2NMUA

Crystal structure of the hypothetical protein from salmonella typhimurium lt2. northeast structural genomics consortium target str127.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
137
structure length
137
Chain Sequence
HNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical protein from Salmonella typhimurium LT2. Northeast Structural Genomics Consortium target StR127.
rcsb
source organism Salmonella typhimurium
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 30
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2nmuA01
4BT2A 2H6LA 4BT5A 2NMUA 4BT7A 3HWUA 4BT6A 2P6YA 3HTNA 1XV2A 2HX0A 4BT3A 2DT4A 4BT4A
chains in the Genus database with same CATH superfamily
5G4VC 5IJ9B 3KJKA 5J2TA 1YHQF 5HY0A 4IHJB 1TUBB 5EAZA 4HNAB 2DYYA 3WGKA 4BW0B 1W3EX 1X52A 1M90H 5LA6A 4B45A 2R751 4X1KB 1ZWZA 4BT4A 4F6RB 1W5BA 5HP7A 1FFXB 2QTPA 3N2GA 1GX1A 3PLAC 3K0TA 3C9TA 3JAWA 1VQ4F 3RYHA 2QI2A 5GANK 3FD5A 3JAMM 3VCZA 3VOAA 4EI9A 1H48A 4O4LA 3LWQC 2RHJA 2HP0A 3JATB 3VYUC 4U39A 1R1MA 1JN1A 3PAFA 3I7TA 3CB2A 5EIBD 5EB0A 5A2QM 2OHWA 1W5AA 4BT6A 2OZBA 3ESJA 5AVMA 1QU9A 3RYIA 1TUBA 1VQ6F 3UT5A 1X7PA 3C9SA 1PXWA 4TZZA 4I55A 3IMPA 2YXZA 4LNUA 3SIUA 2UYKA 1YQNA 2VAPA 4B62A 5FLXM 4F6RA 2ZODA 3E1YA 3VI6A 2DT4A 5GINC 4YJ3A 4BT2A 3HKBA 1JFFA 1SA0B 4O2BA 4WBNB 3E22B 5BMVA 3CCVF 3HKDB 3T80A 3CCEF 1X25A 2RHHA 4BVSA 3RYHB 1IV1A 5CA0B 3B6NA 4R40B 5LXTA 4YJ2A 3F0GA 1VHAA 1H7MA 1X7OA 1IV2A 3U0OA 4O4JA 3CPQA 3RA6A 4BT3A 3CXCF 2HS0A 3CC2F 1YJ9F 3RE3A 1K9MH 3DDNA 1M1KH 2ZAUA 5KX5B 1ODEA 1NJIH 3S06A 2K1SA 3ZP7A 1VQLF 5GONB 4TV9B 4ZHWA 3JCMM 2UYNA 3NK6A 3RYIB 4E6EA 4BVTA 1CN7A 5JCOA 1GO1A 4BY9D 3C9RA 2LBTA 4LNUB 3KJJA 5EO3A 4FFBB 4NQ3A 3LWVC 3HKCB 3LFOA 5GIPC 2AIFA 4DRXA 1SA0A 1K73H 1GO0A 1XRGA 5LP6B 1N8RH 2WALA 3J80M 1OFUA 5JCOC 3HWUA 1Z5WA 3M4SA 3I55F 4X20B 4ZHYB 4O4JB 1VQKF 1XBIA 3J7AR 2L26A 3GHZA 1RQ7A 5IJ9A 5KX5A 1FFXA 2RHOA 