2NMQA

Simultaneous determination of protein structure and dynamics using rdcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
TYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous determination of protein backbone structure and dynamics from residual dipolar couplings
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Signaling protein
molecule keywords Immunoglobulin G-binding protein G precursor
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nmqA00
1P7FA 1XCTL 2KWDA 2N9KA 4MACA 4KGRA 3FILB 1F2RI 2PW9A 3UI3A 1HZ5A 1K51A 2JSVX 2K0PA 4IOIE 2KACA 4HKZE 3GB1A 2QSDA 1MHXA 4WH4A 5HG2A 2IGGA 2KN4A 2NMQA 2GI9A 1MHHE 2ZW1A 4GLSC 2PTLA 1MPEA 1GB4A 5BMIA 1GB1A 1PGAA 2KDMA 2LUMA 2RMMA 5BMGA 2KQ4X 2ZW0A 1JMLA 2EELA 2RPVA 2I2YA 2JWUA 1XCQL 4KGTA 1MVKA 4HJGE 1FCLA 1ZXHA 1IBXA 4D2KA 1HEZE 1IGCA 1D4BA 1PGXA 1YNTE 1UWXA 1HZ6A 1YMHE 2N9LA 2JU6X 1F2RC 2IGHA 1MI0A 2J52A 5HI1A 2J53A 4OZAA 2JZPA 2N7JA 4IKGA 5HHDG 1IGDA 2LGIA 1FD6A 1Q10A 2GB1A 2ON8A 1P7EA 2I38A 5HFYA 1XF5L 2LHEA 5JXVA 1K52A 1IBXB 2JXTA 1K50A 2QMTA 1QKZA 2OEDA 1FCCC 2ONQA 2IGDA 1K53A 4KGSA 2PLPA 3FILA 1EM7A 4OZBA 4OZCA 1C9FA 1KH0A 1PGBA 5BMHA 2LHDA 3V3XA 3MP9A
chains in the Genus database with same CATH superfamily
3AH7A 2K0PA 4HCNB 4NJ7A 5CTRC 3N30A 5IA7A 5MPOA 4F8CB 1WGDA 3DWGC 3QIJA 1MHHE 3RI7C 1PQSA 4MM3B 1C77A 2EKEC 1UNSA 4BKSD 4NQLB 2Y5CA 5FR3A 4EFOA 3RMKC 4A6QA 5E6PA 1AWDA 3OJ4B 4ARCA 1XCQL 3AE4B 2QIEB 4FJVB 4MT5A 2V1YA 2MRPA 1LXDA 1V1PA 3X23A 2HTHA 3P63A 4AP4C 3KLSX 1OEYJ 1UWXA 2QEJC 4YXDB 1L0YB 3LYYA 4EE2A 1HQRD 2XK5B 1GPXA 2JZ3B 3GOEA 4XC2A 4M8MA 1WJ4A 2INPE 3AU5A 4W9GA 4US8A 4YSZB 4RM8A 3PPAA 3TCAA 2N0SB 2BGFA 1FRDA 4W9KA 4WWPA 2ZNVB 1Z2MA 1UGJA 2ZCCA 1ZDXA 1WM2A 4JWSC 3PSEB 5IO9A 2QMTA 4WQMA 2KDBA 2O2VB 2SAKA 1GAQB 2KX0A 3ZYYX 2BS4B 2DLBA 2WX0A 3P4QB 3PGEA 2MQJA 2VH1A 1H8CA 4KGRA 1VZ8A 1SXTA 3FILB 4BBNC 4MJSB 4ZOHC 1K51A 4IOIE 3DBHB 1UZXB 1N5WA 4RNAA 2JUOA 4GMVA 1XXGA 2GBJA 4OVVA 2Q5WD 5EE9A 4GLSC 1DOXA 1B1ZA 5CX3A 1V5OA 2KDMA 2JRIB 2BWFA 4F1SA 5C23A 4PT5A 5BYSA 1OQRA 3AEBB 5EE1A 1XLOA 3H7SA 1KLGD 1WMHB 2MBQA 2UYZB 2G4SA 1IYFA 4A90A 2KAJA 1ZPSA 4JL9A 1D6EC 4JGHB 4XWWA 3TEWA 5H92C 1F2RC 1SF0A 3FAHA 3O13A 4KIKB 1S1QB 1WE6A 4GXBA 1JQ4A 1FIQA 3CWIA 1FPYA 3B0AA 1V97A 2DHZA 4W9HA 4IKGA 3RNBC 3R3MA 2WNMA 1F9JA 1WXAA 3TUOA 2LVPA 3P4PB 1EO6A 1EF5A 2X8XX 3TMPB 5L95C 3Q8FA 3DBLB 2MBEA 2DAFA 2J0KA 3RNFC 1WSPA 2PVOD 2KQSA 1JW9D 1QLBB 3URYA 2I1JA 4LDTB 4MGYE 2IO0B 1WH3A 2KWDA 2ZZPB 1TS4A 5KHQA 2KT7A 2KD0A 5EE0A 3JVZX 3PT2B 2R2QA 3OLMD 3ZQ4A 2BT6A 2KACA 4N59A 1ESFA 3NOBA 3DWMA 2NPTA 4NY0A 2NMQA 5C1ZA 3SD5A 3UGBB 3B1LX 4EZJA 3BINA 3ZO5B 1JMLA 2O2VA 3A4SC 1CK1A 1WF9A 2RPVA 4WAAA 1MVKA 2LGSA 1T6BX 2C7NB 2KX3A 1YN4A 2DNFA 3PS6A 3RNEC 2D3CA 2QHOA 4XZ4A 3MC9A 4UDUC 2N9LA 3RNGC 1J0GA 2XNAC 3I9V1 1TS5A 2JU6X 3M63B 4BKGA 4JWUC 2BYVE 1QOBA 4WJPA 3GZNI 3GP7A 4E3CA 2FIFA 1YJ1A 4NAWB 4YTNB 1FNVA 2KNBA 2N1VA 1WGKA 3AEEB 4US9A 1RAXA 2LGIA 4G11A 3ZNHB 3ZTCA 1TTNA 4HJKA 5LLIA 2GBNA 4X57B 1P0RA 2RDGA 2FBWB 5EE3A 2LJ5A 1SE3A 3RZFA 2ONQA 1TKYA 2IGDA 2RGFA 2MWSB 4ZYNA 4OZCA 5CHVC 4MH8A 4MSMB 2KWUB 2CU3A 2IY1B 1AYFA 1N61A 1JROA 3Q8CA 2K6DB 1OEYA 1ZW7A 3UI3A 3W9CB 2CS4A 3KWLA 4YTMB 4BFRA 4PS3A 1RM6C 2K6QA 2MX2A 4HKQA 5IKCM 4FHJA 2MH7A 3A9JB 4A55A 2GBKA 4IM2A 4YWGG 2MHJA 1Q0WB 4A20A 2LGDA 2EELA 3O65B 2BYFA 2DENB 2LJIA 4L2YA 4P16A 4BZAA 1KLVA 1TS2A 2FE8A 1EWYC 2K3UA 4WIPA 2KTRB 1WGYA 3EA6A 1BT0A 1E10A 3MTNB 2JZPA 4IW0A 3L13A 4HPLB 3EFCA 1UUPA 3VTUA 5CHFA 3Q8EA 3C19A 4MEMA 5G2NA 3RCZA 4CO7A 2MSED 1JRPA 1PUTA 3M62B 1BMLC 4PS7A 3L0WB 3KUCB 3KYCD 1SE9A 3N3KB 2X38A 3DBRI 4HRSA 2KTRA 5LXIB 1UD7A 2D3BA 1V9JA 1EU4A 2LASA 2LD9A 5BO4B 4ZHOA 1I7HA 2INCC 3U7ZA 1OQYA 3B08A 3T9LA 3PHWB 2K9XA 2YEPF 3M3JA 2EMTA 3KW5B 4K3CA 2Z0DB 3QWZB 3V6EB 3WIMA 1XT9B 2L83A 2WXKA 3R7QA 3U52E 1PYWD 2ZVNA 1GB4A 5D3DA 3WAOA 4M01A 2J7QB 2IPKD 3H8HA 3DPDA 3ZXRA 2KO3A 3WAPA 3JSVA 2J0MA 2DZJA 2WDVB 1TZOA 3H7PB 4ANXA 4K81A 3KVFB 1IGCA 2BVCA 2GBMA 1D5XC 2LVOA 1NVID 2SEBD 1WMHA 1YOVB 2CKHB 1HZ6A 1WRDB 2DZIA 2YVCA 2REXA 3DVGX 3KQ4A 3DVNU 1KM7A 3K9OB 2NBWB 1ZUD2 1QT9A 2HJ8A 1M94A 2MEKA 1HTQA 3WANA 5JZEB 2DYMA 5DCNA 2PE9A 4YSXB 5AZHA 3TEZA 2PEAA 3LXFA 3BY4B 1CQVA 2GB1A 3W1SA 3Q14C 4W9LA 3Q3FA 1XQQA 1R7SA 2KN5A 2IO1B 3ZRFA 4NQKE 4KGSA 3K9PB 2WS3B 1T3QA 2KFKB 3H7PA 4BKTA 2WX1A 2BW2A 1FMAD 3VXWA 1ET9A 1J7BA 3PREA 2GRIA 4ICVA 2PW9A 2V3SA 2NTTA 3HVZA 1SE2A 4RF0A 1E90A 3N32A 3BWUD 4WJQA 3TSSA 3VUWA 4M8NA 1NEKB 4A3PA 4PYUA 4ARIA 1YQ3B 1TGZB 1TJEA 1WX9A 1GB1A 1ZGUB 3HK0A 3T3NA 1ZOYB 4PK1A 3OG5A 1Y8RC 2G4DB 4G50A 2KDFB 4NAWA 4J6IA 1E8XA 1FRRA 4ITKA 3SFEB 1ZXHA 4D2KA 3ZW3A 2CJNA 1A70A 3N9YC 2IDYA 2JVCA 2UWQA 4GB9A 3BYYB 1WX8A 1WR6E 4W9JA 4GGQA 1MG8A 1ZKHA 2WHIA 5DPTA 2NBVB 2AQ1B 4E71A 1HTOA 1SIJA 2LEKA 1T5XD 3QQ8B 2LZ6A 4C56C 1UBQA 1WI0A 2DYOA 2L76A 4W9DA 2JT4B 2HDEA 3EECA 1R4MI 4NAMA 4USAA 4WAFA 1R4MB 1SB3C 5DPRA 1FXIA 4IM0A 2BS2B 2MJ3A 1K50A 3NS1A 1UWMA 2WQYB 3GS2A 4MGKE 5L83A 2N9EB 3NVZA 4PS8A 2MJEA 1WWTA 3ML9A 3R66C 1QOAA 2W3RA 2B76B 1L0VB 3P4RB 2BQQA 3DBRB 2LRUA 2LI5A 1J8CA 1J7CA 2L00B 4HEA1 2PIAA 3EHVA 1HZ5A 2M17A 3WAMA 1YJJA 2XBBC 4BKSA 4S0RA 2JZZA 4KKIA 3ZUNA 1D5ZC 2J0JA 2KWCA 2DYBA 5LXHA 3ALBA 1E7UA 2MP2A 2PKOA 2GI9A 4EOYA 2FUHB 2FNJB 1RYJA 2JYTA 4KZCA 1VDVA 1N63A 3AE7B 2N9PC 3WCQA 2BS3B 1WYGA 3AV8A 4K7UA 4WURA 3VTVA 1FNWA 3HRDD 4IUMB 4C4VA 3V61A 3KYDD 2L7RA 4LNFA 5D2MB 1GJZA 2IY0B 4DDID 4ZRIA 3L08A 4HLEA 4JQWC 3VR8B 4M0WB 2AQ2B 1MG4A 2AX5A 4NNJB 1V80A 2KC2A 2FCSA 3OAWA 3T8MA 1T0SC 2KC1A 2WXOA 1Q5WB 1V49A 2CHZA 2WXQA 1Q10A 3Q69A 4OW0A 2BTEA 2HD5B 2AL6A 4MSQB 3PRPB 2K5PA 2INDC 5HFYA 4I6PA 3RD2A 3H9DA 4M00A 3FKYA 3B2FA 3DQVA 1WGRA 3AEFB 2IZVB 4W9IA 5AZGA 4REZA 4B0EA 4ZRPA 1PGBA 4IWQA 1Z5SB 4RGOS 1PFDA 2AQ3B 1FFUA 2DX5B 2ICIA 2L8JA 3KWVA 2H88B 3P42A 2IO3B 4LJPB 2WXLA 1WGGA 4C80A 3TIXA 4F7ZA 1VCBA 4LTUA 2JYEA 4EUTA 2IGGA 5HKHA 4XX5A 4TSSA 2NTSA 4KKJA 3ZNGC 3U8ZA 4TKNA 1VRAB 2K8CA 1JWUD 4FULA 4B6WA 2K8HA 1FNUA 1FO4A 1LM8B 5D94A 3PLUA 1P9DU 2NVUI 2WDRB 3NVVA 2VRRB 4B95A 1LFDA 1JRUA 3Q8BA 3NJTA 2D07B 4ZYSA 2C7MB 4IWPA 1SGHA 2M1MA 2XK5A 3WALA 3MHSD 1C1YB 1YX5B 4N58A 3PZ8A 4J3OD 2DZKA 1G6JA 4A9AA 3NZSA 3IHPC 3E9SA 2BKFA 2KTFA 3VRAB 3L16A 2OHFA 2L3ZA 3ZVVA 5HHDG 3SDLC 4ANVA 5E6JA 1OTRB 2JXXA 3MC0B 1KJTA 4WWNA 4N6EB 2V3PA 3BYTB 4II3B 1TY0A 3SEBA 1QILA 2NS5A 1DOIA 1TKEA 1DYQA 3HM6X 5G5HA 3R8BA 2A4ZA 3UQBA 2G3QB 2WDTB 3LB8C 4LNOA 3AECB 1K53A 1J7AA 3N1YC 3IT6B 2Z0EB 3A4RA 2FCMA 2KJ6A 4RCOA 1C4AA 1F77A 2WXJA 3ECIA 1T0RC 2ZVOA 2WXIA 2N1WA 3Q3MC 1N6ZA 1JWAD 2LVQA 1XEEA 4WJNA 2Z59B 1QF6A 1KLUD 1N62A 4RGMA 3VHTC 5IP4D 1V86A 1C3TA 1TT5B 1JALA 1VZ6A 1WYWB 2MBBB 3TEXA 3NRZA 3PO0A 4LK0M 2BYTA 1MPEA 3N1ZC 2RPQA 2JF5A 2AEHA 5H8YE 2RMMA 5BMGA 2TSSA 2I2YA 1UGMA 4IDIA 1E6EB 2W54A 5AEKB 4AOFA 1AARA 3APCA 2VH2A 1MFWA 3IAS1 2LFIA 2A5UA 3C8YA 1YMHE 2C60A 2V0GA 4JX1C 1FXTB 4MGZE 3I63C 5GMVA 3U2SC 1SEBD 1OGWA 3I57A 5G5GA 5D6JB 4AJWA 3AEAB 3RULA 5JHAA 4WJOA 4JIOU 4ZRJA 2QCZA 1XD3B 2AYOB 1WZ0A 3I3TB 4RFBA 1FD6A 1WY8A 2M56B 3EC8A 3KUDB 3DVNV 4KX6B 1ACCA 2LHEA 4YL8A 1WM3A 3RZWC 2FCNA 2XEWA 2XN9C 5J18A 2CJOA 2C9WB 5D3IB 5FKAC 3AE5B 3GZNB 1L4ZB 2MLBA 1HA5A 1N5XA 1KH0A 2BF8B 2LUEA 1YN3A 2JQRB 2KVZA 3DHHC 4ZRKA 2MBHA 3GE8C 2N9KA 4MACA 3UF8A 4GIVA 1NI2A 2KMAA 3A1QA 3PZ7A 4FJZA 1U4AA 4IWOA 1V2YA 1ET6A 2V9HA 4I6NB 2KZRA 3AE1B 4ACFA 2D2QA 1TZ1A 3AEGB 3PLVA 2KN4A 1I4GA 4GDLB 2D10A 1L5PA 4EZLA 1K8RB 1ZDVA 1AW7A 1WJ6A 2H89B 3VUYA 2KQ4X 3AXCA 2IBIB 3V05A 3E56A 4YTPB 3X0WA 1C4PA 2G1EA 3VAWA 4CYEA 4E74A 1F1HA 1YNTE 4A3OA 2GMIC 3L17A 1WR1A 2RDBC 3D32A 2IO2B 1BUIC 2D5GA 4C00A 1TYGB 2FIDA 3WA0A 2J53A 3MHZA 3EUB2 3NHEB 1E8WA 2ZJDA 2OOBB 3A1QB 3DHGC 4HPMB 1JWBD 1GC7A 1IGDA 3BVMA 3HUIA 3W5UB 4KVGB 2HJ1A 3DBLI 5GXGB 3EGRA 2FAZA 2ZEQA 2KLCA 3ZJUA 3L54A 3AB5A 2I38A 2K25A 2OJWA 1YQ4B 2WXNA 2O6VD 1RFKA 1IPGA 1J19A 3GE3C 2BWES 2K1FA 2N4FA 3DHIC 2K8BA 2V3NA 4GOCA 3QHTA 1KOTA 1FM0D 1RFAA 3S2AA 2Y5BB 2MW5A 5AUKA 3V3XA 1C78A 2WXGA 5J2RA 1P7FA 4K1RB 1GOZA 3P1MA 3APDA 3JYUA 3RUIB 3U7DA 3P2BA 4ZHPA 1E9MA 4LDTD 3VH4B 4BVUC 5IN7A 1Q1OA 4K3BA 1JWSD 4KSLC 1I4RA 4WH4A 1WZ3A 5HG2A 3SFDB 5JHBA 3DBSA 2GOWA 4FLHA 3QCAA 2ASQA 2NPTB 1TKGA 2DWQA 3NUHB 2JX5A 2LGYA 2N9XA 1WX7A 2C7HA 4FN2A 2ZPYA 1JWMD 4LNIA 3ZKJC 1QOFA 4C7ZA 4XGAB 1IP9A 1NBFC 3RNCC 3NY5A 1EF1A 2KOXA 1MI0A 1D3ZA 3MC8A 2M4NA 3IXSA 2KMCA 4DQOC 1JCKB 2PMVA 4I6LB 1F52A 4GN1A 3DCGA 2W82A 2R61A 3M95A 2EMSA 2W9NA 1L6UA 1AN8A 2JWZA 2FCQA 2KFJA 1GG3A 2M19A 2ON8A 2KANA 3H1UA 1I4XA 4IC7B 1WXSA 5AZFA 1KFYB 2WXRA 3CSTA 4XYCA 3QJZA 1YN5A 3AE6B 2BYEA 1R4NI 3VH3B 4A8XC 1KRHA 3PV1A 1C76A 1V1PB 3QC8B 3DDCB 4TQ0A 4RGTA 4AWJA 3KH0A 3IFWB 4L23A 4AQ7A 3ZJVA 1V5TA 2K39A 4TMAB 3IVFA 3LDZE 4GSWA 4B9KA 2C5LC 3Q2AC 2KJRA 2N7EA 4GDKB 1CJEA 4DXFA 3P4SB 2PVGC 2JSVX 3EFUA 1ENFA 3V62A 4HKZE 4TV3A 3GB1A 4GDKA 2WGSA 1IUEA 5FR6A 4FXCA 2KQ7A 2ZW1A 1SSNA 5C2TB 2FUG1 4HDQA 4OVZA 4DXAB 3NVWA 3QAQA 5BMIA 2K22A 1PGAA 3HM3A 1FCLA 2KDIA 3A9KB 1IBXA 3U4EG 2LWPA 4JE3B 1P98A 1NI3A 1L4DB 3W2DA 1SE4A 3HHMA 4JPSA 2KWVB 1LQBA 2L0FA 1EU3A 2JRHA 1WXMA 1I42A 4XE0A 4ZRQA 1WRIA 3CSFA 4W9CA 3RYTA 3W1SC 4K7WA 5HI1A 4OZAA 4PYZA 1NDDA 3BZDB 3UIPB 4S17A 1NYQA 1V81A 2BKRB 3V6CB 2D3AA 2NBUA 4BOZB 2CHXA 5BYQA 2WP9B 3VRBB 1TS3A 4R3DA 1N60A 2PE6B 4FBJB 1FXAA 1SJHD 1XF5L 5JXVA 2GLSA 1FFVA 1K52A 4L1BA 2YEPB 4NPNA 4DDGD 2YLMA 1FCCC 2D3GA 3FILA 2DBYA 4OZBA 3B9JA 1WJNA 1T0YA 3AULA 2L0TA 4XWTA 2MJDA 4HWIB 1R4NB 4LNNA 1CZPA 3W1YA 3PRZA 2GBRA 2RDHA 3AU4A 3HVDA 4HROA 2WXFA 5J17A 3TL5A 2W3SA 3B2GA 2RR9A 3UINB 3SHQA 2WDQB 1V1OA 4JLCA 4P6VF 3AEDB 3PTFC 1WXQA 2VZKD 3NVYA 5E6NA 4WWOA 1MHXA 3W5VB 3RFZB 1XLNA 4MGIE 1LGRA 2V4LA 1B9RA 4DWFA 3ZDTA 2J42A 4EZKA 2BB6A 3Q3JA 1S3SG 1WFYA 3BK1A 3ZRCA 1SIFA 1KTKA 2KK8A 3BVGA 4DHZB 1DOYA 1VD2A 4HJGE 1E0ZA 4RF1A 2KJHB 2DAJA 3IAM1 1PGXA 1HXYD 1YIWA 2KKCA 3ZIMA 4Q2JA 1I4PA 2PPHA 1F0ZA 1WJUA 3LJ3A 3ZNID 4K7SA 4N9F4 3AE8B 3U30A 4WWMA 1I4QA 1QOGA 2BBCA 5TSSA 2O6VA 3TBLD 4RH6A 4M0WA 1GUAB 1M4VA 2UU7A 3JSVB 3NZUA 3VDZA 3IBEA 3RT3B 3N20C 3CMMB 3A9KA 1IBXB 1RLFA 1L7YA 2OEDA 4TQ1A 1FEHA 2WXMA 3VQIA 1EM7A 3AE3B 3RNAC 2KYWA 3ZXVA 4AUQC 2CHWA 1Y56A 3MP9A 2EKIA 2JPHA 4GU2A 4FADA 3BVZA 3L4PA 2MCNB 3OJ3A 4HCPB 2LGXA 4YT0B 1F2RI 2ACZB 4LLGM 1VLBA 1YJIA 2LXCA 2AL3A 1QQRA 4IM3A 2PJHA 3RPFC 1TIFA 2CU1A 2J4XA 4KV2A 2M0XA 3UIOB 3JW0X 1L2NA 5FK9C 3L10B 3MFGA 2QJLA 2PTLA 1XLPA 4IG7B 1ISNA 2NCNA 3NZ3A 3HIZA 4ANWA 3DBHI 2G9HD 3ZLZA 4P7IA 2KLGA 4AS1A 1ZP0B 1HEZE 2E6XA 