2NMVA

Damage detection by the uvrabc pathway: crystal structure of uvrb bound to fluorescein-adducted dna
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
Knots found
sequence length
652
structure length
620
Chain Sequence
DRFELVKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Damage detection by the UvrABC pathway: crystal structure of UvrB bound to fluorescein-adducted DNA
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
total genus 224
structure length 620
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2nmvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA01
4TLDA 4A0GA 3VKWA 3WMFA 1BMFA 4CEIA 2NO6A 3R9IA 1H8EA 4KO8A 5CYOA 3ZDQA 4OK6A 1SVIA 4EPVA 3AVPA 3SJAA 4IDHA 2H16A 4Z1MA 1YZQA 2JLWA 5FOTA 2FEMA 2QSYA 3I3SR 1B0UA 1LNZA 1UADA 2G1KA 4NYIR 4Q47A 3PEWA 5EZ5A 1KO8A 2ZSAA 2MMCA 1T4GA 2JLVA 2N42A 2QRZA 4HB3A 4RCZA 2ZROA 3QXJA 4QM6A 2WPDD 3QQ5A 3Q5DA 1FMJA 1UFQA 2GK7A 3AF3A 4PAQA 3PIRA 4F93B 3LX5A 1FX0A 4TLAA 2WZQA 2RHDA 1XD9A 5CDFA 3B85A 3SJCA 2P6NA 4IKEA 4MUAA 4BLOA 4IVPA 1SULA 2V54A 3Q7QA 2NO1A 4B3CA 1Q3HA 5CM9C 1G3MA 3V00A 4HAUA 1HYQA 2GVZC 2Y8EA 2JATA 2X8AA 1Z47A 5ELXA 1Q1ZA 1G8PA 2QENA 4JKYA 3OE7D 4W7SA 3NHAA 3OEEA 4M9XA 5H68A 3NEJA 2ZJBA 1N0UA 2FWRA 2ECKA 2GDJA 3BAFA 3SHWA 3WYAA 4XOIA 2D7DA 2IS1A 1E9EA 4FI3C 2VHJA 4PC3A 1KDOA 1NN3A 4U5XA 1AZSC 4JLPA 5DN6A 2ZS7A 1MABB 4G5OA 1MRNA 4NL4H 3AQ4A 1NSTA 3PJRA 1U0HC 1FUKA 2LCFA 1GP2A 4DBLC 4HB4A 2RKOA 3VR3A 2Q9CA 4BFWA 1D9XA 2FX3A 5FI1B 1SQ5A 1U0LA 1Z6TA 3QKTA 3M4YA 4DLTA 2YWHA 2Q21A 1KGDA 4OQNA 2XXAB 1YE8A 5AJXA 1T0JB 3UWOA 3EARA 2BKEA 3UMSA 3OIVA 121PA 4ESVA 1G3UA 1W5SA 4OJKA 2D2EA 1JQJC 2QEQA 4Q48A 1EXMA 2D2FA 1V5WA 3I62A 3AF2A 1DAKA 3LVRE 4U02A 1O87A 1W0JD 4LYAA 4D0LB 2ZRLA 3OESA 4TYPA 3GLGA 2C2HA 3CIOA 4GP6A 4HUQB 4K8OA 4XVRA 2QAJA 1TF7A 3X1ZA 4L16A 3TUIC 4H9GA 5HCIA 4FN5A 4AI6A 2YWGA 2IC5A 4FXPA 1WCV1 2F1IA 2R8RA 2WWIA 2VHCA 1S3GA 3HYTA 1NY6A 2C9CA 3T61A 1NN5A 4MGIR 1VG9B 4Q9KA 1DOAA 1E0AA 2FE4A 2WSMA 3EASA 4I1UA 4RZXA 4MYHA 3HU3A 2J3EA 3W6OA 2IBMA 2Z4SA 4RD2A 4LYFA 1E94E 4O2LA 4YMTA 2JJ2A 2EWVA 2LWIA 4JLAA 5KOYA 3GLHA 1CP2A 3DM5A 3MRSA 3TMKA 4LX0A 1XRJA 4NONA 1LFDB 2A7QA 2R62A 4BRWA 2FSGA 2GNOA 5CB8A 3U60B 3AVVA 1J7KA 2BM1A 4LI0A 3ZZ0A 1M6NA 3W5JA 2GXQA 3A4NA 1R0YA 3FGNA 1XU4A 4HAYA 3SHFA 2GXSA 2FOLA 1Q44A 4G01B 4AK9A 1W36C 3SEAA 4KI0A 2NZJA 1ZMXA 4XWAA 1N5IA 2BHRA 2ZU0C 4A8JB 4YMUA 1E2IA 2VP2A 3U3OA 1G7RA 2WV9A 1E79D 3Q3JB 2QROA 4MKHA 4GI7A 4TN1A 3B1XA 1F60A 4ZDKA 3ADDA 2JEOA 4P0TA 1KK1A 4QJ4A 4BUJA 3THYA 3TSOA 3BERA 3DVLA 1E32A 1DTSA 2B8WA 3QXXA 3S1AA 5E95A 1TQ6A 4HATA 1F6BA 4M21A 4LJ6A 2QAGB 4PR0A 4C0LA 2VHUA 3QG5A 4JSYA 2QQEA 2HXYA 2H7VA 3GLFB 2J5XA 4BZPA 1KMQA 4TL7A 1WRBA 1W49A 3ND8A 1B23P 3OAAD 5L8VA 1CU1A 2JLSA 5AK0A 1N5KA 4LJ7A 2P5TB 4CW7A 1XD8A 4B6EA 5AJYA 2O8BB 1W2HA 2QPTA 3AUYA 1E4YA 2XB2A 2JA1A 3V4FA 1KYIA 1FUUA 3VR6A 3FE2A 4D25A 3GJ0A 2VF7A 4JVNA 2WOJA 1HE1C 2O8FB 3N70A 1HH4A 3NKVA 4L4UA 1OHHD 2IXGA 2WWXA 1W2GA 2W2TA 4NP6A 821PA 1YKSA 2JCSA 3MCAA 4TT3A 5D3QA 3PUVA 1ZCBA 3WXMA 3F3YA 3T1TA 4W5JA 4DWJA 2EFCB 2ZEJA 3PR1A 1TNDA 4KBGA 4KVAA 4M1WA 4R2HA 5GJCA 4AC9A 3M0EA 1XMJA 2HV8A 4LV5B 5JCPA 2IYVA 3NTUA 1SVKA 2ODWA 3W3ZB 3ND9A 4GMDA 4P31A 2OEPA 2VQSA 4JBYA 1YZKA 3BH6A 2NPFA 4DSNA 4EDHA 1LTQA 5EP2A 3THXB 2G0TA 4DFCA 2WICA 1XDBA 4ASUD 1XP8A 3K70D 3U3RA 1KI6A 2WVJA 1F48A 1G8YA 1TU4A 1U99A 3NHBA 2F3RA 4URWR 3QBVA 4F4IA 2IYWA 3AKEA 3RC8A 1CJMA 4X8LA 1J99A 2CLDX 4MA4A 2BCJQ 3TE6A 4IW3B 2ZE8A 5EE9A 5JMTA 3O8BA 2GCNA 5FOVA 3RSOA 2HLDA 2DYKA 4OL0A 4DDUA 1P9RA 4FMDF 2ZU6A 4KSCA 1Q1BA 2CLCX 2W0MA 3ZZUA 1ZUIA 4F4JA 1CF4A 1Z3IX 3CBQA 3LAWA 4D6PA 4DUGA 4TMVA 3KXIA 2C95A 4M4SA 5AJVB 1GKYA 3H2YA 3QJYA 4NTZA 1KIMA 1EFRA 2QORA 3CF0A 3RRMA 4A0HA 4ITRC 1U8ZA 3PEVA 5EE0A 4II7A 2ORVA 3F0TA 2LKCA 1FQKA 3D8BA 1Y3AA 2QM7A 1OXTA 4TMZA 3VFDA 2WM9B 3BJIC 4PAMA 4OKSA 1DELA 3QPVA 5JSZA 2OFOA 3VU9A 2GA8A 3U4QA 1UDXA 3AM1A 5P21A 1EK0A 1D2MA 3PFIA 4YXWD 2IEZA 2BCGY 1AZTA 