2NMQA

Simultaneous determination of protein structure and dynamics using rdcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
TYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous determination of protein backbone structure and dynamics from residual dipolar couplings
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Signaling protein
molecule keywords Immunoglobulin G-binding protein G precursor
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2nmqA00
1UWXA 2N9KA 2JXTA 1HZ6A 3V3XA 2ZW0A 1FCLA 3UI3A 1Q10A 2RPVA 2ZW1A 4KGRA 2JSVX 5HI1A 2LHEA 2JU6X 1GB4A 1IBXA 4MACA 2KWDA 2QSDA 2LHDA 2N9LA 4WH4A 1D4BA 1XCQL 5HFYA 1KH0A 2ONQA 1HZ5A 1ZXHA 1HEZE 2ON8A 1MHHE 1IBXB 3FILB 4HJGE 1PGBA 2RMMA 2GB1A 5JXVA 2NMQA 2IGDA 4OZBA 1F2RI 1MPEA 5HHDG 2KQ4X 2QMTA 1C9FA 1K51A 1K50A 4IKGA 1JMLA 1FD6A 2IGGA 1MHXA 1MVKA 3MP9A 4OZAA 1FCCC 4KGSA 2KN4A 2GI9A 1PGXA 5HG2A 1IGDA 1YMHE 1GB1A 5BMIA 1PGAA 2PW9A 1K53A 3FILA 1P7EA 2OEDA 1YNTE 2KACA 2K0PA 1EM7A 1P7FA 2JWUA 2PTLA 2J53A 1F2RC 2EELA 2KDMA 1K52A 1QKZA 1XF5L 2LUMA 1MI0A 2JZPA 4GLSC 2I2YA 2LGIA 5BMHA 3GB1A 4IOIE 2I38A 4KGTA 4HKZE 2PLPA 2J52A 1IGCA 2IGHA 4OZCA 5BMGA 4D2KA 2N7JA 1XCTL
chains in the Genus database with same CATH superfamily
3C8YA 1J8CA 4BAXA 2ZVOA 4RM9A 4IG7B 1YX5B 4B0EA 3P1MA 1I4RA 2KJRA 2CHZA 3M63B 1UZXB 1WJ6A 1HXYD 2ZZPB 2LGSA 4LNFA 1ET6A 4EUTA 3T3NA 1I35A 1E8YA 4KX6B 4II2B 3VVWB 4AWJA 2K6QA 5D94A 4A3OA 2LRUA 3NS8A 1UUPA 1EF5A 1WRIA 2KTRB 1C77A 3WALA 3OLMD 2MBHA 2MWSB 4HCPB 2KWUB 1N60A 4OVUA 5MPOA 1V81A 2KQ4X 4GIVA 2DZKA 3D32A 2G3QB 2GBKA 4FHJA 2GRIA 3EHVA 2LGDA 1E7PB 2W54A 1CMXB 5AUKA 3WAPA 2KJ6A 1JWSD 4FULA 1ZW7A 4NAWB 2BVCA 3P2BA 4BOSC 4I6NB 3NG0A 3IAM1 1F77A 4MH8A 5LXHA 1F52A 2D11A 1CZPA 2RDBC 2VZKD 1K52A 2E6XA 4EE2A 1MI0A 2JZPA 5LXIB 1Q5WB 3GB1A 2HDEA 5FKAC 4I6LB 3K9PB 2PPHA 4ANWA 1L2NA 2Y3AA 3N1YC 1TTNA 3ZRCA 2Q5WD 1Z2MA 4NZLB 2BGFA 1RLFA 2WXMA 2ZW0A 2CHWA 4KZ0A 3W1SC 3K9OB 3MTNB 3B2FA 3H6NA 2JXXA 4IW0A 2WXLA 3T9LA 1V1PA 3NOBA 4ZRKA 3QC8B 4RM8A 1BXTA 1K8RB 2VH1A 3U4EG 1ZE3D 2L7RA 3QHTA 1YJ1A 4KSLC 3V62A 1Z5SB 3B08A 2KC1A 4FJZA 3GZNB 5C23A 3PRMB 2FAZA 2WXFA 2M0XA 3IVFA 1NYRA 2TSSA 3W5VB 4BKSD 2CU1A 2O6VD 4AUQC 1K50A 1M94A 3H7PB 1JMLA 1VD2A 4YL8A 3V6EB 4UDUC 1P0RA 2WGSA 3O65B 5GMVA 4ZRIA 4RNAA 2RDGA 4OHJA 2QC8A 3ZNHB 3X23A 4ZHOA 2ZPYA 1WIAA 2KX3A 4QAYA 1ZXIA 4JPSA 1FEHA 2GBNA 1QOGA 4JWSC 2MBQA 5EE1A 5KHOA 2JYTA 3OJ4B 2NTTA 4XWTA 3TJPA 2KFKB 2L83A 5JH5C 2WHIA 2JX5A 2BB5A 4W9LA 4LNKA 3RYTA 3AE1B 5AZFA 4M8NA 4EOYA 2FCQA 4GDLA 4XDCA 1ZPSA 1ACCA 3PZ7A 5C3JB 4YWGG 1L0VB 3ZUNA 1EO6A 4BKTA 2LZ6A 1T0SC 4A3PA 1LO5D 3TSSA 2HJ8A 4P6VF 4X57B 3V61A 1DYQA 2GBMA 2KX0A 3DWMA 4BZAA 2RR9A 2DWQA 4NJCA 2KDEB 2V1YA 4FADA 3RD2A 1WYGA 1WX8A 3Q3FA 1NI3A 2J42A 4KIKB 4HKQA 4CO7A 1WZ3A 3VTWA 3E56A 1ESFA 2RPVA 3QQ8B 4W9GA 3WANA 3W5UB 4P7IA 2N4FA 5T8IA 1FNUA 2OOBB 1PDXA 1DOYA 3AU5A 1D4BA 5IO9A 3PHXB 1SIFA 3TIXA 2RD0A 3HUIA 4HLEA 4W9CA 3VQIA 2XK5A 1IUEA 2M1MA 2JQRB 1ZDVA 3AMZA 2V3NA 3UQAA 2KVZA 1KTKA 1C9FA 2Z0EB 2ZCCA 2LUEA 2DAFA 2WXRA 2WDQB 1OQQA 1FNWA 2YEPF 4MH0E 3RNGC 4GDKB 1MVKA 2BWFA 5G5GA 2EMSA 1NBFC 3AE7B 4EZLA 3Q3MC 2KN4A 2DENB 4JWUC 3ZYYX 2XN9C 2FUG1 1YD8U 1OTRB 4MELA 2B3AA 1IGDA 1S3SG 2XBBC 1LXDA 4KDLB 1GB1A 3SHQA 2N0SB 2SEBD 2J0MA 4RFBA 2INDC 3IG3A 3DCGA 2RPQA 5HKHA 1R4NB 4LK0M 2KWVB 4GOCA 2BB6A 3OJ3A 2KDMA 5AZHA 4GB9A 1N61A 1QKZA 4F1SA 5C2TB 4US9A 3BK2A 4PK1A 1AWDA 4PT5A 4IWQA 3TEZA 3ZJTA 4IOIE 2CHXA 3BY4B 1RM6C 4C7YA 3CIRB 1IGCA 3GS2A 1WGKA 1JCKB 3ZNZB 1TS3A 1KFYB 5G5HA 3DOWA 3NVYA 3BYYB 5CX3A 4C00A 3ZJUA 1R4MI 1Q10A 1YQ3B 4ZOHC 4PS7A 4IWPA 1JWAD 2OHFA 4FN2A 2DX5B 4AS1A 1WXAA 1FIQA 3DVGY 1RWSA 2G4DB 4W9KA 1QF6A 3AEAB 5BYSA 1XT9B 4G0NB 3QIJA 3FILB 3L16A 1I7HA 2WDRB 4TMAB 2LI5A 3KWVA 4LDTB 1L6UA 4P16A 3DBHI 2D3BA 1JROA 2AQ1B 4K3CA 5FK9C 3H8HA 4A9AA 4EKUA 1FFVA 1SE3A 4TUUA 3HK0A 4TSSA 3W9CB 2ZNVC 3TUOA 4YTNB 2YVCA 3W1SA 1SBBB 3ML9A 3BIID 1TKYA 5I4DA 1V49A 3Q8CA 2DZMA 3IFWB 3KYCD 3MJWA 3LYYA 5HG2A 2JY6A 1YMHE 1ZGUB 4KKJA 1UNSA 4RCOA 2KO3A 3ZJVA 3PSEB 1JRUA 3AEGB 2IY0B 4WJNA 1XO3A 1RFAA 1TZ1A 4MEMA 1J19A 4RH6A 5AUIA 2MHJA 4L2YA 2PE6B 1YIWA 3DWGC 1HE8A 3VXWA 3CWIA 2KFJA 2WXIA 2FCNA 4A6QA 3A1QA 3LDZE 3AE2B 4HEA1 1NI2A 1SE4A 3W1YA 1YN4A 4W9IA 1ZUD2 5H8YE 2KLGA 1FNVA 1C1YB 4J3OD 4HROA 2FIDA 2L76A 3DPDA 1DOIA 3AECB 4CYEA 2L0FA 4W9FA 4RMAA 3PRZA 1P9DU 4W9JA 1TS2A 2JU6X 2K8HA 2C60A 2KMAA 3ZKJC 3PVLA 3SR6A 2FCMA 2I1KA 3I9V1 2Z59B 2ASQA 3MFGA 1J7AA 5DPWA 4ACFA 1FM0D 2K3UA 2N9PC 2LGXA 5E6PA 4WAFA 1ENFA 1WI0A 3NY5A 4GN1A 1VCBA 3Q69A 4K3BA 1BT0A 4BKGA 2RGFA 2IO3B 3S2AA 1FMAD 1WYWB 3WAOA 1F1HA 1EF1A 1VZ6A 3OG5A 3VH4B 4EEWA 2H88B 3QX1A 2AX5A 3KW5B 2WYQA 5TR5A 1XLPA 2KFKA 4NAMA 4KGSA 3WAMA 3LB8C 3APDA 3KVFB 2AL3A 3AE5B 4HCNB 3R7RA 2NBVB 5L95C 2IJ0A 1TKEA 2WXKA 3L10B 3NVVA 4GMVA 4ZYSA 2BKRB 3PZDA 1WY8A 1T5XD 3U30A 2N7EA 1KRHA 2W82A 4E74A 2FE8A 3I5JC 2H89B 1WGHA 1XF5L 4IM2A 2IPKD 2FNJB 2IY1B 1QOAA 1WE7A 2PVOD 1V6EA 2I38A 4KIKA 4AJWA 4WIPA 3FAHA 4OZCA 5BMGA 3CSFA 2K39A 4BBNC 2M17A 4FLHA 1EWCA 5G2NA 5IOIA 1HZ6A 3ZDMC 2BT6A 3ABVB 4B9KA 4LLGM 3RCZA 4GDLB 1UBQA 1L0XB 3P4QB 1UH6A 1YOVB 1HZ5A 2GBRA 1YN3A 3RMKC 1HEZE 2BKFA 1FRDA 3P4PB 4EFOA 1P3QU 1CJEA 1GOZA 3ENEA 2ZCBA 3M3JA 