2NMQA

Simultaneous determination of protein structure and dynamics using rdcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
TYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G precursor
publication title Simultaneous determination of protein backbone structure and dynamics from residual dipolar couplings
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Signaling protein
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nmqA00
4IOIE 2PW9A 1MHXA 1HZ5A 1P7FA 1FCCC 2IGGA 1PGBA 1JMLA 1Q10A 5JXVA 2LHDA 2I38A 1HZ6A 1XF5L 2N9LA 1EM7A 2ZW0A 1GB4A 1ZXHA 1HEZE 1PGXA 3V3XA 2J52A 2ZW1A 5HI1A 4MACA 2GB1A 4D2KA 2JWUA 2LUMA 4HKZE 2EELA 1YNTE 1GB1A 2K0PA 2ONQA 4KGRA 5HHDG 2KWDA 1K51A 3UI3A 1MHHE 2GI9A 1P7EA 2RMMA 2KDMA 2LGIA 5BMIA 1FCLA 1YMHE 3MP9A 2JZPA 2JSVX 4OZBA 1XCTL 2IGDA 1F2RC 1C9FA 4WH4A 2J53A 4OZCA 2QMTA 1MI0A 1IGCA 1K53A 2RPVA 2N7JA 2KACA 1XCQL 2KN4A 1QKZA 4KGSA 2LHEA 5HFYA 2PLPA 1UWXA 4OZAA 4IKGA 1KH0A 1MVKA 1FD6A 3FILB 2ON8A 4GLSC 1D4BA 1K50A 2NMQA 2QSDA 3FILA 1IBXB 3GB1A 4KGTA 2JXTA 2I2YA 2PTLA 5BMGA 5HG2A 1IBXA 5BMHA 1IGDA 2OEDA 2N9KA 1MPEA 1F2RI 1PGAA 2KQ4X 4HJGE 2JU6X 2IGHA 1K52A
chains in the Genus database with same CATH superfamily
1VCBA 3VRAB 1N5XA 2W54A 4EZKA 5EE0A 4HVBA 1MG4A 4LNNA 2C7MB 4XDDA 2BBCA 1C1YB 1R4NI 4XC2A 1E7PB 5I4DA 4CYEA 2I1KA 3ZRCA 3MC9A 3H8HA 4BKSD 3PVLA 2M1MA 2WXKA 2RPQA 1YJIA 2DZMA 3IAM1 2IZVB 1E7UA 2MRPA 2JWUA 3MHSD 2LUMA 2LEKA 1CMXB 4RNAA 3RD2A 1OGWA 3N32A 3ZJVA 3V6EB 5E6NA 1E6EB 2K8CA 2Q5WD 4C4VB 3C8YA 3B2GA 2RMMA 2N1WA 1WZ0A 4RGTA 5BMIA 2HTME 1JWSD 1FMAD 2CS4A 2NR2A 1P9DU 1FXAA 1C3TA 1A70A 4G50A 1NI2A 4NAWA 1H8CA 3UQBA 1E8ZA 3PSEB 4GSWA 4TQ0A 2V3NA 2DBYA 4OZCA 4II2B 2RPVA 2Y5PA 4YWGG 2KTRA 3HM6X 1X1MA 2NS5A 2GBJA 1Z2MA 1TY0A 3AE6B 4BKTA 2C5LC 5GMVA 3ZDTA 1VRAB 1WJ6A 4AS1A 3P2BA 4N9F4 2RDHA 1P0RA 4LK0M 2E3TA 2N7DA 2ZPNA 3DWGC 1TKYA 3ML8A 2KMCA 1EU4A 2D07B 2N9XA 2DLBA 2MJDA 5CHWA 5IOIA 2K8HA 3PZ8A 1FFVA 5FK9C 2JUOA 3TL5A 5IO9A 1XO3A 2JU6X 3AE1B 1ZE3D 2IGGA 1NDDA 3H9DA 4DK5A 3K9PB 3BYTB 5JXVA 3KUCB 4NQLB 3O65B 1WJUA 2YLMA 2J0MA 5BYSA 2MBBB 3R7RA 2R61A 2C7NB 4GDKA 4NJ6A 1WRIA 2KHWB 2MW5A 3RNFC 3BY4B 4W9KA 1J19A 4FJYA 2KAJA 3JSVB 5AEKB 3AULA 5MPOA 2R2QA 4GGQA 1JRUA 3BVMA 5E6JA 2I1JA 1Q1OA 3QJZA 3CMMB 2FAZA 4K3CA 2Y5CA 3TBLD 1J0GA 3Q8AA 4HK2A 2WXMA 4WWOA 2FUHB 1UUPA 4RGMA 2LRWA 1D5XC 1WJ4A 1EO6A 3QHTA 3QQ8B 1WZ3A 2W55A 2REXA 4QAYA 3DWMA 3EUB2 1V1PB 3AE2B 3EHVA 4MGZE 4EEWA 1QKZA 4ZYSA 3PZDA 2LHEA 1SGHA 3VXWA 2LGSA 4YT0B 1S3SG 1N5WA 5BYRA 3L10B 4US9A 1SE4A 4ZDVA 3VFKA 2DAFA 2I2YA 4HEA1 5HKHA 1CZPA 2WDTB 2K25A 3EECA 4M0WB 3P4QB 1E8YA 3MFGA 1WXMA 3AN1A 3AEDB 1TS5A 3TCAA 1E5WA 2MH7A 2MSED 3SR6A 1MHXA 3W2DA 2KVRA 1V6EA 3Q3OC 1FIQA 1B1ZA 5C2TB 4PS3A 1IUEA 1L7YA 3U52E 2J4XA 3ZVVA 2FE8A 2LGDA 2QILA 2WS3B 5LXIB 1V2YA 5FR3A 2QIEB 4YTMB 1GB1A 4IW0A 1RLFA 3H7PB 2BW2A 1L6UA 1NEKB 1UBQA 1N6ZA 4B6WA 2KQSA 1L4ZB 3A9JB 2LRUA 1C76A 1WYWB 2J0JA 5IN7A 2IGDA 1Y56A 1F2RC 2L0FA 3HVZA 1SB3C 2G3QB 3A1QB 3NVYA 2JRHA 1FNWA 1EWCA 4HXDA 2PLPA 2WXIA 4IKGA 1MVKA 2PIAA 3VQIA 4LNKA 2WXLA 3FILB 4K7WA 2UWQA 1KTKA 1SE3A 1OQQA 3AECB 1V97A 1B9RA 4FLHA 3URYA 3VUXA 4KV2A 3RN9C 3AEAB 4JL9A 4ARCA 3T3OA 1TS4A 2KC2A 3AH7A 5G2NA 1F0ZA 1OEYA 3IBEA 2KT7A 2V0GA 2GRIA 4MDKE 2WX0A 1KLUD 5LXHA 5T8IA 2MWSB 2LD9A 2G1EA 4ZRPA 1C4PA 3MJWA 2EKEC 2KMAA 4HCNB 1M94A 1FXTB 1MG8A 3VDZA 2J7QB 1XLPA 1XD3B 1Z5SB 2GBMA 5DPSA 3RI7C 2ZW0A 4J3OD 1WGGA 1YJ1A 4NNJB 3QARA 4URKA 1FRDA 4ACFA 5C23A 3ZO5B 2PJHA 3AE3B 2DX5B 1VZ7A 4M00A 1R4MB 5HHDG 3OG5A 1RWSA 3UI3A 5JH5C 2ZVNA 3BWUD 4B95A 3PLVA 2E6XA 1XLQA 1BT0A 4NAWB 1N63A 3HHMA 4MT5A 2KJRA 4M01A 4W9FA 5EDSA 2Z0EB 3EGRA 4EOYA 2KTRB 1WMHA 4OVVA 1YD8U 3AXCA 1K53A 3ZLZA 2HDEA 2L0TA 1KRHA 1TGZB 2KK8A 3D32A 3JW0X 3PHWB 1ACCA 1FFUA 3C0RB 4K81A 1UWXA 3Q8BA 2D3BA 4WJOA 4ZRJA 3WALA 3W5UB 1D4BA 2Z8LA 1T6BX 4M02A 1P98A 1S1QB 1Q0WB 3SDLC 3WIMA 2O6VD 5BMGA 2KN5A 3KWLA 4AJYB 3DVNU 2KC1A 2NBUA 2WWZA 2DZJA 1WXVA 3L08A 4JGHB 4A20A 1L0XB 2X8XX 3KUDB 3H6NA 3EC8A 3ZKJC 3LXFA 1WGKA 3VTUA 1ZUD2 4YSXB 5D6JB 1P3QU 1PGBA 3UGBB 1TKEA 3GZNB 4M8MA 3OAWA 4FA6A 2KYWA 4I6NB 3TIXA 1NENB 2IO2B 1FNUA 2V4IB 3UIPB 2ZCCA 2BKRB 2FCNA 1ZXHA 2HJ8A 4R3DA 2NVUI 1C4AA 2L1AA 4WWPA 1GC7A 2ZNVB 1YNTE 3IT4B 2JX5A 3W1YA 2L00B 1I4RA 2MQJA 3QK0A 3CSTA 3TEZA 2KDMA 1UF0A 1E10A 4HRSA 4WWNA 4BVUC 2C60A 2GBRA 2LVOA 2DZKA 3U8ZA 3DQVA 3CSFA 2INPE 5AUIA 4WJPA 2Y3AA 3PGEA 4IWQA 4GDLA 2IJ0A 4BKSA 3PRZA 2WQYB 1D5MC 2WU5B 3I57A 4ICVA 2WDVB 2QSDA 3C19A 2BWES 1WXQA 2OJWA 3QAQA 1YN5A 4KZCA 4RGOS 4XX5A 3WAMA 2EMTA 3QA8A 1JROA 3U30A 1FNVA 2KJHB 2W82A 4NJ7A 4I6LB 3HM3A 2PW9A 1FCCC 3I3TB 1WE7A 2BS4B 4MEMA 2BS3B 2PVGC 2I38A 3L13A 2LXCA 3IHPC 1E8XA 4KSLC 1EF1A 3NVWA 4LNIA 3H7SA 3ZNZB 3GP7A 4ANVA 1V1OA 4KKJA 2KLCA 4BBNC 5TR5A 3V3XA 2W3SA 2MP2A 3B9JA 3I9V1 4HKZE 1R4MI 2YEPF 3L17A 2PVOD 1DYQA 4HLEA 1TZOA 3E56A 2CKHB 5DCNA 2LWPA 2MBOA 2KWUB 3PPAA 3MP9A 4RCOA 1T0RC 4K7UA 2JYEA 2MJ3A 4LCDE 2BYEA 2JQRB 1I4HA 2C9WB 1IP9A 4P1CC 2WU2B 4GU2A 1VZ8A 2WXJA 5CHVC 1F9JA 1WX9A 3TJPA 3QIJA 3PZ7A 4RF1A 4XWTA 2K3UA 4WWMA 1FO4A 2KZRA 2W3RA 1WGHA 1GOZA 1ZXIA 2DYBA 4L1BA 4A6QA 4CO7A 1K50A 3RZWC 1JWMD 1PUTA 3R66C 4AUQC 3AMZA 2PTLA 4YTNB 3NOBA 4OW0A 2JT4B 3GE3C 