4BOSC 5AUIA 2L05A 3TEYA 1PDXA 4G0NB 4ASWC 2L52A 4FA6A 3CIRB 3VUXA 1P1AA 2RSUA 3VVWB 1CMXB 4DXGA 3I5JC 1BXTA 2L1AA 2E3TA 1H4RA 3Q8AA 4FHKA 4G3XB 3AE9B 4DHJD 1LO5D 4QAYA 3VR9B 1P3QU 4W9EA 3H6NA 3PRMB 4KDIC 1SJED 2LMCA 3MJ5A 2KMMA 1RRBA 3VTWA 2D11A 4FJYA 3OWEB 1RWSA 1X1MA 2RD0A 2ZPNA 3BIID 2B3AA 3AN1A 3A9JA 4M02A 3UQAA 3QARA 2WLBA 3SR6A 1XCTL 4ICUA 4HVBA 3APFA 1WE7A 3R2IA 2AWTA 1C4CA 2M8SA 2IJ0A 2DZMA 4KIKA 1VJKA 3PVLA 5T8IA 2HE7A 5D7GA 2WU2B 4LJOB 3Q6BA 2QSDA 1YD8U 1V8CA 5DPSA 2Y5PA 2QDFA 2M0AA 1NYRA 3NG0A 2WU5B 2KVRA 2INNE 3Q3NC 3ZTDA 4CHKA 5I4DA 2BB5A 2KDEB 2LUMA 3QX1A 3ONSA 5IOIA 1TBEA 2ZW0A 2ZCBA 4KGTA 1ROEA 4MJSA 4NJ6A 4TUUA 1VR9A 1UF0A 1L6VA 4B0MA 4HXDA 1GC6A 1L0XB 1STEA 4O1NA 5E6OA 2LRWA 4C4VB 3TJPA 1OFFA 1MJDA 2BPSA 3IT4B 2LXAA 2IYDB 3T3OA 2J52A 1TY2A 3N1XC 3ETRA 2CR5A 3CF6E 5DPWA 3ZDMC 4EEWA 5JH5C 3FC4A 3ML8A 3C0RB 2JY6A 2G45B 3V60A 4EKUA 2HTME 4ANUA 4OVUA 4DK5A 2QC8A 4GDLA 2N7DA 1E8ZA 4OHJA 4YSYB 4HK2A 3NS8A 4AJYB 1ZXIA 3PHXB 1XO3A 3RN9C 4MM3A 1YX6B 2Y3AA 1QKZA 3DVGY 5EDSA 3ZGZA 2KXJA 2OJRA 2PLPA 3QA8A 4DHZE 3ENEA 1I35A 3QK0A 1C9FA 4ZDVA 1I4HA 2WWZA 2LHDA 4MDKE 1T0QC 4DHJB 4URKA 1NENB 1C79A 3AE2B 5BYRA 3KUZA 1ZE3D 2R2OA 1E7VA 1DGJA 2ZNVC 2O6VB 2V4IB 1E7PB 4P1BC 2MA9B 1D5MC 4W9FA 4BBNF 4NJCA 2NR2A 4XDDA 4RM9A 3SU8X 4P1CC 2JWUA 4CQNA 3VFKA 2VZKB 4C7YA 5KHOA 4HPPA 3ZNZB 3AI5A 4MELA 1D4BA 3AM9A 4WQOB 5CHWA 2MBOA 1VZ7A 3DOWA 2Z8LA 3AMZA 1E5WA 2WYQA 1UBIA 1A5RA 2L32A 2IGHA 3R7RA 1OQQA 3J9CA 5IAAC 3BK2A 4DBGA 1WGHA 2QILA 2N7JA 1UELA 4NZLB 2MP2B 3A33B 1WIAA 4BAXA 3ABVB 4II2B 4KDLB 1EWCA 3PZDA 4KZ0A 1HE8A 4HDOA 2W55A 1E8YA 4MH0E 2WXHA 1P7EA 1V6EA 1WXVA 4H2AA 1SBBB 1KF6B 1QZEA 4LNKA 5G55A 2JXTA 3IG3A 2KHWB 1GNUA 5TR5A 4RGNA 5C3JB 1XLQA 1YQBA 4RMAA 3MJWA 3ZJTA 1EUVB 2KFKA 4LCDE 4XDCA 2I1KA 2WXPA 5LNK1 5BMHA 3R2TA 1UH6A 4KSKC 3Q3OC
chains in the Genus database with same CATH topology
1I7HA 1JWAD 2RDHA 3AH7A 1XEEA 3HVDA 3U7ZA 4HROA 2WXFA 1QF6A 2W3SA 3B2GA 1KLUD 1N62A 2WDQB 1V1OA 2K9XA 4RGMA 2K0PA 2YEPF 4P6VF 3AEDB 1WXQA 2VZKD 3NVYA 3W5VB 1MHXA 1JALA 1VZ6A 3RFZB 1XLNA 5MPOA 2L83A 2WXKA 3TEXA 3DWGC 1MHHE 3NRZA 1B9RA 3PO0A 4LK0M 2BYTA 1MPEA 3U52E 1PYWD 2J42A 1C77A 4MM3B 2BB6A 1UNSA 1GB4A 5D3DA 2Y5CA 5FR3A 5H8YE 4A6QA 3BK1A 2RMMA 5BMGA 1AWDA 3BVGA 1KTKA 2IPKD 3H8HA 2TSSA 2I2YA 4ARCA 1DOYA 1XCQL 4IDIA 4HJGE 3AE4B 2QIEB 1E0ZA 1E6EB 2W54A 2WDVB 1TZOA 4MT5A 4RF1A 3IAM1 1V1PA 1IGCA 1D5XC 2SEBD 1NVID 3P63A 1PGXA 1HXYD 2LFIA 3IAS1 3KLSX 1UWXA 3C8YA 2QEJC 1HZ6A 1YMHE 4YXDB 1L0YB 3LYYA 4Q2JA 2V0GA 4EE2A 1I4PA 1HQRD 4JX1C 1F0ZA 1GPXA 3U2SC 1SEBD 3I57A 5G5GA 3KQ4A 3AE8B 3AEAB 2INPE 1ZUD2 1QT9A 4WWMA 1I4QA 1QOGA 2BBCA 5TSSA 2MEKA 4RH6A 4US8A 4M0WA 2DYMA 4YSZB 4YSXB 3TEZA 2N0SB 1M4VA 1FRDA 3LXFA 4RFBA 1FD6A 2M56B 1CQVA 2GB1A 3W1SA 4KX6B 1UGJA 1R7SA 1ZDXA 1ACCA 4JWSC 2LHEA 1IBXB 2QMTA 2OEDA 2XN9C 4WQMA 2CJOA 4KGSA 5D3IB 4TQ1A 3AE5B 5FKAC 2WS3B 1T3QA 2SAKA 1GAQB 1L4ZB 1FEHA 2WXMA 3VQIA 1EM7A 1HA5A 3AE3B 1N5XA 1KH0A 3ZYYX 2BS4B 1YN3A 2BW2A 1Y56A 3MP9A 2EKIA 2DLBA 3P4QB 1FMAD 2JQRB 1ET9A 1J7BA 3BVZA 3L4PA 2N9KA 4MACA 2GRIA 4KGRA 4YT0B 1VZ8A 1SXTA 1F2RI 3FILB 2ACZB 3PZ7A 2PW9A 4LLGM 1VLBA 1YJIA 2NTTA 3HVZA 4ZOHC 1K51A 1ET6A 1SE2A 1QQRA 4IOIE 4RF0A 1N5WA 4RNAA 3BWUD 3RPFC 3TSSA 2J4XA 3AE1B 1XXGA 1NEKB 3AEGB 2KN4A 4ARIA 1YQ3B 2Q5WD 1I4GA 5FK9C 5EE9A 1TJEA 2QJLA 3MFGA 2PTLA 4GLSC 1XLPA 4GDLB 1DOXA 1L5PA 1B1ZA 1GB1A 1ZDVA 2KDMA 1AW7A 2H89B 3T3NA 1ZOYB 3NZ3A 2KQ4X 2G9HD 3E56A 3V05A 4PT5A 5BYSA 1OQRA 4YTPB 1FRRA 3AEBB 5EE1A 1XLOA 4ITKA 3SFEB 4AS1A 1ZP0B 1C4PA 1ZXHA 4D2KA 1HEZE 2CJNA 1A70A 2G1EA 1KLGD 3N9YC 2IDYA 2E6XA 4A90A 1YNTE 2KAJA 3BYYB 5AUIA 1ZPSA 3TEYA 1D6EC 1PDXA 4XWWA 3TEWA 5H92C 1F2RC 1BUIC 2D5GA 1SF0A 2L52A 3FAHA 3CIRB 3O13A 1TYGB 2J53A 3MHZA 3EUB2 2AQ1B 4DXGA 1BXTA 1JQ4A 2L1AA 2E3TA 1FIQA 3CWIA 3Q8AA 1SIJA 2LEKA 3AE9B 1T5XD 1V97A 1LO5D 4IKGA 1JWBD 4C56C 2WNMA 3VR9B 1IGDA 2DYOA 3BVMA 3HUIA 3TUOA 3W5UB 3P4PB 2HDEA 5GXGB 4NAMA 3EGRA 4USAA 4WAFA 3Q8FA 1SB3C 1SJED 2LMCA 3ZJUA 3AB5A 2I38A 1FXIA 2WXNA 1YQ4B 3MJ5A 2KMMA 2BS2B 2MJ3A 1K50A 3NS1A 1RFKA 1UWMA 2WQYB 3GS2A 3OWEB 1RWSA 1WSPA 2PVOD 2V3NA 3BIID 3NVZA 2MJEA 1WWTA 1QOAA 3AN1A 1JW9D 2W3RA 2B76B 1L0VB 1QLBB 1FM0D 3P4RB 3URYA 5AUKA 3V3XA 1C78A 2WXGA 2WLBA 3SR6A 1P7FA 1XCTL 1GOZA 2KWDA 3P1MA 1TS4A 3R2IA 1J7CA 1C4CA 2IJ0A 4HEA1 5EE0A 4ZHPA 1VJKA 2PIAA 5T8IA 1E9MA 1HZ5A 5D7GA 1YJJA 2WU2B 3ZQ4A 4KKIA 1D5ZC 2BT6A 2KACA 4N59A 2QSDA 1V8CA 1ESFA 1JWSD 2Y5PA 3DWMA 1I4RA 4WH4A 5HG2A 2M0AA 1NYRA 2NMQA 2GI9A 2PKOA 3SFDB 2WU5B 1RYJA 2INNE 2JYTA 1VDVA 1N63A 3AE7B 2BB5A 5I4DA 2LUMA 1TKGA 3WCQA 2DWQA 2BS3B 3NUHB 2ZW0A 1JMLA 1WYGA 2JX5A 3AV8A 4WURA 1CK1A 2RPVA 1FNWA 4KGTA 1ROEA 1MVKA 3HRDD 1T6BX 1JWMD 1YN4A 1VR9A 1QOFA 1L6VA 4C7ZA 4B0MA 1L0XB 1STEA 4O1NA 4UDUC 1OFFA 2N9LA 2XNAC 3I9V1 3IT4B 1TS5A 2JU6X 4JWUC 3T3OA 1MI0A 2J52A 1TY2A 1QOBA 3VR8B 2AQ2B 3ETRA 3GP7A 3IXSA 4DQOC 2AX5A 4NAWB 4YTNB 1FNVA 1JCKB 2PMVA 3AEEB 3FC4A 1WGKA 4US9A 2W82A 2R61A 2HTME 2LGIA 2WXOA 1L6UA 1AN8A 3Q69A 2WXQA 1Q10A 4OHJA 4OW0A 4YSYB 2M19A 2ON8A 2BTEA 1I4XA 2K5PA 1ZXIA 1XO3A 1KFYB 5HFYA 2WXRA 2RDGA 2FBWB 5EE3A 2Y3AA 1QKZA 1SE3A 3B2FA 1YN5A 3ZGZA 2ONQA 1TKYA 2IGDA 3AE6B 3AEFB 2PLPA 4REZA 4A8XC 4B0EA 1KRHA 