2ZF8A 3CG6A 5G4UC 1QAHA 2ALEA 3DC2A 3JAWB 3L7QA 2UYJA 1Q81H 3LDTA 1VQVA 2H6LA 2UYNB 4BVQA 4G4ZA 4X1KA 3WJPA 3CCUF 2P6YA 3LYBA 5EZYB 3VIUA 1SZQA 3G4SF 4PWTA 5LP6C 3MBMA 3FFMA 2VAMA 2GVIA 3JAKA 5IJ0B 4BT7A 4ZHQA 1W59A 2CHSA 1SDSA 2PHNA 3CD6F 3WPWA 1TVKA 3P0ZA 3MCQA 3NVKE 1CK2A 3IKEA 3IR9A 3NK7A 3JATA 5IYZA 2KGWA 2H8EA 2CZWA 3C9UA 3TD3A 3JALA 5CA1B 2AMTA 3OBYA 1JFFB 4ZI7B 3O85A 2LCAA 1K8AH 3CCJF 2GLZA 2QEXF 1KNKA 2CSLA 1Z5VA 3S0HA 2ZVZA 3HKEB 3V7EA 4YJ2B 3TD4A 5IT9M 3OBWA 3ZOPA 1T0AA 3F6MA 5LOVA 3HKBB 4I4TB 3TD5A 5HY2A 3RYFA 2HX0A 1KNJA 3JARA 4IHJA 1OAPA 4XCQA 5GIOC 2VXYA 3VYSC 3EORA 1U40A 2EWCA 1VQ9F 1YJNF 5LA6B 3ON1A 3CCQF 1KC8H 1W581 3K2XA 4BVRA 1UFYA 5JQGA 2QA4F 4ZOLB 4TV8B 3MQWA 3QHDA 1YITF 2LBXA 4G4XA 3HKCA 3OW2F 5HXUA 3CMEF 1Q82H 4TUYB 3E20B 3SIVA 3CYPB 2VGMA 2R6R1 4ZI7A 3IEWA 1VQMF 2Q1XA 2RB9A 3AGKA 1RLGA 5JVDB 1W5FA 2FGYA 2HP0B 3CPWF 4O4IA 2GZLA 2OTMA 2V9YA 3M84A 3WGMA 2Z1FA 4G4YA 1KD1H 4X1YB 4X20A 3CCLF 3G71F 3WGNA 4I4TA 1W40A 2Q1YA 3MDOA 4O2AA 1VQPF 5EWRA 1VQ7F 3VMFB 3RYFB 2MQEA 1T0KB 1QVFF 4C8IA 5J2TB 1RQ2A 3P4EA 3N4ZA 3N4YA 4I50B 3S0WA 2G9IA 2CVLA 1DT9A 4G88A 4RQOA 4ERHA 1DBFA 2LBWA 5FNVA 3IKFA 4O2BB 4WBNA 3E22A 1W5EA 5BMVB 3NVIB 4IIJB 5EYPA 1VQ8F 2HP3A 3QTYA 2FC3A 4TUYA 5CA0A 3F0DA 4ZHQB 4C8GA 4U3JB 3WGJA 3CCSF 3JASA 1TVKB 1JD1A 3D00A 3JVHA 1QVGF 2HS4A 5LYJA 2HQSC 3VOBA 4B46A 3I56F 1W2BF 2KG4A 3CYQA 3K14A 3C8LA 2IQQA 2CHTA 3WJRA 3KIZA 5GAPK 2Z1TA 4O4HA 3ELCA 1FNKA 3IEQA 3G6EF 3LWPC 2OTJF 3FD6A 5ITZB 3GTZA 3ZO8A 2I6RA 2JNBA 3CCRF 2I6DA 1YI2F 2BTQB 5IYZB 2IAFA 2Z01A 3QUWA 5KMGA 2HRYA 3UT5B 1J7HA 1U3PA 3ERNA 3VYTC 3V4DA 4FFBA 4RHAA 3JALB 4NWOB 3HAXD 1XHOA 5MN5A 2AIZP 5CB4A 3FPIA 1YIJF 4YJ3B 5FJ4C 5EYPB 1U3LA 2YYEA 1YJWF 4LCKA 4X1IB 3Q8HA 2Z1UA 5B8FA 2HRUA 3LWRC 3KE1A 3WPXA 4U3JA 2HS3A 5LXTB 4X3MA 4EI8A 4EI7A 5LOVB 5C8YA 4G4WA 2Z1EA 3S0YA 3WJQA 4DXDA 1QD9A 1VH8A 3N2KA 2N48A 4ZOLA 4TV8A 4O4HB 2KTUA 1FNJA 2IG8A 