5E6PA 2KDFB 1I35A 1TKGA 1LM8B 1YN3A 1K8RB 2OEDA 1HTOA 1JRPA 2FNJB 3KYDD 1VZ6A 3NJTA 3DBSA 2CU1A 3GZNI 1AW7A 3L16A 1JALA 1P7FA 1J7CA 2ZNVC 4FHKA 2M19A 3T3NA 2N4FA 1ZKHA 2QDFA 3PS6A 3O13A 2CJNA 4FJZA 3ZTCA 1GB4A 1JWAD 1WX7A 4IWPA 3WAPA 3OWEB 1HE8A 2J52A 1U4AA 4HKQA 3TEYA 2DWQA 4EZJA 1K51A 2D2QA 4DHJB 2LJIA 2H88B 2JVCA 4HPLB 1NBFC 3AI5A 1FCLA 3ZYYX 3X23A 1WMHB 2GMIC 2N0SB 2WDRB 5D94A 3Q69A 1E8WA 1FRRA 4BAXA 2M0XA 5AZGA 4PT5A 2AEHA 4MJSA 1UZXB 3RNEC 4WURA 2J42A 2D3GA 4P1BC 3E9SA 5DPRA 4FJVB 4J6IA 3CIRB 3HVDA 3V6CB 1OQRA 2CR5A 1V5OA 3V05A 2X38A 3ZGZA 1QT9A 1NVID 2KMMA 1GG3A 1F52A 4ZHOA 3ZNHB 4L23A 4E3CA 1H4RA 3RCZA 1E0ZA 3RUIB 2OOBB 4EUTA 1HXYD 1M4VA 4B0MA 4ZYNA 3N30A 1I4QA 1WGDA 1QOFA 4A55A 2VZKD 2A5UA 3VTVA 2PE9A 1YJJA 3ZTDA 4A3PA 4JLCA 1TYGB 1HTQA 4Q2JA 1EM7A 2Y5BB 3CWIA 5FR6A 1NYQA 2VH1A 1WYGA 2ZW1A 5HI1A 2KD0A 3ZJTA 2BB6A 3IXSA 3RULA 3S2AA 2M8SA 1YX6B 3DBHB 2BT6A 4KGRA 1OEYJ 2ZVOA 3ZUNA 1TIFA 3NRZA 1SJHD 4FXCA 3DBRB 2WNMA 1YN4A 1QOGA 3TUOA 1J7AA 1DOYA 2LGIA 1V9JA 1YX5B 1RFKA 3BZDB 5D3DA 4LNFA 4HJKA 2B76B 1KJTA 1ENFA 1WI0A 2WXPA 3B08A 1MFWA 1OTRB 2B3AA 1V80A 2WXRA 1WRDB 1N62A 4GDLB 2GOWA 1EU3A 2IY0B 4W9CA 2AL6A 2M17A 2QCZA 1OFFA 3H1UA 4IWOA 4ITKA 2XK5A 3ABVB 1IYFA 2G4SA 3M62B 4JWSC 4ZRQA 2LUEA 3L54A 4LTUA 2V3PA 2FUG1 3MHZA 2INDC 1XEEA 1ZDXA 1JQ4A 4II3B 4DHZB 1FM0D 3GB1A 2RDGA 4CQNA 1WF9A 4W9JA 1IBXA 4TMAB 2M0AA 1YIWA 3N1ZC 2UYZB 1LQBA 2HE7A 3SFEB 1RRBA 3FKYA 3BINA 4MGYE 1WJNA 2AWTA 2WXGA 2FCSA 5KHQA 1F2RI 1E7VA 1YOVB 2IGHA 3K9OB 3MC0B 5CTRC 1YQBA 3V61A 2KQ7A 2L8JA 1JMLA 1LXDA 1Q10A 2LHDA 2ZCBA 1RFAA 3NVZA 5IA7A 4I6PA 2NCNA 2MP2B 2D5GA 3Q8FA 4XDCA 4DDGD 2R2OA 5H92C 4LJPB 3DHGC 4MGKE 3L0WB 3RNCC 2JZZA 2O6VA 1L6VA 2KFKA 1TS3A 2XN9C 1GC6A 5J2RA 2L7RA 1WGRA 2MBEA 3A4SC 1NYRA 4HDOA 2PMVA 4MSQB 1UH6A 1QZEA 1Q5WB 4WJQA 2JSVX 4BZAA 1FPYA 1DOIA 3NHEB 2YVCA 4KIKA 2AX5A 3ZQ4A 4NY0A 2J0KA 2J53A 1AARA 5CHFA 1I42A 3SEBA 1V49A 5G5GA 4TSSA 3AE8B 3NS1A 3T9LA 1VD2A 2ZZPB 4ASWC 5H8YE 2ON8A 3AEEB 1VDVA 5D7GA 3ZW3A 3NZSA 1WM3A 2CHXA 3HUIA 1JW9D 4JWUC 3QX1A 1HQRD 1I4XA 2KTFA 3APCA 3PHXB 2BKFA 3VUYA 4B9KA 4MH8A 1RM6C 3N9YC 4PYUA 3MTNB 2N9KA 1P1AA 1KM7A 4YSYB 3KVFB 5G5HA 2D10A 3R8BA 4DXGA 2JY6A 3V60A 3Q3NC 2JWZA 4HPMB 4AOFA 1WM2A 4JX1C 2BGFA 1L0YB 2QJLA 3QCAA 5EE1A 5KHOA 3ZJUA 4C7ZA 1HEZE 5JZEB 1PDXA 4ARIA 2RR9A 3DBHI 2GB1A 4MACA 4D2KA 2KX0A 3GS2A 3B2FA 3DBRI 3GE8C 1SE2A 4P7IA 1ZPSA 2WHIA 2WXNA 1XT9B 1CJEA 1V86A 1QOAA 1P7EA 1UBIA 2VH2A 2LI5A 4USAA 3IT6B 4FBJB 3TSSA 3IFWB 3Q8CA 4BKGA 1YQ4B 2JZPA 3LYYA 4NPNA 2BQQA 4G0NB 4OZBA 2HD5B 4FN2A 4LDTD 2MLBA 4MJSB 2NPTA 1LGRA 2QMTA 1DGJA 4N59A 4KVGB 4AQ7A 3EFCA 3MJ5A 3PRPB 4X57B 3AEBB 3KW5B 2XEWA 4JIOU 4ICUA 1KH0A 2M56B 4JPSA 1KOTA 2DHZA 4ZOHC 3EFUA 2XNAC 2O2VA 3ZNID 1AN8A 1EF5A 3RYTA 3KH0A 4UDUC 5JHAA 5BO4B 4HWIB 2KXJA 3AE7B 4ANWA 2RSUA 4WAFA 3VHTC 3ZRFA 2BYTA 3I5JC 2K39A 4IM3A 2KOXA 3LB8C 2AQ1B 2KQ4X 2L05A 3P42A 4HJGE 3VRBB 2EELA 4KSKC 4W9GA 2JYTA 3ALBA 1KLGD 3BIID 3BYYB 2IBIB 1WR1A 2INCC 2NBVB 3MC8A 5J17A 2WYQA 1XF5L 4K1RB 3RPFC 1QLBB 5L83A 3IG3A 3PV1A 1TT5B 2KWCA 2N1VA 3Q3FA 2QC8A 4P6VF 1QQRA 4JQWC 1GNUA 2G4DB 4NJCA 3P1MA 2NTSA 3DVNV 1F77A 3QWZB 2LVPA 4OVZA 4A3OA 1WY8A 2KWDA 1GJZA 4PK1A 2MBQA 4RMAA 2GI9A 1CK1A 3U7DA 2YEPB 3AU4A 4DXFA 4RF0A 2CJOA 3KLSX 1L2NA 5EE3A 3DPDA 4N6EB 2K6DB 5D3IB 1XCTL 4HDQA 1BMLC 3Q14C 1C9FA 2RDBC 1WX8A 1UD7A 4TV3A 3Q2AC 1V5TA 2G9HD 3BVGA 4RM9A 2WLBA 4BOSC 3W1SC 2MEKA 1TY2A 2RD0A 2XK5B 2KN4A 4A9AA 1N61A 2AQ3B 2IYDB 3WANA 1Y8RC 3KUZA 3PO0A 1WWTA 2Z59B 4KX6B 3DHIC 1QOBA 4WQOB 2KFJA 3PREA 1ISNA 1PYWD 2K22A 2BS2B 1IBXB 4KGTA 3BK1A 3J9CA 3DOWA 3N3KB 1JWBD 4B0EA 1IGDA 4N58A 4DHZE 4YTPB 2WGSA 4LJOB 1IPGA 1RAXA 1HZ5A 2LGXA 5LLIA 2FCQA 4EKUA 4IUMB 4BFRA 2QEJC 3VVWB 4PS8A 3W1SA 3W9CB 3Q3JA 2NTTA 2WXHA 1T0YA 2BTEA 3A33B 2O6VB 4AWJA 1L5PA 2ASQA 2KFKB 2BB5A 1E9MA 1TTNA 3PLUA 4A8XC 1RYJA 1G6JA 3R2TA 1C4CA 3UF8A 4KDLB 4KIKB 3PRMB 2FIFA 4KZ0A 2IY1B 4K7SA 1EWYC 2OJRA 4F1SA 3Q8EA 1R7SA 5C1ZA 2CU3A 2ACZB 4JE3B 2KDIA 2H89B 2ZEQA 4RM8A 2KJ6A 4OHJA 4LDTB 4W9LA 1C77A 4F7ZA 2BYVE 3M95A 3GOEA 4NAMA 2MJEA 4W9DA 1WXAA 1GUAB 1A5RA 3BVZA 3FAHA 4MM3A 3P4SB 2MBHA 5AZFA 2FBWB 2TSSA 4WIPA 5BMHA 2LGYA 2JZ3B 2ZJDA 4WQMA 4S0RA 2LMCA 1FXIA 2BF8B 3AM9A 4L2YA 1BUIC 1SSNA 2PKOA 3OJ4B 2WX1A 2SEBD 4HCPB 3M63B 2V3SA 5FKAC 2RGFA 3IAS1 5JHBA 2LASA 3AEGB 4G11A 3DCGA 4FADA 2KLGA 4XE0A 3DHHC 2GBNA 4NZLB 3HRDD 4O1NA 3BK2A 1C79A 1TS2A 3I63C 3PT2B 3UQAA 4YSZB 1C78A 1OQYA 4M8NA 1V81A 4AJWA 1N60A 2K0PA 2ONQA 4GMVA 1UGMA 2IPKD 2K6QA 1ZP0B 2KX3A 3ML9A 4RH6A 4IM2A 3DDCB 3KYCD 2SAKA 1WXSA 2WP9B 1GPXA 1KLVA 1ET6A 3N1YC 1YMHE 2PEAA 5J18A 2MCNB 2NPTB 1ROEA 3X0WA 2IO0B 3NZ3A 3OJ3A 2WXOA 3HK0A 4DBGA 1VJKA 1MI0A 3DVGY 1UGJA 2L3ZA 2N7JA 1YQ3B 2KACA 3P63A 4KGSA 5AUKA 4A90A 2L32A 3ECIA 5L95C 2V1YA 3A9KB 3TEXA 2KO3A 2O2VB 2QHOA 4TKNA 1HA5A 1ZDVA 2K8BA 3RMKC 2JRIB 3U7ZA 3SU8X 5G55A 1PQSA 2JXTA 3T8MA 1WSPA 2JPHA 4IC7B 4GIVA 3RNAC 1GAQB 3L4PA 4YXDB 5IKCM 3AEFB 3ZXVA 3B1LX 1MPEA 5D2MB 1BXTA 3NUHB 2CHZA 4PYZA 2N9PC 3EA6A 3AE9B 4DXAB 2ZPYA 2CHWA 4IM0A 1DOXA 1XXGA 3ZXRA 3AE4B 4TUUA 3DBLB 2EKIA 3WAOA 3UINB 3V62A 4LNOA 3ZNGC 2OHFA 2AL3A 4P16A 4GN1A 2ICIA 2KDEB 1MHHE 2DNFA 4E71A 3U4EG 5LNK1 3RT3B 3R2IA 2D3AA 2KWVB 3SHQA 