2PKOA 2MSED 3ZVVA 1E9MA 2IO2B 4XWWA 3UIPB 2WDVB 4W9HA 4BFRA 3ZXVA 3M62B 1OQRA 4AJYB 3Q2AC 3DVNU 1FCCC 1SGHA 1H4RA 4NPNA 2IBIB 1AARA 4RF0A 1V86A 5TSSA 1QT9A 2PVGC 2WX1A 2MBOA 3DHIC 3B9JA 4O1NA 3BVGA 1YNTE 2AQ2B 2KLCA 1VZ8A 3DVGX 3UINB 1Y56A 2J53A 2MP2A 1Q0WB 1WH3A 4ZRQA 4MGZE 4RGNA 4GLSC 5BMHA 2KTRA 1R4MB 2LJ5A 1SJHD 3UIOB 1VLBA 4MGKE 4JGHB 4KGTA 3AEFB 2K9XA 4WJPA 4HRSA 2FUHB 1OEYA 3PTFC 4C7ZA 1KOTA 4BBNF 1BUIC 1UWXA 2ZVNA 2L05A 2M8SA 2M4NA 3GOEA 4M01A 3IT4B 2M0AA 1IYFA 5DPSA 1WJNA 2V3SA 3JSVA 1GB4A 4DHZB 1IBXA 2KWDA 3AU4A 4G50A 2DLBA 3AEDB 4KSKC 2CR5A 2HJ1A 2GMIC 3AI5A 2GB1A 4R3DA 1VR9A 3APCA 1RFKA 1WX7A 2MX2A 4DHZE 2MP2B 2KDFB 1LGRA 1V9JA 3VHTC 2AEHA 2C9WB 1KM7A 4DBGA 2KC2A 2D3CA 3B1LX 2EKIA 4HVBA 4HXDA 2BTEA 2D07B 1C4AA 2GI9A 4NAWA 5G55A 1JWMD 3NJTA 3X0WA 3Q3OC 1GC6A 3Q6BA 4URKA 1VZ7A 1L5PA 2N9XA 4F7ZA 2IO1B 1OEYJ 1P7EA 4US8A 3LXFA 3ZIMA 4RF1A 3ZTDA 4MJSA 1EM7A 5D3DA 4I6PA 2BYVE 4W9DA 1VRAB 1FO4A 1UGMA 1C3TA 3DBSA 1T0QC 2I2YA 2LXAA 4PS8A 4REZA 3ONSA 4AQ7A 3VH3B 2INPE 1F9JA 2EKEC 2N9KA 1VJKA 3PO0A 3JSVB 2MBBB 3URYA 2X38A 3FC4A 1Y8RC 3QAQA 2V3PA 2JRHA 5AEKB 2KHWB 4M8MA 3VUXA 2JF5A 2K6DB 4P1BC 2V4LA 1C76A 3Q8FA 1R4NI 4ASWC 2FBWB 3ZW3A 1XCQL 1DOXA 4MGIE 1QQRA 1MHHE 4AP4C 2JT4B 3P4RB 2LRWA 3ZNID 5BO4B 2N9EB 1F2RI 1N5XA 1WMHB 1TGZB 2AYOB 5EE0A 4FBJB 3KWLA 1WR6E 2WP9B 4JLCA 1I4QA 4NQLB 4LJOB 1YJJA 5EE3A 2KK8A 4DDID 3R8BA 3NZUA 4LJPB 2O6VB 2BYEA 3I3TB 4M02A 2JYEA 2JZ3B 3VFKA 5J2RA 1JALA 4LCDE 2WWZA 3A9JA 3RFZB 5FR3A 1GC7A 2NPTB 3PT2B 4E71A 2CS4A 1K53A 3FILA 3L08A 4NY0A 4WWPA 3TEWA 2YEPB 3JW0X 3ZDTA 5D7GA 2EELA 2WXQA 3KYDD 2N1VA 1IP9A 1QOFA 2W55A 3DVNV 1WMHA 2LWPA 1GJZA 4PYZA 3Q8BA 1JWUD 2MJ3A 1E7VA 2M56B 4DQOC 2WXNA 1WF9A 2L8JA 3V6CB 1TKGA 1SF0A 3U52E 2IO0B 5H92C 3GZNI 4WQMA 2ZPNA 3NS1A 1FCLA 1FRRA 2LJIA 4Q2JA 4FXCA 2E3TA 1R7SA 3RI7C 2X8XX 1KLGD 3EFUA 4MACA 1BMLC 2WXPA 1GUAB 4GXBA 3PV1A 4WH4A 2MA9B 2N7DA 2JWZA 4J6IA 2KWCA 2IDYA 4C4VA 3U7ZA 1T3QA 5KHQA 4HJGE 4S17A 5JXVA 3BINA 1GG3A 3VTUA 3NZSA 2IGDA 2JVCA 1V80A 3EGRA 3EUB2 5E6OA 3L4PA 2MJEA 1GNUA 1SSNA 2KZRA 4DDGD 2LVPA 4DHJD 3SDLC 2KMCA 3KUZA 4TKNA 2WXOA 1E7UA 2QJLA 1NEKB 1ZKHA 3RNCC 3TEXA 3T8MA 1M4VA 1TZOA 3NVWA 1WE6A 1G6JA 3SD5A 4LDTD 1XLOA 3BVZA 3VUYA 2ZEQA 2LVQA 5DPTA 4DK5A 4ZRJA 3APFA 4ANVA 3WIMA 1QZEA 2KN5A 3WCQA 4NJ7A 2WU5B 3H7SA 4S0RA 2K1FA 3HM6X 3NUHB 4MM3A 2PMVA 1V5TA 1N5WA 2INCC 4M00A 2WXJA 4HK2A 2V9HA 3U7DA 1FXTB 5J18A 4FHKA 2PIAA 4YSYB 2OJWA 2KAJA 4NQKE 1SE2A 1ZDXA 3PS6A 3B2GA 4NNJB 1MG8A 3ZGZA 4XGAB 5HFYA 1E0ZA 1TT5B 2QCZA 2RSUA 1L7YA 5IKCM 2FCSA 1D5MC 4FA6A 1CQVA 4IDIA 1PYWD 3A1QB 4RGOS 1WGRA 1WX9A 1A5RA 5HHDG 2ICIA 2KTFA 5DCNA 1IPGA 4MT5A 2D3GA 1D5ZC 3ZTCA 4IKGA 4ANUA 2KYWA 2G1EA 1UBIA 1KLUD 4IUMB 4MM3B 4II3B 3U8ZA 3R2TA 3ZQ4A 3N9YC 1J0GA 4YTPB 1UWMA 3VAWA 1EWYC 1V5OA 2A4ZA 2AWTA 4YTMB 5E6JA 1OFFA 2KACA 3BK1A 2KQ7A 2GOWA 2G45B 1QOBA 2R61A 4YSZB 2UWQA 2G4SA 1SE9A 2C7HA 1T0YA 2KVRA 1XEEA 4BKSA 2VH2A 3CMMB 3DBLB 3VR8B 1WXSA 2MH7A 1J7CA 3HVZA 3DDCB 2BF8B 4F8CB 4ZYNA 4K7WA 3DHHC 2W3RA 5BYQA 5FR6A 3RT3B 1C4CA 1GPXA 3I57A 1E8XA 1LFDA 1WRDB 2IYDB 3A33B 3BYTB 3N32A 3ZO5B 2WS3B 1WM3A 2LHDA 3IHPC 2L32A 4JE3B 5C1ZA 4ARCA 1SEBD 2Y5BB 3RUIB 1XD3B 3Q14C 4C80A 2HTHA 3RULA 3IXSA 3NVZA 3JYUA 3KUDB 5EDSA 3P42A 4AOFA 2JZZA 1B1ZA 4K81A 4XDDA 4K1RB 2WQYB 4DHJB 2KD0A 4HPMB 1Q1OA 3OWEB 1C4PA 2QMTA 3RNFC 3N30A 1RRBA 3H1UA 1PUTA 3AV8A 4DXAB 2CU3A 1MHXA 1WXVA 2O2VA 2BQQA 3MP9A 3AE8B 4HJKA 4W9EA 2BW2A 2XEWA 1PFDA 5BMIA 1TY2A 1WGDA 3W2DA 5CHFA 2GBJA 3QCAA 1NYQA 1ISNA 1JRPA 2V0GA 1KF6B 5E6NA 3NRZA 2K8BA 4GSWA 1TY0A 3P63A 2D10A 3AE6B 3IBEA 4A90A 1D3ZA 2L00B 3VTVA 1I42A 2KANA 1WXQA 1WGGA 4JL9A 5J17A 3UF8A 3BWUD 1FXIA 4XZ4A 2HE7A 4KV2A 1S1QB 2JXTA 1LM8B 3PPAA 3V3XA 5CHWA 4OVZA 2LFIA 3V05A 1F0ZA 5AZGA 2QSDA 1UELA 3GP7A 3MC0B 2IZVB 1YJIA 3GE3C 3E9SA 4HPPA 3BVMA 3VUWA 3AULA 1TIFA 1J7BA 3TL5A 4DWFA 3A9KA 4ARIA 3TEYA 4P1CC 2LASA 1E90A 3KH0A 3C19A 2MCNB 4LNOA 3HRDD 4WWOA 2LMCA 3TMPB 3PHWB 2PJHA 3L13A 2LVOA 3LJ3A 4IC7B 2N1WA 3SEBA 3AB5A 2REXA 4BVUC 3AM9A 2D3AA 1WM2A 5CTRC 5BYRA 2PW9A 1NENB 2KQSA 2MRPA 3ZNGC 2K0PA 1NDDA 4G11A 3SFDB 1WSPA 2QIEB 4N59A 3R3MA 2C5LC 4RGMA 1C78A 2L52A 2LUMA 3N3KB 4YXDB 5DPRA 3KLSX 3A4RA 4LTUA 3KQ4A 3QWZB 2NTSA 1AN8A 2GLSA 3Q3JA 1CK1A 2IGHA 2BYTA 4KKIA 3AEEB 1V2YA 1XCTL 1UD7A 3TCAA 1DGJA 2L1AA 1WWTA 3RN9C 3U2SC 3AE9B 1C79A 3T3OA 1WXMA 4H2AA 1YQBA 3RZFA 3PRPB 3UI3A 1E5WA 1HQRD 3I63C 1QLBB 3SU8X 2MW5A 1LQBA 2JSVX 1L4ZB 3QJZA 1QILA 2N9LA 4ICVA 4M0WB 1WR1A 5CHVC 2KMMA 2WDTB 3RNAC 1E6EB 2K5PA 3ZLZA 2NBUA 3MC8A 4IM0A 2WX0A 4CHKA 5IP4D 2BPSA 1B9RA 5D2MB 4RGTA 3HHMA 4USAA 4B95A 2NR2A 2KJHB 4NJ6A 2C7MB 3ECIA 1FD6A 2IGGA 2VRRB 3VDZA 2WXHA 4IWOA 4ZDVA 5JHAA 1JW9D 2D2QA 4N6EB 2NS5A 1UGJA 2J4XA 3HVDA 2WXGA 3RNBC 3IT6B 1P98A 4N9F4 1V8CA 1AW7A 2ACZB 4E3CA 1STEA 2OEDA 3DBLI 4GDKA 4L23A 3SFEB 4XC2A 3PGEA 5JHBA 3MC9A 1MFWA 2R2OA 1ET9A 2DZIA 3ALBA 4B0MA 3JVZX 1GAQB 3QA8A 1YN5A 1ROEA 4DXFA 2LGIA 1V97A 4HDQA 5IA7A 2K8CA 3TBLD 4WJQA 1TBEA 3L54A 3DBHB 4D2KA 3PLUA 1X1MA 4YT0B 5LNK1 4JQWC 1MG4A 1L4DB 4GU2A 4ANXA 1YX6B 4BOZB 1A70A 4ICUA 5IAAC 2LHEA 2DNFA 1E8WA 3AH7A 1MJDA 1KH0A 2BS4B 2DYMA 2ONQA 4YSXB 2V4IB 2NCNA 3VR9B 3M95A 1TS4A 3ZRFA 1IBXB 3L0WB 3L17A 4TQ1A 