4HNAA 3CCMF 3BYQA 5J2UA 1FSZA 3CC7F 4TV9A 5HY4A 1GZ0A 5JVDA 3V7QA 1W42A 3HJWC 4NUTA 5HWEA 3CC4F 2HVYD 5JQGB 3WGLA 4G4VA 4O4IB 4BT5A 1JY8A 3N2GB 4M8IA 3JAKB 5IJ0A 1XV2A 2ZOVA 5JH7A 2H8CA 4B5CA 3RYCA 2UZHA 4X1IA 2OTLF 1PF5A 3MCAB 1VQOF 4O4LB 5EB1B 4EB6A 2ZVYA 1UI9A 3CMAF 4KWEA 4X1YA 3LWOC 1VK3A 1U43A 1VQ5F 4I55B 4O2AB 5CA1A 3WXMB 1W41A 5FNVB 5HXZA 1W55A 2VGNA 3M1XA 1JJ2F 4C4WC 1NMUB 3D54A 1Q8RA 1KQSF 1CLIA 2CWJA 2W8BC 5J2UB 3FBAA 4I50A 1RA4A 3JASB 3F0FA 2BTOA 1IPAA 4ZHVA 2NMUA 5EZYA 3KHNA 5MN4A 4IIJA 5LYJB 3GYQA 4X3LA 3RA5A 3V3TA 3VO8A 1Q7YH 2BTUA 2KTVA 1RLUA 1COMA 3HKDA 1IV3A 3JARB 5HY1A 5JH7B 1IV4A 1YGYA 3HTNA 1H47A 3RYCB 4C8EA 1W57A 2VAWA 1Q86H 4EB6B 1ONIA 2PMPA 3P10A 5KMGB 3F0EA 5DCVA 3S02A 3S03A 5ITZA 4C82A 3J81M 5GONA 5CB4B 3ZP4A 4C81A 3I3FA 4DRXB 3NMUC 3OONA 5LP6A 2B33A 2RHLA 3LMEA 3D01A 3HKEA 5EIBC 1VQNF 5C8YB 1E7KA 5MN6A 3VTIC 2BO1A 1S72F 1NQ3A 2F9ZC 5HP8A 3R0PA 2CW4A 4ZK7A 3N2KB 3K12A 2UYPA
chains in the Genus database with same CATH topology
4BT2A 2H6LA 4BT5A 2NMUA 4BT7A 3HWUA 4BT6A 2P6YA 3HTNA 1XV2A 2HX0A 4BT3A 2DT4A 4BT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT2 A;  2H6L A;  4BT5 A;  2NMU A;  4BT7 A;  3HWU A;  4BT6 A;  2P6Y A;  3HTN A;  1XV2 A;  2HX0 A;  4BT3 A;  2DT4 A;  4BT4 A; 
#chains in the Genus database with same CATH topology
 5G4V C;  5IJ9 B;  3KJK A;  5J2T A;  1YHQ F;  5HY0 A;  4IHJ B;  1TUB B;  5EAZ A;  4HNA B;  2DYY A;  3WGK A;  4BW0 B;  1W3E X;  1X52 A;  1M90 H;  5LA6 A;  4B45 A;  2R75 1;  4X1K B;  1ZWZ A;  4BT4 A;  4F6R B;  1W5B A;  5HP7 A;  1FFX B;  2QTP A;  3N2G A;  1GX1 A;  3PLA C;  3K0T A;  3C9T A;  3JAW A;  1VQ4 F;  3RYH A;  2QI2 A;  5GAN K;  3FD5 A;  3JAM M;  3VCZ A;  3VOA A;  4EI9 A;  1H48 A;  4O4L A;  3LWQ C;  2RHJ A;  2HP0 A;  3JAT B;  3VYU C;  4U39 A;  1R1M A;  1JN1 A;  3PAF A;  3I7T A;  3CB2 A;  5EIB D;  5EB0 A;  5A2Q M;  2OHW A;  1W5A A;  4BT6 A;  2OZB A;  3ESJ A;  5AVM A;  1QU9 A;  3RYI A;  1TUB A;  1VQ6 F;  3UT5 A;  1X7P A;  3C9S A;  1PXW A;  4TZZ A;  4I55 A;  3IMP A;  2YXZ A;  4LNU A;  3SIU A;  2UYK A;  1YQN A;  2VAP A;  4B62 A;  5FLX M;  4F6R A;  2ZOD A;  3E1Y A;  3VI6 A;  2DT4 A;  5GIN C;  4YJ3 A;  4BT2 A;  3HKB A;  1JFF A;  1SA0 B;  4O2B A;  4WBN B;  3E22 B;  5BMV A;  3CCV F;  3HKD B;  3T80 A;  3CCE F;  1X25 A;  2RHH A;  4BVS A;  3RYH B;  1IV1 A;  5CA0 B;  3B6N A;  4R40 B;  5LXT A;  4YJ2 A;  3F0G A;  1VHA A;  1H7M A;  1X7O A;  1IV2 A;  3U0O A;  4O4J A;  3CPQ A;  3RA6 A;  4BT3 A;  3CXC F;  2HS0 A;  3CC2 F;  1YJ9 F;  3RE3 A;  1K9M H;  3DDN A;  1M1K H;  2ZAU A;  5KX5 B;  1ODE A;  1NJI H;  3S06 A;  2K1S A;  3ZP7 A;  1VQL F;  5GON B;  4TV9 B;  4ZHW A;  3JCM M;  2UYN A;  3NK6 A;  3RYI B;  4E6E A;  4BVT A;  1CN7 A;  5JCO A;  1GO1 A;  4BY9 D;  3C9R A;  2LBT A;  4LNU B;  3KJJ A;  5EO3 A;  4FFB B;  4NQ3 A;  3LWV C;  3HKC B;  3LFO A;  5GIP C;  2AIF A;  4DRX A;  1SA0 A;  1K73 H;  1GO0 A;  1XRG A;  5LP6 B;  1N8R H;  2WAL A;  3J80 M;  1OFU A;  5JCO C;  3HWU A;  1Z5W A;  3M4S A;  3I55 F;  4X20 B;  4ZHY B;  4O4J B;  1VQK F;  1XBI A;  3J7A R;  2L26 A;  3GHZ A;  1RQ7 A;  5IJ9 A;  5KX5 A;  1FFX A;  2RHO A;  2ZF8 A;  3CG6 A;  5G4U C;  1QAH A;  2ALE A;  3DC2 A;  3JAW B;  3L7Q A;  2UYJ A;  1Q81 H;  3LDT A;  1VQV A;  2H6L A;  2UYN B;  4BVQ A;  4G4Z A;  4X1K A;  3WJP A;  3CCU F;  2P6Y A;  3LYB A;  5EZY B;  3VIU A;  1SZQ A;  3G4S F;  4PWT A;  5LP6 C;  3MBM A;  3FFM A;  2VAM A;  2GVI A;  3JAK A;  5IJ0 B;  4BT7 A;  4ZHQ A;  1W59 A;  2CHS A;  1SDS A;  2PHN A;  3CD6 F;  3WPW A;  1TVK A;  3P0Z A;  3MCQ A;  3NVK E;  1CK2 A;  3IKE A;  3IR9 A;  3NK7 A;  3JAT A;  5IYZ A;  2KGW A;  2H8E A;  2CZW A;  3C9U A;  3TD3 A;  3JAL A;  5CA1 B;  2AMT A;  3OBY A;  1JFF B;  4ZI7 B;  3O85 A;  2LCA A;  1K8A H;  3CCJ F;  2GLZ A;  2QEX F;  1KNK A;  2CSL A;  1Z5V A;  3S0H A;  2ZVZ A;  3HKE B;  3V7E A;  4YJ2 B;  