1FEHA 2MA9B 4C4VA 3NZUA 1PFDA 1KF6B 1MJDA 4GXBA 4WH4A 3N1XC 5AZHA 1UNSA 3Q3MC 4XGAB 3U2SC 1AYFA 2GBKA 2UU7A 3NVVA 1WIAA 5HFYA 2G45B 4IG7B 1D3ZA 2K9XA 2DAJA 2L76A 3JYUA 3TMPB 4EFOA 1SIJA 3QC8B 4PS7A 1LFDA 2DYMA 1XLOA 4XYCA 5CX3A 4DDID 4E74A 1I4GA 1ZGUB 2PE6B 1D6EC 1UELA 5HG2A 1TZ1A 1T0SC 3VH4B 4W9EA 4MGIE 3WCQA 3KQ4A 1WR6E 4TQ1A 3R3MA 4MH0E 3NG0A 2EMSA 3LDZE 3HIZA 1QF6A 5BYQA 3LJ3A 1NI3A 3RFZB 4NQKE 1HZ6A 1LO5D 2LXAA 3ONSA 2KDBA 2BWFA 3PTFC 4EE2A 4ANXA 3JVZX 1R4NB 1EUVB 4FHJA 2N9LA 4REZA 3ENEA 1F1HA 1I4PA 4RFBA 1TBEA 2FIDA 1ZW7A 4DQOC 3APDA 3JSVA 3VR8B 2INNE 1T0QC 3AV8A 5GXGB 5DPWA 4G3XB 4BBNF 4FULA 2KANA 3VH3B 4C7YA 2PPHA 2WDQB 4C56C 3ETRA 4WJNA 2MX2A 3Q6BA 3VUWA 4ZHPA 4XZ4A 3FC4A 1V8CA 3UIOB 1WGYA 2VZKB 3TEWA 3AB5A 1IGCA 4KKIA 4W9IA 4H2AA 3RNBC 3KWVA 1VLBA 3NY5A 1XCQL 3NS8A 3VR9B 4DWFA 1SIFA 1V1PA 2DZIA 4ZRIA 5IAAC 1D5ZC 4YL8A 1E90A 1XQQA 2KKCA 1FD6A 1SXTA 4BOZB 4GLSC 1AWDA 2A4ZA 4US8A 4OVUA 1WE6A 4MM3B 2N9EB 4GDKB 1STEA 2K1FA 5C3JB 2Z0DB 5E6OA 1SEBD 2LFIA 2M4NA 3M3JA 2XBBC 3RNGC 3DVGX 2D11A 2HJ1A 4ANUA 1L0VB 4DHJD 2WXQA 2GLSA 2LZ6A 4M0WA 5EE9A 1PGAA 4GB9A 2L52A 3A9KA 2BPSA 1ET9A 4LLGM 4IOIE 2AQ2B 1SF0A 2DYOA 2AYOB 2IO3B 4MELA 2N7EA 1XLNA 3AU5A 2JXXA 1J8CA 1KFYB 2KVZA 4RGNA 2LVQA 1SBBB 2L83A 3APFA 4S17A 4C80A 3DBLI 3ZIMA 4EZLA 1CQVA 2MHJA 4IDIA 1SJED 1I7HA 1PGXA 3A4RA 2BYFA 3W5VB 2LJ5A 3CF6E 2KNBA 1WFYA 2K5PA 3R7QA 1ESFA 1WH3A 5IP4D 3P4PB 1JWUD 2IO1B 4C00A 4KDIC 3H7PA 3B0AA 5DPTA 1ZOYB 4W9HA 4CHKA 1T3QA 2D3CA 3A9JA 4K3BA 4ZRKA 2JF5A 4WAAA 1L4DB 3AE5B 3IVFA 1JCKB 2V9HA 1TJEA 2VRRB 2WXFA 3A1QA 1J7BA 4AP4C 3P4RB 1VR9A 4OZAA 3VAWA 1SE9A 2V4LA 4GOCA 1UWMA 2C7HA 4F8CB 3SD5A 3VTWA 1QILA 2IDYA 2NMQA 3FILA 4MSMB 2FCMA 4XWWA 1T5XD 3RZFA 5TSSA 3OLMD 3ZDMC 2NBWB 4HROA 2BVCA 2W9NA 3SFDB 4HPPA 2DENB 3WA0A 3N20C 2HTHA 1K52A
chains in the Genus database with same CATH topology
1BUIC 1SSNA 2PKOA 3MC0B 3VRAB 1N5XA 2W54A 1ZUD2 4YSXB 1PGBA 1JMLA 2SEBD 1Q10A 5EE0A 1TKEA 2LHDA 4XDDA 5FKAC 3IAS1 2BBCA 3NVZA 3AEGB 1NENB 1E7PB 1FNUA 5I4DA 2V4IB 4XE0A 4NZLB 3HRDD 4O1NA 3BK2A 1C79A 1TS2A 2D5GA 3H8HA 3Q8FA 1ZXHA 4XDCA 2WXKA 4YSZB 1YJIA 1C78A 4R3DA 5H92C 1C4AA 2L1AA 3IAM1 2JWUA 2LUMA 1YNTE 1N60A 2K0PA 3IT4B 2LEKA 2ONQA 2JX5A 4RNAA 3ZJVA 2IPKD 1L6VA 1ZP0B 1I4RA 1TS3A 1E6EB 2XN9C 4RH6A 2Q5WD 3C8YA 3TEZA 3B2GA 2RMMA 2KDMA 2SAKA 4RGTA 5BMIA 2WP9B 1E10A 1GPXA 1ET6A 1NYRA 2HTME 1JWSD 1FMAD 1YMHE 2PMVA 4HRSA 2JSVX 1FXAA 1ROEA 1A70A 1DOIA 2AX5A 3NZ3A 3ZQ4A 2WXOA 4TQ0A 2V3NA 2J53A 2DBYA 4OZCA 1VJKA 1MI0A 1UGJA 2RPVA 2Y5PA 2INPE 4YWGG 2N7JA 5AUIA 1YQ3B 2KACA 3P63A 4KGSA 1TY0A 3AE6B 5AUKA 4A90A 2Y3AA 3SEBA 2L32A 3TEXA 5G5GA 1VRAB 4TSSA 3AE8B 2IJ0A 3NS1A 1HA5A 1ZDVA 2WQYB 5H8YE 1D5MC 2ON8A 2WU5B 1VDVA 3AEEB 3I57A 5D7GA 3U7ZA 2RDHA 4AS1A 2WDVB 4LK0M 2E3TA 2QSDA 3DWGC 1TKYA 1WXQA 1JW9D 2JXTA 3HUIA 4JWUC 1EU4A 1YN5A 2DLBA 2MJDA 1WSPA 1HQRD 1I4XA 4RGOS 1GAQB 3L4PA 4YXDB 4MH8A 3PZ8A 1RM6C 1FFVA 3AEFB 3N9YC 5FK9C 1JROA 1XO3A 2N9KA 1MPEA 4YSYB 1FNVA 1BXTA 2W82A 3NUHB 2JU6X 5G5HA 3AE1B 3R8BA 2PW9A 1ZE3D 2IGGA 1FCCC 4DXGA 3EA6A 2BS4B 3AE9B 3BYTB 5JXVA 2BS3B 1DOXA 2PVGC 1XXGA 2I38A 5BYSA 2R61A 3NVWA 4JX1C 3AE4B 1WRIA 3GP7A 1L0YB 2QJLA 5EE1A 2EKIA 1V1OA 4C7ZA 3ZJUA 1HEZE 4KKJA 2KAJA 3V3XA 1PDXA 2W3SA 4ARIA 4MACA 2GB1A 3I9V1 3B9JA 4D2KA 5MPOA 4HKZE 3GS2A 3B2FA 2YEPF 2PVOD 2OHFA 1SE2A 1DYQA 3BVMA 5E6JA 4P16A 1ZPSA 2WXNA 2ICIA 1MHHE 1TZOA 1CJEA 3E56A 1QOAA 3U4EG 5LNK1 1P7EA 3R2IA 4USAA 1FEHA 3IT6B 2Y5CA 3TSSA 3Q8CA 3MP9A 1PFDA 3Q8AA 1YQ4B 2JZPA 3LYYA 2WXMA 4RCOA 1KF6B 4OZBA 2JYEA 2MJ3A 1UUPA 4RGMA 2JQRB 4WH4A 1I4HA 1D5XC 2QMTA 1UNSA 2WU2B 1DGJA 4N59A 2W55A 3DWMA 1VZ8A 3EUB2 1V1PB 2WXJA 3AE2B 4AQ7A 3U2SC 1AYFA 1QKZA 4ZYSA 2LHEA 3NVVA 3PZ7A 5HFYA 3MJ5A 4RF1A 4XWTA 3AEBB 2K9XA 1KH0A 2M56B 2K3UA 4JPSA 4YT0B 1SIJA 1N5WA 4ZOHC 4WWMA 1FO4A 5BYRA 2W3RA 1ZXIA 1GOZA 2DYMA 2XNAC 4L1BA 4A6QA 4US9A 1SE4A 1XLOA 1K50A 1AN8A 1I4GA 1JWMD 1PUTA 3AMZA 1D6EC 4UDUC 2I2YA 4HEA1 2PTLA 4YTNB 5HG2A 1CZPA 3AE7B 4OW0A 4WAFA 2BYTA 3P4QB 1TKGA 3WCQA 1YN3A 3MFGA 3AN1A 2OEDA 1JRPA 3AEDB 3KQ4A 3LB8C 2AQ1B 2KQ4X 3P42A 4TQ1A 1TS5A 4HJGE 1VZ6A 2EELA 3VRBB 2MH7A 2JYTA 3SR6A 1AW7A 1MHXA 1JALA 1P7FA 3W2DA 1J7CA 1QF6A 1KLGD 5BYQA 3BIID 3BYYB 1NI3A 3RFZB 2M19A 3T3NA 1HZ6A 1LO5D 1FIQA 1XF5L 4EE2A 1B1ZA 3RPFC 1QLBB 5C2TB 3O13A 1IUEA 2CJNA 3U52E 2J4XA 2N9LA 1GB4A 4REZA 1JWAD 2FE8A 4P6VF 1QQRA 1I4PA 4RFBA 2QILA 2WS3B 3OWEB 2J52A 4NJCA 5FR3A 2QIEB 3P1MA 4YTMB 2NTSA 1GB1A 4DQOC 1F77A 4HKQA 3TEYA 4OVZA 2DWQA 3VR8B 2INNE 2KWDA 1K51A 3AV8A 5GXGB 2LJIA 2BW2A 1L6UA 1NEKB 2GI9A 2H88B 1CK1A 2YEPB 4DXFA 1L4ZB 4RF0A 4C7YA 2CJOA 3KLSX 2WDQB 1C76A 4C56C 3ETRA 5EE3A 1FCLA 4N6EB 3ZYYX 5D3IB 4ZHPA 3FC4A 1V8CA 1XCTL 2IGDA 1BMLC 1Y56A 1F2RC 2VZKB 2N0SB 1C9FA 2WDRB 3Q69A 3HVZA 1FRRA 3TEWA 1SB3C 2G9HD 3AB5A 3BVGA 3NVYA 1IGCA 2WLBA 4KKIA 4H2AA 3KWVA 1VLBA 2MEKA 1TY2A 4PT5A 1FNWA 1XCQL 2KN4A 1EWCA 3VR9B 4A9AA 4WURA 1N61A 2AQ3B 2J42A 3E9SA 1V1PA 2PLPA 1D5ZC 2WXIA 3PO0A 1WWTA 4KX6B 3CIRB 4IKGA 1QOBA 1MVKA 2PIAA 3HVDA 3VQIA 2WXLA 1FD6A 3FILB 1OQRA 1SXTA 1PYWD 2K22A 4GLSC 1KTKA 1SE3A 1OQQA 3AECB 1V97A 1AWDA 4US8A 3V05A 4MM3B 1B9RA 2BS2B 1IBXB 2X38A 4GDKB 1STEA 4KGTA 3BK1A 3ZGZA 3URYA 1QT9A 1NVID 2KMMA 