2NMUA

Crystal structure of the hypothetical protein from salmonella typhimurium lt2. northeast structural genomics consortium target str127.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
137
structure length
137
Chain Sequence
HNASTARFYALRLLPGQEVFSQLHAFVQQNQLRAAWIAGCTGSLTDVALRYAGQEATTSLTGTFEVISLNGTLELTGEHLHLAVSDPYGVMLGGHMMPGCTVRTTLELVIGELPALTFSRQPCAISGYDELHISSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical protein from Salmonella typhimurium LT2. Northeast Structural Genomics Consortium target StR127.
rcsb
source organism Salmonella typhimurium
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
total genus 30
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2nmuA01
3HTNA 2HX0A 2DT4A 3HWUA 2P6YA 4BT3A 4BT4A 4BT2A 4BT6A 2H6LA 4BT5A 1XV2A 4BT7A 2NMUA
chains in the Genus database with same CATH superfamily
1IV4A 3N4YA 3LMEA 1SDSA 3S06A 3WPXA 4ZHQB 4DRXB 3CCUF 2ZODA 3K12A 1W41A 1W5BA 3JATB 3LWPC 4G4VA 4YJ3B 2PMPA 5GANK 1M90H 2QA4F 4O2BA 3VI6A 4WBNB 4G4XA 3CCLF 4FFBA 5LOVA 1XV2A 4YJ3A 3OONA 5C8YA 1H48A 5IYZA 5JCOA 2GZLA 1XRGA 4O2BB 4X20A 2H8CA 2W8BC 4FFBB 1FNKA 4O4IB 3NVKE 3VTIC 4IHJB 1W5AA 3G6EF 1UI9A 4BVTA 1VQKF 3UT5B 3C9SA 3C9UA 3C9TA 2AIFA 1IV2A 1U3PA 4M8IA 3PLAC 3JAKB 4IHJA 5LXTB 1NJIH 3ON1A 4YJ2A 3DDNA 3FD6A 2IG8A 3O85A 1W5FA 5LA6B 3KJKA 3QHDA 5LXTA 3RYHA 3V3TA 2EWCA 3FBAA 5BMVA 3RYCB 2Z1TA 1VQ5F 3HTNA 1VQNF 4NUTA 2OTMA 3LWOC 1S72F 2R751 3K2XA 5LA6A 3D01A 3VYTC 1JJ2F 3WGLA 2HQSC 1RQ2A 3CMEF 2KG4A 4LNUB 4ZHWA 3MBMA 4BVSA 2H8EA 3I56F 5IJ9B 3N2KB 3HWUA 4BY9D 5EYPA 3R0PA 1GX1A 3J80M 2UYKA 2HX0A 2OZBA 5HY2A 4TUYA 5IJ9A 2BTUA 3ESJA 2Z01A 5JH7A 3OBYA 3DC2A 2UZHA 3VYSC 2OHWA 4O4JA 3WJQA 2YXZA 5CB4A 5HY4A 5HWEA 3GYQA 2QI2A 2VGNA 1X52A 4ZOLB 3S0WA 2CWJA 3ERNA 4B5CA 2DT4A 5CB4B 5JCOC 1QD9A 3F0FA 3F6MA 2H6LA 5MN4A 1YQNA 3HKDB 3SIVA 1IV3A 1Z5VA 5MN5A 3T80A 3EORA 1RQ7A 5J2UB 2HP0B 4BT7A 1VQOF 3HKCB 1QU9A 1SZQA 1PXWA 4ZI7B 