1NG1A 1JXMA 3RS7A 1KZ7B 4UNPA 3TNFA 3ZVMA 1S1MA 4PPGA 3LDAA 2HCJB 3RS4A 4YC7A 2REBA 4BZXA 2IYXA 4FMDB 2VHTA 2XB4A 3UANA 2D3WA 1OT3A 1P5ZB 2OM2A 3G5UA 3JZAA 5KTYA 4PHFA 4LZZA 5FBVB 3B8HA 2OSBA 1UKEA 2ZJAA 4LRWA 2WJJA 1Z2CA 3T15A 3A4LA 2ZREA 4FMBB 1RIFA 4MQBA 4QHSA 5JWRA 4C0JA 3R9XA 1U81A 2E1RA 3K9LA 3C5HA 1E2HA 2AFHE 1Z0JA 5DHFA 4RKEA 4BPBA 4DCTA 3DM9B 5H1YA 4PHGA 4PC6A 3QKSB 4KBFA 3DO6A 2J0SA 4DLZA 3WMEA 2HYDA 4B34A 1ZM4A 3GEEA 5F9FA 2CDNA 4D4LA 1W46A 4B43A 1X8KA 1JBKA 1CULC 4WOPA 1R0XA 3ZGXA 3LBIA 3C41J 2B92A 5AR1A 3X1WA 4CEJA 3LNCA 4LJ5A 2WWYA 4B75A 1SZPA 3QXCA 3R8CA 2J7PD 2H18A 2G0NA 3KJHA 3KQUA 3ADKA 1WF3A 2V55B 1E2LA 4Y0VA 1SKYE 4Q1BA 2FPKA 4A9AA 3CH4B 4H1VA 1DS6A 1VCOA 1NRJB 4D0GA 4TYYA 4Q4AA 5JWOA 1W47A 3DDCA 2FA9A 1DAEA 2F43B 3QXSA 1COWD 1QHYA 5JFGA 4IDPA 4F4CA 2B7BA 2PEYA 2WMNB 4GOJA 4XTRA 3IUYA 5KDDA 1I2MA 3ZVNA 2Z43A 1E9BA 1VG8A 1G7TA 2C03A 3H4MA 2WAYA 4ESHA 3L2OB 4JL8A 1UJ2A 2BMDA 1FP6A 2WWGA 3BWDD 4TLEA 1L4UA 5G41A 4NYIQ 4E03A 621PA 1VECA 1XWIA 5GJVC 2FGKA 5EP4A 3DZ8A 2O8CA 1US8A 2GILA 5DO9A 4BFSA 4A1FA 3KB1A 1JAHA 2O8DA 1XD2B 1GWNA 2H8KA 3CNOA 2H17A 3VAAA 3ZIAA 4Z8XA 4WZBE 2IYSA 2ZM5A 1YR7A 4B3FX 4GZLA 4C0AC 1KI8A 2WJVA 1I4TD 3N5CA 4UXIA 3RRYA 5GJBA 2FZ4A 2RGCA 4ARZB 3R20A 1GAJA 3SZRA 1Z0DA 3T34A 5CB6A 1LW7A 2FZLA 2ZRMA 2ZYUX 3LX8A 3X1YA 2XJ9A 4Q9JA 3X1DA 4CDGA 4A0RA 1Z28A 4MRRA 1ONBA 3EPLA 3I32A 4U00A 1X86B 4ACBA 4CRWB 3C4JA 1KHTA 1XF9A 2HXSA 2IX3A 2XNDD 3GMTA 4EAQA 1F5NA 2RH5A 4PXAA 1SXJB 3KDSE 2P6RA 3SQWA 4HB2A 4IOLA 2ZRIA 1VYVA 5B2ZA 4HZUA 2HEIA 1JECA 4URYR 3LO5A 2CL0X 4N0DA 2A5GA 4HAZA 4OQFA 4R9UC 1YVDA 2OUKA 1P2TA 2DCUA 1D9ZA 1WP9A 4LPKA 1FTNA 1G16A 3IO5A 1ETUA 2ODNA 3R7WB 3CX8A 1QHHA 4GMXA 1A4RA 3RHFA 2ZRAA 4BFZA 1CBUA 1M1YE 3QVUA 1YQTA 4EPRA 4LDJA 4QGFA 4AKHA 1BYUA 2CCKA 1NIPA 3AVQA 2CBZA 4LWZA 2CL7X 2J0QA 2IXEA 3RS0A 1A5TA 4NYMR 1TEXA 4DSOA 5JJKA 4PO8A 1NL3A 2QG6A 2PMKA 2WKRA 1DO0A 1JPNA 4BASA 3MD0A 4OI4A 3KQHA 4QRHA 1OYWA 3GJ8A 2RGNC 5FOSA 1YU9A 3UKDA 2BDTA 2AWNA 2OO7A 1ZNWA 3CRQA 4PZZA 4QFMA 5TDHA 3VHLB 5C4MA 5J4YA 1H8HD 2JDIA 2ZVPX 3MFYA 4WW0A 4C0QC 2Z4RA 4LPSA 4LJYA 4NU0A 3GLIA 4I99A 1M8PA 5JCZA 1OXVA 3PUWA 3DOFA 4CYMA 4W9MC 4OQLA 1FNMA 1N6HA 1QVRA 3RYTC 2ZI4A 3WBKA 2QMOA 3D7MA 4KYUA 1E9AA 2GJ8A 4MKFA 5KSOA 3UG6A 1RRFA 1XJCA 3MWLA 4ZDJA 2KB0A 1YZGA 1MO3A 4OHWA 1YRBA 2IS4A 5FL7A 2J0UA 2P67A 221PA 3H0KA 1E98A 1CIPA 5JS7A 1SGWA 2PX0A 3C7KA 3KB2A 2PT7A 3H86A 1N25A 1E69A 1W4RA 3ECCA 2A3RA 1Q20A 2QSZA 4RFVA 1W0KA 4HAVA 1ZM2A 2X1VA 5ANRB 3B7GA 4Z51A 1X6VA 1FPMA 2AFIE 1FMLA 4B35A 2BEKA 3R8FA 3A36A 5AJZA 2FSIA 4Q9HA 2BMEA 4QGHA 4CEIB 2ATVA 2YZ2A 3IHLA 5KUTA 2WJYA 1VKJA 1M7HA 4TMXA 5KU1A 1E0SA 1ELOA 2OCBA 2XTMA 3KQKA 1OH8A 4KFTA 2QT0A 1OSNA 2V6JA 4LHXA 3G0HA 1XTKA 2CNWD 2DB3A 2VLIA 5AUPB 3MWKA 3SI7A 4POAA 3C5CA 5C46F 2F1HA 2QMEA 3OEHD 4PAOA 4NYJR 2VTKA 3QEJA 2EFEB 2PT5A 3U7EB 1QZXA 5AUQA 5EQTA 2KSQA 2BWJA 2CL6X 3DZDA 2G3YA 2IUSA 2OILA 2QNRA 2W83A 4J0QA 2WPDA 3WHKA 1CJKC 3DOEA 2FMXA 4LK2A 1HA3A 4WXRA 1FX0B 2NTYC 2H92A 2ZRCA 4K46A 3SBDA 3C14C 4HYYA 4PPNA 1PUIA 1SVSA 4JVSB 3RVBA 1KAGA 2VIIA 5CK5A 3M6AA 1TX4B 4EPTA 2VSOA 5JJLA 421PA 1XTJA 2ZS8A 3VMAA 4YDSA 2ONJA 1RJ9A 4DVGA 1R2QA 2GCPA 4LBZA 1DEKA 1TUIA 3Q8XB 4E5UA 1IN6A 1K5GA 4PO9A 1VIYA 3PCRB 3B5JA 2BEJA 3Q72A 4XVQA 1XBTA 3A58B 1CR4A 2FPLA 4MDEA 3QNUA 3X2SA 2XAUA 1EESA 4P4UA 1IY0A 2V7QD 4OHYA 2JLXA 1C9KA 1N6OA 3OE7A 2ZI9A 1GNQA 1CKEA 4BFTA 1OH6A 2AN9A 1Z63A 4MYCA 4E22A 3OIWA 2W6ID 2NO7A 1G41A 1Z0IA 4AKGA 1W4BA 3TVDA 1SVLA 2KBFA 4Q4HA 1AQUA 4LGMA 1M74A 2UVQA 3B13B 4HZIA 2F9MA 4Q7JB 1T5IA 3SJZA 4TLBA 3SC3A 1IY1A 4M2LA 3WYFA 2NZ8A 3L0SA 2Q9AA 2X2EA 4PPQA 4B71A 5HR5A 1KY2A 3AVTA 2PZFA 2UKDA 3WP1B 1NJGA 2VYFA 2FFQA 4BE7B 4DDTA 1Z07A 3ADBA 3PQCA 2G9NA 1VDZA 3RC3A 1NIJA 1E0JA 2ZI7A 1HY3A 4IFEA 4XD7D 5FTJA 4BFYA 2G88A 3FWYA 4M1TA 2A78A 2FGJA 1N5LA 4IXMA 3ZD6A 4PQYA 1SVOA 3KKNA 4OYHA 4RJLA 4ZPXA 5J4KA 3QE0A 2WTUA 3B9PA 5JHGB 3A1VA 4K81B 4RFSB 5F3WB 3EW9A 3SFZA 2DFKB 4H1UA 5F98A 