3J9CA 5C3JB 1SEBD 3AEAB 2LFIA 4ZHOA 4L23A 4ARCA 3T3OA 1JWBD 1TS4A 4B0EA 3AH7A 1E0ZA 1IGDA 1L0VB 2WXQA 1F0ZA 1HXYD 4N58A 4M0WA 4YTPB 5EE9A 1PGAA 2L52A 1M4VA 4B0MA 4LLGM 1ET9A 4IOIE 2V0GA 2AQ2B 1SF0A 2DYOA 2GRIA 1I4QA 1HZ5A 1KLUD 5T8IA 1XLNA 2G1EA 4ZRPA 1C4PA 1QOFA 4A55A 2VZKD 1KFYB 1YJJA 2QEJC 4RGNA 1SBBB 2L83A 4C80A 1XLPA 1TYGB 3W1SA 4Q2JA 3W9CB 1EM7A 2ZW0A 4J3OD 3CWIA 1CQVA 2NTTA 4IDIA 1SJED 1NYQA 2WXHA 2BTEA 1I7HA 1PGXA 1WYGA 1FRDA 2ZW1A 5HI1A 1L5PA 3ZJTA 2BB6A 3IXSA 3W5VB 2BB5A 3AE3B 1VZ7A 1E9MA 2K5PA 2BT6A 4KGRA 4A8XC 5HHDG 3NRZA 1RYJA 3R2TA 1SJHD 1C4CA 1ESFA 1RWSA 4FXCA 2WNMA 3UI3A 1YN4A 3P4PB 1JWUD 3BWUD 1QOGA 3TUOA 1J7AA 1DOYA 2LGIA 2E6XA 1XLQA 1ZOYB 1RFKA 4NAWB 3BZDB 1N63A 5D3DA 1T3QA 4MT5A 2B76B 1K52A 1EWYC 1ENFA 3EGRA 2WXPA 3Q8EA 1R7SA 1L4DB 2CU3A 3AE5B 1K53A 2ACZB 2HDEA 4JE3B 2WXRA 1JCKB 1KRHA 1TJEA 1N62A 4GDLB 2WXFA 1EU3A 2H89B 1J7BA 1ACCA 1FFUA 1OFFA 3P4RB 1UWXA 4ITKA 1VR9A 4OHJA 4OZAA 3ABVB 3Q8BA 4JWSC 1C77A 1UWMA 4ZRQA 4LTUA 4NAMA 2V3PA 2FUG1 3MHZA 2MJEA 3W5UB 1D4BA 1XEEA 1ZDXA 2Z8LA 1QILA 1T6BX 2IDYA 2NMQA 1JQ4A 3FILA 1FM0D 3GB1A 3BVZA 2RDGA 4XWWA 1T5XD 5BMGA 3FAHA 3KWLA 4CQNA 5TSSA 3P4SB 1IBXA 4TMAB 2M0AA 2FBWB 4HROA 3SFDB 3SFEB 2TSSA 4WIPA 5BMHA 1L0XB 4WQMA 2LMCA 1FXIA 2WXGA 3AM9A 4L2YA 1F2RI 3LXFA 2IGHA 1WGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOI E;  2PW9 A;  1MHX A;  1HZ5 A;  1P7F A;  1FCC C;  2IGG A;  1PGB A;  1JML A;  1Q10 A;  5JXV A;  2LHD A;  2I38 A;  1HZ6 A;  1XF5 L;  2N9L A;  1EM7 A;  2ZW0 A;  1GB4 A;  1ZXH A;  1HEZ E;  1PGX A;  3V3X A;  2J52 A;  2ZW1 A;  5HI1 A;  4MAC A;  2GB1 A;  4D2K A;  2JWU A;  2LUM A;  4HKZ E;  2EEL A;  1YNT E;  1GB1 A;  2K0P A;  2ONQ A;  4KGR A;  5HHD G;  2KWD A;  1K51 A;  3UI3 A;  1MHH E;  2GI9 A;  1P7E A;  2RMM A;  2KDM A;  2LGI A;  5BMI A;  1FCL A;  1YMH E;  3MP9 A;  2JZP A;  2JSV X;  4OZB A;  1XCT L;  2IGD A;  1F2R C;  1C9F A;  4WH4 A;  2J53 A;  4OZC A;  2QMT A;  1MI0 A;  1IGC A;  1K53 A;  2RPV A;  2N7J A;  2KAC A;  1XCQ L;  2KN4 A;  1QKZ A;  4KGS A;  2LHE A;  5HFY A;  2PLP A;  1UWX A;  4OZA A;  4IKG A;  1KH0 A;  1MVK A;  1FD6 A;  3FIL B;  2ON8 A;  4GLS C;  1D4B A;  1K50 A;  2NMQ A;  2QSD A;  3FIL A;  1IBX B;  3GB1 A;  4KGT A;  2JXT A;  2I2Y A;  2PTL A;  5BMG A;  5HG2 A;  1IBX A;  5BMH A;  1IGD A;  2OED A;  2N9K A;  1MPE A;  1F2R I;  1PGA A;  2KQ4 X;  4HJG E;  2JU6 X;  2IGH A;  1K52 A; 
#chains in the Genus database with same CATH topology
 1VCB A;  3VRA B;  1N5X A;  2W54 A;  4EZK A;  5EE0 A;  4HVB A;  1MG4 A;  4LNN A;  2C7M B;  4XDD A;  2BBC A;  1C1Y B;  1R4N I;  4XC2 A;  1E7P B;  5I4D A;  4CYE A;  2I1K A;  3ZRC A;  3MC9 A;  3H8H A;  4BKS D;  3PVL A;  2M1M A;  2WXK A;  2RPQ A;  1YJI A;  2DZM A;  3IAM 1;  2IZV B;  1E7U A;  2MRP A;  2JWU A;  3MHS D;  2LUM A;  2LEK A;  1CMX B;  4RNA A;  3RD2 A;  1OGW A;  3N32 A;  3ZJV A;  3V6E B;  5E6N A;  1E6E B;  2K8C A;  2Q5W D;  4C4V B;  3C8Y A;  3B2G A;  2RMM A;  2N1W A;  1WZ0 A;  4RGT A;  5BMI A;  2HTM E;  1JWS D;  1FMA D;  2CS4 A;  2NR2 A;  1P9D U;  1FXA A;  1C3T A;  1A70 A;  4G50 A;  1NI2 A;  4NAW A;  1H8C A;  3UQB A;  1E8Z A;  3PSE B;  4GSW A;  4TQ0 A;  2V3N A;  2DBY A;  4OZC A;  4II2 B;  2RPV A;  2Y5P A;  4YWG G;  2KTR A;  3HM6 X;  1X1M A;  2NS5 A;  2GBJ A;  1Z2M A;  1TY0 A;  3AE6 B;  4BKT A;  2C5L C;  5GMV A;  3ZDT A;  1VRA B;  1WJ6 A;  4AS1 A;  3P2B A;  4N9F 4;  2RDH A;  1P0R A;  4LK0 M;  2E3T A;  2N7D A;  2ZPN A;  3DWG C;  1TKY A;  3ML8 A;  2KMC A;  1EU4 A;  2D07 B;  2N9X A;  2DLB A;  2MJD A;  5CHW A;  5IOI A;  2K8H A;  3PZ8 A;  1FFV A;  5FK9 C;  2JUO A;  3TL5 A;  5IO9 A;  1XO3 A;  2JU6 X;  3AE1 B;  1ZE3 D;  2IGG A;  1NDD A;  3H9D A;  4DK5 A;  3K9P B;  3BYT B;  5JXV A;  3KUC B;  4NQL B;  3O65 B;  1WJU A;  2YLM A;  2J0M A;  5BYS A;  2MBB B;  3R7R A;  2R61 A;  2C7N B;  4GDK A;  4NJ6 A;  1WRI A;  2KHW B;  2MW5 A;  3RNF C;  3BY4 B;  4W9K A;  1J19 A;  4FJY A;  2KAJ A;  3JSV B;  5AEK B;  3AUL A;  5MPO A;  2R2Q A;  4GGQ A;  1JRU A;  3BVM A;  5E6J A;  2I1J A;  1Q1O A;  3QJZ A;  3CMM B;  2FAZ A;  4K3C A;  2Y5C A;  3TBL D;  1J0G A;  3Q8A A;  4HK2 A;  2WXM A;  4WWO A;  2FUH B;  1UUP A;  4RGM A;  2LRW A;  1D5X C;  1WJ4 A;  1EO6 A;  3QHT A;  3QQ8 B;  1WZ3 A;  2W55 A;  2REX A;  4QAY A;  3DWM A;  3EUB 2;  1V1P B;  3AE2 B;  3EHV A;  4MGZ E;  4EEW A;  1QKZ A;  4ZYS A;  3PZD A;  2LHE A;  1SGH A;  3VXW A;  2LGS A;  4YT0 B;  1S3S G;  1N5W A;  5BYR A;  3L10 B;  4US9 A;  1SE4 A;  4ZDV A;  3VFK A;  2DAF A;  2I2Y A;  4HEA 1;  5HKH A;  1CZP A;  2WDT B;  2K25 A;  3EEC A;  4M0W B;  3P4Q B;  1E8Y A;  3MFG A;  1WXM A;  3AN1 A;  3AED B;  1TS5 A;  3TCA A;  1E5W A;  2MH7 A;  2MSE D;  3SR6 A;  1MHX A;  3W2D A;  2KVR A;  1V6E A;  3Q3O C;  1FIQ A;  1B1Z A;  5C2T B;  4PS3 A;  1IUE A;  1L7Y A;  3U52 E;  2J4X A;  3ZVV A;  2FE8 A;  2LGD A;  2QIL A;  2WS3 B;  5LXI B;  1V2Y A;  5FR3 A;  2QIE B;  4YTM B;  1GB1 A;  4IW0 A;  1RLF A;  3H7P B;  2BW2 A;  1L6U A;  1NEK B;  1UBQ A;  1N6Z A;  4B6W A;  2KQS A;  1L4Z B;  3A9J B;  2LRU A;  1C76 A;  1WYW B;  2J0J A;  5IN7 A;  2IGD A;  1Y56 A;  1F2R C;  2L0F A;  3HVZ A;  1SB3 C;  2G3Q B;  3A1Q B;  3NVY A;  2JRH A;  1FNW A;  1EWC A;  4HXD A;  2PLP A;  2WXI A;  4IKG A;  1MVK A;  