4OZCA 1C76A 4ZRPA 1C9FA 1V1PB 1I4HA 1PGBA 4MH8A 4TQ0A 4RGTA 4RGOS 1PFDA 2AQ3B 2LHDA 2CU3A 1FFUA 1NENB 1AYFA 1C79A 4L23A 3AE2B 4AQ7A 5BYRA 3ZJVA 4TMAB 2ICIA 1N61A 3KWVA 1JROA 2H88B 3Q8CA 3P42A 4GDKB 1CJEA 3UI3A 2WXLA 1ZE3D 3W9CB 4DXFA 3P4SB 2PVGC 2JSVX 4C80A 1DGJA 3KWLA 4YTMB 1ENFA 4HKZE 3GB1A 1RM6C 4LTUA 1IUEA 2V4IB 4HKQA 2JYEA 4FXCA 2IGGA 1E7PB 4TSSA 2NTSA 1D5MC 1SSNA 2MH7A 2ZW1A 4KKJA 5C2TB 2FUG1 4OVZA 4A55A 3NVWA 5BMIA 2K22A 4YWGG 4NJCA 1PGAA 1VRAB 4XDDA 1JWUD 1FNUA 2EELA 1FO4A 2JWUA 1FCLA 2LJIA 4CQNA 2WDRB 3NVVA 3U4EG 1IBXA 2VZKB 4C7YA 3Q8BA 4JE3B 4L2YA 4P16A 1D4BA 1NI3A 1L4DB 3W2DA 1SE4A 3AM9A 4ZYSA 4JPSA 1VZ7A 1TS2A 2FE8A 1EU3A 1EWYC 2K3UA 2Z8LA 4WIPA 3AMZA 4XE0A 4ZRQA 1WRIA 3EA6A 1E10A 2L32A 2IGHA 4N58A 3PZ8A 1OQQA 4J3OD 5HI1A 3J9CA 4OZAA 3BK2A 2JZPA 4A9AA 3BZDB 3E9SA 2QILA 2N7JA 1UUPA 3VRAB 2OHFA 4NZLB 3Q8EA 3ABVB 5HHDG 1NYQA 5E6JA 3MC0B 1EWCA 5BYQA 2W55A 2V3PA 1JRPA 2WP9B 1PUTA 3BYTB 4N6EB 2WXHA 1TY0A 3VRBB 1TS3A 1BMLC 4R3DA 3SEBA 1N60A 1P7EA 1QILA 1DOIA 1TKEA 4H2AA 1SBBB 1DYQA 1FXAA 5G5HA 1SJHD 3R8BA 1KF6B 1XF5L 5JXVA 1FFVA 1K52A 2JXTA 4L1BA 2YEPB 2X38A 5C3JB 4HRSA 4RGNA 3LB8C 1FCCC 1XLQA 3AECB 1K53A 1J7AA 3IT6B 3FILA 3ZJTA 2DBYA 4RCOA 1C4AA 4OZBA 1F77A 3B9JA 4XDCA 2WXJA 4XWTA 2WXPA 2MJDA 5LNK1 5BMHA 1EU4A 3R2TA 2WXIA 4ZHOA 1CZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7F A;  1XCT L;  2KWD A;  2N9K A;  4MAC A;  4KGR A;  3FIL B;  1F2R I;  2PW9 A;  3UI3 A;  1HZ5 A;  1K51 A;  2JSV X;  2K0P A;  4IOI E;  2KAC A;  4HKZ E;  3GB1 A;  2QSD A;  1MHX A;  4WH4 A;  5HG2 A;  2IGG A;  2KN4 A;  2NMQ A;  2GI9 A;  1MHH E;  2ZW1 A;  4GLS C;  2PTL A;  1MPE A;  1GB4 A;  5BMI A;  1GB1 A;  1PGA A;  2KDM A;  2LUM A;  2RMM A;  5BMG A;  2KQ4 X;  2ZW0 A;  1JML A;  2EEL A;  2RPV A;  2I2Y A;  2JWU A;  1XCQ L;  4KGT A;  1MVK A;  4HJG E;  1FCL A;  1ZXH A;  1IBX A;  4D2K A;  1HEZ E;  1IGC A;  1D4B A;  1PGX A;  1YNT E;  1UWX A;  1HZ6 A;  1YMH E;  2N9L A;  2JU6 X;  1F2R C;  2IGH A;  1MI0 A;  2J52 A;  5HI1 A;  2J53 A;  4OZA A;  2JZP A;  2N7J A;  4IKG A;  5HHD G;  1IGD A;  2LGI A;  1FD6 A;  1Q10 A;  2GB1 A;  2ON8 A;  1P7E A;  2I38 A;  5HFY A;  1XF5 L;  2LHE A;  5JXV A;  1K52 A;  1IBX B;  2JXT A;  1K50 A;  2QMT A;  1QKZ A;  2OED A;  1FCC C;  2ONQ A;  2IGD A;  1K53 A;  4KGS A;  2PLP A;  3FIL A;  1EM7 A;  4OZB A;  4OZC A;  1C9F A;  1KH0 A;  1PGB A;  5BMH A;  2LHD A;  3V3X A;  3MP9 A; 
#chains in the Genus database with same CATH topology
 3AH7 A;  2K0P A;  4HCN B;  4NJ7 A;  5CTR C;  3N30 A;  5IA7 A;  5MPO A;  4F8C B;  1WGD A;  3DWG C;  3QIJ A;  1MHH E;  3RI7 C;  1PQS A;  4MM3 B;  1C77 A;  2EKE C;  1UNS A;  4BKS D;  4NQL B;  2Y5C A;  5FR3 A;  4EFO A;  3RMK C;  4A6Q A;  5E6P A;  1AWD A;  3OJ4 B;  4ARC A;  1XCQ L;  3AE4 B;  2QIE B;  4FJV B;  4MT5 A;  2V1Y A;  2MRP A;  1LXD A;  1V1P A;  3X23 A;  2HTH A;  3P63 A;  4AP4 C;  3KLS X;  1OEY J;  1UWX A;  2QEJ C;  4YXD B;  1L0Y B;  3LYY A;  4EE2 A;  1HQR D;  2XK5 B;  1GPX A;  2JZ3 B;  3GOE A;  4XC2 A;  4M8M A;  1WJ4 A;  2INP E;  3AU5 A;  4W9G A;  4US8 A;  4YSZ B;  4RM8 A;  3PPA A;  3TCA A;  2N0S B;  2BGF A;  1FRD A;  4W9K A;  4WWP A;  2ZNV B;  1Z2M A;  1UGJ A;  2ZCC A;  1ZDX A;  1WM2 A;  4JWS C;  3PSE B;  5IO9 A;  2QMT A;  4WQM A;  2KDB A;  2O2V B;  2SAK A;  1GAQ B;  2KX0 A;  3ZYY X;  2BS4 B;  2DLB A;  2WX0 A;  3P4Q B;  3PGE A;  2MQJ A;  2VH1 A;  1H8C A;  4KGR A;  1VZ8 A;  1SXT A;  3FIL B;  4BBN C;  4MJS B;  4ZOH C;  1K51 A;  4IOI E;  3DBH B;  1UZX B;  1N5W A;  4RNA A;  2JUO A;  4GMV A;  1XXG A;  2GBJ A;  4OVV A;  2Q5W D;  5EE9 A;  4GLS C;  1DOX A;  1B1Z A;  5CX3 A;  1V5O A;  2KDM A;  2JRI B;  2BWF A;  4F1S A;  5C23 A;  4PT5 A;  5BYS A;  1OQR A;  3AEB B;  5EE1 A;  1XLO A;  3H7S A;  1KLG D;  1WMH B;  2MBQ A;  2UYZ B;  2G4S A;  1IYF A;  4A90 A;  2KAJ A;  1ZPS A;  4JL9 A;  1D6E C;  4JGH B;  4XWW A;  3TEW A;  5H92 C;  1F2R C;  1SF0 A;  3FAH A;  3O13 A;  4KIK B;  1S1Q B;  1WE6 A;  4GXB A;  1JQ4 A;  1FIQ A;  3CWI A;  1FPY A;  3B0A A;  1V97 A;  2DHZ A;  4W9H A;  4IKG A;  3RNB C;  3R3M A;  2WNM A;  1F9J A;  1WXA A;  3TUO A;  2LVP A;  3P4P B;  1EO6 A;  1EF5 A;  2X8X X;  3TMP B;  5L95 C;  3Q8F A;  3DBL B;  2MBE A;  2DAF A;  2J0K A;  3RNF C;  1WSP A;  2PVO D;  2KQS A;  1JW9 D;  1QLB B;  3URY A;  2I1J A;  4LDT B;  4MGY E;  2IO0 B;  1WH3 A;  2KWD A;  2ZZP B;  1TS4 A;  5KHQ A;  2KT7 A;  2KD0 A;  5EE0 A;  3JVZ X;  3PT2 B;  2R2Q A;  3OLM D;  3ZQ4 A;  2BT6 A;  2KAC A;  4N59 A;  1ESF A;  3NOB A;  3DWM A;  2NPT A;  4NY0 A;  2NMQ A;  5C1Z A;  3SD5 A;  3UGB B;  3B1L X;  4EZJ A;  3BIN A;  3ZO5 B;  1JML A;  2O2V A;  3A4S C;  1CK1 A;  1WF9 A;  2RPV A;  4WAA A;  1MVK A;  2LGS A;  1T6B X;  2C7N B;  2KX3 A;  1YN4 A;  2DNF A;  3PS6 A;  3RNE C;  2D3C A;  2QHO A;  4XZ4 A;  3MC9 A;  4UDU C;  2N9L A;  3RNG C;  1J0G A;  2XNA C;  3I9V 1;  1TS5 A;  2JU6 X;  3M63 B;  4BKG A;  4JWU C;  2BYV E;  1QOB A;  4WJP A;  3GZN I;  3GP7 A;  4E3C A;  2FIF A;  1YJ1 A;  4NAW B;  4YTN B;  1FNV A;  2KNB A;  2N1V A;  1WGK A;  3AEE B;  4US9 A;  1RAX A;  2LGI A;  4G11 A;  3ZNH B;  3ZTC A;  1TTN A;  4HJK A;  5LLI A;  2GBN A;  4X57 B;  1P0R A;  2RDG A;  2FBW B;  5EE3 A;  2LJ5 A;  1SE3 A;  3RZF A;  2ONQ A;  1TKY A;  2IGD