3AVYA 1SHZA 2ZYVX 3TJZA 3KKQA 3W3AA 3FHCB 5CK4A 4KXFB 3AKCA 2FF7A 4BWYA 3O47A 2YOFA 4C2TA 5J47A 1W0JA 2RGEA 5IT5A 1ZD9A 3GLGB 4PHHA 1JB1A 4L8GA 3A6PC 2DFNA 3B6EA 4MITA 1KMHA 2ZAMA 2QGZA 1XEWX 3L43A 3L8YA 2QA5A 5EXTA 3AKDA 2JLYA 5IHPA 1HT1E 3ZYCA 4UNSA 4GNKA 4JBWA 4HAXA 2GVDC 3W5IA 3U61B 2BMFA 4C0HA 1XEWY 5DNYB 1R5OA 1PVOA 1K5DA 1LV7A 1NVXQ 1OXXK 3SDZA 5J4LA 3SQXA 3SNHA 1YR9A 1XEXB 4AYXA 1GDDA 4DB2A 4A6PA 4AY2A 1E6CA 2VP6A 5EP3A 2YOHA 2VA8A 3GJ7A 2OE2A 4EPYA 3W9YA 3CH5A 5JI3E 2JAQA 1E1RD 1Q3TA 4TYQA 1A7JA 1U9IC 4DLYA 3K09A 3EC1A 2HJGA 2FFBA 4A2QA 2EW1A 1BO6A 3L82B 4AYWA 1BKDR 2OAP1 3K53A 1BOFA 2ANCA 2ORWA 3AKYA 4Q9LA 3VNVA 1H65A 3KXKA 3MUFA 4TMTA 5G3YA 3A8TA 3GLFE 3FKQA 2FEOA 4EQ6A 3FMFA 1E79A 4MH0R 2G1JA 2H5EA 4GL2A 1KI1A 1XTRA 521PA 2Z6VA 3IDQA 4TWZA 3THYB 2ZJYA 3MSXA 1RW4A 1IN5A 4A36A 3FPAA 1HQYE 3S1AB 1AIPA 1CJUC 1G291 1S9DA 4LOAA 5D3MB 4F7WA 5DIFA 4D0NA 1ZUNB 5HKKD 1IJEA 1GL6A 2E87A 1T0HB 2J9RA 3AP2A 1XXHE 3CM0A 3B78A 2IF2A 1LB1B 4BFVA 5L3SA 3K0FA 1JR3D 2I4IA 3KFVA 4YLGA 3VR1A 2YINC 2YV5A 4UJ3A 1OH5A 4CVNA 3I1FA 2ZJ2A 2IS6A 1DADA 2ZQ5A 4QHYA 4OI0A 4JMPA 3OAAA 1O3YA 3U7GA 1W4AA 4HI0E 4JLJA 1U90A 1NBME 1E4VA 3PUXA 2A5DA 3KL4A 3W6PA 5FOXA 4P33A 2D06A 2QT1A 4EPXA 1X8JA 4P3YA 2ZUCA 4NH0A 2P65A 5EE1A 5FBLB 2F3TA 2KI5A 3F5FA 3HP1A 4LY6A 2ZE7A 2BJWA 2QZ4A 1OHHA 1KK2A 1ZU5A 3M1IA 4PZLA 2XX3A 3QIAA 4P4SA 2AX4A 1YZLA 3PEUA 2P0EA 4XSHA 1SVMA 1NKTA 1QG2A 1KNXA 4ZI2A 5BWMA 3U3JA 5JECA 1G5TA 1NMYA 1IQPA 4MRNA 4S2EA 2ZRBA 2DR3A 2ZRNA 1P3JA 4HDOB 4IDQA 2ZSFA 3TK1A 1G5PA 3CWZA 1CJTC 1T3SA 4Q1CA 4JL6A 5HZKA 1QHXA 2R44A 5C18A 3U7FB 3UATA 4RD1A 1MOZA 4BFXA 2HF8A 2GAAA 2WKQA 2BOVA 2GXAA 3I5XA 4EKDA 2B7CA 2WWFA 2FU5C 5E7MA 1T9HA 5B30A 4ASUA 1KKLA 3VMFA 4BFUA 2OZEA 1JXOA 1GUAA 1NLFA 5KYKA 2ZRKA 3BK7A 4M1SA 5TB5A 4NCNA 1KO1A 2W00A 3CKLA 1U9IA 1ZRHA 3ASZA 2F1JA 4QG7A 5DI3A 3PG5A 4A92A 1W36B 2J87A 5FUWA 3A1UA 5HTKA 5J4HA 3WNBA 4MGZR 4QOSA 1KNQA 4A2PA 4GOKA 2OCAA 2YC4C 3HU1A 2REOA 3HR7A 1EX7A 2ZRHA 2WIAA 4URVR 4HSEA 1G18A 1PLJA 3BXZA 3NDBB 1U94A 1NNEA 2N1BA 1DARA 2FH5B 2YYZA 4KFSA 2ZRPA 1PLLA 4JLBA 3BB4A 3FKSD 4GP7A 5KDOA 3CW2A 1ZM9A 4P4TA 4BZQA 3SOPA 3EG5A 3Q9LA 1G9XA 1W44A 2OLKA 2PJZA 4QJ5A 4D82A 2PZGA 3TQFA 5JSZB 3VU9B 2QP4A 3U4QB 2WSSD 4ZDWA 4OQXA 3DMDA 1LS1A 2NO9A 4YXWA 2V4ZA 3B1WA 1N6PA 2WIBA 1ZUHA 2BM0A 2C98A 4NCKA 4NYMQ 1MH1A 2BMJA 1XTQA 2XOKD 3QUSA 3SYNA 1ZAKA 4ZDIA 2B2NA 4PPFA 4O0MA 1NVVR 3BGWA 3Q7PA 2FDCA 2EFGA 2OBLA 5C4GB 2J46A 5FUYA 3CB4A 1QBKC 1CR0A 3FHTA 2QQ0A 2NGRA 4NKRA 3I5YA 2XTZA 1AM4D 4URUR 4IOJA 1Q57A 2ZXUA 5FBWB 5DLQC 5JEDA 3NIBA 1E1QD 2V1XA 2ZI6A 3U44A 1DG1G 3QVVA 3CRMA 1XZQA 3SYKA 1XNJA 2ZR9A 5H70A 4W5WA 2PZEA 2ZUBA 2W2VA 3NC1C 1NG9A 4CEJB 4YONB 1XB2A 4JIMA 2J7PA 4QJ3A 4RY2A 5LPNA 3PENA 5BQ5A 5FUXA 1N3BA 1XCPA 1NP6A 3IHWA 1ZNXA 3CUEF 2D62A 4YQFA 4PSKA 4EFNA 4LJ4A 3A1TA 4KVGA 5SZJA 1VG0B 1GIAA 1ZC3A 2MSCB 3U5ZB 2I1QA 5BXQC 3KFXA 2B21A 1P72A 1MO5A 1MV5A 2CCGA 1COWA 2O5VA 1U8YA 3LA6A 1N6LA 2GK6A 4PC7A 4Y0AA 2GEVA 5A0FA 1R7RA 3NWJA 1AS0A 2CK3D 3IQWA 4M9ZA 4RD0A 3EX7C 1J90A 2ASEA 1G8GA 1G5RA 3KJEA 4Q7MB 3AP3A 4NYJQ 2G83A 4QXAA 4V0KA 2C04A 1OIVA 2VP4A 2R6FA 2O8CB 1US8B 2R9VA 2WAXA 3EIHA 4DEYA 5B58C 3QY0A 5EZ6B 4NE2A 3LY5A 2J0VA 2DFLA 1TL7C 2QM8A 3O8DA 2F9LA 3RLFA 1VHTA 1SXJE 2YNMA 3W8RA 4FCTA 2Q3FA 3OHMA 3KKMA 3KXLA 3WP0A 4IVRA 3WYGA 4Q03A 3QENA 3BH7A 1NF3A 1UBFA 3GCGA 3WRYC 1D8TA 3P32A 2GXUA 3ZQJA 5KNBA 1GVNB 4Z8YA 3OFND 4M22A 2PEZA 2ANBA 3A4MA 4TQUS 4C0BA 1JR3E 4QM7A 4KAXA 3MMPA 4IRUB 3E5HA 5M04A 1OV4A 5FOUA 2IHBA 4GRAA 4AKEA 4HLUC 2W6JD 4DT1A 2OT3B 1IJFA 1N0WA 3BFKA 3THWB 1G1MA 3SS8A 1JPJA 1VMAA 1C4OA 2XSZD 4XIGS 2XNDA 2ZITA 3CRW1 3IPYA 4DHEA 2PL3A 1DAIA 4A8JA 3LLUA 2ZR0A 3AP1A 4V0LA 3K0AA 4IXNA 5DYGA 2PX3A 4HZUB 1EFCA 1QHGA 2CXXA 3BFXA 4Q00A 3IBYA 1A82A 2V9PA 4UXHA 4CEHA 4DLUA 3C16C 1IAQA 2ZRFA 3RRZA 4LCBA 1KAOA 3C15C 4ZIRA 3ETLA 1XZPA 3LQRA 4HAWA 2C9OA 1YZNA 4HEJA 5J5CA 4TZ6A 5IK2D 1KK0A 2GZAA 4G5RA 3CF2A 3AGQA 3DEFA 3TW4A 3AVXA 