4BW0B 2CHTA 4IIJB 1Q7YH 2ZVZA 3L7QA 5EZYB 2LBXA 4C8EA 2CHSA 5LP6A 1M1KH 4B45A 3HKCA 3SIUA 2BTQB 4RQOA 1COMA 3IR9A 3RA5A 1YGYA 2GVIA 4BT3A 1JFFA 3ZP4A 1CN7A 4BT4A 5HP7A 1U43A 4C8IA 1SA0B 1W57A 4C82A 2HP3A 5GONB 1JFFB 3E22B 5EIBD 3JASB 3CMAF 3MDOA 5J2TA 3JAWA 2LBWA 5CA0B 5GINC 5GONA 4U3JA 3QTYA 3TD4A 3RYFA 4NWOB 4X3LA 5KX5B 3CPQA 2Q1XA 3VIUA 3N2GB 1H7MA 1GO1A 4X1YB 1W581 2WALA 3CC2F 3JAWB 2KGWA 3CXCF 3B6NA 2MQEA 4EI8A 2HVYD 3CG6A 4U3JB 2PHNA 3C9RA 5EAZA 5KX5A 4O2AB 4O4HA 4PWTA 4F6RB 4C8GA 4X1KA 3P10A 1VQ7F 4O4LA 1H47A 3HKEB 3RYIB 4O4HB 2IAFA 4O2AA 3ZO8A 4ZK7A 3I3FA 4TV9A 4G4YA 4F6RA 3M4SA 4X1KB 4ERHA 3LYBA 1FFXB 1RLUA 1VQLF 5FLXM 1QVFF 3F0EA 4X1IB 3CCSF 3TD3A 1Z5WA 2LBTA 1W5EA 1DT9A 1W55A 1KD1H 5JQGA 3S0HA 1FFXA 3VYUC 2RHLA 2RB9A 2L26A 3ZP7A 5B8FA 1RLGA 3V7EA 3NK6A 3JARB 1CLIA 1YJ9F 1ZWZA 3JAMM 1NMUB 2CW4A 2HS4A 2N48A 1UFYA 2GLZA 1YITF 1ONIA 3LDTA 3G4SF 1TUBA 4HNAA 4X3MA 2Q1YA 1VQ9F 3HKBB 2I6DA 2CSLA 2OTJF 5JVDA 3E1YA 2FGYA 1TUBB 3KIZA 4B62A 2VAPA 5LOVB 2VXYA 4EB6B 2FC3A 5C8YB 3ZOPA 5JVDB 5IYZB 5MN6A 3N4ZA 1IPAA 5FNVA 4DRXA 1QAHA 5GAPK 3IEWA 3F0DA 1W2BF 3Q8HA 3WGJA 4O4IA 3JATA 2AMTA 3F0GA 1NQ3A 2HRYA 5FNVB 2Z1FA 4WBNA 3I55F 3TD5A 1T0KB 3LWVC 3JAKA 3WGNA 3K14A 3G71F 4YJ2B 4ZHYB 1OAPA 3FD5A 4X20B 1XBIA 1T0AA 3S03A 1W59A 3RYHB 5BMVB 3RYCA 1XHOA 2K1SA 2QTPA 4E6EA 1K73H 3AGKA 3CCQF 3UT5A 2HS0A 1K8AH 4ZHVA 3CCVF 3S0YA 3OW2F 3QUWA 4BT2A 1W42A 3J81M 4BT5A 2ALEA 4RHAA 3CD6F 2UYNB 2BTOA 3VO8A 3D00A 1VQ8F 1W40A 3IKFA 5G4VC 1OFUA 3V7QA 1R1MA 5EYPB 5GIOC 1Q86H 2I6RA 3M1XA 1VH8A 2UYNA 3KE1A 2UYJA 5IT9M 2R6R1 5JH7B 1Q81H 2P6YA 1VQ6F 2KTUA 3HJWC 1U3LA 3I7TA 3FFMA 4LNUA 3J7AR 4I55B 3CYPB 2Z1EA 1VK3A 4B46A 5A2QM 3CCMF 3KJJA 1KQSF 3N2KA 3E20B 5GIPC 5EIBC 5IJ0A 5HY0A 1YI2F 4I55A 1X25A 3CB2A 3NK7A 3KHNA 4DXDA 3JVHA 4TUYB 2KTVA 2VGMA 1K9MH 3CCJF 1Q82H 4I50B 1VQMF 5IJ0B 4LCKA 5CA1A 4O4JB 1U40A 3HKDA 3CC4F 4I4TB 5KMGB 1KNKA 2YYEA 3WJPA 5HY1A 5EWRA 2ZF8A 5DCVA 