A;  2RGF A;  2MWS B;  4ZYN A;  4OZC A;  5CHV C;  4MH8 A;  4MSM B;  2KWU B;  2CU3 A;  2IY1 B;  1AYF A;  1N61 A;  1JRO A;  3Q8C A;  2K6D B;  1OEY A;  1ZW7 A;  3UI3 A;  3W9C B;  2CS4 A;  3KWL A;  4YTM B;  4BFR A;  4PS3 A;  1RM6 C;  2K6Q A;  2MX2 A;  4HKQ A;  5IKC M;  4FHJ A;  2MH7 A;  3A9J B;  4A55 A;  2GBK A;  4IM2 A;  4YWG G;  2MHJ A;  1Q0W B;  4A20 A;  2LGD A;  2EEL A;  3O65 B;  2BYF A;  2DEN B;  2LJI A;  4L2Y A;  4P16 A;  4BZA A;  1KLV A;  1TS2 A;  2FE8 A;  1EWY C;  2K3U A;  4WIP A;  2KTR B;  1WGY A;  3EA6 A;  1BT0 A;  1E10 A;  3MTN B;  2JZP A;  4IW0 A;  3L13 A;  4HPL B;  3EFC A;  1UUP A;  3VTU A;  5CHF A;  3Q8E A;  3C19 A;  4MEM A;  5G2N A;  3RCZ A;  4CO7 A;  2MSE D;  1JRP A;  1PUT A;  3M62 B;  1BML C;  4PS7 A;  3L0W B;  3KUC B;  3KYC D;  1SE9 A;  3N3K B;  2X38 A;  3DBR I;  4HRS A;  2KTR A;  5LXI B;  1UD7 A;  2D3B A;  1V9J A;  1EU4 A;  2LAS A;  2LD9 A;  5BO4 B;  4ZHO A;  1I7H A;  2INC C;  3U7Z A;  1OQY A;  3B08 A;  3T9L A;  3PHW B;  2K9X A;  2YEP F;  3M3J A;  2EMT A;  3KW5 B;  4K3C A;  2Z0D B;  3QWZ B;  3V6E B;  3WIM A;  1XT9 B;  2L83 A;  2WXK A;  3R7Q A;  3U52 E;  1PYW D;  2ZVN A;  1GB4 A;  5D3D A;  3WAO A;  4M01 A;  2J7Q B;  2IPK D;  3H8H A;  3DPD A;  3ZXR A;  2KO3 A;  3WAP A;  3JSV A;  2J0M A;  2DZJ A;  2WDV B;  1TZO A;  3H7P B;  4ANX A;  4K81 A;  3KVF B;  1IGC A;  2BVC A;  2GBM A;  1D5X C;  2LVO A;  1NVI D;  2SEB D;  1WMH A;  1YOV B;  2CKH B;  1HZ6 A;  1WRD B;  2DZI A;  2YVC A;  2REX A;  3DVG X;  3KQ4 A;  3DVN U;  1KM7 A;  3K9O B;  2NBW B;  1ZUD 2;  1QT9 A;  2HJ8 A;  1M94 A;  2MEK A;  1HTQ A;  3WAN A;  5JZE B;  2DYM A;  5DCN A;  2PE9 A;  4YSX B;  5AZH A;  3TEZ A;  2PEA A;  3LXF A;  3BY4 B;  1CQV A;  2GB1 A;  3W1S A;  3Q14 C;  4W9L A;  3Q3F A;  1XQQ A;  1R7S A;  2KN5 A;  2IO1 B;  3ZRF A;  4NQK E;  4KGS A;  3K9P B;  2WS3 B;  1T3Q A;  2KFK B;  3H7P A;  4BKT A;  2WX1 A;  2BW2 A;  1FMA D;  3VXW A;  1ET9 A;  1J7B A;  3PRE A;  2GRI A;  4ICV A;  2PW9 A;  2V3S A;  2NTT A;  3HVZ A;  1SE2 A;  4RF0 A;  1E90 A;  3N32 A;  3BWU D;  4WJQ A;  3TSS A;  3VUW A;  4M8N A;  1NEK B;  4A3P A;  4PYU A;  4ARI A;  1YQ3 B;  1TGZ B;  1TJE A;  1WX9 A;  1GB1 A;  1ZGU B;  3HK0 A;  3T3N A;  1ZOY B;  4PK1 A;  3OG5 A;  1Y8R C;  2G4D B;  4G50 A;  2KDF B;  4NAW A;  4J6I A;  1E8X A;  1FRR A;  4ITK A;  3SFE B;  1ZXH A;  4D2K A;  3ZW3 A;  2CJN A;  1A70 A;  3N9Y C;  2IDY A;  2JVC A;  2UWQ A;  4GB9 A;  3BYY B;  1WX8 A;  1WR6 E;  4W9J A;  4GGQ A;  1MG8 A;  1ZKH A;  2WHI A;  5DPT A;  2NBV B;  2AQ1 B;  4E71 A;  1HTO A;  1SIJ A;  2LEK A;  1T5X D;  3QQ8 B;  2LZ6 A;  4C56 C;  1UBQ A;  1WI0 A;  2DYO A;  2L76 A;  4W9D A;  2JT4 B;  2HDE A;  3EEC A;  1R4M I;  4NAM A;  4USA A;  4WAF A;  1R4M B;  1SB3 C;  5DPR A;  1FXI A;  4IM0 A;  2BS2 B;  2MJ3 A;  1K50 A;  3NS1 A;  1UWM A;  2WQY B;  3GS2 A;  4MGK E;  5L83 A;  2N9E B;  3NVZ A;  4PS8 A;  2MJE A;  1WWT A;  3ML9 A;  3R66 C;  1QOA A;  2W3R A;  2B76 B;  1L0V B;  3P4R B;  2BQQ A;  3DBR B;  2LRU A;  2LI5 A;  1J8C A;  1J7C A;  2L00 B;  4HEA 1;  2PIA A;  3EHV A;  1HZ5 A;  2M17 A;  3WAM A;  1YJJ A;  2XBB C;  4BKS A;  4S0R A;  2JZZ A;  4KKI A;  3ZUN A;  1D5Z C;  2J0J A;  2KWC A;  2DYB A;  5LXH A;  3ALB A;  1E7U A;  2MP2 A;  2PKO A;  2GI9 A;  4EOY A;  2FUH B;  2FNJ B;  1RYJ A;  2JYT A;  4KZC A;  1VDV A;  1N63 A;  3AE7 B;  2N9P C;  3WCQ A;  2BS3 B;  1WYG A;  3AV8 A;  4K7U A;  4WUR A;  3VTV A;  1FNW A;  3HRD D;  4IUM B;  4C4V A;  3V61 A;  3KYD D;  2L7R A;  4LNF A;  5D2M B;  1GJZ A;  2IY0 B;  4DDI D;  4ZRI A;  3L08 A;  4HLE A;  4JQW C;  3VR8 B;  4M0W B;  2AQ2 B;  1MG4 A;  2AX5 A;  4NNJ B;  1V80 A;  2KC2 A;  2FCS A;  3OAW A;  3T8M A;  1T0S C;  2KC1 A;  2WXO A;  1Q5W B;  1V49 A;  2CHZ A;  2WXQ A;  1Q10 A;  3Q69 A;  4OW0 A;  2BTE A;  2HD5 B;  2AL6 A;  4MSQ B;  3PRP B;  2K5P A;  2IND C;  5HFY A;  4I6P A;  3RD2 A;  3H9D A;  4M00 A;  3FKY A;  3B2F A;  3DQV A;  1WGR A;  3AEF B;  2IZV B;  4W9I A;  5AZG A;  4REZ A;  4B0E A;  4ZRP A;  1PGB A;  4IWQ A;  1Z5S B;  4RGO S;  1PFD A;  2AQ3 B;  1FFU A;  2DX5 B;  2ICI A;  2L8J A;  3KWV A;  2H88 B;  3P42 A;  2IO3 B;  4LJP B;  2WXL A;  1WGG A;  4C80 A;  3TIX A;  4F7Z A;  1VCB A;  4LTU A;  2JYE A;  4EUT A;  2IGG A;  5HKH A;  4XX5 A;  4TSS A;  2NTS A;  4KKJ A;  3ZNG C;  3U8Z A;  4TKN A;  1VRA B;  2K8C A;  1JWU D;  4FUL A;  4B6W A;  2K8H A;  1FNU A;  1FO4 A;  1LM8 B;  5D94 A;  3PLU A;  1P9D U;  2NVU I;  2WDR B;  3NVV A;  2VRR B;  4B95 A;  1LFD A;  1JRU A;  3Q8B A;  3NJT A;  2D07 B;  4ZYS A;  2C7M B;  4IWP A;  1SGH A;  2M1M A;  2XK5 A;  3WAL A;  3MHS D;  1C1Y B;  1YX5 B;  4N58 A;  3PZ8 A;  4J3O D;  2DZK A;  1G6J A;  4A9A A;  3NZS A;  3IHP C;  3E9S A;  2BKF A;  2KTF A;  3VRA B;  3L16 A;  2OHF A;  2L3Z A;  3ZVV A;  5HHD G;  3SDL C;  4ANV A;  5E6J A;  1OTR B;  2JXX A;  3MC0 B;  1KJT A;  4WWN A;  4N6E B;  2V3P A;  3BYT B;  4II3 B;  1TY0 A;  3SEB A;  1QIL A;  2NS5 A;  1DOI A;  1TKE A;  1DYQ A;  3HM6 X;  5G5H A;  3R8B A;  2A4Z A;  3UQB A;  2G3Q B;  2WDT B;  3LB8 C;  4LNO A;  3AEC B;  1K53 A;  1J7A A;  3N1Y C;  3IT6 B;  2Z0E B;  3A4R A;  2FCM A;  2KJ6 A;  4RCO A;  1C4A A;  1F77 A;  2WXJ A;  3ECI A;  1T0R C;  2ZVO A;  2WXI A;  2N1W A;  3Q3M C;  1N6Z A;  1JWA D;  2LVQ A;  1XEE A;  