A 5K2ZA 3DZ1A 4PCFA 2A21A 2A6NA 2OMAA 1XL9A 4O19A 2BXVA 4QAIA 1U5JA 4XZ9A 3TV8A 3W9ZA 4LVGA 1KV8A 3LERA 1DL3A 3UD6A 3SIZA 1FY6A 2H6RA 2ZTJA 3N9SA 1SSGA 4UTWC 4AXKA 4GBUA 3NYZA 3CLMA 3OHIA 4UFJA 4O1BA 1TPDA 3B0VC 1YTKA 4CQAA 3G3MA 2V5LA 5F2IA 1XBZA 2C6QA 2JK2A 4YXGA 2P0OA 3EX4A 4I7UA 3GXTA 3TX9A 3VCRA 1OG0A 3JRKA 1LBMA 4GUHA 2QKFA 4KFNA 5AHEA 1M6JA 1JR1A 1KM1A 3P82A 1KLZA 1Z44A 5CZTA 3W75A 1SSDA 4IWWA 3LDVA 1P5BA 5SWUA 1R30A 3EWZA 3PBYA 3KVMA 3FIGA 4KFOA 4O13A 1A5AA 4WUIA 4H3DA 1D9EA 1SO4A 2Y63A 5F4SA 1M7PA 3QJAA 4IGHA 3R8RA 3PUOA 4NJGA 3UQNA 3BW4A 3U6WA 3RLUA 1OFDA 3LCIA 5U7SA 3W85A 3GYEA 3T40A 2CLFA 3P74A 4UNKA 1JUEA 2JKPA 1EWDA 3OEXA 3L5LA 2NUXA 1UUOA 2YR1A 1SQ7A 3S1VA 1QAPA 4ZQNA 1QNVA 1ZAJA 2QCEA 3RFAA 1H7NA 3S8HA 3LCWA 4OGZA 1YTEA 1GTEA 5I3FA 2ZA1A 3HPXA 3BLFA 4YCOA 4QQ3A 3N3MA 5DY3A 2VEIA 4JX6A 3NO5A 4CNPA 3M1ZA 3C61A 3MBDA 1TPH1 3TMLA 2WJZA 3W22A 3W6YA 1GZGA 1GYLA 3LLFA 4FNSA 4W9TA 3L67A 2Y85A 3L9CA 5D2TA 3V1PA 2E6YA 5CZ0A 3DFPA 4Y8FA 4JXCA 1THFD 3F03K 1NF7A 4LWWA 3W1TA 3ZWTA 5AFDA 2NWSA 3H53A 7TIMA 3W2LA 1B4EA 1LP6A 3S5OA 1GQNA 3N9RA 1EUAA 4GRSA 1I2OA 3A22A 4BK9A 3GXNA 2GVLA 1LRTA 4PODA 1ZFJA 1X7FA 4AVFA 3TC6A 2ZZ1A 2Q8ZA 3M5ZA 3TQKA 2YCEA 5HWJA 2Q3OA 3GDKA 3EWXA 2ZRZA 3C6CA 2FFCA 3L0KA 5IBXC 3TNOA 2GQAA 1FDZA 2WSRA 3S9YA 3QH2A 1I8JA 3UPBA 1G67A 2VFFA 3TSDA 3P60A 3GAKA 3NNTA 5K4XA 1PE1A 2Y7FA 1UJPA 4WY0F 3ATYA 4UTTC 3W88A 3CWOX 1W5NA 2V0TA 2J88A 4RJEA 1FCBA 1PCKA 1UB3A 5TIMA 3KVKA 3TDFA 1KM6A 3L2IA 4FXSA 1LRQA 2NWRA 1N8FA 3S42A 3NQCA 3E9AA 4QJ1A 4AAJA 2QF7A 1JCMP 3IEBA 3NDOA 1R2TA 3TUUA 1KM5A 1OFQA 2EF9A 3LX9A 1S5TA 1YYAA 4UFMA 2RHGA 5ABTA 1LOSA 4MY8A 4NX0A 4HN4A 2H3BA 4EVZA 2CZ5A 3P81A 5FF7A 2ZZ2A 3UWZA 4TR9A 4NJJA 5FESA 5F2LA 3PSWA 1GEQA 3TFXA 3MMTA 1IXNA 3P61A 2Y7EA 4CCEA 1NSJA 1AL8A 1VR6A 4XKYA 4O0KA 5LZLA 3W1UA 3U8GA 3WJYA 3SJ3A 3C3NA 4XKYB 3O6YX 4WOZA 5AYZA 1Q45A 1HO1A 3IVSA 2ZZ4A 3MO7A 4IMGA 2XN2A 5A5WA 1QPRA 2WOQA 2ZTKA 2Z6JA 2WNZA 3UYCA 2B7OA 3LHYA 4MLJA 3FA5A 1JCLA 2TMDA 4RX0A 1IF2A 5FEZA 3OVQA 1XM3A 2ZZ6A 3NM1A 3PB0A 4XTDA 5D2XA 4LY8A 3VE9A 3ANYA 4ADSA 3GDRA 1VRDA 2C13A 3MI6A 3NPVA 4CQ9A 1SW0A 1TIMA 1KFCA 1ME7A 5TQLA 2C19A 4C1LA 3CQ0A 2D73A 2ZFAA 3NZ1A 3TJXA 3G8RA 4UTKA 3L68A 1O95A 4IPJA 1XFBA 4IX2A 4UR7A 1TQXA 1WQ5A 1ZENA 4X3ZA 3GIYA 4M19A 1OF8A 4JR5A 5I3JA 1R2SA 1SZEA 5KITA 2C1HA 2Z2UA 3ELFA 3TK7A 1W0MA 1JQXA 3LOTA 3C2EA 2QDGA 1CI1A 2LLEA 4OE7A 1TSIA 3WJZA 4MKNA 4BI5A 1MXSA 3IIZA 2DZUA 2C15A 4FF7A 1FWRA 2TPSA 2WNQA 1WXJA 5BNKA 1FDJA 4JTKA 1OHLA 3EX6A 2W0UA 1H5YA 3MYPA 4LT9A 2PCQA 1LDCA 2VEMA 4LUIA 3BG3A 5AHFA 4O4VA 1X1OA 3THQA 2A7RA 1DQWA 1X6UA 4Z1CA 4FXRA 1FWNA 1OK6A 2DU2A 3NL2A 2DZSA 3MUXA 4JIPA 2FIQA 4HHPA 1TPUA 3QW3A 4DF0A 4Y90A 4RZ5A 4JY8A 3F4NA 3NL5A 5F2GA 2H8XA 2FLIA 1JRCA 3I6RA 2YSWA 3SI9A 1YPIA 1VJIA 5G5IA 4UTMA 1WOBA 3TE9A 1V7YA 2Y7GA 4OBTA 3W1PA 1VLIA 4NVTA 3G1SA 3NGJA 4S2CA 4M6VA 2R8WA 2NZLA 2G5WA 3FKKA 4O15A 3L5AA 4IMFA 3IIXA 1P4CA 1TPEA 4EWND 2ABAA 1F5ZA 1R46A 2YXGA 3NQGA 3W74A 3MP5A 1OX6A 3VFLA 3NQ8A 4UFHA 1EPXA 1VLWA 4MJMA 3NVTA 1XUUA 4BF9A 5FF2A 4LRTA 5K9DA 5FEXA 3DBPA 4ZMGA 1LLZA 3PS7A 3SW6A 3QSRA 4ZL1A 3JR2A 2GUUA 2ZRYA 3A5FA 1K03A 3PBVA 5F4XA 2AQWA 2NUYA 3PG9A 5D33A 4OU1A 1YLVA 1LM1A 4M7TA 8TIMA 2V81A 2CZEA 3TXZA 3UWVA 3N19B 4JIQA 3G24A 1I2NA 1K8ZA 2DORA 3DU0A 1I2RA 5AHLA 3KAOA 1OABA 1TMHA 6TIMA 1WDWA 3W2MA 3PSVA 3NL6A 5CZJA 1GVFA 4FNQA 2HS8A 1GYNA 4M6PA 4CCCA 4UTHA 1QOQA 3W1RA 4O10A 2NXHA 4D2JA 4LVAA 5K9CA 5LSMA 3C56A 2NV1A 2YPIA 1ZAIA 1UUMA 1RQBA 3IV3A 3M6YA 3W3OA 1IIHA 1H51A 3S5NA 4IXHA 1LCOA 4Q4KA 1JCXA 1VS1A 4HPJA 4KWVA 3OVPA 5AC8A 2ZZ7A 5E93A 1DKWA 3G1XA 3W86A 2FQIA 3LRMA 3M5VA 4HPXA 5LNRA 3GVGA 1F76A 4M5PA 1I4NA 3FJ6A 5E1QA 1T99A 3TCEA 1QO5A 3OBKA 5T26A 4HNTA 3C8FA 4GNJA 1Q6LA 1XXXA 3UZJA 3O05A 3PWAA 4UFLA 4YWIA 3WK1A 3G18A 4CCDA 4A2SA 3T78A 3P67A 2B7NA 3ABOA 3TQ0A 2BWGA 4MIMA 5D37A 3EWWA 1PVNA 3TROA 4HSNA 1OFPA 3W1QA 4ALDA 3BLEA 3HOJA 1YTDA 1LRNA 1ZY9A 5LGZA 1F73A 3SR7A 2X1RA 4DO4A 3B04A 5L9FA 1ZALA 1VGAA 3SZ8A 3G0UA 5C54A 1FQ0A 3NQ2A 4XTIA 3KRUA 1KM4A 1SU5A 1B57A 5KTLA 3PY2A 5FI8A 4X22A 3W7OA 3BLIA 3QQ1A 1QPNA 3B03A 3NQ7A 1YDOA 1WYIA 4NT0A 3QQ0A 3NQEA 1XCFA 