2PIA A;  3VQI A;  4LNK A;  2WXL A;  3FIL B;  4K7W A;  2UWQ A;  1KTK A;  1SE3 A;  1OQQ A;  3AEC B;  1V97 A;  1B9R A;  4FLH A;  3URY A;  3VUX A;  4KV2 A;  3RN9 C;  3AEA B;  4JL9 A;  4ARC A;  3T3O A;  1TS4 A;  2KC2 A;  3AH7 A;  5G2N A;  1F0Z A;  1OEY A;  3IBE A;  2KT7 A;  2V0G A;  2GRI A;  4MDK E;  2WX0 A;  1KLU D;  5LXH A;  5T8I A;  2MWS B;  2LD9 A;  2G1E A;  4ZRP A;  1C4P A;  3MJW A;  2EKE C;  2KMA A;  4HCN B;  1M94 A;  1FXT B;  1MG8 A;  3VDZ A;  2J7Q B;  1XLP A;  1XD3 B;  1Z5S B;  2GBM A;  5DPS A;  3RI7 C;  2ZW0 A;  4J3O D;  1WGG A;  1YJ1 A;  4NNJ B;  3QAR A;  4URK A;  1FRD A;  4ACF A;  5C23 A;  3ZO5 B;  2PJH A;  3AE3 B;  2DX5 B;  1VZ7 A;  4M00 A;  1R4M B;  5HHD G;  3OG5 A;  1RWS A;  3UI3 A;  5JH5 C;  2ZVN A;  3BWU D;  4B95 A;  3PLV A;  2E6X A;  1XLQ A;  1BT0 A;  4NAW B;  1N63 A;  3HHM A;  4MT5 A;  2KJR A;  4M01 A;  4W9F A;  5EDS A;  2Z0E B;  3EGR A;  4EOY A;  2KTR B;  1WMH A;  4OVV A;  1YD8 U;  3AXC A;  1K53 A;  3ZLZ A;  2HDE A;  2L0T A;  1KRH A;  1TGZ B;  2KK8 A;  3D32 A;  3JW0 X;  3PHW B;  1ACC A;  1FFU A;  3C0R B;  4K81 A;  1UWX A;  3Q8B A;  2D3B A;  4WJO A;  4ZRJ A;  3WAL A;  3W5U B;  1D4B A;  2Z8L A;  1T6B X;  4M02 A;  1P98 A;  1S1Q B;  1Q0W B;  3SDL C;  3WIM A;  2O6V D;  5BMG A;  2KN5 A;  3KWL A;  4AJY B;  3DVN U;  2KC1 A;  2NBU A;  2WWZ A;  2DZJ A;  1WXV A;  3L08 A;  4JGH B;  4A20 A;  1L0X B;  2X8X X;  3KUD B;  3H6N A;  3EC8 A;  3ZKJ C;  3LXF A;  1WGK A;  3VTU A;  1ZUD 2;  4YSX B;  5D6J B;  1P3Q U;  1PGB A;  3UGB B;  1TKE A;  3GZN B;  4M8M A;  3OAW A;  4FA6 A;  2KYW A;  4I6N B;  3TIX A;  1NEN B;  2IO2 B;  1FNU A;  2V4I B;  3UIP B;  2ZCC A;  2BKR B;  2FCN A;  1ZXH A;  2HJ8 A;  4R3D A;  2NVU I;  1C4A A;  2L1A A;  4WWP A;  1GC7 A;  2ZNV B;  1YNT E;  3IT4 B;  2JX5 A;  3W1Y A;  2L00 B;  1I4R A;  2MQJ A;  3QK0 A;  3CST A;  3TEZ A;  2KDM A;  1UF0 A;  1E10 A;  4HRS A;  4WWN A;  4BVU C;  2C60 A;  2GBR A;  2LVO A;  2DZK A;  3U8Z A;  3DQV A;  3CSF A;  2INP E;  5AUI A;  4WJP A;  2Y3A A;  3PGE A;  4IWQ A;  4GDL A;  2IJ0 A;  4BKS A;  3PRZ A;  2WQY B;  1D5M C;  2WU5 B;  3I57 A;  4ICV A;  2WDV B;  2QSD A;  3C19 A;  2BWE S;  1WXQ A;  2OJW A;  3QAQ A;  1YN5 A;  4KZC A;  4RGO S;  4XX5 A;  3WAM A;  2EMT A;  3QA8 A;  1JRO A;  3U30 A;  1FNV A;  2KJH B;  2W82 A;  4NJ7 A;  4I6L B;  3HM3 A;  2PW9 A;  1FCC C;  3I3T B;  1WE7 A;  2BS4 B;  4MEM A;  2BS3 B;  2PVG C;  2I38 A;  3L13 A;  2LXC A;  3IHP C;  1E8X A;  4KSL C;  1EF1 A;  3NVW A;  4LNI A;  3H7S A;  3ZNZ B;  3GP7 A;  4ANV A;  1V1O A;  4KKJ A;  2KLC A;  4BBN C;  5TR5 A;  3V3X A;  2W3S A;  2MP2 A;  3B9J A;  3I9V 1;  4HKZ E;  1R4M I;  2YEP F;  3L17 A;  2PVO D;  1DYQ A;  4HLE A;  1TZO A;  3E56 A;  2CKH B;  5DCN A;  2LWP A;  2MBO A;  2KWU B;  3PPA A;  3MP9 A;  4RCO A;  1T0R C;  4K7U A;  2JYE A;  2MJ3 A;  4LCD E;  2BYE A;  2JQR B;  1I4H A;  2C9W B;  1IP9 A;  4P1C C;  2WU2 B;  4GU2 A;  1VZ8 A;  2WXJ A;  5CHV C;  1F9J A;  1WX9 A;  3TJP A;  3QIJ A;  3PZ7 A;  4RF1 A;  4XWT A;  2K3U A;  4WWM A;  1FO4 A;  2KZR A;  2W3R A;  1WGH A;  1GOZ A;  1ZXI A;  2DYB A;  4L1B A;  4A6Q A;  4CO7 A;  1K50 A;  3RZW C;  1JWM D;  1PUT A;  3R66 C;  4AUQ C;  3AMZ A;  2PTL A;  4YTN B;  3NOB A;  4OW0 A;  2JT4 B;  3GE3 C;  5E6P A;  2KDF B;  1I35 A;  1TKG A;  1LM8 B;  1YN3 A;  1K8R B;  2OED A;  1HTO A;  1JRP A;  2FNJ B;  3KYD D;  1VZ6 A;  3NJT A;  3DBS A;  2CU1 A;  3GZN I;  1AW7 A;  3L16 A;  1JAL A;  1P7F A;  1J7C A;  2ZNV C;  4FHK A;  2M19 A;  3T3N A;  2N4F A;  1ZKH A;  2QDF A;  3PS6 A;  3O13 A;  2CJN A;  4FJZ A;  3ZTC A;  1GB4 A;  1JWA D;  1WX7 A;  4IWP A;  3WAP A;  3OWE B;  1HE8 A;  2J52 A;  1U4A A;  4HKQ A;  3TEY A;  2DWQ A;  4EZJ A;  1K51 A;  2D2Q A;  4DHJ B;  2LJI A;  2H88 B;  2JVC A;  4HPL B;  1NBF C;  3AI5 A;  1FCL A;  3ZYY X;  3X23 A;  1WMH B;  2GMI C;  2N0S B;  2WDR B;  5D94 A;  3Q69 A;  1E8W A;  1FRR A;  4BAX A;  2M0X A;  5AZG A;  4PT5 A;  2AEH A;  4MJS A;  1UZX B;  3RNE C;  4WUR A;  2J42 A;  2D3G A;  4P1B C;  3E9S A;  5DPR A;  4FJV B;  4J6I A;  3CIR B;  3HVD A;  3V6C B;  1OQR A;  2CR5 A;  1V5O A;  3V05 A;  2X38 A;  3ZGZ A;  1QT9 A;  1NVI D;  2KMM A;  1GG3 A;  1F52 A;  4ZHO A;  3ZNH B;  4L23 A;  4E3C A;  1H4R A;  3RCZ A;  1E0Z A;  3RUI B;  2OOB B;  4EUT A;  1HXY D;  1M4V A;  4B0M A;  4ZYN A;  3N30 A;  1I4Q A;  1WGD A;  1QOF A;  4A55 A;  2VZK D;  2A5U A;  3VTV A;  2PE9 A;  1YJJ A;  3ZTD A;  4A3P A;  4JLC A;  1TYG B;  1HTQ A;  4Q2J A;  1EM7 A;  2Y5B B;  3CWI A;  5FR6 A;  1NYQ A;  2VH1 A;  1WYG A;  2ZW1 A;  5HI1 A;  2KD0 A;  3ZJT A;  2BB6 A;  3IXS A;  3RUL A;  3S2A A;  2M8S A;  1YX6 B;  3DBH B;  2BT6 A;  4KGR A;  1OEY J;  2ZVO A;  3ZUN A;  1TIF A;  3NRZ A;  1SJH D;  4FXC A;  3DBR B;  2WNM A;  1YN4 A;  1QOG A;  3TUO A;  1J7A A;  1DOY A;  2LGI A;  1V9J A;  1YX5 B;  1RFK A;  3BZD B;  5D3D A;  4LNF A;  4HJK A;  2B76 B;  1KJT A;  1ENF A;  1WI0 A;  2WXP A;  3B08 A;  1MFW A;  1OTR B;  2B3A A;  1V80 A;  2WXR A;  1WRD B;  1N62 A;  4GDL B;  2GOW A;  1EU3 A;  2IY0 B;  4W9C A;  2AL6 A;  2M17 A;  2QCZ A;  1OFF A;  3H1U A;  4IWO A;  4ITK A;  2XK5 A;  3ABV B;  1IYF A;  2G4S A;  3M62 B;  4JWS C;  4ZRQ A;  2LUE A;  3L54 A;  4LTU A;  2V3P A;  2FUG 1;  3MHZ A;  2IND C;  1XEE A;  1ZDX A;  1JQ4 A;  