1GL7A 3U3KA 1HTWA 4MYUA 2HJVA 2OXCA 4M8NE 4TSFD 5KNCA 2I3BA 1FW6A 3VR4A 2YJTD 1UBEA 3MGCA 1CR1A 1JEEA 4TLCA 4UQOA 1CEEA 2CEAA 3VR2A 2GJKA 4Q01A 4ON9A 5FTNA 2QPOA 3ZVRA 2O8BA 4DDVA 4NBSA 2GHIA 1KI7A 1R0WA 2GCOA 2GWHA 3F8TA 3NBFA 3U7HB 1TEVA 4DIEA 3AGPA 1MO4A 1Q12A 2OESA 5TV2A 1H8HA 4IEEA 3GLIB 4RD4A 4EFMA 1ZVQA 4QL3A 1XXHA 5UKDA 1Q0UA 5FL3A 3T35A 2RHMA 4MRSA 3LV8A 1D2EA 2JJ1D 4B33A 4KLZA 4C4PA 1AJEA 1II0A 4CZ2A 3TQCA 1TUEA 3TR5A 3K0CC 1OXUA 2J0UB 4IDOA 1KI4A 3U3MA 1Z08A 4PC2A 1VYUA 2UZIR 4V03A 2F1RA 3E1SA 3NH6A 2FFAA 2Q0HA 2OAQ1 4G3XA 1UKVY 2QI9C 5FTMA 4I4LA 3I72A 2EQBA 3HWSA 1M7GA 3DL0A 3D31A 1E9DA 5E3HA 4ZI3A 1P6XA 2A5FA 1U8AA 2QY9A 2VRWA 3TR0A 3B82A 1TU3A 4AYTA 3CNNA 2Z83A 4PSVA 1J8YF 1J8MF 2QN6A 3EWSA 3EZ7A 2AL7A 4Q1AA 4EJSA 5HE8A 3RRNA 2REXB 2JGNA 3GPLA 3KUDA 1GTVA 1EFUA 4WIAA 1QHSA 4V0OA 5KDLA 2CNWA 1KO7A 4C9BA 3PEYA 3FWLA 5E7JA 2FJUA 2R6CA 1VCNA 2OCPA 3FDIA 4HLUA 5FR2A 4TTPA 4GT1A 3OEHA 4RVCA 4RSGA 1NVWQ 1Z29A 4FINA 5DI9A 1OW3B 2IUTA 1TMKA 4C7OA 1II8B 4BEBA 3VHXA 1AS3A 3WNCA 4G5GA 2A5YB 4LHYA 2NQ2C 3FB4A 3CRVA 2IYYA 4US0R 4B3GA 1DVRA 4AKIA 3NH9A 1HEIA 3ZH9B 1N6NA 2OCYC 1Z83A 3IBGA 4DEXA 5EE3A 2QBYA 3IEVA 4QBFA 1RJ9B 3ZLJA 1IXRC 3KJIA 4BLRA 4NCIA 4BRUA 4A0FA 2XEXA 2ZYTX 4NMMA 1KJZA 4DXAA 3GJXC 4ERNA 3E70C 4HUTA 5CLQA 3SYLA 3BIFA 1UEJA 2VPPA 4O25A 2EFHB 3GFOA 2V7QA 3KKPA 1IN4A 3CRRA 3T1VA 1ZCAA 2EWWA 2MSEB 1QHIA 4JLOA 5KPDA 1N2CE 2C99A 1P73A 1MO6A 2W6IA 3K9HA 1HUQA 5G3ZA 4Q4HB 1OJLA 5LD2C 4Q1DA 4QGAA 1E9CA 1OKKD 4LBVA 4TYWA 1OYYA 4QBIA 4TL9A 4G5QA 3CR7A 4KODA 4GZMA 1EFHA 2VO1A 3P27A 3D6TB 3HU2A 4N0EA 3QPWA 4QNRA 1G64A 1F2UA 2EYQA 1P62B 2VSFA 4C30A 1KSGA 3GLGE 3RWMB 1C1YA 1VPLA 4D4KA 1KDTA 3E2IA 1HT2E 4HLCA 1G3QA 4DSTA 3QF4A 4BEJA 4ZKEA 1VCIA 4G1UC 3UPUA 1NKSA 4XD7A 3AV0B 2B8TA 3K0CA 4LBYA 3CPHA 2R6AA 1OB5A 4BLTA 1Z5ZA 3LXRA 2Z0MA 1BYIA 3UMFA 2A5JA 4WZAE 1LY1A 2BVNA 3EA0A 2IYZA 1G4UR 1NBMD 3QKRA 1JR6A 2RCNA 1IXZA 1QF9A 4R7ZA 1NSFA 2V8OA 3B1VA 1JJ7A 4NPHA 3JZMA 3NC0C 4AG6A 1KMHB 3LW7A 2OXRA 1R0ZA 2C77A 4HLQB 4PQRA 5C2JB 1YR8A 2K5UA 3CX6A 1RZ3A 1E9RA 1MKYA 3BB1A 1KJWA 3EPJA 3FYHA 4ABYA 4PFSA 2EYUA 5A5GA 4PSAA 4B2IA 5FBQB 1FOEB 4YDHB 3GEIA 5HE9A 1E2JA 2QE7D 2AXNA 2IHYA 4B3XA 4US1R 1ZP6A 1KSFX 1XMSA 3ADCA 1Z6XA 1AQYA 2XTNA 2W58A 4URZR 2DWPA 4U7DA 2OG2A 1ZM3A 2C8VA 1SKYB 1L4YA 5IDVA 5DSZA 4MUBA 2JLUA 1XD2A 4JT4A 1XFAA 2IXFA 2KJQA 3QF7A 1XTSA 1E2FA 1Z06A 2F7SA 3TAHA 1JQLB 1EWQA 3HDTA 1NLYA 3EPKA 1E1RA 2A2ZA 5GVRA 1WA5A 4ARZA 3IEUA 3I4LA 3REGA 5FH9A 1GG2A 4LC0A 3GFTA 4EPWA 3P20A 4ZCMA 3SU8A 2CVFA 3REFA 4WXPA 3DKPA 1IM2A 2J1LA 3K09C 4N3NA 3I61A 4M9QA 4QHTA 2JIZD 3WNDA 1Z0AA 3BB3A 1G19A 1AKEA 5DGXA 1VYTA 2ZI5A 3IQXA 5FFMA 3I8XA 2GEUA 1NVVQ 4B73A 1TAGA 1KJYA 5E4FA 1UM8A 4TYNA 3P1JA 3SR0A 4A4DA 3HPQA 2ZTSA 5JS8A 1ZNZA 4CIDA 2W2XA 4WBSA 1Y63A 2ZSEA 3EIEA 1ZINA 3LH5A 1E2EA 3ASYA 3WBJA 1S0UA 4M53A 3K1JA 1Z0KA 5HKKA 4G0NA 2KBEA 2CJWA 2BBOA 1WDTA 3LVQE 3B2EA 5L3SB 3K0FB 3GJ4A 4B76A 1GNPA 1JR3A 1Z8FA 3P26A 4X8HA 2FSHA 3J81k 4ZKDA 3O8RA 4M1OA 2BKUA 2GKSA 1MRSA 2HF9A 4B3BA 4ZO4A 1P4SA 4JT2A 2Z5FA 2RGAA 2RB4A 5KPJA 1Q21A 2QTHA 1NN1A 4B2LA 4JLDA 5BN3A 4JSTA 1PLKA 1YZUA 1AN0A 3PUZA 2X2FA 3GJ5A 1LF0A 5FR1A 2XNSA 5TY0A 2VP9A 3BH0A 3QKUA 1VCMA 2CCJA 4Q19A 3VQTA 2GAOA 3CPEA 4UKDA 4P4SB 1G8FA 3FVQA 2A30A 1Q1QA 1S3SA 2HYIC 4JLMA 5FTLA 1T6NA 2GZDA 1Z22A 4M1YA 3B9QA 3QEOA 3RS2A 8OHMA 2FG5A 4AG5A 4LBWA 1XMVA 4TQ9A 1N5JA 4LJ8A 4BQSA 2P3SA 1KSHA 2KWIA 4DLVA 2C5LA 2IWRA 3KUCA 4DLSA 3CWQA 1FFHA 3ZD7A 3KQLA 2DBYA 4GDFA 3GLHB 4TMWA 4IOMA 3LBNA 2XJ4A 2JJ8A 2QL6A 2XGJA 3LQQA 1CXZA 3ZS8A 4BECA 4QC2A 1J70A 4FMCF 3K70C 3B1YA 4FD2A 4BLSA 4X8MA 5DI3B 2P6UA 5EP1A 1I4DD 2O8EA 3V4RA 2RGGA 1E2MA 2YC2C 4CF7A 1YHNA 4JVLA 1D2NA 1JEDA 1YR6A 3QPUA 5AUNB 4DCUA 3UG7A 3MWYW 1CS4C 1U2RA 2FN4A 5JWHA 4Q4JA 5BYJA 1R6BX 3KTAA 3UK6A 2ZSBA 2HUPA 4L9SA 4MYTA 3B60A 4BGDA 1N6KA 3VX3A 3BE4A 3ICQB 2V6IA 2RGBA 4NHOA 3Q5EA 2Q6TA 2IL1A 1FL9A 2BBTA 1KDPA 2KE5A 2ZI3A 4FCWA 2C9YA 2Q3HA 4NCHA 4QGGA 3FKSA 