4WJN A;  2Z59 B;  1QF6 A;  1KLU D;  1N62 A;  4RGM A;  3VHT C;  5IP4 D;  1V86 A;  1C3T A;  1TT5 B;  1JAL A;  1VZ6 A;  1WYW B;  2MBB B;  3TEX A;  3NRZ A;  3PO0 A;  4LK0 M;  2BYT A;  1MPE A;  3N1Z C;  2RPQ A;  2JF5 A;  2AEH A;  5H8Y E;  2RMM A;  5BMG A;  2TSS A;  2I2Y A;  1UGM A;  4IDI A;  1E6E B;  2W54 A;  5AEK B;  4AOF A;  1AAR A;  3APC A;  2VH2 A;  1MFW A;  3IAS 1;  2LFI A;  2A5U A;  3C8Y A;  1YMH E;  2C60 A;  2V0G A;  4JX1 C;  1FXT B;  4MGZ E;  3I63 C;  5GMV A;  3U2S C;  1SEB D;  1OGW A;  3I57 A;  5G5G A;  5D6J B;  4AJW A;  3AEA B;  3RUL A;  5JHA A;  4WJO A;  4JIO U;  4ZRJ A;  2QCZ A;  1XD3 B;  2AYO B;  1WZ0 A;  3I3T B;  4RFB A;  1FD6 A;  1WY8 A;  2M56 B;  3EC8 A;  3KUD B;  3DVN V;  4KX6 B;  1ACC A;  2LHE A;  4YL8 A;  1WM3 A;  3RZW C;  2FCN A;  2XEW A;  2XN9 C;  5J18 A;  2CJO A;  2C9W B;  5D3I B;  5FKA C;  3AE5 B;  3GZN B;  1L4Z B;  2MLB A;  1HA5 A;  1N5X A;  1KH0 A;  2BF8 B;  2LUE A;  1YN3 A;  2JQR B;  2KVZ A;  3DHH C;  4ZRK A;  2MBH A;  3GE8 C;  2N9K A;  4MAC A;  3UF8 A;  4GIV A;  1NI2 A;  2KMA A;  3A1Q A;  3PZ7 A;  4FJZ A;  1U4A A;  4IWO A;  1V2Y A;  1ET6 A;  2V9H A;  4I6N B;  2KZR A;  3AE1 B;  4ACF A;  2D2Q A;  1TZ1 A;  3AEG B;  3PLV A;  2KN4 A;  1I4G A;  4GDL B;  2D10 A;  1L5P A;  4EZL A;  1K8R B;  1ZDV A;  1AW7 A;  1WJ6 A;  2H89 B;  3VUY A;  2KQ4 X;  3AXC A;  2IBI B;  3V05 A;  3E56 A;  4YTP B;  3X0W A;  1C4P A;  2G1E A;  3VAW A;  4CYE A;  4E74 A;  1F1H A;  1YNT E;  4A3O A;  2GMI C;  3L17 A;  1WR1 A;  2RDB C;  3D32 A;  2IO2 B;  1BUI C;  2D5G A;  4C00 A;  1TYG B;  2FID A;  3WA0 A;  2J53 A;  3MHZ A;  3EUB 2;  3NHE B;  1E8W A;  2ZJD A;  2OOB B;  3A1Q B;  3DHG C;  4HPM B;  1JWB D;  1GC7 A;  1IGD A;  3BVM A;  3HUI A;  3W5U B;  4KVG B;  2HJ1 A;  3DBL I;  5GXG B;  3EGR A;  2FAZ A;  2ZEQ A;  2KLC A;  3ZJU A;  3L54 A;  3AB5 A;  2I38 A;  2K25 A;  2OJW A;  1YQ4 B;  2WXN A;  2O6V D;  1RFK A;  1IPG A;  1J19 A;  3GE3 C;  2BWE S;  2K1F A;  2N4F A;  3DHI C;  2K8B A;  2V3N A;  4GOC A;  3QHT A;  1KOT A;  1FM0 D;  1RFA A;  3S2A A;  2Y5B B;  2MW5 A;  5AUK A;  3V3X A;  1C78 A;  2WXG A;  5J2R A;  1P7F A;  4K1R B;  1GOZ A;  3P1M A;  3APD A;  3JYU A;  3RUI B;  3U7D A;  3P2B A;  4ZHP A;  1E9M A;  4LDT D;  3VH4 B;  4BVU C;  5IN7 A;  1Q1O A;  4K3B A;  1JWS D;  4KSL C;  1I4R A;  4WH4 A;  1WZ3 A;  5HG2 A;  3SFD B;  5JHB A;  3DBS A;  2GOW A;  4FLH A;  3QCA A;  2ASQ A;  2NPT B;  1TKG A;  2DWQ A;  3NUH B;  2JX5 A;  2LGY A;  2N9X A;  1WX7 A;  2C7H A;  4FN2 A;  2ZPY A;  1JWM D;  4LNI A;  3ZKJ C;  1QOF A;  4C7Z A;  4XGA B;  1IP9 A;  1NBF C;  3RNC C;  3NY5 A;  1EF1 A;  2KOX A;  1MI0 A;  1D3Z A;  3MC8 A;  2M4N A;  3IXS A;  2KMC A;  4DQO C;  1JCK B;  2PMV A;  4I6L B;  1F52 A;  4GN1 A;  3DCG A;  2W82 A;  2R61 A;  3M95 A;  2EMS A;  2W9N A;  1L6U A;  1AN8 A;  2JWZ A;  2FCQ A;  2KFJ A;  1GG3 A;  2M19 A;  2ON8 A;  2KAN A;  3H1U A;  1I4X A;  4IC7 B;  1WXS A;  5AZF A;  1KFY B;  2WXR A;  3CST A;  4XYC A;  3QJZ A;  1YN5 A;  3AE6 B;  2BYE A;  1R4N I;  3VH3 B;  4A8X C;  1KRH A;  3PV1 A;  1C76 A;  1V1P B;  3QC8 B;  3DDC B;  4TQ0 A;  4RGT A;  4AWJ A;  3KH0 A;  3IFW B;  4L23 A;  4AQ7 A;  3ZJV A;  1V5T A;  2K39 A;  4TMA B;  3IVF A;  3LDZ E;  4GSW A;  4B9K A;  2C5L C;  3Q2A C;  2KJR A;  2N7E A;  4GDK B;  1CJE A;  4DXF A;  3P4S B;  2PVG C;  2JSV X;  3EFU A;  1ENF A;  3V62 A;  4HKZ E;  4TV3 A;  3GB1 A;  4GDK A;  2WGS A;  1IUE A;  5FR6 A;  4FXC A;  2KQ7 A;  2ZW1 A;  1SSN A;  5C2T B;  2FUG 1;  4HDQ A;  4OVZ A;  4DXA B;  3NVW A;  3QAQ A;  5BMI A;  2K22 A;  1PGA A;  3HM3 A;  1FCL A;  2KDI A;  3A9K B;  1IBX A;  3U4E G;  2LWP A;  4JE3 B;  1P98 A;  1NI3 A;  1L4D B;  3W2D A;  1SE4 A;  3HHM A;  4JPS A;  2KWV B;  1LQB A;  2L0F A;  1EU3 A;  2JRH A;  1WXM A;  1I42 A;  4XE0 A;  4ZRQ A;  1WRI A;  3CSF A;  4W9C A;  3RYT A;  3W1S C;  4K7W A;  5HI1 A;  4OZA A;  4PYZ A;  1NDD A;  3BZD B;  3UIP B;  4S17 A;  1NYQ A;  1V81 A;  2BKR B;  3V6C B;  2D3A A;  2NBU A;  4BOZ B;  2CHX A;  5BYQ A;  2WP9 B;  3VRB B;  1TS3 A;  4R3D A;  1N60 A;  2PE6 B;  4FBJ B;  1FXA A;  1SJH D;  1XF5 L;  5JXV A;  2GLS A;  1FFV A;  1K52 A;  4L1B A;  2YEP B;  4NPN A;  4DDG D;  2YLM A;  1FCC C;  2D3G A;  3FIL A;  2DBY A;  4OZB A;  3B9J A;  1WJN A;  1T0Y A;  3AUL A;  2L0T A;  4XWT A;  2MJD A;  4HWI B;  1R4N B;  4LNN A;  1CZP A;  3W1Y A;  3PRZ A;  2GBR A;  2RDH A;  3AU4 A;  3HVD A;  4HRO A;  2WXF A;  5J17 A;  3TL5 A;  2W3S A;  3B2G A;  2RR9 A;  3UIN B;  3SHQ A;  2WDQ B;  1V1O A;  4JLC A;  4P6V F;  3AED B;  3PTF C;  1WXQ A;  2VZK D;  3NVY A;  5E6N A;  4WWO A;  1MHX A;  3W5V B;  3RFZ B;  1XLN A;  4MGI E;  1LGR A;  2V4L A;  1B9R A;  4DWF A;  3ZDT A;  2J42 A;  4EZK A;  2BB6 A;  3Q3J A;  1S3S G;  1WFY A;  3BK1 A;  3ZRC A;  1SIF A;  1KTK A;  2KK8 A;  3BVG A;  4DHZ B;  1DOY A;  1VD2 A;  4HJG E;  1E0Z A;  4RF1 A;  2KJH B;  2DAJ A;  3IAM 1;  1PGX A;  1HXY D;  1YIW A;  2KKC A;  3ZIM A;  4Q2J A;  1I4P A;  2PPH A;  1F0Z A;  1WJU A;  3LJ3 A;  3ZNI D;  4K7S A;  4N9F 4;  3AE8 B;  3U30 A;  4WWM A;  1I4Q A;  1QOG A;  2BBC A;  5TSS A;  2O6V A;  3TBL D;  4RH6 A;  4M0W A;  1GUA B;  1M4V A;  2UU7 A;  3JSV B;  3NZU A;  3VDZ A;  3IBE A;  3RT3 B;  3N20 C;  3CMM B;  3A9K A;  1IBX B;  1RLF A;  1L7Y A;  2OED A;  