4II3 B;  4DHZ B;  1FM0 D;  3GB1 A;  2RDG A;  4CQN A;  1WF9 A;  4W9J A;  1IBX A;  4TMA B;  2M0A A;  1YIW A;  3N1Z C;  2UYZ B;  1LQB A;  2HE7 A;  3SFE B;  1RRB A;  3FKY A;  3BIN A;  4MGY E;  1WJN A;  2AWT A;  2WXG A;  2FCS A;  5KHQ A;  1F2R I;  1E7V A;  1YOV B;  2IGH A;  3K9O B;  3MC0 B;  5CTR C;  1YQB A;  3V61 A;  2KQ7 A;  2L8J A;  1JML A;  1LXD A;  1Q10 A;  2LHD A;  2ZCB A;  1RFA A;  3NVZ A;  5IA7 A;  4I6P A;  2NCN A;  2MP2 B;  2D5G A;  3Q8F A;  4XDC A;  4DDG D;  2R2O A;  5H92 C;  4LJP B;  3DHG C;  4MGK E;  3L0W B;  3RNC C;  2JZZ A;  2O6V A;  1L6V A;  2KFK A;  1TS3 A;  2XN9 C;  1GC6 A;  5J2R A;  2L7R A;  1WGR A;  2MBE A;  3A4S C;  1NYR A;  4HDO A;  2PMV A;  4MSQ B;  1UH6 A;  1QZE A;  1Q5W B;  4WJQ A;  2JSV X;  4BZA A;  1FPY A;  1DOI A;  3NHE B;  2YVC A;  4KIK A;  2AX5 A;  3ZQ4 A;  4NY0 A;  2J0K A;  2J53 A;  1AAR A;  5CHF A;  1I42 A;  3SEB A;  1V49 A;  5G5G A;  4TSS A;  3AE8 B;  3NS1 A;  3T9L A;  1VD2 A;  2ZZP B;  4ASW C;  5H8Y E;  2ON8 A;  3AEE B;  1VDV A;  5D7G A;  3ZW3 A;  3NZS A;  1WM3 A;  2CHX A;  3HUI A;  1JW9 D;  4JWU C;  3QX1 A;  1HQR D;  1I4X A;  2KTF A;  3APC A;  3PHX B;  2BKF A;  3VUY A;  4B9K A;  4MH8 A;  1RM6 C;  3N9Y C;  4PYU A;  3MTN B;  2N9K A;  1P1A A;  1KM7 A;  4YSY B;  3KVF B;  5G5H A;  2D10 A;  3R8B A;  4DXG A;  2JY6 A;  3V60 A;  3Q3N C;  2JWZ A;  4HPM B;  4AOF A;  1WM2 A;  4JX1 C;  2BGF A;  1L0Y B;  2QJL A;  3QCA A;  5EE1 A;  5KHO A;  3ZJU A;  4C7Z A;  1HEZ E;  5JZE B;  1PDX A;  4ARI A;  2RR9 A;  3DBH I;  2GB1 A;  4MAC A;  4D2K A;  2KX0 A;  3GS2 A;  3B2F A;  3DBR I;  3GE8 C;  1SE2 A;  4P7I A;  1ZPS A;  2WHI A;  2WXN A;  1XT9 B;  1CJE A;  1V86 A;  1QOA A;  1P7E A;  1UBI A;  2VH2 A;  2LI5 A;  4USA A;  3IT6 B;  4FBJ B;  3TSS A;  3IFW B;  3Q8C A;  4BKG A;  1YQ4 B;  2JZP A;  3LYY A;  4NPN A;  2BQQ A;  4G0N B;  4OZB A;  2HD5 B;  4FN2 A;  4LDT D;  2MLB A;  4MJS B;  2NPT A;  1LGR A;  2QMT A;  1DGJ A;  4N59 A;  4KVG B;  4AQ7 A;  3EFC A;  3MJ5 A;  3PRP B;  4X57 B;  3AEB B;  3KW5 B;  2XEW A;  4JIO U;  4ICU A;  1KH0 A;  2M56 B;  4JPS A;  1KOT A;  2DHZ A;  4ZOH C;  3EFU A;  2XNA C;  2O2V A;  3ZNI D;  1AN8 A;  1EF5 A;  3RYT A;  3KH0 A;  4UDU C;  5JHA A;  5BO4 B;  4HWI B;  2KXJ A;  3AE7 B;  4ANW A;  2RSU A;  4WAF A;  3VHT C;  3ZRF A;  2BYT A;  3I5J C;  2K39 A;  4IM3 A;  2KOX A;  3LB8 C;  2AQ1 B;  2KQ4 X;  2L05 A;  3P42 A;  4HJG E;  3VRB B;  2EEL A;  4KSK C;  4W9G A;  2JYT A;  3ALB A;  1KLG D;  3BII D;  3BYY B;  2IBI B;  1WR1 A;  2INC C;  2NBV B;  3MC8 A;  5J17 A;  2WYQ A;  1XF5 L;  4K1R B;  3RPF C;  1QLB B;  5L83 A;  3IG3 A;  3PV1 A;  1TT5 B;  2KWC A;  2N1V A;  3Q3F A;  2QC8 A;  4P6V F;  1QQR A;  4JQW C;  1GNU A;  2G4D B;  4NJC A;  3P1M A;  2NTS A;  3DVN V;  1F77 A;  3QWZ B;  2LVP A;  4OVZ A;  4A3O A;  1WY8 A;  2KWD A;  1GJZ A;  4PK1 A;  2MBQ A;  4RMA A;  2GI9 A;  1CK1 A;  3U7D A;  2YEP B;  3AU4 A;  4DXF A;  4RF0 A;  2CJO A;  3KLS X;  1L2N A;  5EE3 A;  3DPD A;  4N6E B;  2K6D B;  5D3I B;  1XCT L;  4HDQ A;  1BML C;  3Q14 C;  1C9F A;  2RDB C;  1WX8 A;  1UD7 A;  4TV3 A;  3Q2A C;  1V5T A;  2G9H D;  3BVG A;  4RM9 A;  2WLB A;  4BOS C;  3W1S C;  2MEK A;  1TY2 A;  2RD0 A;  2XK5 B;  2KN4 A;  4A9A A;  1N61 A;  2AQ3 B;  2IYD B;  3WAN A;  1Y8R C;  3KUZ A;  3PO0 A;  1WWT A;  2Z59 B;  4KX6 B;  3DHI C;  1QOB A;  4WQO B;  2KFJ A;  3PRE A;  1ISN A;  1PYW D;  2K22 A;  2BS2 B;  1IBX B;  4KGT A;  3BK1 A;  3J9C A;  3DOW A;  3N3K B;  1JWB D;  4B0E A;  1IGD A;  4N58 A;  4DHZ E;  4YTP B;  2WGS A;  4LJO B;  1IPG A;  1RAX A;  1HZ5 A;  2LGX A;  5LLI A;  2FCQ A;  4EKU A;  4IUM B;  4BFR A;  2QEJ C;  3VVW B;  4PS8 A;  3W1S A;  3W9C B;  3Q3J A;  2NTT A;  2WXH A;  1T0Y A;  2BTE A;  3A33 B;  2O6V B;  4AWJ A;  1L5P A;  2ASQ A;  2KFK B;  2BB5 A;  1E9M A;  1TTN A;  3PLU A;  4A8X C;  1RYJ A;  1G6J A;  3R2T A;  1C4C A;  3UF8 A;  4KDL B;  4KIK B;  3PRM B;  2FIF A;  4KZ0 A;  2IY1 B;  4K7S A;  1EWY C;  2OJR A;  4F1S A;  3Q8E A;  1R7S A;  5C1Z A;  2CU3 A;  2ACZ B;  4JE3 B;  2KDI A;  2H89 B;  2ZEQ A;  4RM8 A;  2KJ6 A;  4OHJ A;  4LDT B;  4W9L A;  1C77 A;  4F7Z A;  2BYV E;  3M95 A;  3GOE A;  4NAM A;  2MJE A;  4W9D A;  1WXA A;  1GUA B;  1A5R A;  3BVZ A;  3FAH A;  4MM3 A;  3P4S B;  2MBH A;  5AZF A;  2FBW B;  2TSS A;  4WIP A;  5BMH A;  2LGY A;  2JZ3 B;  2ZJD A;  4WQM A;  4S0R A;  2LMC A;  1FXI A;  2BF8 B;  3AM9 A;  4L2Y A;  1BUI C;  1SSN A;  2PKO A;  3OJ4 B;  2WX1 A;  2SEB D;  4HCP B;  3M63 B;  2V3S A;  5FKA C;  2RGF A;  3IAS 1;  5JHB A;  2LAS A;  3AEG B;  4G11 A;  3DCG A;  4FAD A;  2KLG A;  4XE0 A;  3DHH C;  2GBN A;  4NZL B;  3HRD D;  4O1N A;  3BK2 A;  1C79 A;  1TS2 A;  3I63 C;  3PT2 B;  3UQA A;  4YSZ B;  1C78 A;  1OQY A;  4M8N A;  1V81 A;  4AJW A;  1N60 A;  2K0P A;  2ONQ A;  4GMV A;  1UGM A;  2IPK D;  2K6Q A;  1ZP0 B;  2KX3 A;  3ML9 A;  4RH6 A;  4IM2 A;  3DDC B;  3KYC D;  2SAK A;  1WXS A;  2WP9 B;  1GPX A;  1KLV A;  1ET6 A;  3N1Y C;  1YMH E;  2PEA A;  5J18 A;  2MCN B;  2NPT B;  1ROE A;  3X0W A;  2IO0 B;  3NZ3 A;  3OJ3 A;  2WXO A;  3HK0 A;  4DBG A;  1VJK A;  1MI0 A;  3DVG Y;  1UGJ A;  2L3Z A;  2N7J A;  1YQ3 B;  2KAC A;  3P63 A;  4KGS A;  5AUK A;  4A90 A;  2L32 A;  3ECI A;  5L95 C;  2V1Y A;  3A9K B;  3TEX A;  2KO3 A;  2O2V B;  