3W23A 5D2YA 3ZS4A 3C2FA 1QWGA 3R2GA 1XDLA 4WZHA 3FYPA 1KW1A 1Q6OA 2OZ0A 4Z0JA 4LNYA 1RQHA 5F2MA 4O28A 4J9JA 2E6AA 1H1YA 2JKAA 3UNDA 3W07A 3C52A 2WO5A 3NG3A 4CNOA 4JDYA 3IVUA 4MJZA 2A7NA 4LC8A 4IMDA 2NX1A 5CPMA 1H1ZA 3CTLA 3KOFA 4WX2A 5KZEA 3E49A 4Q32A 4BI7A 1VH7A 3UY8A 3I7SA 4WY0A 3S1UA 2V9DA 3W7NA 1PHQA 3E0IA 3P5ZA 1FDYA 3BW3A 1MEHA 4WY0B 1ME9A 2R14A 4XUGA 2C14A 5BW6A 3MI3A 1LBFA 2A4AA 3RK8A 3O15A 1BEUA 3CEPA 3MBFA 1KFKA 1OFBA 5FEPA 2QCDA 2GQ9A 4FEZA 3QC3A 3SY5A 4EF9A 3G1YA 2QCDB 1AW1A 4NJKA 3TIMA 4EOUA 1SZNA 1S3HA 4JTSA 3BGGA 5LNSA 3PUEA 4YLWA 3W1LA 2R91A 2G95A 3R89A 3GNDA 3MJYA 1TTQA 3IIOA 3TSBA 1A5BA 5G4WA 4RK8A 3HG3A 2BTMA 3WJWA 1EP2A 2CLEA 4E2BA 4JY9A 1AK5A 2VEKA 3W1MA 4LVFA 3HJZA 1XBVA 4R53A 5D04C 3E96A 3H55A 3STFA 1GVSA 2VFGA 3W1AA 1KFJA 1LROA 2QCCA 3HF3A 3MHGA 4I7VA 4UIOA 2PRHA 1L6WA 1H7PA 5I3GA 5I3KA 3GDLA 4DF1A 2QDHA 3N2XA 2TSYA 4LC6A 4PL1A 3EWYA 4JEQA 2ZA3A 2E1DA 1J2WA 3O63A 3S6DA 1SO3A 4NNAA 4N9DA 2VFDA 3HMJG 2CZDA 4N9BA 4HKPA 3B4UA 5G2IA 4JTIA 1TPC1 1SFLA 2NV2A 2DJLA 3LV5A 3BPWA 4I7WA 4UTLA 4JYFA 3QMTA 2OCZA 3NQ6A 3GK0A 1MO0A 1J4EA 4AHOA 3W70A 1VYRA 2EGZA 1W5MA 2O7SA 4IOTA 5F4WA 1DQXA 1WV2A 3FFSA 3HG2A 4G1KA 3F4WA 5G2WA 1QOPA 5G2HA 4NZFA 5DBUA 3F1QA 3UZ5A 5HQEA 3I65A 3GDMA 5KSWA 3EX2A 1PV8A 3TAKA 1S5WA 3QRHA 1JUKA 5BOOA 1H7RA 3GR8A 3AJXA 3QF0A 1L2UA 3I7RA 4K8EA 3QM3A 4FB7A 1O4UA 1YDVA 3WK0A 1OYCA 4M6QA 2GOUA 2AAMA 2QAPA 3L66A 1CW2A 3KVLA 1K7FA 2J9ZA 5D2WA 2X16A 1KBIA 1W1ZA 4JGDA 4ORMA 2TYSA 1UASA 3M7WA 4DXVA 3VI2A 1FWTA 1EUNA 1G4PA 3GX9A 5D2VA 3TH6A 3G0SA 3LXBA 3PR2A 3HG5A 2PURA 1X8FA 4JYDA 3G22A 4YCPA 3EB2A 5DCEA 4HNVA 3HPZA 1Z41A 2NLIA 1Z48A 2DZTA 4XWUA 3W7DA 4XBSA 1T0OA 2OT1A 4OHQA 4GWEA 1G4SA 2TRSA 3FS2A 3G3DA 5EYWA 1XBXA 1HFBA 5DXXA 1A5SA 2Q3RA 1OX5A 1WX0A 2E68A 2Y61A 5E0KA 1PS9A 4FIRA 2ATSA 1YPFA 3A5VA 3RNDA 3RU6A 5CSSA 1H61A 3LTYA 4I9AA 4A21A 3G8EA 3W73A 5CGQA 1NFBA 2EAWA 1KA9F 3HB9A 5D38A 2DZVA 3BGJA 1EP3A 3Q2DA 1ZNNA 2P1FA 1DJQA 1FX6A 1PIIA 2GPTA 2ISWA 3W7LA 3TJLA 1GWJA 2R94A 1VCGA 4TU1A 4O52A 3LTSA 1BTMA 1U83A 2QCLA 1W3IA 1XUZA 3LCXA 1H50A 4N9CA 3WJSA 4IQLA 2C3ZA 1O5XA 1W37A 5GVJA 2C0AA 2C16A 3GXPA 2J9YA 3LB0A 3W7QA 2WSYA 3LXAA 2ZBTA 1W8SA 1VYSX 2YDAA 2X1UA 3HQ1A 1WBJA 1VCFA 3O6CA 4OQVA 1TPWA 3NPXA 5AHMA 1LYXA 3N2MA 3FLUA 1TJRA 2YZRA 5L6UA 2CFFA 3SECA 3B05A 3N73A 1K8XA 1YDNA 4UXDA 3TQVA 3DXIA 1HUVA 2DP3A 3IIVA 4RCXA 4LVBA 4DQWA 5EMUA 3KRZA 1JCNA 2PRMA 3S1XA 1VZWA 2J27A 4AEOA 3GNNA 3M44A 5TBOA 3YPIA 3PF3A 4PL2A 3BO9A 5G4EA 4WJEA 3CWNA 5HWNA 2YW4A 3LLDA 1W54A 2DZPA 2DZWA 4S2BA 3EKLA 1LZOA 3C0JA 5DCDA 3DFTA 4AB4A 3DHFA 4A3UA 3NAVA 1F6PA 3MHUA 4WD0A 1QCWA 3QYQA 5C55A 4O1AA 3HBLA 4RLIA 1IXOA 3LM7A
chains in the Genus database with same CATH superfamily
2E4TA 1FHUA 1FWSA 1J12A 3W53A 4HA3A 2YXXA 1WZLA 1TZZA 4IGMA 4KWWA 1ZP3A 3BJTA 4E38A 2F2HA 3CHFA 2ZIDA 3OIXA 4IQDA 4JDBA 5TD4A 4FALA 4AH7A 4AD3A 3F5KA 1TWZA 3LCFA 2NX9A 1DIEA 5EMYA 3EXSA 2VOTA 1R7OA 3PBUA 4CD8A 3KBVA 2BGNE 1M5WA 2JALA 1XYZA 3PBWA 2A0NA 1G0CA 2VC6A 1ZPTA 5AYIA 4E3VA 3KHJA 3OQ8A 4UMAA 3T8LA 2B7QA 2G96A 4V33A 4GNVA 3W7RA 1KGXA 3CB8A 1GCYA 2VEGA 4Q8VA 3CL8A 5I3HA 5CSRA 4MZ1A 2Z0IA 3DG7A 2V6AA 2PDXA 2B0MA 4LALA 1HJSA 2PD5A 4Q22A 3QV7A 4KFPA 3SSJA 1BYDA 2PGEA 1Y65A 3LBOA 1OIMA 2Z6IA 5G1YA 4M7SA 4LW7A 2QIWA 1PWMA 2RJGA 3O6DA 2DPEA 2V67A 3L21A 4PTWA 5CZSA 5EFDA 2BVDA 2P53A 1C9DA 2D0GA 2H8ZA 1QW9A 6A3HA 4A2RA 3ARRA 3IGHX 3MZNA 2WNWA 3VNZA 5EMMA 5A8OA 1YX1A 4PE8A 5BOFA 2INZA 3WLQA 4F2TA 5GJMA 4N4QA 3MTWA 2ZZ5A 2PDQA 4AMAA 2VKZG 1R85A 2A85A 3APGA 3FW6A 2R1MA 2D2GA 3FOKA 4HNUA 4GXMA 2WQPA 4YNGA 1WAUA 1FWAC 1FBAA 4YTTA 3W00A 4JCLA 4DPPA 4L1XA 2Q71A 4BEUA 5CCZA 3W83A 2ISVA 4GIAA 4C6EA 1I1XA 1UC4A 3U2CA 5MHBA 4H9XA 4ORIA 2WPBA 4ML9A 4K1GA 2QCHA 1U5VA 1ZLPA 5A8NA 2WJEA 2GDVA 2XISA 4INFA 2QVNA 3M0VA 2Q8LA 3EDJA 3WQ5A 1QI0A 2HISA 4G7FA 2DT0A 4N9EA 4M29A 3W38A 3V7PA 3GKAA 1CGYA 5AC6A 3WF2A 3L65A 3ZJ7A 3N34A 1LWIA 3LHUA 1XW8A 2QUVA 3VMPA 3RN6A 4HHLA 3NSXA 1B9BA 2Z24A 4NIRA 1J10A 3C5QA 2EG6A 3BV4A 2ABBA 4MHBA 3A9BA 4PTNA 3VGBA 4PTDA 5H8UA 4WXYA 4ICMA 2WZHA 1ZRQA 3MPGA 3BTNA 5CLWA 1US3A 5TF0A 5I2UA 1F6KA 2E1WA 3SY1A 1K3UA 4AU0A 3EOSA 3E5PA 4DBDA 