3TD4 A;  5IT9 M;  3OBW A;  3ZOP A;  1T0A A;  3F6M A;  5LOV A;  3HKB B;  4I4T B;  3TD5 A;  5HY2 A;  3RYF A;  2HX0 A;  1KNJ A;  3JAR A;  4IHJ A;  1OAP A;  4XCQ A;  5GIO C;  2VXY A;  3VYS C;  3EOR A;  1U40 A;  2EWC A;  1VQ9 F;  1YJN F;  5LA6 B;  3ON1 A;  3CCQ F;  1KC8 H;  1W58 1;  3K2X A;  4BVR A;  1UFY A;  5JQG A;  2QA4 F;  4ZOL B;  4TV8 B;  3MQW A;  3QHD A;  1YIT F;  2LBX A;  4G4X A;  3HKC A;  3OW2 F;  5HXU A;  3CME F;  1Q82 H;  4TUY B;  3E20 B;  3SIV A;  3CYP B;  2VGM A;  2R6R 1;  4ZI7 A;  3IEW A;  1VQM F;  2Q1X A;  2RB9 A;  3AGK A;  1RLG A;  5JVD B;  1W5F A;  2FGY A;  2HP0 B;  3CPW F;  4O4I A;  2GZL A;  2OTM A;  2V9Y A;  3M84 A;  3WGM A;  2Z1F A;  4G4Y A;  1KD1 H;  4X1Y B;  4X20 A;  3CCL F;  3G71 F;  3WGN A;  4I4T A;  1W40 A;  2Q1Y A;  3MDO A;  4O2A A;  1VQP F;  5EWR A;  1VQ7 F;  3VMF B;  3RYF B;  2MQE A;  1T0K B;  1QVF F;  4C8I A;  5J2T B;  1RQ2 A;  3P4E A;  3N4Z A;  3N4Y A;  4I50 B;  3S0W A;  2G9I A;  2CVL A;  1DT9 A;  4G88 A;  4RQO A;  4ERH A;  1DBF A;  2LBW A;  5FNV A;  3IKF A;  4O2B B;  4WBN A;  3E22 A;  1W5E A;  5BMV B;  3NVI B;  4IIJ B;  5EYP A;  1VQ8 F;  2HP3 A;  3QTY A;  2FC3 A;  4TUY A;  5CA0 A;  3F0D A;  4ZHQ B;  4C8G A;  4U3J B;  3WGJ A;  3CCS F;  3JAS A;  1TVK B;  1JD1 A;  3D00 A;  3JVH A;  1QVG F;  2HS4 A;  5LYJ A;  2HQS C;  3VOB A;  4B46 A;  3I56 F;  1W2B F;  2KG4 A;  3CYQ A;  3K14 A;  3C8L A;  2IQQ A;  2CHT A;  3WJR A;  3KIZ A;  5GAP K;  2Z1T A;  4O4H A;  3ELC A;  1FNK A;  3IEQ A;  3G6E F;  3LWP C;  2OTJ F;  3FD6 A;  5ITZ B;  3GTZ A;  3ZO8 A;  2I6R A;  2JNB A;  3CCR F;  2I6D A;  1YI2 F;  2BTQ B;  5IYZ B;  2IAF A;  2Z01 A;  3QUW A;  5KMG A;  2HRY A;  3UT5 B;  1J7H A;  1U3P A;  3ERN A;  3VYT C;  3V4D A;  4FFB A;  4RHA A;  3JAL B;  4NWO B;  3HAX D;  1XHO A;  5MN5 A;  2AIZ P;  5CB4 A;  3FPI A;  1YIJ F;  4YJ3 B;  5FJ4 C;  5EYP B;  1U3L A;  2YYE A;  1YJW F;  4LCK A;  4X1I B;  3Q8H A;  2Z1U A;  5B8F A;  