4TQ1 A;  1FEH A;  2WXM A;  3VQI A;  1EM7 A;  3AE3 B;  3RNA C;  2KYW A;  3ZXV A;  4AUQ C;  2CHW A;  1Y56 A;  3MP9 A;  2EKI A;  2JPH A;  4GU2 A;  4FAD A;  3BVZ A;  3L4P A;  2MCN B;  3OJ3 A;  4HCP B;  2LGX A;  4YT0 B;  1F2R I;  2ACZ B;  4LLG M;  1VLB A;  1YJI A;  2LXC A;  2AL3 A;  1QQR A;  4IM3 A;  2PJH A;  3RPF C;  1TIF A;  2CU1 A;  2J4X A;  4KV2 A;  2M0X A;  3UIO B;  3JW0 X;  1L2N A;  5FK9 C;  3L10 B;  3MFG A;  2QJL A;  2PTL A;  1XLP A;  4IG7 B;  1ISN A;  2NCN A;  3NZ3 A;  3HIZ A;  4ANW A;  3DBH I;  2G9H D;  3ZLZ A;  4P7I A;  2KLG A;  4AS1 A;  1ZP0 B;  1HEZ E;  2E6X A;  4BOS C;  5AUI A;  2L05 A;  3TEY A;  1PDX A;  4G0N B;  4ASW C;  2L52 A;  4FA6 A;  3CIR B;  3VUX A;  1P1A A;  2RSU A;  3VVW B;  1CMX B;  4DXG A;  3I5J C;  1BXT A;  2L1A A;  2E3T A;  1H4R A;  3Q8A A;  4FHK A;  4G3X B;  3AE9 B;  4DHJ D;  1LO5 D;  4QAY A;  3VR9 B;  1P3Q U;  4W9E A;  3H6N A;  3PRM B;  4KDI C;  1SJE D;  2LMC A;  3MJ5 A;  2KMM A;  1RRB A;  3VTW A;  2D11 A;  4FJY A;  3OWE B;  1RWS A;  1X1M A;  2RD0 A;  2ZPN A;  3BII D;  2B3A A;  3AN1 A;  3A9J A;  4M02 A;  3UQA A;  3QAR A;  2WLB A;  3SR6 A;  1XCT L;  4ICU A;  4HVB A;  3APF A;  1WE7 A;  3R2I A;  2AWT A;  1C4C A;  2M8S A;  2IJ0 A;  2DZM A;  4KIK A;  1VJK A;  3PVL A;  5T8I A;  2HE7 A;  5D7G A;  2WU2 B;  4LJO B;  3Q6B A;  2QSD A;  1YD8 U;  1V8C A;  5DPS A;  2Y5P A;  2QDF A;  2M0A A;  1NYR A;  3NG0 A;  2WU5 B;  2KVR A;  2INN E;  3Q3N C;  3ZTD A;  4CHK A;  5I4D A;  2BB5 A;  2KDE B;  2LUM A;  3QX1 A;  3ONS A;  5IOI A;  1TBE A;  2ZW0 A;  2ZCB A;  4KGT A;  1ROE A;  4MJS A;  4NJ6 A;  4TUU A;  1VR9 A;  1UF0 A;  1L6V A;  4B0M A;  4HXD A;  1GC6 A;  1L0X B;  1STE A;  4O1N A;  5E6O A;  2LRW A;  4C4V B;  3TJP A;  1OFF A;  1MJD A;  2BPS A;  3IT4 B;  2LXA A;  2IYD B;  3T3O A;  2J52 A;  1TY2 A;  3N1X C;  3ETR A;  2CR5 A;  3CF6 E;  5DPW A;  3ZDM C;  4EEW A;  5JH5 C;  3FC4 A;  3ML8 A;  3C0R B;  2JY6 A;  2G45 B;  3V60 A;  4EKU A;  2HTM E;  4ANU A;  4OVU A;  4DK5 A;  2QC8 A;  4GDL A;  2N7D A;  1E8Z A;  4OHJ A;  4YSY B;  4HK2 A;  3NS8 A;  4AJY B;  1ZXI A;  3PHX B;  1XO3 A;  3RN9 C;  4MM3 A;  1YX6 B;  2Y3A A;  1QKZ A;  3DVG Y;  5EDS A;  3ZGZ A;  2KXJ A;  2OJR A;  2PLP A;  3QA8 A;  4DHZ E;  3ENE A;  1I35 A;  3QK0 A;  1C9F A;  4ZDV A;  1I4H A;  2WWZ A;  2LHD A;  4MDK E;  1T0Q C;  4DHJ B;  4URK A;  1NEN B;  1C79 A;  3AE2 B;  5BYR A;  3KUZ A;  1ZE3 D;  2R2O A;  1E7V A;  1DGJ A;  2ZNV C;  2O6V B;  2V4I B;  1E7P B;  4P1B C;  2MA9 B;  1D5M C;  4W9F A;  4BBN F;  4NJC A;  2NR2 A;  4XDD A;  4RM9 A;  3SU8 X;  4P1C C;  2JWU A;  4CQN A;  3VFK A;  2VZK B;  4C7Y A;  5KHO A;  4HPP A;  3ZNZ B;  3AI5 A;  4MEL A;  1D4B A;  3AM9 A;  4WQO B;  5CHW A;  2MBO A;  1VZ7 A;  3DOW A;  2Z8L A;  3AMZ A;  1E5W A;  2WYQ A;  1UBI A;  1A5R A;  2L32 A;  2IGH A;  3R7R A;  1OQQ A;  3J9C A;  5IAA C;  3BK2 A;  4DBG A;  1WGH A;  2QIL A;  2N7J A;  1UEL A;  4NZL B;  2MP2 B;  3A33 B;  1WIA A;  4BAX A;  3ABV B;  4II2 B;  4KDL B;  1EWC A;  3PZD A;  4KZ0 A;  1HE8 A;  4HDO A;  2W55 A;  1E8Y A;  4MH0 E;  2WXH A;  1P7E A;  1V6E A;  1WXV A;  4H2A A;  1SBB B;  1KF6 B;  1QZE A;  4LNK A;  5G55 A;  2JXT A;  3IG3 A;  2KHW B;  1GNU A;  5TR5 A;  4RGN A;  5C3J B;  1XLQ A;  1YQB A;  4RMA A;  3MJW A;  3ZJT A;  1EUV B;  2KFK A;  4LCD E;  4XDC A;  2I1K A;  2WXP A;  5LNK 1;  5BMH A;  3R2T A;  1UH6 A;  4KSK C;  3Q3O C; 
#chains in the Genus database with same CATH homology
 1I7H A;  1JWA D;  2RDH A;  3AH7 A;  1XEE A;  3HVD A;  3U7Z A;  4HRO A;  2WXF A;  1QF6 A;  2W3S A;  3B2G A;  1KLU D;  1N62 A;  2WDQ B;  1V1O A;  2K9X A;  4RGM A;  2K0P A;  2YEP F;  4P6V F;  3AED B;  1WXQ A;  2VZK D;  3NVY A;  3W5V B;  1MHX A;  1JAL A;  1VZ6 A;  3RFZ B;  1XLN A;  5MPO A;  2L83 A;  2WXK A;  3TEX A;  3DWG C;  1MHH E;  3NRZ A;  1B9R A;  3PO0 A;  4LK0 M;  2BYT A;  1MPE A;  3U52 E;  1PYW D;  2J42 A;  1C77 A;  4MM3 B;  2BB6 A;  1UNS A;  1GB4 A;  5D3D A;  2Y5C A;  5FR3 A;  5H8Y E;  4A6Q A;  3BK1 A;  2RMM A;  5BMG A;  1AWD A;  3BVG A;  1KTK A;  2IPK D;  3H8H A;  2TSS A;  2I2Y A;  4ARC A;  1DOY A;  1XCQ L;  4IDI A;  4HJG E;  3AE4 B;  2QIE B;  1E0Z A;  1E6E B;  2W54 A;  2WDV B;  1TZO A;  4MT5 A;  4RF1 A;  3IAM 1;  1V1P A;  1IGC A;  1D5X C;  2SEB D;  1NVI D;  3P63 A;  1PGX A;  1HXY D;  2LFI A;  3IAS 1;  3KLS X;  1UWX A;  3C8Y A;  2QEJ C;  1HZ6 A;  1YMH E;  4YXD B;  1L0Y B;  3LYY A;  4Q2J A;  2V0G A;  4EE2 A;  1I4P A;  1HQR D;  4JX1 C;  1F0Z A;  1GPX A;  3U2S C;  1SEB D;  3I57 A;  5G5G A;  3KQ4 A;  3AE8 B;  3AEA B;  2INP E;  1ZUD 2;  1QT9 A;  4WWM A;  1I4Q A;  1QOG A;  2BBC A;  5TSS A;  2MEK A;  4RH6 A;  4US8 A;  4M0W A;  2DYM A;  4YSZ B;  4YSX B;  3TEZ A;  2N0S B;  1M4V A;  1FRD A;  3LXF A;  4RFB A;  1FD6 A;  2M56 B;  1CQV A;  2GB1 A;  3W1S A;  4KX6 B;  1UGJ A;  1R7S A;  1ZDX A;  1ACC A;  4JWS C;  2LHE A;  1IBX B;  2QMT A;  2OED A;  2XN9 C;  4WQM A;  2CJO A;  4KGS A;  5D3I B;  4TQ1 A;  3AE5 B;  5FKA C;  2WS3 B;  1T3Q A;  2SAK A;  1GAQ B;  1L4Z B;  1FEH A;  2WXM A;  3VQI A;  1EM7 A;  1HA5 A;  3AE3 B;  1N5X A;  1KH0 A;  3ZYY X;  2BS4 B;  1YN3 A;  2BW2 A;  1Y56 A;  3MP9 A;  2EKI A;  2DLB A;  3P4Q B;  1FMA D;  2JQR B;  1ET9 A;  1J7B A;  3BVZ A;  3L4P A;  2N9K A;  4MAC A;  2GRI A;  4KGR