3VIMA 4OKDA 5A2CA 5HMSA 4Z0SA 1EHAA 4UTIA 4ZOAA 1ZAHA 4M1BA 3W2JA 3A9IA 3TYAA 1LF1A 4QG6A 1HGYA 5TNVA 5I7GA 4FX8A 4EXQA 4XZMX 5LA0A 3KRSA 5K7JA 1P48A 1WDPA 1NVMA 1HNYA 3EXRA 1SFJA 1UCWA 1K02A 4D6EA 2HS6A 4V1YA 4GE8A 4W86A 2RDTA 3Q4DA 2CLOA 2G97A 1FCUA 3OG3A 1MVYA 3WQCA 1UP0A 1XIDA 2FH6A 4ZB2A 3FDGA 4LB4A 5A8MA 3EKZA 3GLCA 2HK1A 3GUWA 2PZNA 2W92A 3VX1A 1F3WA 4LF1A 2C71A 1SGJA 1V3HA 3WH6A 5JBFA 4GKTA 4GFSA 4ATWA 4C6OA 1E51A 1ZJHA 3R5EA 3AICA 3CIXA 3GE7A 4UTFA 1JCYA 3N3TA 2PTWA 4XBKA 3UWYA 1QPOA 3SCTA 4MZYA 2E7FA 2CZFA 3RPMA 3H24A 2ALDA 2VYOA 4JL2A 4CQCA 3C0SA 4DJFD 4YPJA 1K7XA 3LHZA 3C3UA 4HOXA 1SO6A 5CKSA 2XN0A 3Q94A 4K38A 4OFCA 3TTOA 3BK0A 4GK8A 4FA3A 4A6GA 2PRLA 2XFWA 4YMZA 5EBUA 1U22A 3O07A 1DJNA 2UY5A 4QDWA 1DJGA 3KX6A 5LYRA 5CC3A 3IGSA 3GXIA 1OADA 4XSMA 3AFBA 5CPNA 4NY2A 3UG8A 5A1AA 1W8GA 1O6IA 4EPKA 2CCRA 1RV8A 4R9XA 1D3GA 2HE5A 4PGLA 1AD1A 3AHZA 2CLLA 1H60A 4TX9A 2NT1A 4F79A 2I16A 2ZZ3A 5AN7A 2VCCA 3L0GA 2VT0A 1MW3A 2I5IA 3U48A 1H62A 3N17A 4GC3A 3AIWA 3ZVHA 3EDKA 2PCEA 4ONVA 4R7OA 3TYBA 3ZVHB 1HL9A 4AHQA 5MKGA 3LZ5A 3REQA 1TKKA 2A7PA 3GVQA 5MKGB 3NR0A 1CDGA 5FJUA 5RUBA 3REQB 5CPOA 3IAPA 4Y9OA 4L4PA 1HJVA 2HXTA 2WCSA 3IAQA 3DC0A 3ARQA 1R86A 2Y5SA 1WB0A 3BJSA 3M07A 4L6DA 1RQEA 4NNCA 5CGMA 4A3YA 1MNSA 3W1XA 3QKZA 2ICSA 4NXSA 1AH0A 1E43A 1XRVA 3LRKA 4KGJA 4O8AA 3WL0A 3TLLA 3B8UA 4TMCA 4GUIA 2J7DA 1Q8JA 4Z1AA 3B8TA 3KDNA 3VDBA 5HOSA 4C5ZA 2NQHA 3GNPA 3CEUA 1TMLA 3CUGA 1B4KA 2AGKA 1FHVA 1PJ9A 1TO3A 5FIPA 3RLVA 1XKYA 3K8KA 1JFXA 1M7JA 1Q6RA 2W62A 1V3KA 2DY3A 4IMEA 3INPA 3H4WA 4Q6XA 4HBKA 3KFTA 1JVNA 2YBTA 1HF6A 2OLAA 4X9SA 4ZB5A 3EOUA 4IIFA 1VENA 3MDWA 2CWXA 3STGA 1PAMA 3THAA 4B5SA 2ZXQA 3QLLA 3OGVA 3TYEA 2Z1SA 2PWVA 5A6BA 1WPCA 3AIEA 1CTNA 4OWGA 4B15A 4Z17A 1WOAA 1E6QM 4U28A 2Z1XA 4NUWA 3ONBA 2AGTA 4FNRA 1UG6A 4LCQA 2VCAA 3CZGA 2OWCA 1UYQA 4ZQCA 4US5A 4F0SA 1CX9A 3MCNA 5HUOA 1RVKA 2RUSA 3CT7A 1S2CA 1DXEA 3AMGA 1L6SA 3T09A 1V3IA 1XQKA 3PC0A 2CLPA 1I9CB 4PN2A 3OO2A 2HE8A 1GG1A 4AWSA 1KRCC 3EGJA 5I06A 4LF2A 1TX0A 4K7VA 5MF5A 7REQA 2FTPA 3TW7A 8XIAA 4S1FA 1WA3A 3LCGA 1M53A 3P7YA 4ZZ9A 4M24A 3B0PA 3LGDA 2QCNA 1XF0A 3QMRA 3AYRA 2VELA 3DI0A 3GXDA 1UR8A 1GVQA 3GXFA 3TN3A 1HKVA 4UFKA 3MYOA 3GIPA 2ZXAA 5JIWA 2VC9A 5BXSA 3U4FA 3VGGA 1TTPA 1QTWA 3Q58A 3KBMA 3I3BA 4M81A 1DJIA 3LD5A 4K7YA 2OX1A 2X8RA 2E5BA 1T8QA 3QTPA 2A1YA 3SSZA 1A50A 2GQ8A 2XZ7A 3AQUA 1ITXA 1EIBA 3C2OA 4GQRA 4QISA 1TE1A 4JTFA 1C90A 1UMYA 1I60A 4DXKA 2D0HA 3MANA 3NQVA 1RP8A 4QROA 4DPQA 5LGXA 4OV4A 5JIPA 4GKLA 4PZVA 5AHNA 2HNHA 4F9DA 2DIJA 3U2ZA 4I8YA 4EF8A 2B4GA 1M01A 1PX8A 2QVHA 4JTJA 4O4WA 1ZB5A 1KB3A 1UZ1A 3IIPA 3GVWA 1LOQA 3CUIA 5D02A 4DYJA 4JQ3A 3APTA 2AKZA 1DQUA 4WOQA 2YFNA 3GTNA 4K3ZA 5I3IA 5BXRA 4HMEA 3BG9A 1TPVA 2VDGA 2NT0A 5CC7A 4BQ5A 1G69A 2ATMA 5I23A 4K8HA 3IGXA 4X2PA 1WKDA 2DZXA 3R58A 4LUTA 5FJRA 1J0YA 4LVDA 2ZUTA 3TEVA 3GH7A 4LUTB 3S6OA 1VFOA 2HWGA 2H9AB 1JD7A 4QRNA 1WUEA 3OLDA 3IK4A 3WL1A 4IPIA 2J6VA 1R3WA 2ZUSA 1W1PA 1H0IA 4F0RA 3VIHA 4W7UA 1KKRA 4NJHA 1ONRA 3H2EA 1BYAA 3KBSA 2VGBA 4HHMA 4PBEA 2FYMA 3HG4A 3WK2A 4NAEA 5K4ZA 4FK9A 1RA0A 3O06A 4NAEB 4RDYA 3OZMA 4XD5A 4O1DA 4L64A 4FOUA 2CHRA 4V1XA 4K68A 2EKGA 3W7EA 3E1F1 4NL1A 1R3TA 3RUBL 3KZPA 4XK2A 2E25A 2DFAA 4ZE5A 3OIHA 2BXZA 1MEIA 1Z89A 3WY1A 3ZIZA 1RUSA 3QEZA 3LGEA 4NAFA 1HJUA 1AMKA 1ML1A 4NAFB 4MZ8A 1H11A 3MVTA 2VURA 4D6FA 3SFWA 4QBXA 3CZKA 5EU9A 4FOJA 3PVFA 3W76A 3M0ZA 3CTTA 3DKLA 4N0RA 1A5LC 2A6LA 2C7FA 3WQDA 1RLCL 5A2BA 2PGRA 3CWHA 3VZYA 3ITCA 4B2DA 2C8NA 1DJZA 3GH5A 4LOCA 4ZO6A 3SCVA 4XAYA 3MI2A 4DJEC 1Q6CA 2EG7A 4HIBA 2I1OA 3RM4A 2F6XA 4JTTA 2PF8A 1UWQA 1F8MA 2I14A 1TV8A 2FDMA 2ZRXA 1RPXA 4FX7A 4HQVA 5DY2A 1C29A 3NL3A 4AVOA 1NDYA 3L7RA 2R82A 1W3TA 4YS1A 1OD0A 3FJ4A 1GJPA 3T2QA 3LSCA 7XIMA 4IMCA 1QBAA 2D2JA 1JCTA 5A6LA 1ONXA 4HNNA 5I6SA 3KLLA 2BXVA 1UD3A 3F2CA 3P0XA 1XG3A 3SIZA 2DVTA 1CGTA 1J96A 3N9SA 4GYKA 4AXKA 1OSEA 4RDZA 3BSGA 1ITUA 1RBOB 4UFJA 3SQMA 3QN3A 4DM2A 1N2VA 3ARPA 3AIBA 4BEQA 4YHEA 3B0XA 1BD0A 3M6DA 1GNXA 2Y0FA 5AVNA 3MV11 2WVUA 3N12A 5LIXX 1B31A 1LT7A 1A3WA 2V5CA 2OYKA 1JR1A 2J75A 1KLZA 2XFRA 1BSIA 4EK7A 3CXOA 5FCZA 1X96A 2J8GA 4IWWA 5DT5A 4NZCA 3PBYA 3MY9A 2VGGA 