4XYCA 2RMMA 3HIZA 3N1XC 1T6BX 3PZ8A 1XLQA 2J7QB 2PE9A 2KT7A 3VRAB 4A8XC 4PYUA 1WZ0A 2BBCA 1XLNA 4EZKA 1TS5A 1VDVA 3Q8AA 2HTME 3AXCA 4OZAA 3QARA 4A55A 1D5XC 2LXCA 1PGXA 4L1BA 3RPFC 2Y5PA 4FJVB 1TYGB 2BWES 4GGQA 2O2VB 1L6VA 2L3ZA 4DXGA 5L83A 3J9CA 1T0RC 2QEJC 4CQNA 1P7FA 2PTLA 4MSQB 1H8CA 2LEKA 3KUCB 3N20C 4KDIC 1EU3A 3A4SC 3R66C 4TV3A 2J0JA 1N6ZA 4FJYA 1SIJA 2JUOA 2XK5B 2SAKA 2MEKA 2ZNVB 1SJED 2MLBA 3MHSD 3RZWC 2PLPA 2QILA 2J52A 2QHOA 3H7PA 1TJEA 4ITKA 4WJOA 2MBEA 1ZP0B 1I4HA 2CKHB 5IN7A 4HDOA 2Z0DB 3V60A 5D6JB 3NZ3A 1OQYA 1EU4A 3EECA 4OVVA 3GE8C 4KGRA 2VZKB 2BS3B 4OW0A 4PS3A 2DAJA 2W9NA 4ZRPA 3P4SB 4WURA 4M0WA 1ZXHA 2RDHA 1WJUA 2ON8A 4MGYE 3Q8EA 3FKYA 3EA6A 2MQJA 1EUVB 1PGBA 2UYZB 1HTQA 3IAS1 3O13A 4KZCA 3PREA 4N58A 2PEAA 1FPYA 2DBYA 1N62A 2A5UA 2JPHA 1YQ4B 5GXGB 4KVGB 4WQOB 1N63A 4MJSB 2Y5CA 2KKCA 2LD9A 2I1JA 1P1AA 4G3XB 4A20A 3HM3A 4ZHPA 4K7SA 2NVUI 3NHEB 1JQ4A 1JWBD 1UF0A 2LGYA 1OGWA 3MJ5A 2INNE 2CJNA 3A9KB 1WGYA 1SB3C 2L0TA 3H9DA 2JWUA 3DHGC 4EZJA 2EMTA 2R2QA 1HA5A 4MSMB 4XX5A 2J0KA 4B6WA 4WAAA 1I4PA 2DYBA 3RNEC 2FIFA 3ZXRA 3UQBA 4C4VB 4HKZE 1RYJA 2AL6A 2JRIB 1NVID 3QK0A 2N7JA 1WJ4A 1V1PB 1I4GA 1AYFA 3DBRB 1KLVA 2BS2B 2KDIA 2M19A 4WWMA 2ZW1A 5JZEB 5HI1A 4K7UA 3EC8A 2G9HD 1I4XA 4HWIB 2CJOA 1FFUA 3AE4B 4MDKE 3N1ZC 2UU7A 1L0YB 2AQ3B 3BZDB 3R2IA 4IM3A 2MJDA 1V1OA 2NBWB 3MHZA 3AE3B 3Q3NC 2NMQA 4OZBA 1FXAA 2DZJA 3AN1A 5EE9A 1MPEA 1D6EC 3UGBB 1RAXA 3CF6E 2KDBA 1WFYA 3B0AA 2O6VA 1K51A 4HPLB 3R7QA 2C7NB 1XXGA 2Z8LA 1KJTA 1E8ZA 2D5GA 2HD5B 4TQ0A 4JIOU 2K25A 3VRBB 2NPTA 4JX1C 3DQVA 3WA0A 2WNMA 2QDFA 1E10A 4LNIA 5LLIA 3CSTA 4WWNA 1PGAA 4LNNA 2WLBA 1PQSA 2KNBA 1ZOYB 3ML8A 3C0RB 2DHZA 2B76B 4C56C 4XE0A 2KXJA 1F2RC 2BYFA 2K22A 3OAWA 1XQQA 2OJRA 2W3SA 2DYOA 3PLVA 3A9JB 1U4AA 2ZJDA 5D3IB 3ETRA 3DBRI 1HTOA 3AEBB 1SXTA 2YLMA 2KOXA 3EFCA 2XNAC 2WU2B
chains in the Genus database with same CATH topology
4WQMA 2L1AA 3C8YA 1WWTA 4J3OD 3U2SC 3AE9B 4HROA 4B0EA 1C79A 3T3OA 3NS1A 4H2AA 1FCLA 3UI3A 1FRRA 3P1MA 1I4RA 2LJIA 4Q2JA 1DOIA 4FXCA 3AECB 2E3TA 1HQRD 1R7SA 1QLBB 1HXYD 2JSVX 1KLGD 1TS2A 2JU6X 4MACA 1L4ZB 1BMLC 2WXPA 3SR6A 1ET6A 1QILA 2N9LA 4WH4A 3T3NA 2KMMA 3I9V1 4KX6B 3MFGA 1J7AA 1E6EB 2IDYA 3U7ZA 2K5PA 1T3QA 4HJGE 5JXVA 1FM0D 1UUPA 2K3UA 1WRIA 4WAFA 1C77A 1ENFA 2IGDA 1B9RA 3EGRA 1N60A 5MPOA 3EUB2 4RGTA 3Q69A 2KQ4X 1FMAD 4USAA 3L4PA 2MJEA 1VZ6A 1SSNA 1FD6A 2IGGA 2GRIA 2H88B 1E7PB 2AX5A 2W54A 2WXHA 1XLPA 1JW9D 4NAMA 4KGSA 5AUKA 4N6EB 2WXOA 3LB8C 2QJLA 1JWSD 1UGJA 3AE5B 2J4XA 1NEKB 3HVDA 3TEXA 2WXGA 4NAWB 3IT6B 1M4VA 1TZOA 2IJ0A 3NVWA 1TKEA 2WXKA 3NVVA 1V8CA 1AW7A 2ACZB 4ZYSA 1STEA 1XLOA 2OEDA 4L23A 3BVZA 3SFEB 3IAM1 1F77A 4MH8A 1T5XD 1CZPA 1ET9A 4B0MA 1KRHA 2W82A 2FE8A 2VZKD 3WCQA 2H89B 1K52A 1XF5L 1GAQB 2IPKD 2WU5B 2E6XA 1YN5A 1ROEA 4EE2A 1MI0A 2JZPA 4DXFA 2LGIA 1V97A 1QOAA 3GB1A 3NUHB 2PVOD 2HDEA 5FKAC 2I38A 2PMVA 1N5WA 4WIPA 3FAHA 2Y3AA 4OZCA 5BMGA 2Q5WD 4D2KA 2WXJA 4NZLB 2WXMA 1EWCA 1HZ6A 4YT0B 5LNK1 2BT6A 2ZW0A 3ABVB 1L4DB 2PIAA 4YSYB 4LLGM 1A70A 2KAJA 3B2FA 1SE2A 1ZDXA 2LHEA 3B2GA 4GDLB 2WXLA 3AH7A 1V1PA 3ZGZA 1L0XB 5HFYA 3P4QB 1E0ZA 1KH0A 2BS4B 2DYMA 1BXTA 1HZ5A 1YN3A 2ONQA 4YSXB 2V4IB 3VR9B 1HEZE 1FRDA 1TS4A 1IBXB 1D5MC 3P4PB 1ZE3D 3U4EG 4TQ1A 2RMMA 1CJEA 1GOZA 1T6BX 1CQVA 4IDIA 1PYWD 3PZ8A 1XLQA 2PKOA 4RGOS 3VRAB 4A8XC 1E9MA 2WXFA 5HHDG 2ICIA 4XWWA 1NYRA 2BBCA 2TSSA 2WDVB 3W5VB 1XLNA 4MT5A 1K50A 1D5ZC 1OQRA 4IKGA 1JMLA 4UDUC 1TS5A 1VDVA 2G1EA 3Q8AA 4RNAA 2HTME 1KLUD 2RDGA 4OHJA 4OZAA 4MM3B 4ZHOA 4A55A 1D5XC 1FCCC 1ZXIA 3R2TA 3ZQ4A 3N9YC 4JPSA 1PGXA 4L1BA 4YTPB 1FEHA 1QOGA 3RPFC 4JWSC 1UWMA 2Y5PA 1EWYC 5EE1A 4RF0A 2JYTA 5TSSA 1QT9A 1TYGB 2PVGC 2NTTA 4XWTA 3B9JA 4O1NA 5E6JA 2L83A 1OFFA 4YTMB 4DXGA 1L6VA 3BVGA 1YNTE 2AQ2B 2KACA 3J9CA 1VZ8A 2BB5A 2JX5A 2QEJC 4CQNA 3BK1A 1P7FA 2PTLA 1Y56A 2LEKA 1QOBA 2R61A 2J53A 4YSZB 3AE1B 4ZRQA 1EU3A 1ZPSA 4XDCA 1ACCA 3PZ7A 5C3JB 4RGNA 4YWGG 4GLSC 1XEEA 1L0VB 3VR8B 1SIJA 5BMHA 2SAKA 2MH7A 2MEKA 1SJHD 1J7CA 1VLBA 1LO5D 3HVZA 1SJED 4KGTA 3AEFB 2PLPA 2K9XA 3TSSA 2QILA 4HRSA 2J52A 4P6VF 1DYQA 4C7ZA 1TJEA 3DWMA 4ITKA 1ZP0B 1I4HA 2DWQA 2W3RA 4NJCA 1BUIC 5BYQA 1UWXA 1WYGA 1NI3A 1C4CA 2J42A 3NZ3A 1GPXA 4HKQA 3I57A 1EU4A 3E56A 1ESFA 3IT4B 2M0AA 2RPVA 4KGRA 2VZKB 2BS3B 3BYTB 5T8IA 3W5UB 4OW0A 1FNUA 2WS3B 1GB4A 1PDXA 1IBXA 2KWDA 1DOYA 4ZRPA 2LHDA 3P4SB 2L32A 4WURA 4JE3B 4ARCA 2DLBA 1D4BA 1SEBD 3AEDB 4M0WA 1ZXHA 2RDHA 4C80A 2ON8A 3IXSA 3Q8EA 3NVZA 3EA6A 3P42A 1PGBA 3HUIA 2GB1A 4R3DA 3VQIA 3IAS1 1IUEA 1VR9A 3O13A 2JQRB 1B1ZA 1ZDVA 1RFKA 3AMZA 4N58A 4XDDA 2DBYA 2V3NA 2WQYB 1N62A 3OWEB 1C4PA 1KTKA 2QMTA 1YQ4B 5GXGB 1C9FA 1PUTA 2WXRA 3AV8A 2WDQB 1N63A 1OQQA 1FNWA 2CU3A 2YEPF 1MHXA 2Y5CA 1MVKA 4GDKB 3MP9A 5G5GA 3AE7B 2EKIA 3AE8B 2BTEA 4ZHPA 1C4AA 2KN4A 2GI9A 4JWUC 1JWMD 2BW2A 3ZYYX 1JQ4A 2XN9C 2FUG1 1JWBD 1IGDA 1VZ7A 1PFDA 1GB1A 1L5PA 5BMIA 1TY2A 2N0SB 3W2DA 2SEBD 3MJ5A 4RFBA 1P7EA 2INNE 2CJNA 5H92C 4US8A 1NYQA 1JRPA 3LXFA 1SB3C 4RF1A 2V0GA 1EM7A 2JWUA 5D3DA 1KF6B 4LK0M 2BB6A 1VRAB 1HA5A 3NRZA 2KDMA 1TY0A 1FO4A 3P63A 1N61A 1QKZA 3AE6B 4A90A 1I4PA 5C2TB 4US9A 3BK2A 2I2YA 1AWDA 4PT5A 1WXQA 3TEZA 3ZJTA 4IOIE 4REZA 4AQ7A 4HKZE 1RM6C 4C7YA 2INPE 3CIRB 1IGCA 3GS2A 1RYJA 1WGKA 1JCKB 3BWUD 1NVID 