2HRU A;  3LWR C;  3KE1 A;  3WPX A;  4U3J A;  2HS3 A;  5LXT B;  4X3M A;  4EI8 A;  4EI7 A;  5LOV B;  5C8Y A;  4G4W A;  2Z1E A;  3S0Y A;  3WJQ A;  4DXD A;  1QD9 A;  1VH8 A;  3N2K A;  2N48 A;  4ZOL A;  4TV8 A;  4O4H B;  2KTU A;  1FNJ A;  2IG8 A;  4HNA A;  3CCM F;  3BYQ A;  5J2U A;  1FSZ A;  3CC7 F;  4TV9 A;  5HY4 A;  1GZ0 A;  5JVD A;  3V7Q A;  1W42 A;  3HJW C;  4NUT A;  5HWE A;  3CC4 F;  2HVY D;  5JQG B;  3WGL A;  4G4V A;  4O4I B;  4BT5 A;  1JY8 A;  3N2G B;  4M8I A;  3JAK B;  5IJ0 A;  1XV2 A;  2ZOV A;  5JH7 A;  2H8C A;  4B5C A;  3RYC A;  2UZH A;  4X1I A;  2OTL F;  1PF5 A;  3MCA B;  1VQO F;  4O4L B;  5EB1 B;  4EB6 A;  2ZVY A;  1UI9 A;  3CMA F;  4KWE A;  4X1Y A;  3LWO C;  1VK3 A;  1U43 A;  1VQ5 F;  4I55 B;  4O2A B;  5CA1 A;  3WXM B;  1W41 A;  5FNV B;  5HXZ A;  1W55 A;  2VGN A;  3M1X A;  1JJ2 F;  4C4W C;  1NMU B;  3D54 A;  1Q8R A;  1KQS F;  1CLI A;  2CWJ A;  2W8B C;  5J2U B;  3FBA A;  4I50 A;  1RA4 A;  3JAS B;  3F0F A;  2BTO A;  1IPA A;  4ZHV A;  2NMU A;  5EZY A;  3KHN A;  5MN4 A;  4IIJ A;  5LYJ B;  3GYQ A;  4X3L A;  3RA5 A;  3V3T A;  3VO8 A;  1Q7Y H;  2BTU A;  2KTV A;  1RLU A;  1COM A;  3HKD A;  1IV3 A;  3JAR B;  5HY1 A;  5JH7 B;  1IV4 A;  1YGY A;  3HTN A;  1H47 A;  3RYC B;  4C8E A;  1W57 A;  2VAW A;  1Q86 H;  4EB6 B;  1ONI A;  2PMP A;  3P10 A;  5KMG B;  3F0E A;  5DCV A;  3S02 A;  3S03 A;  5ITZ A;  4C82 A;  3J81 M;  5GON A;  5CB4 B;  3ZP4 A;  4C81 A;  3I3F A;  4DRX B;  3NMU C;  3OON A;  5LP6 A;  2B33 A;  2RHL A;  3LME A;  3D01 A;  3HKE A;  5EIB C;  1VQN F;  5C8Y B;  1E7K A;  5MN6 A;  3VTI C;  2BO1 A;  1S72 F;  1NQ3 A;  2F9Z C;  5HP8 A;  3R0P A;  2CW4 A;  4ZK7 A;  3N2K B;  3K12 A;  2UYP A; 
#chains in the Genus database with same CATH homology
 4BT2 A;  2H6L A;  4BT5 A;  2NMU A;  4BT7 A;  3HWU A;  4BT6 A;  2P6Y A;  3HTN A;  1XV2 A;  2HX0 A;  4BT3 A;  2DT4 A;  4BT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...