4KFOA 4O13A 1OGGA 1D9EA 1SO4A 3PUOA 3BW4A 3U6WA 3RLUA 4Z2GA 3EA2A 3A12A 5FJPA 1AH3A 1J0KA 3P74A 1WCGA 1E6XM 2HK0A 3OEXA 3L5LA 4P8VA 1UUOA 2YR1A 3GY1A 1TUFA 2Z29A 3RYSA 3MSDA 3S1VA 4ZQNA 7ODCA 1ZAJA 2OSXA 4R5EA 1CGWA 4AZHA 4HNCA 4FI4A 4JTDA 5A6JA 3APYA 1R9YA 2AQOA 2A3AA 3M1ZA 3C61A 3MBDA 2QV5A 2ISDA 1GW1A 2OLSA 4A3HA 3I3EA 1LL7A 1RBAA 1BF2A 3V1PA 1L6FA 4Y8FA 4JXCA 1THFD 4FS9A 2VDHA 4LWWA 5HDRA 2DIKA 2VMFA 3ZWTA 2BOFX 3Q65A 1B4EA 3SEPA 2F8QA 3S5OA 1FWEC 3LA4A 3QR0A 1SJCA 2HPIA 3AC0A 1LRTA 3KL3A 4PODA 4AVFA 2Q8ZA 1EDTA 4KRUA 2B81A 1XLFA 2PD9A 2O92A 3PHAA 3C6CA 3L0KA 1LUCA 3TNOA 2CZVA 3QH2A 1LUCB 1U1JA 4HD5A 1I8JA 1MUMA 2OX4A 2Y7FA 3BAIA 2WZEA 3PZVA 3OB8A 1DWHM 1V02A 3W88A 4UTTC 3CWOX 4GYJA 5I02A 1W5NA 1MRAA 3FSTA 2J88A 2VUYA 1W17A 4DBWA 4XZLX 5IDIA 5B80A 2DSZA 1KM6A 4L56A 1LRQA 1W91A 1RA5A 3V0TA 3NQCA 4HYWA 4DBUA 4F0MA 1S5NA 1XSKA 3POHA 1JCMP 2EF9A 1YYAA 1O5QA 4EVZA 3AMCA 2CZ5A 5FF7A 1O1HA 1JPIA 1LJYA 1C91A 4EACA 1BPLB 2IQDA 3PSWA 4I6KA 1F6YA 1IXNA 2Y7EA 9XIMA 5DMMA 5E6YA 4HMDA 1SZRA 3AS2A 1OC6A 3MUAA 3C3NA 3O6YX 4WOZA 1CT5A 3C2YA 3MWCA 1HO1A 2ZZ4A 3NGFA 3SRFA 1NOWA 2XN2A 4HCDA 1CLKA 4NILA 5A5WA 3T0CA 1BGAA 2OELA 4MLJA 1JCLA 3S6TA 3P6LA 1XM3A 3THDA 2EJ1A 1KXQA 1A5OC 1BXNA 1VRDA 3B8IA 3MI6A 3CHEA 1TIMA 1KFCA 4AY7A 5TQLA 1FWCC 4C1LA 3G8RA 5CAKA 1TCMA 2IMRA 4GIYA 1RY0A 2YLAA 4IX2A 4PUUA 3LK6A 4MWAC 1TQXA 5DMLA 1ZENA 1VB9A 1KFWA 2CHNA 1REQB 2Y8KA 2ACSA 4JR5A 5I3JA 3G5EA 4GZ7A 5LIUX 1X8CA 2Z2UA 4PCTA 4F0LA 1JQXA 4FLQA 3A64A 4FLSA 2LLEA 4BI5A 4CN1A 2I5GA 1O12A 2BXYA 2C15A 1FWRA 1WXJA 1FDJA 4O1FA 2W0UA 5DRIA 4LT9A 1LDCA 2WC4A 1JZ2A 4BQ2A 1X1OA 1ZTVA 4HPNA 4RE0A 1DQWA 3AU2A 4AY1A 1GZJA 4NRSA 3SN1A 1L8PA 4C7FA 1OK6A 4ERAA 1YDYA 3QW3A 4DF0A 4Y90A 3W6MA 1X1NA 4JY8A 3F4NA 3NL5A 4MJ4A 4S38A 3I6RA 3NO3A 2YSWA 1VJIA 1WOBA 2D2HA 2VL4A 4OBTA 3G6MA 3G1SA 3ECQA 3WF1A 3AIRA 1PKMA 3U0HA 4RNHA 2W9MA 4DJDC 5CJNA 2G5WA 3SCQA 4O15A 4IMFA 4EWND 4B4FA 3NQGA 5HAOA 1TX2A 1EPXA 4MJMA 3NVTA 1XLMA 1XUUA 3EKGA 3S83A 1Z69A 3DBPA 2BG5A 5I00A 4OVXA 2PP3A 4BKNA 1GGOA 3LNMA 5EGRA 3JR2A 1CGXA 3A5FA 1RJPA 3V18A 2XFFA 5F4XA 2XIQA 4OU1A 3KWXA 1LM1A 8TIMA 2BVYA 3GR4A 2CZEA 3H12A 2V69A 4H7ZA 1UWAA 4DZIA 1K8ZA 1I2RA 1OABA 1T6MA 4AEFA 3WQEA 1TMHA 3S2NA 3W2MA 4PYSA 2WQDA 4Q4PA 5CZJA 4FNQA 3UESA 4M6PA 3W1RA 2NXHA 3SCWA 3BXWA 2BY1A 2NV1A 2YPIA 1UUMA 1RQBA 3WH8A 3W3OA 4QLLA 1Q85A 4ZGYA 2A3BA 3N6QA 2WPGA 4IXHA 1VS1A 3S9IA 4IP7A 2O9RA 3OVPA 5DRCA 5AC8A 3FNDA 4ZA0A 2ZZ7A 3M5VA 4QDMA 1AJ2A 3FJ6A 4CEUC 1T99A 1QASA 1JZ5A 5M2FX 1NIUA 3VD7A 3A3XA 1N82A 3EWCA 3OLIA 1YQ2A 4UFLA 1W1TA 2J13A 2VNCA 1K9DA 3BWWA 4D8ZA 4HTYA 1XIEA 2G3IA 2IW0A 3GHUA 3RR1A 4MB5A 2ACQA 2CBUA 3S2CA 1S2UA 1FWIC 4G9PA 1A5KC 3TROA 4QCEA 4HSNA 3HOJA 4KBXA 5LGZA 1F73A 4DO4A 3I4EA 3ERPA 3IRSA 4H8NA 2D1ZA 2UZ9A 2FKPA 1T5AA 4XTIA 1SU5A 3EDDA 2QNEA 4KCUA 5T91A 1EL3A 2OZ3A 3D46A 4P7OA 1JDAA 3QQ0A 4MNLA 1QWGA 3R2GA 4AD5A 1KW1A 4J3WA 4LNYA 1RQHA 4REQA 3LZ3A 3L4XA 4REQB 3NXLA 3DYMA 3TQPA 4UQDA 4CUCA 4MWAE 1FKWA 4CNOA 4CNUA 4IMDA 2ZX8A 4P8UA 2OZ8A 1O1ZA 1PB0A 5BZAA 2C0HA 1EDGA 3PBGA 4J28A 2PUZA 2GGJA 2V9DA 3S1UA 3W7NA 3B8WA 4NASA 1RD6A 1WKFA 1EJ7L 1PIFA 1RBLA 1LBFA 2A4AA 3IJ8A 1EBHA 1KCLA 1M68A 1KFKA 3UA4A 3NUKA 1E4MM 2GQ9A 4MB1A 3VVGA 4XIMA 1RH9A 1SZNA 3QHOA 4WSHA 2OB3A 3SCUA 4A35A 4AY8A 4G1NA 1E55A 3KTSA 3R89A 3GNDA 3GTXA 3TP4A 1FH7A 4BHYA 3FDKA 3WJWA 2CLEA 4U5IA 1S2AA 3W1MA 3OTRA 1V6WA 2WYSA 3STFA 4HZ6A 3W1AA 2RDXA 1LROA 3H4GA 3HF3A 3MHGA 2PRHA 1H7PA 2PDCA 1WDRA 5I3KA 3PBMA 3GDLA 1N8IA 4DF1A 2QDHA 1Z6KA 3GDBA 5FJOA 4JFTA 4KF1A 3PTDA 4J40A 1JPDX 3K4DA 7TAAA 3TYZA 1DTUA 2WHMA 4DZAA 4V15A 1SO3A 4OECA 4N9BA 3AI0A 3ZLHA 4IL2A 2W66A 4B3KA 5G2IA 4JTIA 1TPC1 2XIJA 1B9ZA 3W0KA 4YYFA 2VX5A 4IFKA 1MO0A 3R0DA 2QUNA 3CK5A 1J4EA 3WQ6A 2WZIA 2XVLA 1XGEA 2PLCA 4IFKB 1EX1A 1W5MA 4E6MA 4HA1A 4G1KA 2R1LA 1TV3A 1V79A 4NZFA 4LEQA 5HQEA 3GDMA 1PV8A 3ZSTA 3TAKA 3RRAA 5BOOA 4CCZA 4FLOA 3QF0A 3DX5A 1AZ1A 1BYBA 4C91A 1L2UA 2ANUA 3WK0A 4I9TA 2QAPA 2AAMA 4IH3A 4QJ3B 2J9ZA 2WMHA 5JVLA 1TV2A 1W1ZA 4E3TA 3M7WA 3WDRA 3THCA 1FWTA 1EUNA 1T7LA 3RCYA 1XYLA 2DGAA 3VGHA 1X8FA 4JYDA 1UMLA 4YCPA 1KGUA 1EJVC 1Z41A 4L9YA 4HMCA 3RO6A 3BCFA 2PBOA 