A;  4YT0 B;  1VZ8 A;  1SXT A;  1F2R I;  3FIL B;  2ACZ B;  3PZ7 A;  2PW9 A;  4LLG M;  1VLB A;  1YJI A;  2NTT A;  3HVZ A;  4ZOH C;  1K51 A;  1ET6 A;  1SE2 A;  1QQR A;  4IOI E;  4RF0 A;  1N5W A;  4RNA A;  3BWU D;  3RPF C;  3TSS A;  2J4X A;  3AE1 B;  1XXG A;  1NEK B;  3AEG B;  2KN4 A;  4ARI A;  1YQ3 B;  2Q5W D;  1I4G A;  5FK9 C;  5EE9 A;  1TJE A;  2QJL A;  3MFG A;  2PTL A;  4GLS C;  1XLP A;  4GDL B;  1DOX A;  1L5P A;  1B1Z A;  1GB1 A;  1ZDV A;  2KDM A;  1AW7 A;  2H89 B;  3T3N A;  1ZOY B;  3NZ3 A;  2KQ4 X;  2G9H D;  3E56 A;  3V05 A;  4PT5 A;  5BYS A;  1OQR A;  4YTP B;  1FRR A;  3AEB B;  5EE1 A;  1XLO A;  4ITK A;  3SFE B;  4AS1 A;  1ZP0 B;  1C4P A;  1ZXH A;  4D2K A;  1HEZ E;  2CJN A;  1A70 A;  2G1E A;  1KLG D;  3N9Y C;  2IDY A;  2E6X A;  4A90 A;  1YNT E;  2KAJ A;  3BYY B;  5AUI A;  1ZPS A;  3TEY A;  1D6E C;  1PDX A;  4XWW A;  3TEW A;  5H92 C;  1F2R C;  1BUI C;  2D5G A;  1SF0 A;  2L52 A;  3FAH A;  3CIR B;  3O13 A;  1TYG B;  2J53 A;  3MHZ A;  3EUB 2;  2AQ1 B;  4DXG A;  1BXT A;  1JQ4 A;  2L1A A;  2E3T A;  1FIQ A;  3CWI A;  3Q8A A;  1SIJ A;  2LEK A;  3AE9 B;  1T5X D;  1V97 A;  1LO5 D;  4IKG A;  1JWB D;  4C56 C;  2WNM A;  3VR9 B;  1IGD A;  2DYO A;  3BVM A;  3HUI A;  3TUO A;  3W5U B;  3P4P B;  2HDE A;  5GXG B;  4NAM A;  3EGR A;  4USA A;  4WAF A;  3Q8F A;  1SB3 C;  1SJE D;  2LMC A;  3ZJU A;  3AB5 A;  2I38 A;  1FXI A;  2WXN A;  1YQ4 B;  3MJ5 A;  2KMM A;  2BS2 B;  2MJ3 A;  1K50 A;  3NS1 A;  1RFK A;  1UWM A;  2WQY B;  3GS2 A;  3OWE B;  1RWS A;  1WSP A;  2PVO D;  2V3N A;  3BII D;  3NVZ A;  2MJE A;  1WWT A;  1QOA A;  3AN1 A;  1JW9 D;  2W3R A;  2B76 B;  1L0V B;  1QLB B;  1FM0 D;  3P4R B;  3URY A;  5AUK A;  3V3X A;  1C78 A;  2WXG A;  2WLB A;  3SR6 A;  1P7F A;  1XCT L;  1GOZ A;  2KWD A;  3P1M A;  1TS4 A;  3R2I A;  1J7C A;  1C4C A;  2IJ0 A;  4HEA 1;  5EE0 A;  4ZHP A;  1VJK A;  2PIA A;  5T8I A;  1E9M A;  1HZ5 A;  5D7G A;  1YJJ A;  2WU2 B;  3ZQ4 A;  4KKI A;  1D5Z C;  2BT6 A;  2KAC A;  4N59 A;  2QSD A;  1V8C A;  1ESF A;  1JWS D;  2Y5P A;  3DWM A;  1I4R A;  4WH4 A;  5HG2 A;  2M0A A;  1NYR A;  2NMQ A;  2GI9 A;  2PKO A;  3SFD B;  2WU5 B;  1RYJ A;  2INN E;  2JYT A;  1VDV A;  1N63 A;  3AE7 B;  2BB5 A;  5I4D A;  2LUM A;  1TKG A;  3WCQ A;  2DWQ A;  2BS3 B;  3NUH B;  2ZW0 A;  1JML A;  1WYG A;  2JX5 A;  3AV8 A;  4WUR A;  1CK1 A;  2RPV A;  1FNW A;  4KGT A;  1ROE A;  1MVK A;  3HRD D;  1T6B X;  1JWM D;  1YN4 A;  1VR9 A;  1QOF A;  1L6V A;  4C7Z A;  4B0M A;  1L0X B;  1STE A;  4O1N A;  4UDU C;  1OFF A;  2N9L A;  2XNA C;  3I9V 1;  3IT4 B;  1TS5 A;  2JU6 X;  4JWU C;  3T3O A;  1MI0 A;  2J52 A;  1TY2 A;  1QOB A;  3VR8 B;  2AQ2 B;  3ETR A;  3GP7 A;  3IXS A;  4DQO C;  2AX5 A;  4NAW B;  4YTN B;  1FNV A;  1JCK B;  2PMV A;  3AEE B;  3FC4 A;  1WGK A;  4US9 A;  2W82 A;  2R61 A;  2HTM E;  2LGI A;  2WXO A;  1L6U A;  1AN8 A;  3Q69 A;  2WXQ A;  1Q10 A;  4OHJ A;  4OW0 A;  4YSY B;  2M19 A;  2ON8 A;  2BTE A;  1I4X A;  2K5P A;  1ZXI A;  1XO3 A;  1KFY B;  5HFY A;  2WXR A;  2RDG A;  2FBW B;  5EE3 A;  2Y3A A;  1QKZ A;  1SE3 A;  3B2F A;  1YN5 A;  3ZGZ A;  2ONQ A;  1TKY A;  2IGD A;  3AE6 B;  3AEF B;  2PLP A;  4REZ A;  4A8X C;  4B0E A;  1KRH A;  4OZC A;  1C76 A;  4ZRP A;  1C9F A;  1V1P B;  1I4H A;  1PGB A;  4MH8 A;  4TQ0 A;  4RGT A;  4RGO S;  1PFD A;  2AQ3 B;  2LHD A;  2CU3 A;  1FFU A;  1NEN B;  1AYF A;  1C79 A;  4L23 A;  3AE2 B;  4AQ7 A;  5BYR A;  3ZJV A;  4TMA B;  2ICI A;  1N61 A;  3KWV A;  1JRO A;  2H88 B;  3Q8C A;  3P42 A;  4GDK B;  1CJE A;  3UI3 A;  2WXL A;  1ZE3 D;  3W9C B;  4DXF A;  3P4S B;  2PVG C;  2JSV X;  4C80 A;  1DGJ A;  3KWL A;  4YTM B;  1ENF A;  4HKZ E;  3GB1 A;  1RM6 C;  4LTU A;  1IUE A;  2V4I B;  4HKQ A;  2JYE A;  4FXC A;  2IGG A;  1E7P B;  4TSS A;  2NTS A;  1D5M C;  1SSN A;  2MH7 A;  2ZW1 A;  4KKJ A;  5C2T B;  2FUG 1;  4OVZ A;  4A55 A;  3NVW A;  5BMI A;  2K22 A;  4YWG G;  4NJC A;  1PGA A;  1VRA B;  4XDD A;  1JWU D;  1FNU A;  2EEL A;  1FO4 A;  2JWU A;  1FCL A;  2LJI A;  4CQN A;  2WDR B;  3NVV A;  3U4E G;  1IBX A;  2VZK B;  4C7Y A;  3Q8B A;  4JE3 B;  4L2Y A;  4P16 A;  1D4B A;  1NI3 A;  1L4D B;  3W2D A;  1SE4 A;  3AM9 A;  4ZYS A;  4JPS A;  1VZ7 A;  1TS2 A;  2FE8 A;  1EU3 A;  1EWY C;  2K3U A;  2Z8L A;  4WIP A;  3AMZ A;  4XE0 A;  4ZRQ A;  1WRI A;  3EA6 A;  1E10 A;  2L32 A;  2IGH A;  4N58 A;  3PZ8 A;  1OQQ A;  4J3O D;  5HI1 A;  3J9C A;  4OZA A;  3BK2 A;  2JZP A;  4A9A A;  3BZD B;  3E9S A;  2QIL A;  2N7J A;  1UUP A;  3VRA B;  2OHF A;  4NZL B;  3Q8E A;  3ABV B;  5HHD G;  1NYQ A;  5E6J A;  3MC0 B;  1EWC A;  5BYQ A;  2W55 A;  2V3P A;  1JRP A;  2WP9 B;  1PUT A;  3BYT B;  4N6E B;  2WXH A;  1TY0 A;  3VRB B;  1TS3 A;  1BML C;  4R3D A;  3SEB A;  1N60 A;  1P7E A;  1QIL A;  1DOI A;  1TKE A;  4H2A A;  1SBB B;  1DYQ A;  1FXA A;  5G5H A;  1SJH D;  3R8B A;  1KF6 B;  1XF5 L;  5JXV A;  1FFV A;  1K52 A;  2JXT A;  4L1B A;  2YEP B;  2X38 A;  5C3J B;  4HRS A;  4RGN A;  3LB8 C;  1FCC C;  1XLQ A;  3AEC B;  1K53 A;  1J7A A;  3IT6 B;  3FIL A;  3ZJT A;  2DBY A;  4RCO A;  1C4A A;  4OZB A;  1F77 A;  3B9J A;  4XDC A;  2WXJ A;  4XWT A;  2WXP A;  2MJD A;  5LNK 1;  5BMH A;  1EU4 A;  3R2T A;  2WXI A;  4ZHO A;  1CZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...