1TS3A 2N7JA 1V1PB 1KFYB 5G5HA 1FXIA 1I4GA 3NVYA 3BYYB 1AYFA 2N9KA 2JXTA 1VJKA 3V3XA 3PO0A 2BS2B 2M19A 3URYA 2X38A 3FC4A 3ZJUA 4WWMA 4OVZA 1Q10A 2ZW1A 1YQ3B 2LFIA 2V3PA 4ZOHC 5HI1A 1JWAD 3V05A 2OHFA 1F0ZA 4AS1A 1C76A 2QSDA 2G9HD 3Q8FA 3GP7A 1I4XA 2FBWB 3MC0B 1FIQA 2CJOA 1RWSA 1FFUA 1XCQL 3AE4B 1DOXA 1YJIA 3E9SA 1QF6A 1L0YB 2AQ3B 3BVMA 3BZDB 3AEAB 3R2IA 2MJDA 1QQRA 1MHHE 5BYSA 1J7BA 4ARIA 3FILB 1V1OA 3TEYA 1I7HA 3P4RB 3MHZA 3AE3B 2WDRB 4TMAB 2NMQA 3KWVA 1L6UA 3HRDD 4OZBA 1FXAA 1F2RI 3AN1A 1N5XA 2LMCA 5EE9A 4P16A 1MPEA 1D6EC 5EE0A 3KWLA 1JROA 2AQ1B 2WP9B 1K51A 5FK9C 3H8HA 4A9AA 1I4QA 1FFVA 1SE3A 3SEBA 2WU2B 1YJJA 5EE3A 4TSSA 1XXGA 3W9CB 3R8BA 2Z8LA 3AB5A 2D5GA 3TUOA 4YTNB 4TQ0A 3AM9A 3VRBB 1SBBB 3W1SA 2JYEA 1TKYA 3BIID 5I4DA 4JX1C 3Q8CA 1JALA 2WNMA 3LYYA 5HG2A 1E10A 3RFZB 1YMHE 5FR3A 4KKJA 5BYRA 1UNSA 1PGAA 2PW9A 4RCOA 1K53A 2WLBA 3FILA 1NENB 3ZJVA 2K0PA 1ZOYB 3AEGB 3TEWA 2B76B 3SFDB 1XO3A 1WSPA 2YEPB 4C56C 4XE0A 5D7GA 1F2RC 2EELA 2K22A 2QIEB 4N59A 4RH6A 5AUIA 2WXQA 4L2YA 1QOFA 2W55A 3DWGC 2W3SA 3CWIA 2DYOA 4RGMA 1C78A 3Q8BA 2L52A 2LUMA 2WXIA 4YXDB 3KLSX 1JWUD 5D3IB 3ETRA 4A6QA 2MJ3A 3AE2B 4HEA1 2M56B 4DQOC 4LTUA 3KQ4A 2WXNA 2NTSA 1AN8A 3AEBB 1CK1A 1SE4A 1SXTA 1YN4A 1ZUD2 1TKGA 1SF0A 2IGHA 2BYTA 4KKIA 3U52E 5H8YE 3AEEB 1XCTL 2XNAC 1FNVA 1DGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWX A;  2N9K A;  2JXT A;  1HZ6 A;  3V3X A;  2ZW0 A;  1FCL A;  3UI3 A;  1Q10 A;  2RPV A;  2ZW1 A;  4KGR A;  2JSV X;  5HI1 A;  2LHE A;  2JU6 X;  1GB4 A;  1IBX A;  4MAC A;  2KWD A;  2QSD A;  2LHD A;  2N9L A;  4WH4 A;  1D4B A;  1XCQ L;  5HFY A;  1KH0 A;  2ONQ A;  1HZ5 A;  1ZXH A;  1HEZ E;  2ON8 A;  1MHH E;  1IBX B;  3FIL B;  4HJG E;  1PGB A;  2RMM A;  2GB1 A;  5JXV A;  2NMQ A;  2IGD A;  4OZB A;  1F2R I;  1MPE A;  5HHD G;  2KQ4 X;  2QMT A;  1C9F A;  1K51 A;  1K50 A;  4IKG A;  1JML A;  1FD6 A;  2IGG A;  1MHX A;  1MVK A;  3MP9 A;  4OZA A;  1FCC C;  4KGS A;  2KN4 A;  2GI9 A;  1PGX A;  5HG2 A;  1IGD A;  1YMH E;  1GB1 A;  5BMI A;  1PGA A;  2PW9 A;  1K53 A;  3FIL A;  1P7E A;  2OED A;  1YNT E;  2KAC A;  2K0P A;  1EM7 A;  1P7F A;  2JWU A;  2PTL A;  2J53 A;  1F2R C;  2EEL A;  2KDM A;  1K52 A;  1QKZ A;  1XF5 L;  2LUM A;  1MI0 A;  2JZP A;  4GLS C;  2I2Y A;  2LGI A;  5BMH A;  3GB1 A;  4IOI E;  2I38 A;  4KGT A;  4HKZ E;  2PLP A;  2J52 A;  1IGC A;  2IGH A;  4OZC A;  5BMG A;  4D2K A;  2N7J A;  1XCT L; 
#chains in the Genus database with same CATH topology
 3C8Y A;  1J8C A;  4BAX A;  2ZVO A;  4RM9 A;  4IG7 B;  1YX5 B;  4B0E A;  3P1M A;  1I4R A;  2KJR A;  2CHZ A;  3M63 B;  1UZX B;  1WJ6 A;  1HXY D;  2ZZP B;  2LGS A;  4LNF A;  1ET6 A;  4EUT A;  3T3N A;  1I35 A;  1E8Y A;  4KX6 B;  4II2 B;  3VVW B;  4AWJ A;  2K6Q A;  5D94 A;  4A3O A;  2LRU A;  3NS8 A;  1UUP A;  1EF5 A;  1WRI A;  2KTR B;  1C77 A;  3WAL A;  3OLM D;  2MBH A;  2MWS B;  4HCP B;  2KWU B;  1N60 A;  4OVU A;  5MPO A;  1V81 A;  2KQ4 X;  4GIV A;  2DZK A;  3D32 A;  2G3Q B;  2GBK A;  4FHJ A;  2GRI A;  3EHV A;  2LGD A;  1E7P B;  2W54 A;  1CMX B;  5AUK A;  3WAP A;  2KJ6 A;  1JWS D;  4FUL A;  1ZW7 A;  4NAW B;  2BVC A;  3P2B A;  4BOS C;  4I6N B;  3NG0 A;  3IAM 1;  1F77 A;  4MH8 A;  5LXH A;  1F52 A;  2D11 A;  1CZP A;  2RDB C;  2VZK D;  1K52 A;  2E6X A;  4EE2 A;  1MI0 A;  2JZP A;  5LXI B;  1Q5W B;  3GB1 A;  2HDE A;  5FKA C;  4I6L B;  3K9P B;  2PPH A;  4ANW A;  1L2N A;  2Y3A A;  3N1Y C;  1TTN A;  3ZRC A;  2Q5W D;  1Z2M A;  4NZL B;  2BGF A;  1RLF A;  2WXM A;  2ZW0 A;  2CHW A;  4KZ0 A;  3W1S C;  3K9O B;  3MTN B;  3B2F A;  3H6N A;  2JXX A;  4IW0 A;  2WXL A;  3T9L A;  1V1P A;  3NOB A;  4ZRK A;  3QC8 B;  4RM8 A;  1BXT A;  1K8R B;  2VH1 A;  3U4E G;  1ZE3 D;  2L7R A;  3QHT A;  1YJ1 A;  4KSL C;  3V62 A;  1Z5S B;  3B08 A;  2KC1 A;  4FJZ A;  3GZN B;  5C23 A;  3PRM B;  2FAZ A;  2WXF A;  2M0X A;  3IVF A;  1NYR A;  2TSS A;  3W5V B;  4BKS D;  2CU1 A;  2O6V D;  4AUQ C;  1K50 A;  1M94 A;  3H7P B;  1JML A;  1VD2 A;  4YL8 A;  3V6E B;  4UDU C;  1P0R A;  2WGS A;  3O65 B;  5GMV A;  4ZRI A;  4RNA A;  2RDG A;  4OHJ A;  2QC8 A;  3ZNH B;  3X23 A;  4ZHO A;  2ZPY A;  1WIA A;  2KX3 A;  4QAY A;  1ZXI A;  4JPS A;  1FEH A;  2GBN A;  1QOG A;  4JWS C;  2MBQ A;  5EE1 A;  5KHO A;  2JYT A;  3OJ4 B;  2NTT A;  4XWT A;  3TJP A;  2KFK B;  2L83 A;  5JH5 C;  2WHI A;  2JX5 A;  2BB5 A;  4W9L A;  4LNK A;  3RYT A;  3AE1 B;  5AZF A;  4M8N A;  4EOY A;  2FCQ A;  4GDL A;  4XDC A;  1ZPS A;  1ACC A;  3PZ7 A;  5C3J B;  4YWG G;  1L0V B;  3ZUN A;  1EO6 A;  4BKT A;  2LZ6 A;  1T0S C;  4A3P A;  1LO5 D;  3TSS A;  2HJ8 A;  4P6V F;  4X57 B;  3V61 A;  1DYQ A;  2GBM A;  2KX0 A;  3DWM A;  4BZA A;  2RR9 A;  2DWQ A;  4NJC A;  2KDE B;  2V1Y A;  4FAD A;  3RD2 A;  1WYG A;  1WX8 A;  3Q3F A;  1NI3 A;  2J42 A;  4KIK B;  4HKQ A;  4CO7 A;  1WZ3 A;  3VTW A;  3E56 A;  1ESF A;  2RPV A;  3QQ8 B;  4W9G A;  3WAN A;  3W5U B;  4P7I A;  2N4F A;  5T8I A;  1FNU A;  2OOB B;  1PDX A;  1DOY A;  3AU5 A;  1D4B A;  5IO9 A;  3PHX B;  1SIF A;  3TIX A;  2RD0 A;  3HUI A;  4HLE A;  4W9C A;  3VQI A;  2XK5 A;  1IUE A;  2M1M A;  2JQR B;  1ZDV A;  3AMZ A;  2V3N A;  3UQA A;  2KVZ A;  1KTK A;  1C9F A;  2Z0E B;  2ZCC A;  2LUE A;  2DAF A;  2WXR A;  2WDQ B;  1OQQ A;  1FNW A;  2YEP