4BLPA 1J2JA 1ZC4A 1P75A 3LFUA 1SXJD 4PO1A 1RFLA 1GITA 4HLDA 4NCJA 2NMVA 3SBEA 4DRZA 2HT6A 2WSSA 4V02A 4Z54A 2ZJ8A 3TBKA 4I1OA 4FMCB 1P60A 5LB2A 2AK2A 4D4MA 3O8CA 3DMNA 2O0KA 4A82A 2FV8A 4JKIA 1SHKA 2ZJOA 5FPSA 1T8UA 3K8YA 4FW9A 2RGDA 4WZ6A 3LW8A 1DG3A 2XOKA 1F2TA 1XTIA 3TSZA 1VIAA 3ZQ6A 4MRVA 4F38A 2BBWA 1IN7A 3PVSA 3MLEA 1ZD1A 4Q9IA 4LHVA 4FWIB 3CONA 3CPJB 1KK3A 3H1TA 2IEYA 1DPFA 4I1VA 3WHLA 4I81A 5GVSA 1DBSA 4XJXA 3RS5A 4DLRA 3K9GA 1Z6YA 3EZ2A 3HPRA 4R71A 1OIXA 1II9A 1OE0A 5IF9A 2QTFA 5CJ2A 1QVAA 3U44B 5JI2E 1U98A 4JYBA 1E1QA 5JBQA 1HV8A 3LLMA 2IYRA 2AK3A 2TMKA 3VR5A 3T12A 3OIYA 1XPRA 1OIWA 1P2VA 1TF2A 1E99A 3FPNB 2YWFA 4OBEA 1WQ1R 4IHQA 2UZ3A 5L3QA 3KQNA 3HJHA 1P2SA 1X8LA 2WKPA 4IOKA 3IO3A 4MKGA 1X1RA 1AS2A 2FSFA 4WAUA 4RFSA 1S9HA 2VP5A 4NDZA 1GRQA 2OFXA 3VKHA 4JS0A 4EFLA 5EXPA 2YKGA 1HQCA 5K8LA 3PUYA 3K0SA 1XMIA 1QG4A 1KI6B 2E9SA 3AVOA 4US2R 2ZR7A 1E2DA 5CYPA 1Z6AA 2QP3A 5FBRB 5K8UA 5EXSA 3LWNA 2CK3A 5CIWA 3AH8A 3X1XA 1NJFA 4KFUA 4M0LA 1BMFD 2IYTA 4IEIA 1H8ED 4JLKA 1UKYA 1IOZA 3LBHA 5E7IA 4C3ZA 5JJIA 4GBMA 4KFRA 3CX7A 1VTKA 4V0ME 2PJRA 4Z1MD 1UPTA 2GZHA 3I8SA 3U6KA 1CTQA 2WOOA 3RWOA 3MWJA 5LDDC 1JNYA 2AHOA 1E0KA 2F6RA 3JVVA 1XEXA 1KOFA 1TPZA 1TQ4A 3T06B 2VF8A 5DH9A 1E96A 1RVDA 1ZD8A 4LV6A 1E2PA 3GFPA 4NZYA 3OFNA 3NDPA 5LBIA 1RPZA 2ZSDA 2GJAA 5BYKA 1ODFA 4DT1B 3QOFA 3T1QA 5TARA 4HB0A 1X3SA 4B32A 1EX6A 1IHUA 2J59A 2W6JA 2GJ9A 4L9WA 3H84A 1ZNYA 2YVUA 4QKQA 1WB9A 1ZU4A 2CHQA 2R6DA 2XSZA 3KJGA 4OHXA 1KY3A 1U0JA 3T5GA 4YMVA 4RKFA 2PCJA 2QU8A 5G53C 3K0AB 3HJNA 1W5TA 1XCMA 2H57A 2QMUA 4KV9A 1G20E 1S2MA 2GTPA 1G7SA 2OHFA 2QMHA 4A8JC 1KI2A 3OEED 2JLZA 1FQJA 1EWRA 4CEHB 1G8HA 1HURA 4PHTA 1CLUA 4KHZA 1TADA 4ZIRB 1P2UA 4RD3A 2AD5A 3T1OA 4DDWA 5JHHB 5D3MA 2F55A 3SFVA 3JVUA 1VG1A 2L0XA 3IIJA 3GLIE 3P4XA 2BJVA 4RZ2A 5AJWA 5DN6D 3EC2A 4JLVA 5IK2A 5JEEA 1SKQA 2AKYA 2OLJA 1MABA 2IWHA 2ZIAA 2QAGC 3NEYA 1L7VC 3TRFA 4DIDA 3QG1A 1G4AE 2P2LA 4JJKA 4OK5A 5FOWA 3FOZA 1BIFA 1LVGA 2J45A 4A15A 4PC1A 3EZ6A 2CE2X 4TSFA 4OHVA 2IA5A 1UAAA 2NIPA 2GJSA 4LJ9A 1PJRA 4DJTA 1PV4A 2NOAA 5KO2A 2GCOB 2V3CC 4FIDA 4DCSA 2BC9A 3NVAA 2WWWA 2XXAA 4JZKA 1ZBDA 3VNUA 1M7BA 1IXSB 1WMSA 2CHGA 2ERYA 3GD7A 3BS4A 5KSPA 1XXHB 4B44A 4Q4AB 1KKMA 2GBLC 2ONKA 1ANKA 2JJ1A 1TQ2A 5GADl 5EUQB 2GEDA 2GESA 2AD1A 4DB4A 3IGFA 3QXHA 2IF0A 3RABA 1OH7A 3ONWA 2O52A 3U6BA 1GOTA 1R5BA 2MSDB 1CR2A 1WXQA 2IYQA 3QBTA 4HUQA 1RYHA 3LXXA 1S4QA 2ZUDA 3KX2A 3IILA 2O0HA 2OFWA 3OZXA 2QPAA 1D6JA 2BIFA 1OFIA 2QP9X 3L0PA 4IVQA 4KYIB 1NVUQ 4B47A 2AXPA 3EA5A 1ZJ6A 3G82C 1YZTA 4KSBA 4Q4LA 2O8DB 4ILEA 2N46A 3P4YA 4O3MA 1AK2A 3NBZC 1T91A 4XSGA 4EJSB 1T3HA 2PBRA 2JJ2D 2RMKA 721PA 1EG7A 4DZZA 4EUNA 1IONA 2XZOA 1G6OA 5TVKA 5K8TA 1XPOA 2AWOA 3CZPA 4E07A 4D2IA 4EJSC 2IK8A 2ZETA 4C0KA 1AGPA 5JRJA 2R65A 1OFHA 3UMRA 5KNDA 1VHLA 2VP0A 4LV8B 5DISB 4B74A 4Q02A 4R98A 4QNMA 1KI9A 2VH5R 1T3LA 3CNLA 1EGAA 3UXMA 1KTVA 4Q5IA 5BN5A 4C7OB 2PLFA 2QRNA 1E2KA 3FMOB 1E9FA 1DO2A 4CT5A 3TH5A 1YJ5A 4D26A 3BOSA 1UBGA 2G6BA 3TAUA 2VHQA 4TL8A 3AVWA 2AR7A 1UDWA 1ESNA 1ZW6A 4KU4A 2QBYB 5H8WA 3UIEA 4XWOA 1FP7A 1DAHA 3IKJA 3QI2A 3RS3A 2IT1A 4CT4B 1XJQA 4JJZA 1F3OA 1G7CA 1P9NA 4I1SA 2H1LA 3ZJYA 3ZVLA 1QHHB 4B2PA 1K8RA 2JLRA 1OF1A 2QAGA 4C2UA 4QBHA 3DHWC 3BD9A 5EE5B 2ZJ5A 4Q7KA 2WMOB 5F2EA 4FWTA 3SN6A 4OK3A 1I4LD 3Q85A 3GLFA 2R2AA 3U2QA 1OKKA 4IDNA 4IJMA 3W8NA 4A6XA 3BORA 3DKVA 2EFDB 3QSYA 1MT0A 1R8QA 5BN4A 1ZM7A 1W1WA 5EUMA 1F2UB 2DWQA 3W6NA 2C78A 2PCLA 2ZAOA 5KHOC 4D80A 4JYCA 1P61B 1S96A 3TSWA 1WBDA 2X19A 4DLWA 5K8IA 1QHNA 4XWKA 2Q9BA 1ESMA 1OFUX 2GBLA 3QF4B 4Q1EA 5FPHA 3TLXA 4KITB 4LSGA 2O8FA 2IUUA 3AF4A 1XX6A 3R9WA 2D4HA 3RNLA 4TT3D 2ODEA 3OIUA 5FPTA 2VSXA 1R10A 3RANA 4X8OA 4P32A 5B57C 5CM8B 4DCVA 1RRCA 4QBGB 5DE3A 2D7CA 2W0SA 2WJIA 3AEZA 1LF5A 1Z2AA 2Q3MA 1A2KC 3FFBA 3FMPB 3N2IA 4XTCS 1AA9A 2CLSA 3MJRA 2JASA 4B48A 4TZ0A 3CZQA 1FTSA 1GFIA 3QKRB 1Z0FA 5JLJA 3SE0A 1NBMA 2YHSA 2NG1A 2ZRDA 3AB3A 3I73A 3IIKA 1GNRA 4TQAA 1CJVC 1OXSC 3THOA 4DC9A 3TW8B 