4ZOLA 4I50A 1TVKB 1CK2A 5J2UA 2HP0A 3MCAB 5CA1B 3RA6A 4G4ZA 4I4TA 2HS3A 3OBWA 3VOBA 5KMGA 4ZI7A 3WXMB 4BVRA 3NMUC 4IIJA 3BYQA 1TVKA 2RHHA 4BVQA 5HXUA 3VMFB 3IEQA 4R40B 1YJWF 5LP6B 3GHZA 3IKEA 5LYJA 4XCQA 1N8RH 3LWQC 4C81A 1KC8H 1E7KA 2G9IA 1GZ0A 3FPIA 2VAMA 5LYJB 1KNJA 3CYQA 4NQ3A 3K0TA 3WJRA 1JY8A 1VQPF 3JASA 5EZYA 2ZVYA 3JCMM 2NMUA 3MQWA 3VOAA 1FNJA 2HRUA 3WPWA 3V4DA 1PF5A 1VQVA 2BO1A 2VAWA 2DYYA 1GO0A 2QEXF 3RE3A 1SA0A 4BT6A 4X1YA 2CZWA 3E22A 2JNBA 2CVLA 3CCEF 2UYPA 4EI7A 5J2TB 4TV8B 2RHJA 2ZAUA 3CCRF 5EO3A 5CA0A 1VQ4F 5G4UC 1IV1A 5HP8A 3U0OA 3C8LA 3HKEA 1X7OA 2IQQA 1VHAA 3P4EA 3RYFB 5FJ4C 3M84A 3RYIA 3CC7F 1DBFA 3ELCA 3D54A 3N2GA 3WGKA 4TV9B 4TV8A 5LP6C 2AIZP 4X1IA 3IMPA 2F9ZC 5EB0A 3HAXD 3LFOA 1FSZA 4G88A 2OTLF 1QVGF 1Q8RA 4G4WA 1JD1A 3GTZA 4O4LB 4TZZA 1ODEA 3JALA 3JARA 5AVMA 4C4WC 3MCQA 2B33A 3P0ZA 1YIJF 2LCAA 3WGMA 2ZOVA 1W3EX 2RHOA 3JALB 4HNAB 2Z1UA 5JQGB 5ITZA 1YHQF 1JN1A 2V9YA 5HXZA 3HKBA 3NVIB 3PAFA 1X7PA 4KWEA 4U39A 1RA4A 4ZHQA 3S02A 3LWRC 4EI9A 1J7HA 3VCZA 3CPWF 1YJNF 5ITZB 5EB1B 4EB6A
chains in the Genus database with same CATH topology
3HTNA 2HX0A 2DT4A 3HWUA 2P6YA 4BT3A 4BT4A 4BT2A 4BT6A 2H6LA 4BT5A 1XV2A 4BT7A 2NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTN A;  2HX0 A;  2DT4 A;  3HWU A;  2P6Y A;  4BT3 A;  4BT4 A;  4BT2 A;  4BT6 A;  2H6L A;  4BT5 A;  1XV2 A;  4BT7 A;  2NMU A; 
#chains in the Genus database with same CATH topology
 1IV4 A;  3N4Y A;  3LME A;  1SDS A;  3S06 A;  3WPX A;  4ZHQ B;  4DRX B;  3CCU F;  2ZOD A;  3K12 A;  1W41 A;  1W5B A;  3JAT B;  3LWP C;  4G4V A;  4YJ3 B;  2PMP A;  5GAN K;  1M90 H;  2QA4 F;  4O2B A;  3VI6 A;  4WBN B;  4G4X A;  3CCL F;  4FFB A;  5LOV A;  1XV2 A;  4YJ3 A;  3OON A;  5C8Y A;  1H48 A;  5IYZ A;  5JCO A;  2GZL A;  1XRG A;  4O2B B;  4X20 A;  2H8C A;  2W8B C;  4FFB B;  1FNK A;  4O4I B;  3NVK E;  3VTI C;  4IHJ B;  1W5A A;  3G6E F;  1UI9 A;  4BVT A;  1VQK F;  3UT5 B;  3C9S A;  3C9U