F;  4MH0 E;  3RNG C;  4GDK B;  1MVK A;  2BWF A;  5G5G A;  2EMS A;  1NBF C;  3AE7 B;  4EZL A;  3Q3M C;  2KN4 A;  2DEN B;  4JWU C;  3ZYY X;  2XN9 C;  2FUG 1;  1YD8 U;  1OTR B;  4MEL A;  2B3A A;  1IGD A;  1S3S G;  2XBB C;  1LXD A;  4KDL B;  1GB1 A;  3SHQ A;  2N0S B;  2SEB D;  2J0M A;  4RFB A;  2IND C;  3IG3 A;  3DCG A;  2RPQ A;  5HKH A;  1R4N B;  4LK0 M;  2KWV B;  4GOC A;  2BB6 A;  3OJ3 A;  2KDM A;  5AZH A;  4GB9 A;  1N61 A;  1QKZ A;  4F1S A;  5C2T B;  4US9 A;  3BK2 A;  4PK1 A;  1AWD A;  4PT5 A;  4IWQ A;  3TEZ A;  3ZJT A;  4IOI E;  2CHX A;  3BY4 B;  1RM6 C;  4C7Y A;  3CIR B;  1IGC A;  3GS2 A;  1WGK A;  1JCK B;  3ZNZ B;  1TS3 A;  1KFY B;  5G5H A;  3DOW A;  3NVY A;  3BYY B;  5CX3 A;  4C00 A;  3ZJU A;  1R4M I;  1Q10 A;  1YQ3 B;  4ZOH C;  4PS7 A;  4IWP A;  1JWA D;  2OHF A;  4FN2 A;  2DX5 B;  4AS1 A;  1WXA A;  1FIQ A;  3DVG Y;  1RWS A;  2G4D B;  4W9K A;  1QF6 A;  3AEA B;  5BYS A;  1XT9 B;  4G0N B;  3QIJ A;  3FIL B;  3L16 A;  1I7H A;  2WDR B;  4TMA B;  2LI5 A;  3KWV A;  4LDT B;  1L6U A;  4P16 A;  3DBH I;  2D3B A;  1JRO A;  2AQ1 B;  4K3C A;  5FK9 C;  3H8H A;  4A9A A;  4EKU A;  1FFV A;  1SE3 A;  4TUU A;  3HK0 A;  4TSS A;  3W9C B;  2ZNV C;  3TUO A;  4YTN B;  2YVC A;  3W1S A;  1SBB B;  3ML9 A;  3BII D;  1TKY A;  5I4D A;  1V49 A;  3Q8C A;  2DZM A;  3IFW B;  3KYC D;  3MJW A;  3LYY A;  5HG2 A;  2JY6 A;  1YMH E;  1ZGU B;  4KKJ A;  1UNS A;  4RCO A;  2KO3 A;  3ZJV A;  3PSE B;  1JRU A;  3AEG B;  2IY0 B;  4WJN A;  1XO3 A;  1RFA A;  1TZ1 A;  4MEM A;  1J19 A;  4RH6 A;  5AUI A;  2MHJ A;  4L2Y A;  2PE6 B;  1YIW A;  3DWG C;  1HE8 A;  3VXW A;  3CWI A;  2KFJ A;  2WXI A;  2FCN A;  4A6Q A;  3A1Q A;  3LDZ E;  3AE2 B;  4HEA 1;  1NI2 A;  1SE4 A;  3W1Y A;  1YN4 A;  4W9I A;  1ZUD 2;  5H8Y E;  2KLG A;  1FNV A;  1C1Y B;  4J3O D;  4HRO A;  2FID A;  2L76 A;  3DPD A;  1DOI A;  3AEC B;  4CYE A;  2L0F A;  4W9F A;  4RMA A;  3PRZ A;  1P9D U;  4W9J A;  1TS2 A;  2JU6 X;  2K8H A;  2C60 A;  2KMA A;  3ZKJ C;  3PVL A;  3SR6 A;  2FCM A;  2I1K A;  3I9V 1;  2Z59 B;  2ASQ A;  3MFG A;  1J7A A;  5DPW A;  4ACF A;  1FM0 D;  2K3U A;  2N9P C;  2LGX A;  5E6P A;  4WAF A;  1ENF A;  1WI0 A;  3NY5 A;  4GN1 A;  1VCB A;  3Q69 A;  4K3B A;  1BT0 A;  4BKG A;  2RGF A;  2IO3 B;  3S2A A;  1FMA D;  1WYW B;  3WAO A;  1F1H A;  1EF1 A;  1VZ6 A;  3OG5 A;  3VH4 B;  4EEW A;  2H88 B;  3QX1 A;  2AX5 A;  3KW5 B;  2WYQ A;  5TR5 A;  1XLP A;  2KFK A;  4NAM A;  4KGS A;  3WAM A;  3LB8 C;  3APD A;  3KVF B;  2AL3 A;  3AE5 B;  4HCN B;  3R7R A;  2NBV B;  5L95 C;  2IJ0 A;  1TKE A;  2WXK A;  3L10 B;  3NVV A;  4GMV A;  4ZYS A;  2BKR B;  3PZD A;  1WY8 A;  1T5X D;  3U30 A;  2N7E A;  1KRH A;  2W82 A;  4E74 A;  2FE8 A;  3I5J C;  2H89 B;  1WGH A;  1XF5 L;  4IM2 A;  2IPK D;  2FNJ B;  2IY1 B;  1QOA A;  1WE7 A;  2PVO D;  1V6E A;  2I38 A;  4KIK A;  4AJW A;  4WIP A;  3FAH A;  4OZC A;  5BMG A;  3CSF A;  2K39 A;  4BBN C;  2M17 A;  4FLH A;  1EWC A;  5G2N A;  5IOI A;  1HZ6 A;  3ZDM C;  2BT6 A;  3ABV B;  4B9K A;  4LLG M;  3RCZ A;  4GDL B;  1UBQ A;  1L0X B;  3P4Q B;  1UH6 A;  1YOV B;  1HZ5 A;  2GBR A;  1YN3 A;  3RMK C;  1HEZ E;  2BKF A;  1FRD A;  3P4P B;  4EFO A;  1P3Q U;  1CJE A;  1GOZ A;  3ENE A;  2ZCB A;  3M3J A;  2PKO A;  2MSE D;  3ZVV A;  1E9M A;  2IO2 B;  4XWW A;  3UIP B;  2WDV B;  4W9H A;  4BFR A;  3ZXV A;  3M62 B;  1OQR A;  4AJY B;  3Q2A C;  3DVN U;  1FCC C;  1SGH A;  1H4R A;  4NPN A;  2IBI B;  1AAR A;  4RF0 A;  1V86 A;  5TSS A;  1QT9 A;  2PVG C;  2WX1 A;  2MBO A;  3DHI C;  3B9J A;  4O1N A;  3BVG A;  1YNT E;  2AQ2 B;  2KLC A;  1VZ8 A;  3DVG X;  3UIN B;  1Y56 A;  2J53 A;  2MP2 A;  1Q0W B;  1WH3 A;  4ZRQ A;  4MGZ E;  4RGN A;  4GLS C;  5BMH A;  2KTR A;  1R4M B;  2LJ5 A;  1SJH D;  3UIO B;  1VLB A;  4MGK E;  4JGH B;  4KGT A;  3AEF B;  2K9X A;  4WJP A;  4HRS A;  2FUH B;  1OEY A;  3PTF C;  4C7Z A;  1KOT A;  4BBN F;  1BUI C;  1UWX A;  2ZVN A;  2L05 A;  2M8S A;  2M4N A;  3GOE A;  4M01 A;  3IT4 B;  2M0A A;  1IYF A;  5DPS A;  1WJN A;  2V3S A;  3JSV A;  1GB4 A;  4DHZ B;  1IBX A;  2KWD A;  3AU4 A;  4G50 A;  2DLB A;  3AED B;  4KSK C;  2CR5 A;  2HJ1 A;  2GMI C;  3AI5 A;  2GB1 A;  4R3D A;  1VR9 A;  3APC A;  1RFK A;  1WX7 A;  2MX2 A;  4DHZ E;  2MP2 B;  2KDF B;  1LGR A;  1V9J A;  3VHT C;  2AEH A;  2C9W B;  1KM7 A;  4DBG A;  2KC2 A;  2D3C A;  3B1L X;  2EKI A;  4HVB A;  4HXD A;  2BTE A;  2D07 B;  1C4A A;  2GI9 A;  4NAW A;  5G55 A;  1JWM D;  3NJT A;  3X0W A;  3Q3O C;  1GC6 A;  3Q6B A;  4URK A;  1VZ7 A;  1L5P A;  2N9X A;  4F7Z A;  2IO1 B;  1OEY J;  1P7E A;  4US8 A;  3LXF A;  3ZIM A;  4RF1 A;  3ZTD A;  4MJS A;  1EM7 A;  5D3D A;  4I6P A;  2BYV E;  4W9D A;  1VRA B;  1FO4 A;  1UGM A;  1C3T A;  3DBS A;  1T0Q C;  2I2Y A;  2LXA A;  4PS8 A;  4REZ A;  3ONS A;  4AQ7 A;  3VH3 B;  2INP E;  1F9J A;  2EKE C;  2N9K A;  1VJK A;  3PO0 A;  3JSV B;  2MBB B;  3URY A;  2X38 A;  3FC4 A;  1Y8R C;  3QAQ A;  2V3P A;  2JRH A;  5AEK B;  2KHW B;  4M8M A;  3VUX A;  2JF5 A;  2K6D B;  4P1B C;  2V4L A;  1C76 A;  3Q8F A;  1R4N I;  4ASW C;  2FBW B;  3ZW3 A;  1XCQ L;  1DOX A;  4MGI E;  1QQR A;  1MHH E;  4AP4 C;  2JT4 B;  3P4R B;  2LRW A;  3ZNI D;  5BO4 B;  2N9E B;  1F2R I;  1N5X A;  1WMH B;  1TGZ B;  2AYO B;  5EE0 A;  4FBJ B;  3KWL A;  1WR6 E;  