1H5VA 4IPNB 3NZPA 3W7DA 2YB4A 2OT1A 1EJSC 4PSPA 2TRSA 3FS2A 4AD1A 3UGRA 5EYWA 4G2DA 1NWTA 3GU9A 3AHVA 2Q3RA 3VOHA 3QV8A 4PUNA 3A47A 5E0KA 1Y7VA 3K1DA 1AFSA 4IUGA 3WENA 2BHUA 4XSLA 5CGQA 1KA9F 3HB9A 1KRMA 3QGKC 6TAAA 3BGJA 3L12A 1JPHA 3AIQA 5HMEA 1DJQA 1FX6A 1J0JA 2FHBA 3TJLA 1GWJA 3S46A 2PPGA 4GMEA 3UP8A 3WNMA 1J8VA 3LTSA 1F3XA 3HPFA 2FJUB 5CSUA 2DT2A 1F9CA 3FA4A 3SY8A 3ALGA 1XUZA 4N9CA 4IQLA 4RV3A 4D6DA 1F3EA 2C16A 3GXPA 3ITOA 5BXTA 3OVGA 4WSJA 5A6AA 3LXAA 2ZBTA 3KUMA 4W89A 1FWGC 2YDAA 1HT6A 2OKOA 2E9LA 3O6CA 2OYLA 1GQLA 4OQVA 4Y2WA 1OM0A 5L6UA 3QVQA 1J0HA 3VILA 3B05A 3QZAA 1YDNA 1V6TA 3T1GA 3K13A 2DP3A 4PUMA 4DQWA 4LVBA 3KOWA 3KRZA 1VZWA 3W26A 1Q5MA 5E09A 3GNNA 2PSNA 2GZXA 3M44A 3U2EA 4C6NA 1VEPA 4IISA 3PF3A 1B5TA 4PL2A 2FHFA 5G4EA 3CWNA 2YW4A 3LLDA 2DZPA 5FAGA 3S2MA 5DCDA 3DFTA 4AB4A 3SCNA 3UCCA 5A3HA 2GFTA 3OW1A 1F6PA 4RNIA 3JUGA 3CMJA 4G5DA 3WSUA 4K2SA 4O1AA 3HBLA 4U5KA 1IXOA 3W7IA 3P8JA 1UHVA 4FO4A 4IM4A 4AWTA 3PAJA 1TWSA 4B5WA 3FHQA 1O5KA 3QGVA 3WF0A 1ISVA 2Y1HA 4PC8A 1QI2A 4ZSUA 3N6JA 4AW7A 2XVPA 3WNPA 4Z08A 1DORA 2OTDA 1IT0A 4JHZA 5LHEA 2BFGA 3COTA 1H7OA 3VYLA 3SGGA 4O17A 3QC0A 4GO8A 3A4XA 2DSWA 3P5YA 3XIMA 1CPUA 3RILA 2ODOA 4PMDA 1KR1A 1TV5A 4H6KA 1E5JA 3WUEA 2XN1A 4QSFA 2CLIA 4PUDA 4H1ZA 1P6BA 3W37A 4HZ7A 2DT3A 3TWAA 1JJKA 4PMQA 1F7BA 1UR3M 2X7WA 5C2GA 3NDYA 2D23A 3DI1A 4Y9MA 3TA6A 2VX7A 3VKCA 2EPOA 1F74A 2PTYA 5CAHA 3W4RA 1W31A 3QOMA 4C6JA 1UD6A 3DFNA 3RO8A 3S4TA 2V8ZA 3M5XA 4TV5A 1B90A 3NTYA 4PUJA 3AXKA 2Z4GA 4AX7A 1QT1A 1W5QA 2OQHA 1OX4A 3STEA 2DSUA 5FL0A 1OX4B 4UQBA 2X0YA 3UWWA 3VIFA 2DJXA 1JXKA 3P8IA 7ENLA 3TVAA 4Q4QA 5BXPA 2V2CA 1CXEA 4PA8A 1QFEA 1EB3A 4LS0A 1MFUA 1XIJA 4NRRA 4JFWA 4HYRA 3W27A 1Q65A 2WK2A 2WSKA 4M3PA 3ZOAA 1RY8A 3WF3A 3IVTA 1WZAA 4OBRA 4RZ6A 1DVJA 4MB3A 1IEIA 1VAHA 4F2BA 1R3SA 1IGSA 2VFEA 1MFVA 3RXZA 3G1AA 2G37A 2CLHA 3N04A 1O60A 3NEVA 1HW6A 1E9YB 3UXAA 3WDPP 3LRLA 3LLXA 5T9CE 4A05A 3DGBA 1RCOB 3VKJA 4HGXA 5D09A 1IEVA 3NOYA 4LY4A 3R10A 3E2SA 2A3HA 3M7SA 3Q67A 2IPGA 4QITA 1Y8BA 3N1AA 2E9BA 3GTFA 4FHAA 4WQ6A 1K7EA 1AMYA 4FXFA 3RLHA 2BOGX 4MDPA 1W3LA 2FDSA 4XIAA 4P7NA 2OVLA 4B16A 3D0CA 1HXJA 1YNYA 1WXZA 4AIUA 2GVEA 4DJED 3BAXA 1GQKA 3WLNA 1KCKA 2GSHA 1QBBA 2Z1WA 3DKJA 2J7CA 1QNPA 3FXYA 3NCOA 4MY1A 3HZ3A 2INFA 3BZJA 3H22A 2Y70A 2XSXA 3ANUA 4XQ6A 1M41A 3QY8A 5HMFA 3C4UA 3QHMA 4LEFA 1DWGM 1NELA 3ZT6A 3K30A 1K1DA 2QUUA 4EXBA 2YBVA 3V3WA 4AQLA 1OGSA 3BLPX 5ABHA 5IFTA 2ISSA 3CPRA 2J7FA 5FEWA 3E0FA 4MPQA 3VOCA 1YE4A 3IANA 4GISA 2QR6A 4IG2A 3MWAA 3QR1A 3U3HA 3VM7A 3IRDA 2F7FA 4ZCWA 4IG2B 3LHVA 2OGYA 3ARYA 5A8QA 5D9OA 1JCJA 3V5CA 1KBBA 1Q8AA 3N18A 1BWLA 3CC1A 3UPMA 2QAFA 2CBJA 3K1GA 3T0TA 1BFNA 2RGMA 4GI8A 4JIEA 4RR4A 1U5HA 3ID7A 1TR9A 2PWEA 1ZU8A 4UZUA 3W7GA 3VNLA 3HGOA 3KZSA 5LNVA 3NPWA 3L2MA 1W2PA 4K6AA 4TMBA 4C5YA 3UWEA 1OB0A 1FKXA 2ZUNA 2PC4A 1KNWA 3IUIA 5DBTA 4NU7A 1B1YA 1XRSA 5IOBA 4D8LA 2E5CA 1T96A 4U4MA 3AUOA 1VP5A 1PDZA 4LV4A 2BOEX 4RZ4A 4DB7A 1K70A 1XDMA 1FHLA 3L0NA 1A4LA 4KWOA 1F2JA 1J6PA 1RLDA 2FZNA 4TVUA 2BY0A 2PE4A 1TJ2A 1WE5A 2XIOA 1D2KA 4HTBA 1VBRA 4W4QA 3D6NA 3MQTA 4LYQA 5HINA 4AIEA 3AXIA 3LBMA 2XH2A 1BWVA 3VKKA 1UZ4A 5HJYA 1IXPA 1HKMA 1OBAA 1GVOA 1PYMA 3GKFA 5B7ZA 3QKEA 4PBGA 3MB9A 1EF2A 2OKTA 4O16A 3TMQA 5M03A 3GHRA 5CJ5A 2C18A 2J6XA 4FSAA 4MKSA 3RX2A 1ZZMA 4HN8A 3R8HA 1LWJA 1G1YA 3L4UA 1MWOA 4LH8A 4O53A 1QO2A 2WB5A 4MF4A 9XIAA 4M80A 4J5NA 2HEJA 3KCOA 1WDSA 2B7PA 1ICPA 3CUFA 4UWMA 3T6CA 4DJFC 3NSNA 3USBA 1XIIA 3BAKA 2F84A 2H3DA 1JRBA 4DHGA 4R88A 1ICQA 2D24A 1YE6A 4IJBA 3K8MA 4E5TA 3H7VA 1NAL1 4AZBA 3MS8A 1UZDA 4QEHA 3ZWSA 1DYSA 1AUSL 4NZ3A 1FFRA 1JQVA 1M04A 1OYBA 3QZEA 4L9XA 2Q01A 1OFAA 4H2CA 1EKOA 3LTPA 1W3NA 2XYLA 3EMQA 5G4HC 4J4KA 1A0CA 3CL6A 4J27A 2XZ9A 3C2VA 2QJHA 2WANA 2NQ9A 4N2YA 4BS0A 4ADUA 4GUGA 2Y5JA 4ZQOA 5AYYA 3ABQA 4FAMA 1UD2A 2HQAA 4F4RA 1CGUA 1V02E 4OT7A 1IEQA 4WJXA 1TCDA 4D71A 1FFQA 4UC5A 3RPTA 4URIA 4QG9A 1S5VA 1DV7A 1RK5A 3O1NA 4X2RA 5HQMA 1XD1A 3CZJA 1W1IE 4F9JA 1DBTA 1G4EA 4RXGA 4A29A 3IGUA 2J7EA 5H2ZA 4ICCX 4QJ4B 4GI4A 2FB3A 2GL5A 4DI8A 3F7JA 2HSAA 1G4TA 4LAMA 1YADA 4H6RA 2BZNA 2CNCA 1VIZA 4ZQRA 4DUOA 3R13A 3WJXA 2GGEA 3ABRA 3W25A 1TPB1 5EFFA 