A;  3C9T A;  2AIF A;  1IV2 A;  1U3P A;  4M8I A;  3PLA C;  3JAK B;  4IHJ A;  5LXT B;  1NJI H;  3ON1 A;  4YJ2 A;  3DDN A;  3FD6 A;  2IG8 A;  3O85 A;  1W5F A;  5LA6 B;  3KJK A;  3QHD A;  5LXT A;  3RYH A;  3V3T A;  2EWC A;  3FBA A;  5BMV A;  3RYC B;  2Z1T A;  1VQ5 F;  3HTN A;  1VQN F;  4NUT A;  2OTM A;  3LWO C;  1S72 F;  2R75 1;  3K2X A;  5LA6 A;  3D01 A;  3VYT C;  1JJ2 F;  3WGL A;  2HQS C;  1RQ2 A;  3CME F;  2KG4 A;  4LNU B;  4ZHW A;  3MBM A;  4BVS A;  2H8E A;  3I56 F;  5IJ9 B;  3N2K B;  3HWU A;  4BY9 D;  5EYP A;  3R0P A;  1GX1 A;  3J80 M;  2UYK A;  2HX0 A;  2OZB A;  5HY2 A;  4TUY A;  5IJ9 A;  2BTU A;  3ESJ A;  2Z01 A;  5JH7 A;  3OBY A;  3DC2 A;  2UZH A;  3VYS C;  2OHW A;  4O4J A;  3WJQ A;  2YXZ A;  5CB4 A;  5HY4 A;  5HWE A;  3GYQ A;  2QI2 A;  2VGN A;  1X52 A;  4ZOL B;  3S0W A;  2CWJ A;  3ERN A;  4B5C A;  2DT4 A;  5CB4 B;  5JCO C;  1QD9 A;  3F0F A;  3F6M A;  2H6L A;  5MN4 A;  1YQN A;  3HKD B;  3SIV A;  1IV3 A;  1Z5V A;  5MN5 A;  3T80 A;  3EOR A;  1RQ7 A;  5J2U B;  2HP0 B;  4BT7 A;  1VQO F;  3HKC B;  1QU9 A;  1SZQ A;  1PXW A;  4ZI7 B;  4BW0 B;  2CHT A;  4IIJ B;  1Q7Y H;  2ZVZ A;  3L7Q A;  5EZY B;  2LBX A;  4C8E A;  2CHS A;  5LP6 A;  1M1K H;  4B45 A;  3HKC A;  3SIU A;  2BTQ B;  4RQO A;  1COM A;  3IR9 A;  3RA5 A;  1YGY A;  2GVI A;  4BT3 A;  1JFF A;  3ZP4 A;  1CN7 A;  4BT4 A;  5HP7 A;  1U43 A;  4C8I A;  1SA0 B;  1W57 A;  4C82 A;  2HP3 A;  5GON B;  1JFF B;  3E22 B;  5EIB D;  3JAS B;  3CMA F;  3MDO A;  5J2T A;  3JAW A;  2LBW A;  5CA0 B;  5GIN C;  5GON A;  4U3J A;  3QTY A;  3TD4 A;  3RYF A;  4NWO B;  4X3L A;  5KX5 B;  3CPQ A;  2Q1X A;  3VIU A;  3N2G B;  1H7M A;  1GO1 A;  4X1Y B;  1W58 1;  2WAL A;  3CC2 F;  3JAW B;  2KGW A;  3CXC F;  3B6N A;  2MQE A;  4EI8 A;  2HVY D;  3CG6 A;  4U3J B;  2PHN A;  3C9R A;  5EAZ A;  5KX5 A;  4O2A B;  4O4H A;  4PWT A;  4F6R B;  4C8G A;  4X1K A;  3P10 A;  1VQ7 F;  4O4L A;  1H47 A;  3HKE B;  3RYI B;  4O4H B;  2IAF