2WP9 B;  4JLC A;  1I4Q A;  4NQL B;  4LJO B;  1YJJ A;  5EE3 A;  2KK8 A;  4DDI D;  3R8B A;  3NZU A;  4LJP B;  2O6V B;  2BYE A;  3I3T B;  4M02 A;  2JYE A;  2JZ3 B;  3VFK A;  5J2R A;  1JAL A;  4LCD E;  2WWZ A;  3A9J A;  3RFZ B;  5FR3 A;  1GC7 A;  2NPT B;  3PT2 B;  4E71 A;  2CS4 A;  1K53 A;  3FIL A;  3L08 A;  4NY0 A;  4WWP A;  3TEW A;  2YEP B;  3JW0 X;  3ZDT A;  5D7G A;  2EEL A;  2WXQ A;  3KYD D;  2N1V A;  1IP9 A;  1QOF A;  2W55 A;  3DVN V;  1WMH A;  2LWP A;  1GJZ A;  4PYZ A;  3Q8B A;  1JWU D;  2MJ3 A;  1E7V A;  2M56 B;  4DQO C;  2WXN A;  1WF9 A;  2L8J A;  3V6C B;  1TKG A;  1SF0 A;  3U52 E;  2IO0 B;  5H92 C;  3GZN I;  4WQM A;  2ZPN A;  3NS1 A;  1FCL A;  1FRR A;  2LJI A;  4Q2J A;  4FXC A;  2E3T A;  1R7S A;  3RI7 C;  2X8X X;  1KLG D;  3EFU A;  4MAC A;  1BML C;  2WXP A;  1GUA B;  4GXB A;  3PV1 A;  4WH4 A;  2MA9 B;  2N7D A;  2JWZ A;  4J6I A;  2KWC A;  2IDY A;  4C4V A;  3U7Z A;  1T3Q A;  5KHQ A;  4HJG E;  4S17 A;  5JXV A;  3BIN A;  1GG3 A;  3VTU A;  3NZS A;  2IGD A;  2JVC A;  1V80 A;  3EGR A;  3EUB 2;  5E6O A;  3L4P A;  2MJE A;  1GNU A;  1SSN A;  2KZR A;  4DDG D;  2LVP A;  4DHJ D;  3SDL C;  2KMC A;  3KUZ A;  4TKN A;  2WXO A;  1E7U A;  2QJL A;  1NEK B;  1ZKH A;  3RNC C;  3TEX A;  3T8M A;  1M4V A;  1TZO A;  3NVW A;  1WE6 A;  1G6J A;  3SD5 A;  4LDT D;  1XLO A;  3BVZ A;  3VUY A;  2ZEQ A;  2LVQ A;  5DPT A;  4DK5 A;  4ZRJ A;  3APF A;  4ANV A;  3WIM A;  1QZE A;  2KN5 A;  3WCQ A;  4NJ7 A;  2WU5 B;  3H7S A;  4S0R A;  2K1F A;  3HM6 X;  3NUH B;  4MM3 A;  2PMV A;  1V5T A;  1N5W A;  2INC C;  4M00 A;  2WXJ A;  4HK2 A;  2V9H A;  3U7D A;  1FXT B;  5J18 A;  4FHK A;  2PIA A;  4YSY B;  2OJW A;  2KAJ A;  4NQK E;  1SE2 A;  1ZDX A;  3PS6 A;  3B2G A;  4NNJ B;  1MG8 A;  3ZGZ A;  4XGA B;  5HFY A;  1E0Z A;  1TT5 B;  2QCZ A;  2RSU A;  1L7Y A;  5IKC M;  2FCS A;  1D5M C;  4FA6 A;  1CQV A;  4IDI A;  1PYW D;  3A1Q B;  4RGO S;  1WGR A;  1WX9 A;  1A5R A;  5HHD G;  2ICI A;  2KTF A;  5DCN A;  1IPG A;  4MT5 A;  2D3G A;  1D5Z C;  3ZTC A;  4IKG A;  4ANU A;  2KYW A;  2G1E A;  1UBI A;  1KLU D;  4IUM B;  4MM3 B;  4II3 B;  3U8Z A;  3R2T A;  3ZQ4 A;  3N9Y C;  1J0G A;  4YTP B;  1UWM A;  3VAW A;  1EWY C;  1V5O A;  2A4Z A;  2AWT A;  4YTM B;  5E6J A;  1OFF A;  2KAC A;  3BK1 A;  2KQ7 A;  2GOW A;  2G45 B;  1QOB A;  2R61 A;  4YSZ B;  2UWQ A;  2G4S A;  1SE9 A;  2C7H A;  1T0Y A;  2KVR A;  1XEE A;  4BKS A;  2VH2 A;  3CMM B;  3DBL B;  3VR8 B;  1WXS A;  2MH7 A;  1J7C A;  3HVZ A;  3DDC B;  2BF8 B;  4F8C B;  4ZYN A;  4K7W A;  3DHH C;  2W3R A;  5BYQ A;  5FR6 A;  3RT3 B;  1C4C A;  1GPX A;  3I57 A;  1E8X A;  1LFD A;  1WRD B;  2IYD B;  3A33 B;  3BYT B;  3N32 A;  3ZO5 B;  2WS3 B;  1WM3 A;  2LHD A;  3IHP C;  2L32 A;  4JE3 B;  5C1Z A;  4ARC A;  1SEB D;  2Y5B B;  3RUI B;  1XD3 B;  3Q14 C;  4C80 A;  2HTH A;  3RUL A;  3IXS A;  3NVZ A;  3JYU A;  3KUD B;  5EDS A;  3P42 A;  4AOF A;  2JZZ A;  1B1Z A;  4K81 A;  4XDD A;  4K1R B;  2WQY B;  4DHJ B;  2KD0 A;  4HPM B;  1Q1O A;  3OWE B;  1C4P A;  2QMT A;  3RNF C;  3N30 A;  1RRB A;  3H1U A;  1PUT A;  3AV8 A;  4DXA B;  2CU3 A;  1MHX A;  1WXV A;  2O2V A;  2BQQ A;  3MP9 A;  3AE8 B;  4HJK A;  4W9E A;  2BW2 A;  2XEW A;  1PFD A;  5BMI A;  1TY2 A;  1WGD A;  3W2D A;  5CHF A;  2GBJ A;  3QCA A;  1NYQ A;  1ISN A;  1JRP A;  2V0G A;  1KF6 B;  5E6N A;  3NRZ A;  2K8B A;  4GSW A;  1TY0 A;  3P63 A;  2D10 A;  3AE6 B;  3IBE A;  4A90 A;  1D3Z A;  2L00 B;  3VTV A;  1I42 A;  2KAN A;  1WXQ A;  1WGG A;  4JL9 A;  5J17 A;  3UF8 A;  3BWU D;  1FXI A;  4XZ4 A;  2HE7 A;  4KV2 A;  1S1Q B;  2JXT A;  1LM8 B;  3PPA A;  3V3X A;  5CHW A;  4OVZ A;  2LFI A;  3V05 A;  1F0Z A;  5AZG A;  2QSD A;  1UEL A;  3GP7 A;  3MC0 B;  2IZV B;  1YJI A;  3GE3 C;  3E9S A;  4HPP A;  3BVM A;  3VUW A;  3AUL A;  1TIF A;  1J7B A;  3TL5 A;  4DWF A;  3A9K A;  4ARI A;  3TEY A;  4P1C C;  2LAS A;  1E90 A;  3KH0 A;  3C19 A;  2MCN B;  4LNO A;  3HRD D;  4WWO A;  2LMC A;  3TMP B;  3PHW B;  2PJH A;  3L13 A;  2LVO A;  3LJ3 A;  4IC7 B;  2N1W A;  3SEB A;  3AB5 A;  2REX A;  4BVU C;  3AM9 A;  2D3A A;  1WM2 A;  5CTR C;  5BYR A;  2PW9 A;  1NEN B;  2KQS A;  2MRP A;  3ZNG C;  2K0P A;  1NDD A;  4G11 A;  3SFD B;  1WSP A;  2QIE B;  4N59 A;  3R3M A;  2C5L C;  4RGM A;  1C78 A;  2L52 A;  2LUM A;  3N3K B;  4YXD B;  5DPR A;  3KLS X;  3A4R A;  4LTU A;  3KQ4 A;  3QWZ B;  2NTS A;  1AN8 A;  2GLS A;  3Q3J A;  1CK1 A;  2IGH A;  2BYT A;  4KKI A;  3AEE B;  1V2Y A;  1XCT L;  1UD7 A;  3TCA A;  1DGJ A;  2L1A A;  1WWT A;  3RN9 C;  3U2S C;  3AE9 B;  1C79 A;  3T3O A;  1WXM A;  4H2A A;  1YQB A;  3RZF A;  3PRP B;  3UI3 A;  1E5W A;  1HQR D;  3I63 C;  1QLB B;  3SU8 X;  2MW5 A;  1LQB A;  2JSV X;  1L4Z B;  3QJZ A;  1QIL A;  2N9L A;  4ICV A;  4M0W B;  1WR1 A;  5CHV C;  2KMM A;  2WDT B;  3RNA C;  1E6E B;  2K5P A;  3ZLZ A;  2NBU A;  3MC8 A;  4IM0 A;  2WX0 A;  4CHK A;  5IP4 D;  2BPS A;  1B9R A;  5D2M B;  4RGT A;  3HHM A;  4USA A;  4B95 A;  2NR2 A;  2KJH B;  4NJ6 A;  2C7M B;  3ECI A;  1FD6 A;  2IGG A;  2VRR B;  3VDZ A;  2WXH A;  4IWO A;  4ZDV A;  5JHA A;  1JW9 D;  2D2Q A;  4N6E B;  2NS5 A;  1UGJ A;  2J4X A;  3HVD A;  2WXG A;  3RNB C;  3IT6 B;  1P98 A;  4N9F 4;  1V8C A;  1AW7 A;  2ACZ B;  4E3C A;  1STE A;  2OED A;  3DBL I;  4GDK A;  