5LIWX 3HPSA 5BU9A 1FVPA 3GG0A 4RDVA 1GQJA 1NWUA 3W2KA 5J04A 2SFPA 4Y96A 1FXQA 3G1DA 2PLJA 2ZWYA 4PB5A 3VO0A 4W85A 3CHVA 4XX6A 2GJNA 3K8LA 3ABZA 4MWAD 4NXKA 1PZ0A 3GD6A 4MNMA 4YWSA 1KRAC 1W56A 3KW3A 1RAKA 1ELSA 2IKIA 1W9BM 2IPFA 2YYTA 1QJWA 2JFEX 1OC5A 4NJIA 1VC4A 3QSTA 5EA9A 4MYAA 1AQFA 3DAQA 3ARVA 2QULA 4UTWA 1CNVA 4NYUA 2EPKX 4TUFA 3SJNA 1E0WA 3A6OA 2VQUA 1H41A 2PWFA 1C93A 3M4HA 3W1NA 3W7HA 4Q7NA 1FWHC 3M0YA 2KAUC 1E70M 4Y6GA 5BMWA 1FCVA 4JHOA 3CZEA 3A21A 3CHDA 1SJDA 3BAYA 1LWHA 4GY0A 2OOFA 4WJ8A 1KXVA 4PMYA 2W6RA 4GNKB 1GKRA 4Q4SA 4JTUA 3TTQA 4Y8EA 5LKYA 1X97A 1IXQA 1FWWA 4DJDD 4AWUA 1JD9A 5D9MA 2EJAA 1EEXA 2ZUVA 4TO8A 4P5UA 3RCMA 3W7PA 3BURA 4O14A 2EHHA 1SR0A 1OZQA 1QNQA 5LNUA 3M47A 5A2AA 1KC7A 3LXCA 3O8AA 3ABSA 3P80A 4P2VA 1ISYA 4Q8QA 4Z1BA 1GJWA 1KM3A 3NOEA 4A22A 2W79A 1UH3A 3KDOA 4DJFA 4BF7A 4EX4A 1XH1A 3AO0A 4AISA 2EO7A 2OOGA 4C7GA 1POKA 3MP4A 1QNRA 2D3LA 3WLIA 4QLKA 4IUOA 5EL1A 3ALFA 3G1VA 4CU6A 4JTEA 3FK4A 5IDZA 1W6TA 1KCXA 2VR5A 1OFRA 3OLEA 1MXGA 3VKAA 2O7QA 4XVEA 2VFIA 1I0DA 3O6AA 3VMNA 4MNJA 4YTRA 4CLMA 4I90A 1XWYA 3W71A 3LI0A 2REQA 4IIDA 3NXFA 2REQB 1NQKA 4R85A 2Z2AA 2W27A 1MSSA 2HNEA 1GJUA 4LV9A 1SM9A 1TJ1A 2P76A 3LN3A 3KP0A 3L4WA 3CIWA 2E9MA 4O54A 3G77A 1JF6A 3N11A 3P2VA 1GPWA 2PTZA 1DE5A 3EX1A 1EWEA 4WHBA 3VDAA 1Q2SA 1Q13A 3DFSA 1EGZA 4W93A 3OBAA 2OLHA 3EWBX 2MANA 3GDTA 4KRZA 4FP1A 1OG6A 3IS4A 1IIGA 1W3JA 2JKEA 3TOYA 6XIMA 1I2PA 4IFRA 2YFOA 5K3VA 3AMKA 3CBWA 1PTDA 2QJGA 3W2UA 3D5HA 4QE5A 2JGYA 4ZO8A 4JNMA 5FJTA 3T05A 3ITLA 1YXCA 1YEYA 2ZWZA 1K9FA 4NX5A 3HFTA 3OJGA 4GZIA 4NZJA 4O1CA 3FX4A 3P84A 4MUZA 1UR2A 1SZFA 1TB3A 1KTCA 2GVJA 3I10A 4LYKA 4RDWA 2AAAA 2XM1A 3BARA 8RUCA 2RGLA 1KD0A 3A23A 4J2MA 2NXGA 3AMDA 1PPIA 3WQVA 3U9IA 3PM6A 3EOEA 2XVNA 1LQ0A 3TTEA 5BMXA 1E9ZB 2FFIA 2Y62A 2ZX7A 1V5XA 4PR4A 3BZGA 5DCBA 3H4XA 4J3XA 3WLPA 4LS1A 3CB3A 4NNBA 1UKOA 5HR7A 1UD8A 3AWNA 5CBJA 1UUQA 3KVJA 3TU9A 2OSWA 2ZUWA 1JYVA 1QMLA 4ZTXA 1AQMA 4CD5A 4ZFMA 4MM1A 1W9UA 3FSUA 3V1HA 4DY1A 1E4NA 3D3AA 1PZ2A 1TTIA 3VOFA 4BWLC 2ON3A 2Z7KA 5K2ZA 4PCFA 2A6NA 3PZIA 3AZRA 4QAIA 4YVPA 1ODZA 2DH3A 1UC5A 3UVIA 4LVGA 1KV8A 3LERA 4F8XA 1H3GA 1D8CA 2I5QA 1FY6A 4KEZA 3DG3A 3VTRA 1RCXB 1SSGA 4IGSA 2EPLX 4GBUA 2GJXA 3OHIA 4CVUA 4HYVA 4PB4A 1R3VA 1TPDA 2R9RA 1XBZA 2R1PA 1E9LA 3TX9A 1DJYA 2BV9A 3UBPC 2GWGA 3TN5A 1LBMA 1UWTA 4KFNA 2QKFA 1E0TA 3NURA 3MKCA 1BVNP 2VVNA 1QI5A 2PLMA 3LDVA 5SWUA 3CPUA 1R30A 4AFYA 4QFUA 2WMGA 3FIGA 3RHGA 4C6LA 1MMFA 1NARA 3PZ9A 2VJXA 3TJIA 4JZ5A 5F4SA 4GY1A 4P7RA 3DFHA 3R8RA 2WKGA 4Z1YA 3EPNA 1JZ7A 1OFDA 3W85A 3KL0A 5U7SA 3GYEA 2XIIA 1XHGA 1ONWA 4UQCA 2NUXA 4LPCA 4W8AA 1XX1A 4ZOEA 1QW8A 1E40A 1CXHA 4OGZA 5I24A 4YCOA 1RSCA 2YDSA 1JZ3A 2HVOA 2VEIA 4JX6A 3NO5A 3VABA 3TMLA 4PMNA 3W6YA 1J6OA 4I8DA 3LLFA 4FNSA 3EA3A 3L67A 5C9ZA 4I6VA 2E40A 2JF6A 5D2TA 3CUZA 3U5UA 2E6YA 4GQQA 3F03K 2O56A 4UQEA 2JEQA 1NF7A 4PCSA 3W1TA 1O66A 3LYEA 4GYPA 1A5MC 4X0VA 1B3ZA 1R9XA 3MO4A 1OT1A 3W2LA 1E6SM 4UCFA 4C6KA 5BWAA 1GQNA 3N9RA 4GRSA 1I2OA 3CAWA 3GXNA 4DUVA 2GVLA 5XIMA 2ZZ1A 3WKZA 1EFZA 3TQKA 1K8CA 1JNEA 3EYPA 2Q3OA 3KWSA 3ME3A 1UKSA 3EWXA 4JKKA 2FFCA 3BH4A 5IBXC 2WSRA 3S9YA 3H7RA 3WQOA 2WCAA 4HU8A 1G67A 2ZADA 1QW7A 3P60A 2PAJA 2AMGA 2OPJA 3NNTA 3BSHA 3LQGA 3STPA 1PE1A 3AALA 2XPKA 4XB3A 4LXFA 2J66A 4YTUA 3BC9A 3ATYA 1P0EA 4JN8A 2V0TA 2C79A 1PCKA 3QY7A 5TIMA 1CB7B 5I5RA 4FXSA 4GOAA 1XYFA 3E0LA 1UKPA 5JUVA 3KM8A 3T2PA 1UBPC 1OFQA 4NZ1A 4P7QA 3MMWA 4ECLA 1IT8A 1LOSA 1WKEA 4MY8A 4HN4A 6XIAA 4GINA 1NDVA 5FESA 4MB4A 5F2LA 2Q8XA 3HURA 1ENUA 4XD3A 1GEQA 2J7HA 3JZEA 4CCEA 2FTYA 1AL8A 5JMUA 3VPLA 4XKYA 1W1VA 4O0KA 2PP0A 3H26A 1CLXA 2PDGA 3W1UA 3VIKA 4WRHA 3SJ3A 4XKYB 1XYCA 2DEPA 4HJFA 3IVSA 1VKFA 2PGFA 1J2BA 2Z6JA 2TMDA 2PEVA 1MI3A 1IF2A 1NP0A 3ES7A 2ZZ6A 3RRXA 1S2TA 3FVMA 1VRXA 4ZO9A 5HQLA 1M1BA 3ANYA 1NQ6A 3GDRA 1EHNA 4CQ9A 5BCAA 1ME7A 3N6HA 3DDMA 4RE3A 3I4KA 2G0WA 1JFHA 4S3AA 3TJXA 2W4XA 3RX4A 3P0WA 4IPJA 2OSYA 1XFBA 4UR7A 1OF8A 1LT8A 4AZ5A 4GQBA 1R2SA 1SZEA 3M0KA 2UY4A 3O2LA 3ELFA 3LOTA 2QDGA 4PRWA 1BGGA 4MKNA 3WJZA 4DLMA 3IIZA 3PAOA 1FTXA 3UXIA 2PDLA 1QVBA 1B0IA 3EX6A 2ZICA 1H5YA 3MYPA 1PX3A 1F07A 3UXLA 2A7RA 2VC7A 4Z1CA 5EMLA 4YYCA 