A;  4O2A A;  3ZO8 A;  4ZK7 A;  3I3F A;  4TV9 A;  4G4Y A;  4F6R A;  3M4S A;  4X1K B;  4ERH A;  3LYB A;  1FFX B;  1RLU A;  1VQL F;  5FLX M;  1QVF F;  3F0E A;  4X1I B;  3CCS F;  3TD3 A;  1Z5W A;  2LBT A;  1W5E A;  1DT9 A;  1W55 A;  1KD1 H;  5JQG A;  3S0H A;  1FFX A;  3VYU C;  2RHL A;  2RB9 A;  2L26 A;  3ZP7 A;  5B8F A;  1RLG A;  3V7E A;  3NK6 A;  3JAR B;  1CLI A;  1YJ9 F;  1ZWZ A;  3JAM M;  1NMU B;  2CW4 A;  2HS4 A;  2N48 A;  1UFY A;  2GLZ A;  1YIT F;  1ONI A;  3LDT A;  3G4S F;  1TUB A;  4HNA A;  4X3M A;  2Q1Y A;  1VQ9 F;  3HKB B;  2I6D A;  2CSL A;  2OTJ F;  5JVD A;  3E1Y A;  2FGY A;  1TUB B;  3KIZ A;  4B62 A;  2VAP A;  5LOV B;  2VXY A;  4EB6 B;  2FC3 A;  5C8Y B;  3ZOP A;  5JVD B;  5IYZ B;  5MN6 A;  3N4Z A;  1IPA A;  5FNV A;  4DRX A;  1QAH A;  5GAP K;  3IEW A;  3F0D A;  1W2B F;  3Q8H A;  3WGJ A;  4O4I A;  3JAT A;  2AMT A;  3F0G A;  1NQ3 A;  2HRY A;  5FNV B;  2Z1F A;  4WBN A;  3I55 F;  3TD5 A;  1T0K B;  3LWV C;  3JAK A;  3WGN A;  3K14 A;  3G71 F;  4YJ2 B;  4ZHY B;  1OAP A;  3FD5 A;  4X20 B;  1XBI A;  1T0A A;  3S03 A;  1W59 A;  3RYH B;  5BMV B;  3RYC A;  1XHO A;  2K1S A;  2QTP A;  4E6E A;  1K73 H;  3AGK A;  3CCQ F;  3UT5 A;  2HS0 A;  1K8A H;  4ZHV A;  3CCV F;  3S0Y A;  3OW2 F;  3QUW A;  4BT2 A;  1W42 A;  3J81 M;  4BT5 A;  2ALE A;  4RHA A;  3CD6 F;  2UYN B;  2BTO A;  3VO8 A;  3D00 A;  1VQ8 F;  1W40 A;  3IKF A;  5G4V C;  1OFU A;  3V7Q A;  1R1M A;  5EYP B;  5GIO C;  1Q86 H;  2I6R A;  3M1X A;  1VH8 A;  2UYN A;  3KE1 A;  2UYJ A;  5IT9 M;  2R6R 1;  5JH7 B;  1Q81 H;  2P6Y A;  1VQ6 F;  2KTU A;  3HJW C;  1U3L A;  3I7T A;  3FFM A;  4LNU A;  3J7A R;  4I55 B;  3CYP B;  2Z1E A;  1VK3 A;  4B46 A;  5A2Q M;  3CCM F;  3KJJ A;  1KQS F;  3N2K A;  3E20 B;  5GIP C;  5EIB C;  5IJ0 A;  5HY0 A;  1YI2 F;  4I55 A;  1X25 A;  3CB2 A;  3NK7 A;  3KHN A;  4DXD A;  3JVH A;  4TUY B;  2KTV A;  2VGM A;  1K9M H;  3CCJ F;  1Q82 H;  4I50 B;  1VQM F;  5IJ0 B;  4LCK A;  5CA1 A;  