4L23 A;  3SFE B;  4XC2 A;  3PGE A;  5JHB A;  3MC9 A;  1MFW A;  2R2O A;  1ET9 A;  2DZI A;  3ALB A;  4B0M A;  3JVZ X;  1GAQ B;  3QA8 A;  1YN5 A;  1ROE A;  4DXF A;  2LGI A;  1V97 A;  4HDQ A;  5IA7 A;  2K8C A;  3TBL D;  4WJQ A;  1TBE A;  3L54 A;  3DBH B;  4D2K A;  3PLU A;  1X1M A;  4YT0 B;  5LNK 1;  4JQW C;  1MG4 A;  1L4D B;  4GU2 A;  4ANX A;  1YX6 B;  4BOZ B;  1A70 A;  4ICU A;  5IAA C;  2LHE A;  2DNF A;  1E8W A;  3AH7 A;  1MJD A;  1KH0 A;  2BS4 B;  2DYM A;  2ONQ A;  4YSX B;  2V4I B;  2NCN A;  3VR9 B;  3M95 A;  1TS4 A;  3ZRF A;  1IBX B;  3L0W B;  3L17 A;  4TQ1 A;  4XYC A;  2RMM A;  3HIZ A;  3N1X C;  1T6B X;  3PZ8 A;  1XLQ A;  2J7Q B;  2PE9 A;  2KT7 A;  3VRA B;  4A8X C;  4PYU A;  1WZ0 A;  2BBC A;  1XLN A;  4EZK A;  1TS5 A;  1VDV A;  3Q8A A;  2HTM E;  3AXC A;  4OZA A;  3QAR A;  4A55 A;  1D5X C;  2LXC A;  1PGX A;  4L1B A;  3RPF C;  2Y5P A;  4FJV B;  1TYG B;  2BWE S;  4GGQ A;  2O2V B;  1L6V A;  2L3Z A;  4DXG A;  5L83 A;  3J9C A;  1T0R C;  2QEJ C;  4CQN A;  1P7F A;  2PTL A;  4MSQ B;  1H8C A;  2LEK A;  3KUC B;  3N20 C;  4KDI C;  1EU3 A;  3A4S C;  3R66 C;  4TV3 A;  2J0J A;  1N6Z A;  4FJY A;  1SIJ A;  2JUO A;  2XK5 B;  2SAK A;  2MEK A;  2ZNV B;  1SJE D;  2MLB A;  3MHS D;  3RZW C;  2PLP A;  2QIL A;  2J52 A;  2QHO A;  3H7P A;  1TJE A;  4ITK A;  4WJO A;  2MBE A;  1ZP0 B;  1I4H A;  2CKH B;  5IN7 A;  4HDO A;  2Z0D B;  3V60 A;  5D6J B;  3NZ3 A;  1OQY A;  1EU4 A;  3EEC A;  4OVV A;  3GE8 C;  4KGR A;  2VZK B;  2BS3 B;  4OW0 A;  4PS3 A;  2DAJ A;  2W9N A;  4ZRP A;  3P4S B;  4WUR A;  4M0W A;  1ZXH A;  2RDH A;  1WJU A;  2ON8 A;  4MGY E;  3Q8E A;  3FKY A;  3EA6 A;  2MQJ A;  1EUV B;  1PGB A;  2UYZ B;  1HTQ A;  3IAS 1;  3O13 A;  4KZC A;  3PRE A;  4N58 A;  2PEA A;  1FPY A;  2DBY A;  1N62 A;  2A5U A;  2JPH A;  1YQ4 B;  5GXG B;  4KVG B;  4WQO B;  1N63 A;  4MJS B;  2Y5C A;  2KKC A;  2LD9 A;  2I1J A;  1P1A A;  4G3X B;  4A20 A;  3HM3 A;  4ZHP A;  4K7S A;  2NVU I;  3NHE B;  1JQ4 A;  1JWB D;  1UF0 A;  2LGY A;  1OGW A;  3MJ5 A;  2INN E;  2CJN A;  3A9K B;  1WGY A;  1SB3 C;  2L0T A;  3H9D A;  2JWU A;  3DHG C;  4EZJ A;  2EMT A;  2R2Q A;  1HA5 A;  4MSM B;  4XX5 A;  2J0K A;  4B6W A;  4WAA A;  1I4P A;  2DYB A;  3RNE C;  2FIF A;  3ZXR A;  3UQB A;  4C4V B;  4HKZ E;  1RYJ A;  2AL6 A;  2JRI B;  1NVI D;  3QK0 A;  2N7J A;  1WJ4 A;  1V1P B;  1I4G A;  1AYF A;  3DBR B;  1KLV A;  2BS2 B;  2KDI A;  2M19 A;  4WWM A;  2ZW1 A;  5JZE B;  5HI1 A;  4K7U A;  3EC8 A;  2G9H D;  1I4X A;  4HWI B;  2CJO A;  1FFU A;  3AE4 B;  4MDK E;  3N1Z C;  2UU7 A;  1L0Y B;  2AQ3 B;  3BZD B;  3R2I A;  4IM3 A;  2MJD A;  1V1O A;  2NBW B;  3MHZ A;  3AE3 B;  3Q3N C;  2NMQ A;  4OZB A;  1FXA A;  2DZJ A;  3AN1 A;  5EE9 A;  1MPE A;  1D6E C;  3UGB B;  1RAX A;  3CF6 E;  2KDB A;  1WFY A;  3B0A A;  2O6V A;  1K51 A;  4HPL B;  3R7Q A;  2C7N B;  1XXG A;  2Z8L A;  1KJT A;  1E8Z A;  2D5G A;  2HD5 B;  4TQ0 A;  4JIO U;  2K25 A;  3VRB B;  2NPT A;  4JX1 C;  3DQV A;  3WA0 A;  2WNM A;  2QDF A;  1E10 A;  4LNI A;  5LLI A;  3CST A;  4WWN A;  1PGA A;  4LNN A;  2WLB A;  1PQS A;  2KNB A;  1ZOY B;  3ML8 A;  3C0R B;  2DHZ A;  2B76 B;  4C56 C;  4XE0 A;  2KXJ A;  1F2R C;  2BYF A;  2K22 A;  3OAW A;  1XQQ A;  2OJR A;  2W3S A;  2DYO A;  3PLV A;  3A9J B;  1U4A A;  2ZJD A;  5D3I B;  3ETR A;  3DBR I;  1HTO A;  3AEB B;  1SXT A;  2YLM A;  2KOX A;  3EFC A;  2XNA C;  2WU2 B; 
#chains in the Genus database with same CATH homology
 4WQM A;  2L1A A;  3C8Y A;  1WWT A;  4J3O D;  3U2S C;  3AE9 B;  4HRO A;  4B0E A;  1C79 A;  3T3O A;  3NS1 A;  4H2A A;  1FCL A;  3UI3 A;  1FRR A;  3P1M A;  1I4R A;  2LJI A;  4Q2J A;  1DOI A;  4FXC A;  3AEC B;  2E3T A;  1HQR D;  1R7S A;  1QLB B;  1HXY D;  2JSV X;  1KLG D;  1TS2 A;  2JU6 X;  4MAC A;  1L4Z B;  1BML C;  2WXP A;  3SR6 A;  1ET6 A;  1QIL A;  2N9L A;  4WH4 A;  3T3N A;  2KMM A;  3I9V 1;  4KX6 B;  3MFG A;  1J7A A;  1E6E B;  2IDY A;  3U7Z A;  2K5P A;  1T3Q A;  4HJG E;  5JXV A;  1FM0 D;  1UUP A;  2K3U A;  1WRI A;  4WAF A;  1C77 A;  1ENF A;  2IGD A;  1B9R A;  3EGR A;  1N60 A;  5MPO A;  3EUB 2;  4RGT A;  3Q69 A;  2KQ4 X;  1FMA D;  4USA A;  3L4P A;  2MJE A;  1VZ6 A;  1SSN A;  1FD6 A;  2IGG A;  2GRI A;  2H88 B;  1E7P B;  2AX5 A;  2W54 A;  2WXH A;  1XLP A;  1JW9 D;  4NAM A;  4KGS A;  5AUK A;  4N6E B;  2WXO A;  3LB8 C;  2QJL A;  1JWS D;  1UGJ A;  3AE5 B;  2J4X A;  1NEK B;  3HVD A;  3TEX A;  2WXG A;  4NAW B;  3IT6 B;  1M4V A;  1TZO A;  2IJ0 A;  3NVW A;  1TKE A;  2WXK A;  3NVV A;  1V8C A;  1AW7 A;  2ACZ B;  4ZYS A;  1STE A;  1XLO A;  2OED A;  4L23 A;  3BVZ A;  3SFE B;  3IAM 1;  1F77 A;  4MH8 A;  1T5X D;  1CZP A;  1ET9 A;  4B0M A;  1KRH A;  2W82 A;  2FE8 A;  2VZK D;  3WCQ A;  2H89 B;  1K52 A;  1XF5 L;  1GAQ B;  2IPK D;  2WU5 B;  2E6X A;  1YN5 A;  1ROE A;  4EE2 A;  1MI0 A;  2JZP A;  4DXF A;  2LGI A;  1V97 A;  1QOA A;  3GB1 A;  3NUH B;  2PVO D;  2HDE A;  5FKA C;  2I38 A;  2PMV A;  1N5W A;  4WIP A;  3FAH A;  2Y3A A;  4OZC A;  5BMG A;  2Q5W D;  4D2K A;  2WXJ A;  4NZL B;  2WXM A;  1EWC A;  1HZ6 A;  4YT0 B;  5LNK 1;  2BT6 A;  2ZW0 A;  3ABV B;  1L4D B;  2PIA A;  4YSY B;  4LLG M;  1A70 A;  2KAJ A;  3B2F A;  1SE2 A;  1ZDX A;  2LHE A;  3B2G A;  4GDL B;  2WXL A;  3AH7 A;  1V1P A;  3ZGZ A;  1L0X B;  