1M34E 1E9SA 3L0IB 1TF5A 4LYJA 1R8SA 2FPMA 1XEFA 2ZE6A 4TL6A 2ZRJA 2IYUA 3THXA 3FMIA 1TTTA 3W90A 1KDRA 1UEIA 3GJ3A 2HCBA 2YWEA 3A1SA 1OLOA 4JBXA 5CDFE 1GKIA 4TTQA 4MKIA 4OI1A 4M9SA 4R2IA 4KLNA 3PV0A 1XPUA 2QUZA 5AUOB 1YRAA 2QE7A 3GP8A 1V43A 1ZIPA 2WJGA 3B1ZA 5TXGA 1WE2A 2HLDD 2XITA 4GSYA 1W36D 1G3RA 2P5SA 4JL5A 2VL7A 4F92B 2FFHA 3TKLA 2GF0A 2QTVB 5AWFC 1CRPA 1GZSA 4DUGD 4LYHA 1JJVA 1M2OB 4LC1A 3CO5A 3FTQA 1G3IA 1GRRA 4D4JA 2RAPA 2ZVQX 3AF1A 4Q7LA 4BLQA 1EFRD 1X1SA 5KSYA 1KSJA 2HT1A 2R6GA 3ZS9A 1KO4A 5J40A 2NPIA 1Q22A 1W7AA 5SZHB 1E3MA 3UWKA 3I92A 1S1CA 5CITA 5FI0B 2GETA 3AF0A 2JIZA 4PQFA 3W34A 5B64A 5HCNA 3THWA 3TGPA 1Z6GA 3BBPA 5FTKA 1QRAA 1XJ0A 4L15A 4V0MA 1XCGB 2CE7A 5LD2B 3WY9A 5F9HA 2D74A 5TMPA 2HDNB 3WRXC 3D3QA 4V0NA 5CIQA 1OPXA 3CR8A 5SZIA 2VBCA 1T5LA 1NN0A 1MR3F 2CJWB 1SXJC 1K6MA 4WVFA 3CLVA 1A2BA 1E2GA 1ZYUA 3C8UA 1OFTA 4XVUA 1BH2A 1G17A 2WBLC 4W5HA 2IS2A 4MGYR 2J7KA 4PX9A 1NY5A 1IY2A 3VTKA 4AD8A 1L8QA 2ORIA 4Q21A 1A1VA 2XZPA 2V1UA 6Q21A 2ATXA 5KSZA 5IRCD 1DE0A 4TTRA 1P9WA 4ZV4A 3GJ6A 2ZJZA 3QKSA 5L3RA 4G5SA 3TUJC 2PH1A 5EJEA 3TIFA 4UNNA 2ZE5A 4JVMA 5JZVA 3A37A 4JLNA 3VKGA 1FNNA 3MJHA 1T8TA 1PZNA 3PXGA 1WBBA 2CMKA 3EAQA 4GFDA 4D81A 5HPYB 5HZHA 3BC1A 1IBRA 1L2TA 2DHRA 4RCYA 2GF9A 3FFAA 4M1KA 5SZKB 3TUZC 4CGZA 3AVUA 1UBCA 3SJBA 1G21E 5CLLA 1S8FA 1JAIA 1RRGA 3GLHE 4TMKA 5GJWC 1AKYA 3A1WA 1IN8A 2I1VB 4RD6A 5G40A 3V9PA 4S35A 5J4VA 4PANA 4E09A 3MAAC 2YOGA 3GEHA 4HDCA 2F43A 3EZFA 3T5DA 4Q1FA 5FPYA 3AUXA 3DPUA 1KZGB 2G77B 1TQDA 1G6HA 2GRJA 3IPXA 1RKBA 4O2RA 4L5BA 3WMGA 2EU8A 4MGKR 5JRZA 1CRQA 3RSLA 4GOXA 4EIWA 5EXXA 5DYIA 4OI2A 2IYLD 1QDEA 3BRWD 1OB2A 4OQMA 1GM5A 2C96A 2DPXA 2ERXA 2ZPTX 3ZIAD 1UKZA 3MG9A 1EFTA 3L8ZA 2ZYWX 1R5NA 4AWXA 2O8EB 4PZYA 3K0EA 5C1BA 1N6RA 4XH9B 2OBMA 4F91B 5LB4A 3EPHA 2SHKA 3TVTA 2WWHA 3FHOA 2ODBA 4DLXA 4KCGA 3HR8A 3PITA 3ZZTA 4Q4JB 4MDFA 3KTAB 4Q66C 4YMWA 4EQ6B 2QGNA 4UJ5A 4GPTA 1KO5A 5FUVA 2WHXA 1RC8A 4B3DA 3BFVA 4KJZA 2VEDA 4AIIA 4DSUA 1II8A 2AKAB 2IW3A 2PLRA 3EZ9A 1KI3A 3OF5A 4MRPA 1D5CA 4AURA 4ZCIA 2J41A 3VX4A 3EXAA 1P7CA 3NBYC 1SXJA 1RYFA 4FCVA 2JLQA 3NBXX 3NXSA 4DCNA 4B6FA 1W48A 2NO0A 3LD9A 1NLZA 1I2DA 3HYRA 3RAPR 1N6IA 4ACAA 5DHAA 3L0OA 4M1MA 1E2QA 2O0JA 2ZRGA 3EWAA 4OJQA 3KKOA 2ZS9A 2RGXA 4LUCA 4HDQB 3R7WA 1ZIOA 1F2TB 1SVWA 2CVHA 2ZANA 2FNAA 3N2EA 2PMDA 3GQBA 1W4CA 4UXJA 1PUJA 2EVWX 2DY1A 4A2WA 1DAFA 2WJHA 5A4JA 4YMSA 1GILA 4C0SA 2X77A 3CF6R 2XZLA 2DFTA 3K9NA 1AGRA 3KZ1E 2RGNA 4N1AA 1DAMA 1FZQA 1N0VC 4LHWA 1BS1A 2DWOA 2B6HA 2LKDA 5CJPA 1UF9A 4IFBA 4URXR 1R4AA 1LS6A 2JDID 1GL9B 4Q18A 4WA7A 5FPKA 4UNQA 2MMGA 1HE8B 4LHZA 4UNRA 2CHVA 5L3QB 5L3VA 1GSIA 3IIMA 1NI3A 4ZCLA 1GRNA 1E2NA 4OHZA 5FL7D 3RDPA 1NMZA 1GKUB 4RZ3A 1Q1EA 4LJAA 3ICEA 1NMXA 2BV3A 4DKXA 2A9KA 3K70B 1JALA 3EIQA 1W0KD 2OV2A 2OBNA 3LRPA 1RE0A 3NG1A 5BW8A 4RZUA 1RRPA 4PTLA 2BBSA 1JI0A 1DAGA
chains in the Genus database with same CATH superfamily
4A0GA 3CLTC 4H4DA 3R6LA 3VKWA 4XQCA 1H6AA 2J8ZA 2LPMA 3WMFA 2XYPA 1KP2A 1TT5B 4FSHA 3JASA 3NP7A 1H8EA 4M0KA 5CYOA 1WV1A 1YRWA 4JKOA 3BXGA 4R0VA 1SVIA 2I80A 4PIVA 3ITNA 3ZDQA 5M29A 1T1JA 3BCSA 3O8QB 4HXYA 1VYHA 2GK4A 4INJA 1LK5A 2HWYA 2YYSA 2HTEA 4FBLA 1B6SA 2JLWA 2QSYA 3QWAA 3VISA 1INLA 4ZAWA 1DBIA 3I3SR 4Z0TA 1B0UA 1UADA 4Q47A 1P8AA 2G1KA 2PV7A 4DM4A 4EH1A 5B3KA 1DX6A 4WL0A 1BXGB 1FQOA 1I0LA 3KEQA 2JLVA 4HB3A 4RCZA 4OB6A 4F6RA 4QM6A 1JDNA 4I1RA 1HL7A 2GK7A 4XYMA 3JATA 1EA5A 4E46A 5K4HA 5L6LB 1E63A 5J43A 3AINA 2OYSA 2H2GA 5BV8A 4V1CA 5KTKA 3B85A 1T3GA 3EIUA 1B73A 1TC2A 3SJCA 3U9SA 4MUAA 3ZI4A 2IEGA 1RKVA 3C6BA 1SULA 2V54A 2CDCA 1JA0A 2JD0A 2P6PA 3VKVA 5JDIA 2DR2A 1P4JA 1L5HB 3KB6A 1AHIA 4B3CA 1UBKS 1CWUA 1CB7A 4HAUA 2VZLA 2GVZC 2JATA 1RHUA 1KQPA 3I28A 3LKVA 3OETA 2H2DA 2XI4A 2WEKA 4L74A 1G8PA 4PSUA 4BB6A 5E6SB 3P4UA 4JKYA 2OQ2A 4OHPA 4OGLA 1UC9A 4FZVA 4M9XA 3ZBTA 1ONSA 2WMYA 1C3VA 4FTWA 2D7DA 3PNOA 4DPKA 1PU2A 2C7QA 2IS1A 1ZSNA 4HSGA 3BGDA 1GGNA 3CBGA 3S2GA 3LG2A 4U5XA 5DN6A 3ACBA 4RV4A 3TYXA 1EWVA 4HN9A 