4O4J B;  1U40 A;  3HKD A;  3CC4 F;  4I4T B;  5KMG B;  1KNK A;  2YYE A;  3WJP A;  5HY1 A;  5EWR A;  2ZF8 A;  5DCV A;  4ZOL A;  4I50 A;  1TVK B;  1CK2 A;  5J2U A;  2HP0 A;  3MCA B;  5CA1 B;  3RA6 A;  4G4Z A;  4I4T A;  2HS3 A;  3OBW A;  3VOB A;  5KMG A;  4ZI7 A;  3WXM B;  4BVR A;  3NMU C;  4IIJ A;  3BYQ A;  1TVK A;  2RHH A;  4BVQ A;  5HXU A;  3VMF B;  3IEQ A;  4R40 B;  1YJW F;  5LP6 B;  3GHZ A;  3IKE A;  5LYJ A;  4XCQ A;  1N8R H;  3LWQ C;  4C81 A;  1KC8 H;  1E7K A;  2G9I A;  1GZ0 A;  3FPI A;  2VAM A;  5LYJ B;  1KNJ A;  3CYQ A;  4NQ3 A;  3K0T A;  3WJR A;  1JY8 A;  1VQP F;  3JAS A;  5EZY A;  2ZVY A;  3JCM M;  2NMU A;  3MQW A;  3VOA A;  1FNJ A;  2HRU A;  3WPW A;  3V4D A;  1PF5 A;  1VQV A;  2BO1 A;  2VAW A;  2DYY A;  1GO0 A;  2QEX F;  3RE3 A;  1SA0 A;  4BT6 A;  4X1Y A;  2CZW A;  3E22 A;  2JNB A;  2CVL A;  3CCE F;  2UYP A;  4EI7 A;  5J2T B;  4TV8 B;  2RHJ A;  2ZAU A;  3CCR F;  5EO3 A;  5CA0 A;  1VQ4 F;  5G4U C;  1IV1 A;  5HP8 A;  3U0O A;  3C8L A;  3HKE A;  1X7O A;  2IQQ A;  1VHA A;  3P4E A;  3RYF B;  5FJ4 C;  3M84 A;  3RYI A;  3CC7 F;  1DBF A;  3ELC A;  3D54 A;  3N2G A;  3WGK A;  4TV9 B;  4TV8 A;  5LP6 C;  2AIZ P;  4X1I A;  3IMP A;  2F9Z C;  5EB0 A;  3HAX D;  3LFO A;  1FSZ A;  4G88 A;  2OTL F;  1QVG F;  1Q8R A;  4G4W A;  1JD1 A;  3GTZ A;  4O4L B;  4TZZ A;  1ODE A;  3JAL A;  3JAR A;  5AVM A;  4C4W C;  3MCQ A;  2B33 A;  3P0Z A;  1YIJ F;  2LCA A;  3WGM A;  2ZOV A;  1W3E X;  2RHO A;  3JAL B;  4HNA B;  2Z1U A;  5JQG B;  5ITZ A;  1YHQ F;  1JN1 A;  2V9Y A;  5HXZ A;  3HKB A;  3NVI B;  3PAF A;  1X7P A;  4KWE A;  4U39 A;  1RA4 A;  4ZHQ A;  3S02 A;  3LWR C;  4EI9 A;  1J7H A;  3VCZ A;  3CPW F;  1YJN F;  5ITZ B;  5EB1 B;  4EB6 A; 
#chains in the Genus database with same CATH homology
 3HTN A;  2HX0 A;  2DT4 A;  3HWU A;  2P6Y A;  4BT3 A;  4BT4 A;  4BT2 A;  4BT6 A;  2H6L A;  4BT5 A;  1XV2 A;  4BT7 A;  2NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...