5HFY A;  3P4Q B;  1E0Z A;  1KH0 A;  2BS4 B;  2DYM A;  1BXT A;  1HZ5 A;  1YN3 A;  2ONQ A;  4YSX B;  2V4I B;  3VR9 B;  1HEZ E;  1FRD A;  1TS4 A;  1IBX B;  1D5M C;  3P4P B;  1ZE3 D;  3U4E G;  4TQ1 A;  2RMM A;  1CJE A;  1GOZ A;  1T6B X;  1CQV A;  4IDI A;  1PYW D;  3PZ8 A;  1XLQ A;  2PKO A;  4RGO S;  3VRA B;  4A8X C;  1E9M A;  2WXF A;  5HHD G;  2ICI A;  4XWW A;  1NYR A;  2BBC A;  2TSS A;  2WDV B;  3W5V B;  1XLN A;  4MT5 A;  1K50 A;  1D5Z C;  1OQR A;  4IKG A;  1JML A;  4UDU C;  1TS5 A;  1VDV A;  2G1E A;  3Q8A A;  4RNA A;  2HTM E;  1KLU D;  2RDG A;  4OHJ A;  4OZA A;  4MM3 B;  4ZHO A;  4A55 A;  1D5X C;  1FCC C;  1ZXI A;  3R2T A;  3ZQ4 A;  3N9Y C;  4JPS A;  1PGX A;  4L1B A;  4YTP B;  1FEH A;  1QOG A;  3RPF C;  4JWS C;  1UWM A;  2Y5P A;  1EWY C;  5EE1 A;  4RF0 A;  2JYT A;  5TSS A;  1QT9 A;  1TYG B;  2PVG C;  2NTT A;  4XWT A;  3B9J A;  4O1N A;  5E6J A;  2L83 A;  1OFF A;  4YTM B;  4DXG A;  1L6V A;  3BVG A;  1YNT E;  2AQ2 B;  2KAC A;  3J9C A;  1VZ8 A;  2BB5 A;  2JX5 A;  2QEJ C;  4CQN A;  3BK1 A;  1P7F A;  2PTL A;  1Y56 A;  2LEK A;  1QOB A;  2R61 A;  2J53 A;  4YSZ B;  3AE1 B;  4ZRQ A;  1EU3 A;  1ZPS A;  4XDC A;  1ACC A;  3PZ7 A;  5C3J B;  4RGN A;  4YWG G;  4GLS C;  1XEE A;  1L0V B;  3VR8 B;  1SIJ A;  5BMH A;  2SAK A;  2MH7 A;  2MEK A;  1SJH D;  1J7C A;  1VLB A;  1LO5 D;  3HVZ A;  1SJE D;  4KGT A;  3AEF B;  2PLP A;  2K9X A;  3TSS A;  2QIL A;  4HRS A;  2J52 A;  4P6V F;  1DYQ A;  4C7Z A;  1TJE A;  3DWM A;  4ITK A;  1ZP0 B;  1I4H A;  2DWQ A;  2W3R A;  4NJC A;  1BUI C;  5BYQ A;  1UWX A;  1WYG A;  1NI3 A;  1C4C A;  2J42 A;  3NZ3 A;  1GPX A;  4HKQ A;  3I57 A;  1EU4 A;  3E56 A;  1ESF A;  3IT4 B;  2M0A A;  2RPV A;  4KGR A;  2VZK B;  2BS3 B;  3BYT B;  5T8I A;  3W5U B;  4OW0 A;  1FNU A;  2WS3 B;  1GB4 A;  1PDX A;  1IBX A;  2KWD A;  1DOY A;  4ZRP A;  2LHD A;  3P4S B;  2L32 A;  4WUR A;  4JE3 B;  4ARC A;  2DLB A;  1D4B A;  1SEB D;  3AED B;  4M0W A;  1ZXH A;  2RDH A;  4C80 A;  2ON8 A;  3IXS A;  3Q8E A;  3NVZ A;  3EA6 A;  3P42 A;  1PGB A;  3HUI A;  2GB1 A;  4R3D A;  3VQI A;  3IAS 1;  1IUE A;  1VR9 A;  3O13 A;  2JQR B;  1B1Z A;  1ZDV A;  1RFK A;  3AMZ A;  4N58 A;  4XDD A;  2DBY A;  2V3N A;  2WQY B;  1N62 A;  3OWE B;  1C4P A;  1KTK A;  2QMT A;  1YQ4 B;  5GXG B;  1C9F A;  1PUT A;  2WXR A;  3AV8 A;  2WDQ B;  1N63 A;  1OQQ A;  1FNW A;  2CU3 A;  2YEP F;  1MHX A;  2Y5C A;  1MVK A;  4GDK B;  3MP9 A;  5G5G A;  3AE7 B;  2EKI A;  3AE8 B;  2BTE A;  4ZHP A;  1C4A A;  2KN4 A;  2GI9 A;  4JWU C;  1JWM D;  2BW2 A;  3ZYY X;  1JQ4 A;  2XN9 C;  2FUG 1;  1JWB D;  1IGD A;  1VZ7 A;  1PFD A;  1GB1 A;  1L5P A;  5BMI A;  1TY2 A;  2N0S B;  3W2D A;  2SEB D;  3MJ5 A;  4RFB A;  1P7E A;  2INN E;  2CJN A;  5H92 C;  4US8 A;  1NYQ A;  1JRP A;  3LXF A;  1SB3 C;  4RF1 A;  2V0G A;  1EM7 A;  2JWU A;  5D3D A;  1KF6 B;  4LK0 M;  2BB6 A;  1VRA B;  1HA5 A;  3NRZ A;  2KDM A;  1TY0 A;  1FO4 A;  3P63 A;  1N61 A;  1QKZ A;  3AE6 B;  4A90 A;  1I4P A;  5C2T B;  4US9 A;  3BK2 A;  2I2Y A;  1AWD A;  4PT5 A;  1WXQ A;  3TEZ A;  3ZJT A;  4IOI E;  4REZ A;  4AQ7 A;  4HKZ E;  1RM6 C;  4C7Y A;  2INP E;  3CIR B;  1IGC A;  3GS2 A;  1RYJ A;  1WGK A;  1JCK B;  3BWU D;  1NVI D;  1TS3 A;  2N7J A;  1V1P B;  1KFY B;  5G5H A;  1FXI A;  1I4G A;  3NVY A;  3BYY B;  1AYF A;  2N9K A;  2JXT A;  1VJK A;  3V3X A;  3PO0 A;  2BS2 B;  2M19 A;  3URY A;  2X38 A;  3FC4 A;  3ZJU A;  4WWM A;  4OVZ A;  1Q10 A;  2ZW1 A;  1YQ3 B;  2LFI A;  2V3P A;  4ZOH C;  5HI1 A;  1JWA D;  3V05 A;  2OHF A;  1F0Z A;  4AS1 A;  1C76 A;  2QSD A;  2G9H D;  3Q8F A;  3GP7 A;  1I4X A;  2FBW B;  3MC0 B;  1FIQ A;  2CJO A;  1RWS A;  1FFU A;  1XCQ L;  3AE4 B;  1DOX A;  1YJI A;  3E9S A;  1QF6 A;  1L0Y B;  2AQ3 B;  3BVM A;  3BZD B;  3AEA B;  3R2I A;  2MJD A;  1QQR A;  1MHH E;  5BYS A;  1J7B A;  4ARI A;  3FIL B;  1V1O A;  3TEY A;  1I7H A;  3P4R B;  3MHZ A;  3AE3 B;  2WDR B;  4TMA B;  2NMQ A;  3KWV A;  1L6U A;  3HRD D;  4OZB A;  1FXA A;  1F2R I;  3AN1 A;  1N5X A;  2LMC A;  5EE9 A;  4P16 A;  1MPE A;  1D6E C;  5EE0 A;  3KWL A;  1JRO A;  2AQ1 B;  2WP9 B;  1K51 A;  5FK9 C;  3H8H A;  4A9A A;  1I4Q A;  1FFV A;  1SE3 A;  3SEB A;  2WU2 B;  1YJJ A;  5EE3 A;  4TSS A;  1XXG A;  3W9C B;  3R8B A;  2Z8L A;  3AB5 A;  2D5G A;  3TUO A;  4YTN B;  4TQ0 A;  3AM9 A;  3VRB B;  1SBB B;  3W1S A;  2JYE A;  1TKY A;  3BII D;  5I4D A;  4JX1 C;  3Q8C A;  1JAL A;  2WNM A;  3LYY A;  5HG2 A;  1E10 A;  3RFZ B;  1YMH E;  5FR3 A;  4KKJ A;  5BYR A;  1UNS A;  1PGA A;  2PW9 A;  4RCO A;  1K53 A;  2WLB A;  3FIL A;  1NEN B;  3ZJV A;  2K0P A;  1ZOY B;  3AEG B;  3TEW A;  2B76 B;  3SFD B;  1XO3 A;  1WSP A;  2YEP B;  4C56 C;  4XE0 A;  5D7G A;  1F2R C;  2EEL A;  2K22 A;  2QIE B;  4N59 A;  4RH6 A;  5AUI A;  2WXQ A;  4L2Y A;  1QOF A;  2W55 A;  3DWG C;  2W3S A;  3CWI A;  2DYO A;  4RGM A;  1C78 A;  3Q8B A;  2L52 A;  2LUM A;  2WXI A;  4YXD B;  3KLS X;  1JWU D;  5D3I B;  3ETR A;  4A6Q A;  2MJ3 A;  3AE2 B;  4HEA 1;  2M56 B;  4DQO C;  4LTU A;  3KQ4 A;  2WXN A;  2NTS A;  1AN8 A;  3AEB B;  1CK1 A;  1SE4 A;  1SXT A;  1YN4 A;  1ZUD 2;  1TKG A;  1SF0 A;  2IGH A;  2BYT A;  4KKI A;  3U52 E;  5H8Y E;  3AEE B;  1XCT L;  2XNA C;  1FNV A;  1DGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...