2QHO A;  4TKN A;  1HA5 A;  1ZDV A;  2K8B A;  3RMK C;  2JRI B;  3U7Z A;  3SU8 X;  5G55 A;  1PQS A;  2JXT A;  3T8M A;  1WSP A;  2JPH A;  4IC7 B;  4GIV A;  3RNA C;  1GAQ B;  3L4P A;  4YXD B;  5IKC M;  3AEF B;  3ZXV A;  3B1L X;  1MPE A;  5D2M B;  1BXT A;  3NUH B;  2CHZ A;  4PYZ A;  2N9P C;  3EA6 A;  3AE9 B;  4DXA B;  2ZPY A;  2CHW A;  4IM0 A;  1DOX A;  1XXG A;  3ZXR A;  3AE4 B;  4TUU A;  3DBL B;  2EKI A;  3WAO A;  3UIN B;  3V62 A;  4LNO A;  3ZNG C;  2OHF A;  2AL3 A;  4P16 A;  4GN1 A;  2ICI A;  2KDE B;  1MHH E;  2DNF A;  4E71 A;  3U4E G;  5LNK 1;  3RT3 B;  3R2I A;  2D3A A;  2KWV B;  3SHQ A;  1FEH A;  2MA9 B;  4C4V A;  3NZU A;  1PFD A;  1KF6 B;  1MJD A;  4GXB A;  4WH4 A;  3N1X C;  5AZH A;  1UNS A;  3Q3M C;  4XGA B;  3U2S C;  1AYF A;  2GBK A;  2UU7 A;  3NVV A;  1WIA A;  5HFY A;  2G45 B;  4IG7 B;  1D3Z A;  2K9X A;  2DAJ A;  2L76 A;  3JYU A;  3TMP B;  4EFO A;  1SIJ A;  3QC8 B;  4PS7 A;  1LFD A;  2DYM A;  1XLO A;  4XYC A;  5CX3 A;  4DDI D;  4E74 A;  1I4G A;  1ZGU B;  2PE6 B;  1D6E C;  1UEL A;  5HG2 A;  1TZ1 A;  1T0S C;  3VH4 B;  4W9E A;  4MGI E;  3WCQ A;  3KQ4 A;  1WR6 E;  4TQ1 A;  3R3M A;  4MH0 E;  3NG0 A;  2EMS A;  3LDZ E;  3HIZ A;  1QF6 A;  5BYQ A;  3LJ3 A;  1NI3 A;  3RFZ B;  4NQK E;  1HZ6 A;  1LO5 D;  2LXA A;  3ONS A;  2KDB A;  2BWF A;  3PTF C;  4EE2 A;  4ANX A;  3JVZ X;  1R4N B;  1EUV B;  4FHJ A;  2N9L A;  4REZ A;  3ENE A;  1F1H A;  1I4P A;  4RFB A;  1TBE A;  2FID A;  1ZW7 A;  4DQO C;  3APD A;  3JSV A;  3VR8 B;  2INN E;  1T0Q C;  3AV8 A;  5GXG B;  5DPW A;  4G3X B;  4BBN F;  4FUL A;  2KAN A;  3VH3 B;  4C7Y A;  2PPH A;  2WDQ B;  4C56 C;  3ETR A;  4WJN A;  2MX2 A;  3Q6B A;  3VUW A;  4ZHP A;  4XZ4 A;  3FC4 A;  1V8C A;  3UIO B;  1WGY A;  2VZK B;  3TEW A;  3AB5 A;  1IGC A;  4KKI A;  4W9I A;  4H2A A;  3RNB C;  3KWV A;  1VLB A;  3NY5 A;  1XCQ L;  3NS8 A;  3VR9 B;  4DWF A;  1SIF A;  1V1P A;  2DZI A;  4ZRI A;  5IAA C;  1D5Z C;  4YL8 A;  1E90 A;  1XQQ A;  2KKC A;  1FD6 A;  1SXT A;  4BOZ B;  4GLS C;  1AWD A;  2A4Z A;  4US8 A;  4OVU A;  1WE6 A;  4MM3 B;  2N9E B;  4GDK B;  1STE A;  2K1F A;  5C3J B;  2Z0D B;  5E6O A;  1SEB D;  2LFI A;  2M4N A;  3M3J A;  2XBB C;  3RNG C;  3DVG X;  2D11 A;  2HJ1 A;  4ANU A;  1L0V B;  4DHJ D;  2WXQ A;  2GLS A;  2LZ6 A;  4M0W A;  5EE9 A;  1PGA A;  4GB9 A;  2L52 A;  3A9K A;  2BPS A;  1ET9 A;  4LLG M;  4IOI E;  2AQ2 B;  1SF0 A;  2DYO A;  2AYO B;  2IO3 B;  4MEL A;  2N7E A;  1XLN A;  3AU5 A;  2JXX A;  1J8C A;  1KFY B;  2KVZ A;  4RGN A;  2LVQ A;  1SBB B;  2L83 A;  3APF A;  4S17 A;  4C80 A;  3DBL I;  3ZIM A;  4EZL A;  1CQV A;  2MHJ A;  4IDI A;  1SJE D;  1I7H A;  1PGX A;  3A4R A;  2BYF A;  3W5V B;  2LJ5 A;  3CF6 E;  2KNB A;  1WFY A;  2K5P A;  3R7Q A;  1ESF A;  1WH3 A;  5IP4 D;  3P4P B;  1JWU D;  2IO1 B;  4C00 A;  4KDI C;  3H7P A;  3B0A A;  5DPT A;  1ZOY B;  4W9H A;  4CHK A;  1T3Q A;  2D3C A;  3A9J A;  4K3B A;  4ZRK A;  2JF5 A;  4WAA A;  1L4D B;  3AE5 B;  3IVF A;  1JCK B;  2V9H A;  1TJE A;  2VRR B;  2WXF A;  3A1Q A;  1J7B A;  4AP4 C;  3P4R B;  1VR9 A;  4OZA A;  3VAW A;  1SE9 A;  2V4L A;  4GOC A;  1UWM A;  2C7H A;  4F8C B;  3SD5 A;  3VTW A;  1QIL A;  2IDY A;  2NMQ A;  3FIL A;  4MSM B;  2FCM A;  4XWW A;  1T5X D;  3RZF A;  5TSS A;  3OLM D;  3ZDM C;  2NBW B;  4HRO A;  2BVC A;  2W9N A;  3SFD B;  4HPP A;  2DEN B;  3WA0 A;  3N20 C;  2HTH A;  1K52 A; 
#chains in the Genus database with same CATH homology
 1BUI C;  1SSN A;  2PKO A;  3MC0 B;  3VRA B;  1N5X A;  2W54 A;  1ZUD 2;  4YSX B;  1PGB A;  1JML A;  2SEB D;  1Q10 A;  5EE0 A;  1TKE A;  2LHD A;  4XDD A;  5FKA C;  3IAS 1;  2BBC A;  3NVZ A;  3AEG B;  1NEN B;  1E7P B;  1FNU A;  5I4D A;  2V4I B;  4XE0 A;  4NZL B;  3HRD D;  4O1N A;  3BK2 A;  1C79 A;  1TS2 A;  2D5G A;  3H8H A;  3Q8F A;  1ZXH A;  4XDC A;  2WXK A;  4YSZ B;  1YJI A;  1C78 A;  4R3D A;  5H92 C;  1C4A A;  2L1A A;  3IAM 1;  2JWU A;  2LUM A;  1YNT E;  1N60 A;  2K0P A;  3IT4 B;  2LEK A;  2ONQ A;  2JX5 A;  4RNA A;  3ZJV A;  2IPK D;  1L6V A;  1ZP0 B;  1I4R A;  1TS3 A;  1E6E B;  2XN9 C;  4RH6 A;  2Q5W D;  3C8Y A;  3TEZ A;  3B2G A;  2RMM A;  2KDM A;  2SAK A;  4RGT A;  5BMI A;  2WP9 B;  1E10 A;  1GPX A;  1ET6 A;  1NYR A;  2HTM E;  1JWS D;  1FMA D;  1YMH E;  2PMV A;  4HRS A;  2JSV X;  1FXA A;  1ROE A;  1A70 A;  1DOI A;  2AX5 A;  3NZ3 A;  3ZQ4 A;  2WXO A;  4TQ0 A;  2V3N A;  2J53 A;  2DBY A;  4OZC A;  1VJK A;  1MI0 A;  1UGJ A;  2RPV A;  2Y5P A;  2INP E;  4YWG G;  2N7J A;  5AUI A;  1YQ3 B;  2KAC A;  3P63 A;  4KGS A;  1TY0 A;  3AE6 B;  5AUK A;  4A90 A;  2Y3A A;  3SEB A;  2L32 A;  3TEX A;  5G5G A;  1VRA B;  4TSS A;  3AE8 B;  2IJ0 A;  3NS1 A;  1HA5 A;  1ZDV A;  2WQY B;  5H8Y E;  1D5M C;  2ON8 A;  2WU5 B;  1VDV A;  3AEE B;  3I57 A;  5D7G A;  3U7Z A;  2RDH A;  4AS1 A;  2WDV B;  4LK0 M;  2E3T A;  2QSD A;  3DWG C;  1TKY A;  1WXQ A;  1JW9 D;  2JXT A;  3HUI A;  4JWU C;  1EU4 A;  1YN5 A;  2DLB A;  2MJD A;  1WSP A;  1HQR D;  1I4X A;  4RGO S;  1GAQ B;  3L4P A;  4YXD B;  4MH8 A;  3PZ8 A;  1RM6 C;  1FFV A;  3AEF B;  3N9Y C;  5FK9 C;  1JRO A;  1XO3 A;  2N9K A;  1MPE A;  4YSY B;  1FNV A;  1BXT A;  2W82 A;  3NUH B;  2JU6 X;  5G5H A;  3AE1 B;  3R8B A;  2PW9 A;  1ZE3 D;  2IGG A;  1FCC C;  4DXG A;  3EA6 A;  2BS4 