4DX3A 4KPLA 2DU2A 1UH2A 1J5SA 4QCFA 2DZSA 2AQVA 3ZJKA 4ZB0A 3GNXA 3BQ5A 4RZ5A 4YTSA 2FLIA 1NWRA 3SI9A 1JDEA 3WMLA 5G5IA 4UTMA 4RL3A 1V7YA 2OEMA 3QR3A 3FHAA 1NDZA 2POZA 3CQIA 3GSMA 2VD8A 5GJPA 4PTMA 2XUCA 2DQXA 3DBNA 3DFYA 4DYEA 4S2CA 3WBXA 1QNOA 1XINA 3L5AA 3IIXA 1TZ9A 1SFTA 3KEHA 1R46A 1DE6A 3AU6A 2YCJA 4MSSA 1TUXA 1B54A 4XISA 1MDRA 3TW9A 1UD5A 4GQ0A 5K9DA 3EAUA 3AXMA 3E2QA 3QSRA 1B3YA 3PZTA 4ZL1A 5D9NA 2ZRYA 1V4YA 3RAOA 2EBNA 4OBSA 3PBVA 4U3CA 2NUYA 5D33A 1EF3A 4B9ZA 3CUXA 4GIRA 1YLVA 3ITGA 4DNHA 1US0A 1I2NA 1QI3A 2CBVA 2DORA 1Q6DA 3BAJA 5AHLA 3ICJA 1AD4A 1WDWA 5HJXA 3PSVA 1S2VA 4AX6A 3P93A 3BDKA 2GWNA 1GYNA 3PTMA 4JBRA 4D2JA 1D7FA 3BQ6A 5LSMA 1ZAIA 3VM5A 3IV3A 4JTCA 1V7AA 3N4AA 1LCOA 2Y8UA 4Q4KA 4UOQA 1JCXA 4HPJA 5IXEA 5FSEC 4I9MA 5E93A 1D3CA 4QTGA 2FQIA 4GVGA 2PDFA 1WZKA 1UWRA 4M5PA 3KP1A 3TCEA 4HNOA 3LPGA 2BS9A 2ZX6A 5T26A 3R11A 4GNJA 3DHUA 5T8GA 3KS6A 3F2BA 3UZJA 2I57A 2XGBA 3VOJA 3WK1A 3EZ4A 4I5RA 2IKJA 2O4MA 3ABOA 1BRLA 1UROA 5D37A 5BRQA 1BRLB 3N29A 1PVNA 3WX7A 3W1QA 4ALDA 1LRNA 1OWQA 3UFYA 2VZSA 1VD6A 1ZALA 3HTWA 4KEUA 3G0UA 4HP5A 1ZGDA 5HXMA 3NQ2A 3PY2A 4JFSA 3QQ1A 3MUZ1 2ZXDA 3B03A 4AUBA 1XLJA 1YDOA 1XCFA 3O0FA 4EPDC 3W23A 1UP3A 3B8SA 1IQ8A 4WZHA 1HKKA 3ZVIA 4NHVA 3WBYA 4O28A 1WZMA 4R9OA 3V36A 3CV2A 1H1YA 2JKAA 1W32A 3JVAA 1VIWA 3LPOA 3NG3A 4Q8NA 4MJZA 2O55A 4S3BA 4EE9A 2NX1A 2CESA 2E3ZA 1W9PA 1YBQA 4Q6JA 2HVMA 3CT2A 1YBQB 1XIGA 4HU0A 3E0IA 3AYVA 1FDYA 1MEHA 4JHMA 2QGHA 1ME9A 2R14A 1TIWA 1BVZA 3RK8A 4LCSA 2DSVA 2DW7A 1BEUA 3R0UA 4KCWA 2GDQA 4JTAA 1IWAA 5FEPA 2JIEA 2IXVA 4J3UA 5FA5A 3G1YA 4NJKA 1XR2A 3AZTA 1R38A 2A3LA 3URQA 2P0IA 3BGGA 1V6YA 3PUEA 4YLWA 3W1LA 3WEZA 1AJZA 4D6CA 2G95A 5C9RA 1TTQA 5M1TA 2XHYA 3AUJA 4IZGA 3R8GA 3LS9A 2GGHA 1EP2A 2NLYA 2WMIA 2I17A 2HBXA 1GHRA 2VWSA 2WMIB 5C9WA 4R53A 4UNIA 3H55A 3WUFA 2QCCA 3GO2A 4I7VA 1L6WA 5I3GA 4PMXA 3TNBA 3N2XA 4DWSC 2TSYA 1SVDA 5JBDA 2EPMX 4YIWA 4EANA 1BHGA 2PWGA 3EWYA 4JEQA 3GC2A 3S6DA 3CUJA 1JI2A 7CGTA 4CQBA 1CXLA 2CZDA 4H9YA 1NFGA 4XKMA 4HKPA 1XH2A 2NV2A 2DUAA 2DJLA 4I7WA 5EB8A 3H7UA 4Q8OA 3QMTA 2CPUA 3GK0A 1CEOA 1XICA 3GXMA 5HMDA 2ACRA 3MSRA 5AECA 1EQCA 1C7SA 4JKLA 2J77A 3OODA 3HG2A 3F4WA 5ECUA 4IGNA 5G2HA 4GLEA 2FVLA 1L8NA 3QRHA 1H7RA 4K8EA 1O4UA 3LUTA 2OXNA 1HIZA 1XLKA 1OYCA 4M6QA 1VPQA 2GOUA 1CW2A 5D2WA 2NV9A 3D47A 1E0VA 4ORMA 2TYSA 3UZXA 2GUYA 2HJPA 1DWFM 2FZDA 4PUKA 2I7GA 3CHCA 2YIHA 3PR2A 3NQBA 3G22A 5I3DA 4CEXC 1E1FA 3NFUA 5DCEA 1JGIA 1S1RA 2DZTA 3W29A 2OQYA 1G4SA 4D6JA 1XYMA 1EXPA 4ZBCA 3G3DA 3KOXA 4MDOA 5EMKA 5DXXA 1A5SA 2QPUA 1PS9A 2ATSA 2GOKA 3A5VA 1H1NA 3RU6A 2FVMA 1H61A 1C92A 3F2DA 4YN5A 2OYMA 3Q2DA 1ZNNA 2GPTA 4C90A 1V3JA 3VD3A 2R94A 1VCGA 4B3LA 3WD4A 3LNPA 3VMOA 3OOQA 3WDHA 3RITA 1G94A 1W3IA 4KQNA 2BY2A 3VDGA 2XIMA 3E0WA 2C3ZA 2C0AA 3LB0A 2WSYA 3ISIX 4B90A 1W8SA 4GX8A 1WBJA 1KQYA 3B8VA 1TPWA 3NPXA 1NJJA 5AHMA 3N2MA 3FLUA 2XU2A 1TE6A 3PZUA 3VDHA 3N73A 4UXDA 3MVIA 3DXIA 1HUVA 4PFHA 1QWKA 3FAWA 4NZ4A 1UR0A 2PRMA 3S1XA 4W88A 1QK2A 3CASA 5TBOA 3QGAC 2PDJA 4H9TA 2NQ5A 3S3GA 2UY2A 3MMUA 1V77A 3WD2A 1TWIA 1W54A 2DZWA 3EKLA 4EP8C 5C9XA 6ENLA 3C0JA 2V5KA 4B5VA 3MHUA 3E2RA 2WKLA 1MYRA 4FR1A 2UBPC 3GVVA 3XINA 4E8CA 2PWDA 3ZR5A 1TA3A 3EEGA 7REQB 4TIMA 4UB9A 1TA3B 3VC5A 3LY0A 3EX3A 2C91A 1UD4A 1ICSA 2OODA 2D0FA 3R4IA 2L5HA 3DUGA 5KZMA 4UTUA 3QTGA 1XJBA 4LCRA 3QW4B 4GCXA 1M7OA 5LIKX 1UQYA 3U7VA 5AC7A 4OV9A 1CXKA 3TKFA 4US6A 2VZTA 3V5OA 2XWEA 4KKXA 4LBSA 2Y6ZA 3RU8X 1Z3NA 1P1XA 4S3JA 2OJPA 2V3GA 4D72A 1NTHA 3W7CA 8XIMA 3K4WA 2J62A 1OCBA 2PI6A 3ZR4A 4B9YA 4C6CA 2R1KA 1BG4A 1GOMA 1RVGA 3NO1A 4QDPA 2YL6A 3PJUA 5J8LA 3ZSSA 3BMVA 3W02A 2F6UA 1EO7A 3W7JA 5KMYA 3FYOA 4UOJA 1EGVA 1JL8A 4TVDA 4DZ5A 5CZKA 3MW7A 2HXUA 4Q33A 3E0VA 1BKSA 1TVLA 3WFLA 4BQ3A 5AHIA 3RM9A 2ZKMX 3VU2A 3GNRA 1M65A 4KW2A 3G0XA 4R27A 1VYPX 4PMUA 3UWQA 1N7KA 1PO9A 2JEPA 4QHRA 3W87A 3ES8A 4YU1A 4H8HA 3A4AA 2XJ7A 2GSJA 3DH7A 1K8YA 4DXXA 3QMSA 4KRTA 2G50A 1VQTA 4D8AA 1QDSA 2YA2A 4FF5A 2ZRVA 5IHSA 4O50A 4O0QA 2ZDSA 3IJ7A 2PS2A 3C8NA 1XSIA 2D2OA 3N2BA 3PK7A 4GO9A 4IFOA 3QFEA 1FXPA 1V3LA 3R12A 1KWGA 4D1JA 4BFAA 3MCMA 4C6MA 3L4VA 3IV8A 5HA7A 1KM2A 2QPXA 2NUWA 1RPKA 4W7VA 2E09A 4FNUA 2ESCA 3S1WA 