4Y6SA 1WVIA 4TS9A 1QX3A 2A0UA 3AQ4A 3ZHXA 3HB5X 4DLKA 3EFBA 1T1SA 3HRHA 3ZY2A 1EK5A 3DMYA 2RKOA 4YV7A 1A9PA 5JAPA 1D9XA 1MAHA 1NQAO 2FX3A 2XWJI 1O4WA 5FI1B 2ID8A 3KT3A 1PYOA 5FJIA 4U7PB 4YMGA 4W4TA 2PUTA 1J39A 3PU6A 3MTAA 3CXUA 1GCIA 4M1EA 1RACA 3KZXA 2Q21A 3USZA 1PQYA 2ZW9A 1YE8A 5J9FA 4P8RA 4PS0A 1T1GA 3N6RA 4OVKA 3PT5A 5K3EA 5C7IO 1G5FA 4ARBA 1XTZA 2IHUA 4OJKA 2OORA 3E23A 1GPLA 3ANSA 3G2HA 3S5JA 3QEBZ 2QVYX 1V5WA 1YIDA 1TMOA 1DAKA 3W4KA 2CNLA 2YJ4A 3E8SA 3DAOA 4CGYA 4UARA 2I2BA 1ORHA 2XLCA 4CV3A 1U28C 1SD1A 3CIOA 3KR0A 4K8OA 3DTNA 5AVKA 3WGKA 2NYUA 3PJEA 4G0PA 2BHLA 5KYYA 5EJFA 1T8SA 4EL5A 5A5FA 2F8TA 2YWGA 1RAIA 2F1IA 4DC0A 3W1WA 3ANXA 3DW3X 3HRKA 2C9CA 3HYTA 4IQ0A 4EQZA 4LQ4A 3KSDO 1DC4A 1LVHA 3W8DA 4DLPA 5JD4A 1SCKA 1DOAA 1IBCA 2FE4A 2XKBA 1VKNA 5DZSA 4BQPA 3VSEA 4MA5A 4MI1A 5AW8A 1E94E 4RWEA 1SCUB 1K06A 2EWVA 2AW5A 3AEXA 4G4JA 3C4VA 3NJRA 3GLHA 4JJ4A 5CFZA 5EHZA 4MUKA 1XRJA 4BGEA 1X7ZB 2AMJA 3CUKA 1LFDB 2Z9BA 4NONA 2WQ7A 4FFDA 2A7QA 1SCJA 3MGAA 4RL4A 4BRWA 4PWZA 1AO0A 1WZEA 4EHAA 3U60B 2BH9A 1J7KA 5E6RB 5FLEX 3ZZ0A 1UMDB 3R0QA 3FUXA 2AFVA 2NADA 2BCEA 4MUIA 4G5HA 2B0CA 4HAYA 1Q44A 3L6DA 2P30A 4G01B 4ZHQA 2PSDA 1YJXA 4GZ3A 1T6ZA 4B79A 5IVIA 2O1WA 2ZU0C 3KZMA 3AEKA 1QO0A 1ABEA 1E2IA 1P1RA 3MHPA 4RTOA 2WV9A 1E79D 1CUHA 1UXGA 3Q3JB 1ZD5A 2D7JA 2QROA 4IPTA 3MAJA 2B5OA 3JWPA 3B1XA 1F60A 1TFUA 5FDFA 1XNQB 2UXCB 4BNNA 1JDBB 1OCEA 1OLXB 1U7XA 1HG1A 2Z5LA 1NQUA 1P33A 2LV8A 3PT9A 3TSOA 4PFQA 3U4CA 1EFDN 5CLJA 5INTA 2WF7A 1KS2A 1E32A 3QMWA 3QXXA 1NR7A 3DXYA 1JDBC 1TQ6A 1UDBA 4HATA 5LQKA 2HO5A 1HEUA 3WIOA 2EGUA 3KR2A 1J8DA 1HYBA 1QNLA 1U02A 3KTDA 4ZQEA 3UFXA 4UMVA 1FMFA 1OGJA 2GHQA 3EK2A 1GT91 3UC5A 5FV4A 2WMDA 3CZRA 1BG6A 4L1KA 2JK0A 3QG5A 1T1EA 2W2LD 3P9KA 4HEQA 4JSYA 4QPPA 5CXQA 1GZ3A 2HXYA 4B3SB 2HFJA 5CGZA 4P84A 3QJGA 4C4SA 4KOAA 5EUBA 4G81A 1M67A 3ND8A 4GGMX 4H77A 5KHAA 1PP4A 3M82A 4IJWA 5HK9A 3HVRA 4G8JA 2ZATA 5AK0A 1N5KA 3HXOA 3LZDA 4OAOA 1JSLA 2VR1A 4X85A 3PQFA 1GY8A 2O8BB 1RHQA 3MA0A 1C4KA 3HYNA 3AUYA 3VJRA 1HDIA 2JA1A 3CURA 1KYIA 4D25A 2WT4A 6GPBA 3EQ2A 1EP2B 3GJ0A 2VF7A 5FD8A 2QVBA 1HE1C 3A2LA 3BMCA 3W5AA 3QTTA 2IE8A 3NKVA 1W25A 1E1KA 4FHDA 4L75A 1XA0A 2PH5A 2X3UA 2WWXA 3IQGX 4CDMA 2W2TA 2EJBA 3UWSA 5CXUA 2CD7A 4Z4CA 1IM8A 1KPIA 5JG7A 3MCAA 4EI8A 3WXMA 5D3QA 4NQZA 1CQWA 3F3YA 5C52B 4W5JA 1Q91A 3BL8A 3SOZA 4GPD1 4B6PA 5JBIA 4KVAA 3M0EA 3I5UA 3NOOA 3KB8A 4IH9A 4M0UA 4L5IA 3EW7A 3KDPA 1AB5A 4WA8A 3S44A 4F85A 1FDIA 4ILKA 4M83A 5JCPA 2E5LB 1SVKA 3WA6A 2ODWA 3W3ZB 1Z16A 2NX2A 2RBKA 3ND9A 3N3AC 3MM4A 3KXDA 1TKCA 4P31A 2VQSA 2VWPA 2RK6A 3LA8A 1QTIA 3BH6A 4GXTA 3WIEA 4MUGA 4KX3A 4KAAA 1X94A 1BVUA 1JX6A 3WK6A 3BILA 4C20A 3T7CA 4MQ4A 1YD7A 3B6ZA 2G0TA 1SELA 3SSMA 3VI3B 4L02A 5I7HA 3S81A 2WICA 1FYWA 3LLCA 3HLYA 1O96A 5MFPA 4O4IB 2KMLA 1R9GA 1TU4A 1NR5A 3UJBA 2HWXA 2R1ZA 3HA7A 4JQSA 2RHRA 3O3NB 2IYWA 3AKEA 1U8UA 3E3LA 3EEYA 2YIMA 4K2AA 1J99A 1Y5NA 4MA4A 4JB2A 4CM8A 2NVUA 3QW4B 4KMOA 1FYFA 2DFPA 1BW9B 5K0BA 2GCNA 4ENSA 1ODIA 3L6EA 4IHJB 5KKCA 3BTVA 4FMDF 2MR5A 1I01A 1LI4A 1LLQA 4AUEA 4EMBA 4KSCA 3ZZUA 2W0MA 3KOOA 2GBCA 1U6JA 3AR4A 2JI8A 4QJIA 3ZE0B 1CF4A 1OTHA 3BGVA 3MJFA 5B3AA 2WNHA 2XQKA 3ZWPA 2NTEA 3IT0A 2EKQA 2C95A 3M5PA 3ECSA 4IUCS 1KIMA 2EZUA 4AZ0A 1NLUA 3O9ZA 2WUGA 4ITRC 2ZWOA 4YJGB 5EE0A 1I51A 2AQIA 4Y0NA 2FZVA 4EHIA 2AI1A 4PONA 1U2TA 2C07A 3H3FA 3K92A 3K20A 1D0SA 4KO1S 2I8AA 2QM7A 4Z86A 1OXTA 3TLCA 4LMAA 4OKSA 5BV7A 1V6CA 3U4QA 4DARA 1SZCA 1D2MA 1RLUA 2BDUA 1VPDA 1AZTA 2XZDA 4UNPA 3GUHA 4OHUA 1DRVA 2D0OB 5HJ5A 3PNMA 4UBJA 2G5TA 4CLXA 1VI6A 3O6VA 5IYZA 3AFGA 3SSOA 4YUXA 2IYXA 2CFRA 5LU8A 1JG7A 1YRYE 3EZYA 4GEKA 4BO2A 2XB4A 2PUCA 4U7TB 3UANA 1OUMA 1PWEA 2BSQA 4PHFA 4HH1A 2A0XA 3ETCA 2X23A 4JD5A 1N7IA 4BDTA 1YOVB 1UFKA 1UKEA 2GZSA 3ZCVA 1Z2CA 1CZRA 2ZREA 1K27A 4QHSA 1ATZA 1JSCA 3E0XA 3CH7A 3L6OO 4H7DA 1NRXA 4K9LA 1SC4A 1U81A 3OMLA 2CJXA 4H3VA 1DT5A 1J9ZA 3RYIB 2JF0A 4EJ2A 3P2YA 1IEXA 1SC6A 3QGMA 5DHFA 3DM9B 5H1YA 1NLMA 3ZK8A 2EATA 