B;  3AE9 B;  3BYT B;  5JXV A;  2BS3 B;  1DOX A;  2PVG C;  1XXG A;  2I38 A;  5BYS A;  2R61 A;  3NVW A;  4JX1 C;  3AE4 B;  1WRI A;  3GP7 A;  1L0Y B;  2QJL A;  5EE1 A;  2EKI A;  1V1O A;  4C7Z A;  3ZJU A;  1HEZ E;  4KKJ A;  2KAJ A;  3V3X A;  1PDX A;  2W3S A;  4ARI A;  4MAC A;  2GB1 A;  3I9V 1;  3B9J A;  4D2K A;  5MPO A;  4HKZ E;  3GS2 A;  3B2F A;  2YEP F;  2PVO D;  2OHF A;  1SE2 A;  1DYQ A;  3BVM A;  5E6J A;  4P16 A;  1ZPS A;  2WXN A;  2ICI A;  1MHH E;  1TZO A;  1CJE A;  3E56 A;  1QOA A;  3U4E G;  5LNK 1;  1P7E A;  3R2I A;  4USA A;  1FEH A;  3IT6 B;  2Y5C A;  3TSS A;  3Q8C A;  3MP9 A;  1PFD A;  3Q8A A;  1YQ4 B;  2JZP A;  3LYY A;  2WXM A;  4RCO A;  1KF6 B;  4OZB A;  2JYE A;  2MJ3 A;  1UUP A;  4RGM A;  2JQR B;  4WH4 A;  1I4H A;  1D5X C;  2QMT A;  1UNS A;  2WU2 B;  1DGJ A;  4N59 A;  2W55 A;  3DWM A;  1VZ8 A;  3EUB 2;  1V1P B;  2WXJ A;  3AE2 B;  4AQ7 A;  3U2S C;  1AYF A;  1QKZ A;  4ZYS A;  2LHE A;  3NVV A;  3PZ7 A;  5HFY A;  3MJ5 A;  4RF1 A;  4XWT A;  3AEB B;  2K9X A;  1KH0 A;  2M56 B;  2K3U A;  4JPS A;  4YT0 B;  1SIJ A;  1N5W A;  4ZOH C;  4WWM A;  1FO4 A;  5BYR A;  2W3R A;  1ZXI A;  1GOZ A;  2DYM A;  2XNA C;  4L1B A;  4A6Q A;  4US9 A;  1SE4 A;  1XLO A;  1K50 A;  1AN8 A;  1I4G A;  1JWM D;  1PUT A;  3AMZ A;  1D6E C;  4UDU C;  2I2Y A;  4HEA 1;  2PTL A;  4YTN B;  5HG2 A;  1CZP A;  3AE7 B;  4OW0 A;  4WAF A;  2BYT A;  3P4Q B;  1TKG A;  3WCQ A;  1YN3 A;  3MFG A;  3AN1 A;  2OED A;  1JRP A;  3AED B;  3KQ4 A;  3LB8 C;  2AQ1 B;  2KQ4 X;  3P42 A;  4TQ1 A;  1TS5 A;  4HJG E;  1VZ6 A;  2EEL A;  3VRB B;  2MH7 A;  2JYT A;  3SR6 A;  1AW7 A;  1MHX A;  1JAL A;  1P7F A;  3W2D A;  1J7C A;  1QF6 A;  1KLG D;  5BYQ A;  3BII D;  3BYY B;  1NI3 A;  3RFZ B;  2M19 A;  3T3N A;  1HZ6 A;  1LO5 D;  1FIQ A;  1XF5 L;  4EE2 A;  1B1Z A;  3RPF C;  1QLB B;  5C2T B;  3O13 A;  1IUE A;  2CJN A;  3U52 E;  2J4X A;  2N9L A;  1GB4 A;  4REZ A;  1JWA D;  2FE8 A;  4P6V F;  1QQR A;  1I4P A;  4RFB A;  2QIL A;  2WS3 B;  3OWE B;  2J52 A;  4NJC A;  5FR3 A;  2QIE B;  3P1M A;  4YTM B;  2NTS A;  1GB1 A;  4DQO C;  1F77 A;  4HKQ A;  3TEY A;  4OVZ A;  2DWQ A;  3VR8 B;  2INN E;  2KWD A;  1K51 A;  3AV8 A;  5GXG B;  2LJI A;  2BW2 A;  1L6U A;  1NEK B;  2GI9 A;  2H88 B;  1CK1 A;  2YEP B;  4DXF A;  1L4Z B;  4RF0 A;  4C7Y A;  2CJO A;  3KLS X;  2WDQ B;  1C76 A;  4C56 C;  3ETR A;  5EE3 A;  1FCL A;  4N6E B;  3ZYY X;  5D3I B;  4ZHP A;  3FC4 A;  1V8C A;  1XCT L;  2IGD A;  1BML C;  1Y56 A;  1F2R C;  2VZK B;  2N0S B;  1C9F A;  2WDR B;  3Q69 A;  3HVZ A;  1FRR A;  3TEW A;  1SB3 C;  2G9H D;  3AB5 A;  3BVG A;  3NVY A;  1IGC A;  2WLB A;  4KKI A;  4H2A A;  3KWV A;  1VLB A;  2MEK A;  1TY2 A;  4PT5 A;  1FNW A;  1XCQ L;  2KN4 A;  1EWC A;  3VR9 B;  4A9A A;  4WUR A;  1N61 A;  2AQ3 B;  2J42 A;  3E9S A;  1V1P A;  2PLP A;  1D5Z C;  2WXI A;  3PO0 A;  1WWT A;  4KX6 B;  3CIR B;  4IKG A;  1QOB A;  1MVK A;  2PIA A;  3HVD A;  3VQI A;  2WXL A;  1FD6 A;  3FIL B;  1OQR A;  1SXT A;  1PYW D;  2K22 A;  4GLS C;  1KTK A;  1SE3 A;  1OQQ A;  3AEC B;  1V97 A;  1AWD A;  4US8 A;  3V05 A;  4MM3 B;  1B9R A;  2BS2 B;  1IBX B;  2X38 A;  4GDK B;  1STE A;  4KGT A;  3BK1 A;  3ZGZ A;  3URY A;  1QT9 A;  1NVI D;  2KMM A;  3J9C A;  5C3J B;  1SEB D;  3AEA B;  2LFI A;  4ZHO A;  4L23 A;  4ARC A;  3T3O A;  1JWB D;  1TS4 A;  4B0E A;  3AH7 A;  1E0Z A;  1IGD A;  1L0V B;  2WXQ A;  1F0Z A;  1HXY D;  4N58 A;  4M0W A;  4YTP B;  5EE9 A;  1PGA A;  2L52 A;  1M4V A;  4B0M A;  4LLG M;  1ET9 A;  4IOI E;  2V0G A;  2AQ2 B;  1SF0 A;  2DYO A;  2GRI A;  1I4Q A;  1HZ5 A;  1KLU D;  5T8I A;  1XLN A;  2G1E A;  4ZRP A;  1C4P A;  1QOF A;  4A55 A;  2VZK D;  1KFY B;  1YJJ A;  2QEJ C;  4RGN A;  1SBB B;  2L83 A;  4C80 A;  1XLP A;  1TYG B;  3W1S A;  4Q2J A;  3W9C B;  1EM7 A;  2ZW0 A;  4J3O D;  3CWI A;  1CQV A;  2NTT A;  4IDI A;  1SJE D;  1NYQ A;  2WXH A;  2BTE A;  1I7H A;  1PGX A;  1WYG A;  1FRD A;  2ZW1 A;  5HI1 A;  1L5P A;  3ZJT A;  2BB6 A;  3IXS A;  3W5V B;  2BB5 A;  3AE3 B;  1VZ7 A;  1E9M A;  2K5P A;  2BT6 A;  4KGR A;  4A8X C;  5HHD G;  3NRZ A;  1RYJ A;  3R2T A;  1SJH D;  1C4C A;  1ESF A;  1RWS A;  4FXC A;  2WNM A;  3UI3 A;  1YN4 A;  3P4P B;  1JWU D;  3BWU D;  1QOG A;  3TUO A;  1J7A A;  1DOY A;  2LGI A;  2E6X A;  1XLQ A;  1ZOY B;  1RFK A;  4NAW B;  3BZD B;  1N63 A;  5D3D A;  1T3Q A;  4MT5 A;  2B76 B;  1K52 A;  1EWY C;  1ENF A;  3EGR A;  2WXP A;  3Q8E A;  1R7S A;  1L4D B;  2CU3 A;  3AE5 B;  1K53 A;  2ACZ B;  2HDE A;  4JE3 B;  2WXR A;  1JCK B;  1KRH A;  1TJE A;  1N62 A;  4GDL B;  2WXF A;  1EU3 A;  2H89 B;  1J7B A;  1ACC A;  1FFU A;  1OFF A;  3P4R B;  1UWX A;  4ITK A;  1VR9 A;  4OHJ A;  4OZA A;  3ABV B;  3Q8B A;  4JWS C;  1C77 A;  1UWM A;  4ZRQ A;  4LTU A;  4NAM A;  2V3P A;  2FUG 1;  3MHZ A;  2MJE A;  3W5U B;  1D4B A;  1XEE A;  1ZDX A;  2Z8L A;  1QIL A;  1T6B X;  2IDY A;  2NMQ A;  1JQ4 A;  3FIL A;  1FM0 D;  3GB1 A;  3BVZ A;  2RDG A;  4XWW A;  1T5X D;  5BMG A;  3FAH A;  3KWL A;  4CQN A;  5TSS A;  3P4S B;  1IBX A;  4TMA B;  2M0A A;  2FBW B;  4HRO A;  3SFD B;  3SFE B;  2TSS A;  4WIP A;  5BMH A;  1L0X B;  4WQM A;  2LMC A;  1FXI A;  2WXG A;  3AM9 A;  4L2Y A;  1F2R I;  3LXF A;  2IGH A;  1WGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...