1EJWC 5FF0A 4NI8A 3FJNA 5H8MA 1AW2A 3F5JA 1AQHA 3VUPA 2JBMA 1EJTC 1ZBVA 3VE7A 3WUGA 5BOEA 2YA0A 2CLMA 2FVKA 4QAWA 3N2OA 3AAMA 4CU7A 3PULA 1YHTA 3EPOA 2NVDA 2QW5A 1WO2A 5J5DA 3PANA 3WH5A 2AMXA 1LORA 2FPYA 2WVVA 3VGFA 3VFCA 4CD4A 4M1RA 4H9ZA 3UY7A 1ISZA 3W6LA 2WVVB 4HOWA 1MDLA 2G41A 1MEWA 1VHCA 1O68A 3HIJA 1GG0A 2QUTA 3S5ZA 3HGJA 1A3XA 1OF6A 1L0PA 1DXFA 1HL2A 3T4CA 2ZX5A 3WH7A 4A8IA 2V30A 3WD3A 2YJQA 5DXYA 1EYWA 5AZ0A 3WQ4A 1BG9A 1DJXA 3WK3A 4GH3A 3CYVA 3E12A 1QPQA 5HULA 3I68A 3W28A 3VX0A 1H63A 4DF2A 4RKAA 1A49A 4B3ZA 4LFYA 4KMQA 5AC4A 3JW7A 3WFAA 1Q6GA 1DJWA 1ZL1A 1V0NA 2VC5A 4BJHA 2PDBA 2X2GA 1YKWA 3SUSA 5FSDC 4Y9PA 3BOFA 1UOKA 5AY7A 1KLYA 2PFHA 4MKVA 1Z42A 5DANA 5I07A 3TJ4A 4A8RA 5HPOA 3UWUA 4QE4A 1H49A 3ORWA 3WG6A 4FMVA 3OVRA 4QQUA 4L4OA 5KETA 2ZRWA 3GW3A 3IUHA 2R24A 3WLLA 1ZQ5A 1H09A 3EXTA 4K1WA 2HV5A 4DELA 1GVIA 2GJPA 4IPPA 5LHFA 4UFIA 3CH0A 4LAUA 3NJ3A 3VNDA 1JULA 3MCOA 3QHNA 1XLIA 2BB0A 2E5DA 2W67A 3DYPA 3PNUA 1HKIA 3QV9A 4GZJA 5D4YA 3LHTA 2WV8A 3AS1A 1OC7A 4LAZA 5C7VA 1JGMA 3QQWA 2VP8A 2ZC8A 4FZIA 4J3TA 5I79A 4AC7C 5D8WA 1LLWA 2FPTA 1Q6QA 1UIPA 2RH9A 4XD4A 2Z1BA 4O18A 1LG1A 2G3MA 2OEKA 2HZGA 3GFZA 1EYEA 4W7WA 3AIUA 3SFKA 1E4IA 3NVDA 4DAIA 2WMFA 2Y7DA 3UGVA 2VZVA 2DSKA 4D9PA 2UY3A 4ZO7A 4HSHA 1P0NA 4E8DA 1XDJA 3EB3A 3A24A 4KEVA 4MYXA 4GJJA 1KO0A 4KIRA 3ZXWA 3PUDA 3GB6A 4MY9A 1XCXA 4H4IA 3AHYA 5DMYA 1OK4A 4TOQA 5FJJA 5JU6A 4Y9AA 1VJSA 5A6MA 1EIXA 2IS7A 4IIBA 4HB7A 1P6WA 2XH0A 2XH7A 3OGSA 4C6QA 2TODA 3GG1A 2Z26A 1ADSA 1OD8A 4PB3A 3MKVA 2OR2A 1JZ6A 2ZVIA 4AD0A 1Q2RA 1F8IA 1JPMA 1DTNA 5F1VA 3A4WA 2NQJA 2GSEA 8CGTA 3H54A 1O94A 2E6DA 3W7MA 1R9ZA 4AEEA 1I1WA 4L61A 1W5PA 3N14A 2PDIA 4GGBA 3VNYA 2J7BA 5LXXA 1ME8A 4QSHA 1JI1A 4P61A 4EKJA 4N02A 1JXJA 5E9AA 4LRSA 2O9PA 4GVIA 3WLTA 3VNIA 4S3KA 4LAKA 2QCMA 2YCIX 3FJLA 4JN6A 1UIOA 2BSLA 2Y88A 2WSQA 3I7QA 4FOKA 1KKOA 5C2XA 3EOLA 1G7VA 3VZXA 2QPSA 2WM0A 4MFEA 4Q7IA 3CV6A 1GORA 1I6NA 3LCHA 1C7TA 3PPCA 3ZQ9A 5G1MA 1YXYA 4DJEA 1OCQA 1ZBKA 1HG3A 3AS3A 1B3OA 5FF4A 3T44A 4IIEA 4Z1DA 3S5YA 3QOKA 1OFOA 3Q37A 2A2IA 3NQDA 5G1TA 2Z25A 3VUSA 4RW3A 4QXIA 4AD4A 4OOUA 6ALDA 1HTIA 3BICA 4LUYA 4NZ5A 1GKQA 1D8WA 2V82A 1RD5A 1ZJIA 4IIGA 4XO6A 1R2RA 4MFDA 4POCA 3MP3A 4UMBA 2QJNA 4D6IA 4TV6A 3UR8A 4DUXA 3WMBA 4C1NA 4ZOCA 3W72A 1X98A 4C1NB 1XG4A 3GTIA 4ROPA 4XZWA 1ISWA 3MUCA 1A53A 2WW5A 1EGMA 3MC5A 2G3JA 2WJDA 4ZQPA 3IK2A 4WXZA 5EMJA 4RUBA 2E6FA 1OQFA 2V3FA 5AYBA 3ITTA 4LAOA 1QATA 4KCTA 5I77A 3LG3A 4D6GA 3M41A 4FIQA 1W9VA 2A79A 4O12A 3W84A 2VRJA 4H00A 2QHAA 1EPVA 4X60A 2QEZA 3W7KA 2WNNA 4MLRA 3UYIA 3M5YA 1KXHA 3I6EA 3N4FA 3UG5A 2QIIA 1W9XA 1XKJA 4B5UA 2FZ8A 4BZYA 3P62A 1Z7AA 4HT3A 3EOOA 2XTKA 3HO8A 5HR6A 1DJHA 1GOXA 4LUJA 4JTLA 3UT0A 1J5TA 1XI3A 1L9WA 2YGYA 3GRIA 3NQMA 2VZOA 1E6RA 3S5SA 4HA0A 3J7HA 1J93A 1QHPA 1T40A 1YW1A 1ITCA 3H2MA 4LUSA 5IRPA 3KTXA 1XIFA 1FH9A 4JTGA 3ITXA 4QLJA 4WDWA 3TSMA 3LHWA 2ZCGA 4LUSB 4N6EA 3B3DA 1SYTA 5GPRA 1R7AA 4CQ8A 5LA2A 1VHNA 4UUIA 3URAA 3MV01 3O16A 2QDDA 3XISA 1JUBA 4K36A 1ZJBA 1E15A 1FH8A 2FH8A 1DIDA 1X1ZA 1RXOB 3PZMA 1C9WA 3QBUA 2X1SA 1P0KA 1TV7A 2CEQA 4HK7A 4DAFA 1XPYA 2GQ3A 3T0AA 4S23A 2VCBA 5A6SA 5EY5A 4J3VA 4DRSA 1KBKA 3TAOA 4PMJA 3NPUA 2IKHA 4ZVJA 3HGSA 1LL4A 3MKKA 2VOMA 1UKQA 3TYUA 1EEPA 1HP4A 4QNWA 1VBJA 2HMCA 3G6LA 3S47A 4UTTA 5DELA 2OQLA 1BVWA 1XRTA 3VNKA 2HTMA 2OT0A 5ENLA 1B3XA 1CENA 4EIVA 2YL5A 2CWNA 1QUMA 3OG2A 2X1IA 1YXDA 2WKJA 1ALDA 3KLKA 1OCJA 3DC8A 1OY0A 4ZTYA 1TZ7A 1GW9A 4JL1A 5HJLA 2CU0A 5A8PA 3TCSA 4F2UA 1KFEA 2F38A 2J8TA 2F2KA 2X1TA 1XYBA 2XG9A 5KZDA 2ALRA 4R33A 2J24A 2PDHA 4Q8TA 4O11A 4HJWA 2DZBA 2A3CA 2WC7A 1UPMB 4DUWA 1EA0A 4AZ6A 2X7VA 3WLSA 1A4MA 1LBLA 3BLKA 1E6NA 2DW6A 1PKNA 1W1B1 3UG4A 3FCPA 1OFEA 2YW3A 5AKQA 4ZFCA 5D9PA 3RMEA 5CPLA 1E5NA 1TRIA 3EPMA 4Z2KA 4I5XA 4X61A 4DLFA 1TR1A 4DM1A 1TQJA 1EXBA 4YL2A 1JAKA 1Q7ZA 1XLCA 3EWUA 3W81A 1XLDA 3TC7A 3NZRA 1KRBC 2JQXA 3M0XA 4YVXA 3SGZA 2MUCA 4GJ1A 2P8BA 2FGBA 4JX4A 1K4GA 2DH2A 4MWAA 4N4PA 4MWAB 1ZCCA 4DO7A 1N55A 3L4YA 4Q8WA 3JZUA 2EQDA 1TMQA 1ECQA 2WJFA 1ZJAA 1KWKA 5B7YA 4N42A 1RJQA 2PB1A 1KM0A 1WAWA 4QM1A 2OWXA 2YX0A 4CNSA 3M0MA 5PTDA 4TX6A 1XL9A 4Q8MA 2QQ6A 3GFYA 3VKDA 1U5JA 4Q4MA