4F04A 5KMGA 1ESCA 2HYDA 4B34A 2G72A 5F9FA 1QV6A 2CDNA 4G0ZA 1V1RA 5HDBB 3T5CA 4WOPA 1R0XA 4DA6A 3LBIA 2Z30A 4QYIB 2B30A 4K6OA 1ZQ1A 4RA9B 4JA2A 2NU9B 1KP9A 3DE3X 4B75A 1SZPA 5M5BA 1GEGA 3K9BA 4MIEA 4QT4A 2OQIA 4UBLA 1B43A 3KQUA 2PZMA 3ZV5A 2JCBA 3ADKA 4X97A 4IBOA 1T3ZA 2ILVA 3UQYS 4BVLA 3F2IA 2WUDA 3CH4B 4YGXB 3FCSB 3OKCA 4A10A 4UBIA 5FPQA 4EI2A 1W47A 1AQLA 2Y1FA 4K8RB 1DAEA 3DB2A 1AKRA 1JSZA 1P7WA 5JFGA 5LM3A 2XYVA 1VSQA 3EVFA 3EE6A 3GA7A 4HQ6A 4IDPA 4PRLA 4GOJA 4XTRA 4UQLA 3IUYA 3TF5A 2OC4A 1QNFA 3AR9A 2BKVA 1E9BA 3OJFA 4G1VA 2C03A 1RCTE 3OWOA 5JNRA 4JL8A 1UJ2A 2HHCA 2QZSA 2WWGA 4MQ5A 3GFGA 4E03A 3FNFA 2PVPA 1VECA 1X7YB 3ZE2B 5KX5F 2IHZA 1MF7A 1L3BA 1US8A 2GILA 1FYXA 2JHCA 2BGIA 2GBFA 5IM5A 3E3OA 3HVKA 3UN1A 5K01A 1DI0A 2O2ZA 3H7IA 1E3TA 3KB1A 3QU7A 3DLCA 4C88A 5BSGA 3CNOA 1BDHA 2EJCA 3VAAA 1O6ZA 1ZDMA 3A3NA 4GPBA 3ZIAA 3L1HA 2IYSA 3IMCA 5EZQA 4DQVA 4F7DA 4GZLA 1MVNA 2WJVA 4FGWA 1K9VF 1W0CA 3PC6A 2HQ1A 1JR2A 2FZ4A 4ARZB 3R20A 5DV9A 5H3CA 1NJ5A 4Z7JA 1U8CB 3T34A 4Q9DA 4R16A 3R7NA 3WFJA 2FZLA 2ZRMA 3CKYA 3HB9A 4ZZ3A 3DS8A 5ALQA 3X1DA 4E51A 4Q9JA 3L8MA 4L28A 3H17A 3NM4A 2H3HA 3O1JC 4A0RA 5EGSA 4QWWA 3PGJA 1ONBA 3EPLA 3I32A 4U00A 3H1EA 3IP9A 4U3JB 4CRWB 3C4JA 3TZHA 2RCYA 3KQOA 1GPBA 1XF9A 4EHLA 2HXSA 2AG5A 4N47A 5JTUA 2XNDD 3GMTA 1USVA 2I33A 1JQKA 1F5NA 4GLLA 2Z98A 4IWXA 4Y2SA 3OLWA 1YR1A 3RT7A 2P6RA 1ORRA 2IZ1A 1LBTA 4KVZA 3UBMA 2WI8A 3H5NA 1U1FA 3X0DA 2W70A 4LF8B 5CCDA 4HZUA 2HEIA 4URYR 1PJ8A 2A5GA 5DHSA 3NATA 1YVDA 2HK6A 4Y18A 2OUKA 2FPUA 3IJPA 4DDMA 3I01M 3L7BA 1CNEA 1H0RA 1WP9A 3H9UA 4JQYA 2X6QA 3P5SA 2PSJA 2ODNA 3CX8A 2GN4A 1XVUA 1A4RA 4R1UA 1O7JA 1VQ1A 4CUKA 3K5WA 4BFZA 2DHDA 5BSMA 5LLSA 3P9CA 1M1YE 3FDZB 3JXEA 1X80A 3FGOA 4QGFA 4CUZA 4CKZA 4MDHA 3ZHVA 1M0WA 1NIPA 1SM4A 3BWEA 5H3LA 2CBZA 4WKNA 4AF8A 4XDYA 1YQXA 1QFXA 1W19A 1DWUA 1A5TA 4NYMR 1A8IA 1TEXA 3HFRA 1YFZA 5CT6A 5DNWA 4PO8A 1G20A 2GPAA 3NMUF 4H4EA 3RHZA 4BB9A 1JPNA 2I71A 2XCSB 1PSWA 2W2MA 2DZDA 7AT1A 4J0HA 1OYWA 1PT8A 4K9MA 3KQHA 2O59A 5FOSA 3QHAA 3UYKA 2YJ6A 3GZTB 3AESB 1RMYA 2EP5A 2CB0A 3HP7A 4JUFA 3MFYA 1U7DA 1BS9A 2IXAA 4LPSA 4Z49A 3FVWA 1ZRSA 1IWBB 1M8PA 4YN3A 1UJMA 3SEZA 3VUFA 3PUWA 4F3CA 4FDTA 2IPAB 4GAEA 1V95A 4CYMA 9ABPA 1RBYA 2ACWA 1QH9A 2HSGA 2V03A 4X61A 5LDGA 2FEXA 1QZTA 5F3DA 2YXNA 2Q99A 3RYTC 3WBKA 4YUWA 1E9AA 4MKFA 3VVMA 1V71A 2VTBB 5ABPA 3MWLA 1VLMA 2KB0A 3E03A 3GJTA 4RLSA 3HKBA 5FL7A 2R6ZA 4YWHA 3PGA1 2HRDA 4EI9A 4DWOA 1CIPA 3QLEA 1Q50A 1PX0A 1FUYB 3PDJA 5EI5A 2PKCA 2PX0A 2Q1WA 3V5NA 3ECCA 4K9SA 4PYIA 4F84A 1GU0A 4KIJA 4E12A 2QSZA 4WK4B 1W0KA 2ZUTA 1ZM2A 2QRPA 1ISGA 2H85A 2YV4A 3LUHA 5AW9A 2C82A 1B6TA 3LL4A 4GU5A 4IQ8A 5ANRB 2Z5GA 4BMYA 1XRMA 3SHVA 4P54A 4BO6A 5HS4A 4ALMA 3ETDA 3NR2A 4R2KA 1L7QA 2O6HA 3FPKA 4Q9HA 5AJZA 2BMEA 4QGHA 5EPUA 3JASB 2ATVA 2YZ2A 2V6GA 1VKJA 3QI7A 3FUUA 4TMXA 3G0HA 2V0CA 3Q11A 4KFTA 4MPPA 2EKDA 3PSHA 1XTKA 2B1QA 3T4UA 1SQ0A 2DB3A 1HM5A 4QUIA 1HDZA 1X9HA 3SI7A 1XIVA 3NHSA 1PAUA 1YRLA 3OHPA 4B6SA 4ENQA 2G9UA 3GJQA 4ZYZA 2F1HA 3OEHD 1K5PA 3AJ9A 3IX7A 3RSCA 2VTKA 3C6MA 3INGA 1QQ7A 5AUQA 4EG3A 3K1TA 2KSQA 3HKEA 4F6RB 4ZTBA 5D00A 2JAWA 2G3YA 3G9XA 3DZKA 2OILA 3G5AA 2W83A 4FGUA 4X91A 2POCA 3DF9A 1GLNA 1ZK1A 3ORYA 3JATB 4M0PA 3RK1A 2QLNA 2YWBA 4LK2A 2FMXA 3TM4A 4N49A 4P9NA 1HA3A 4YCNA 1VB5A 3C1OA 2ZRCA 4PPNA 1DJPA 2Z6AA 2A57A 1J06A 4CMIA 4V1CB 3C6KA 1QYDA 1ZL0A 2BGTA 3Q98A 1J97A 2BI8A 2CSXA 3ZV3A 5JJLA 1RR6A 1XTJA 1W93A 4G25A 4JUCA 1R2QA 1SD5A 4QLOA 4YCDA 3SIWA 2WFLA 3Q8XB 4PM4A 3WAGA 1IN6A 1PF7E 1ZBQA 1ZH2A 1VIYA 3Q72A 4PO9A 4XVQA 5A3SA 3A58B 4N3GA 4H6XA 3CLSD 2FPLA 2GBIA 5DRTA 3QNUA 1VLJA 4D81A 5K20A 2CV1A 1IY0A 2GASA 4NNOA 3SC6A 4OHYA 3F90A 2JLXA 2PDAA 1C9KA 4BFTA 2ZI9A 2WM3A 4WCVA 1EUCB 1NW5A 4INZA 4ZI5A 3AILA 4E22A 1OQAA 5J1TB 4BV2A 5DOVA 2QMYA 4EKGA 1SXHA 5I8PA 1DKUA 1Y1LA 1AQUA 2KBFA 3QVSA 4LGMA 4N5NA 4Q4HA 5FAXA 2OSVA 3R41A 1M74A 1EBFA 2UVQA 4Q7JB 5H9VA 3FLAA 2QL7A 1T5IA 1LWNA 1ZOLA 2AQ8A 2IH5A 4RL6A 4WH0A 3T9EA 2Y2UA 5JSFA 3WRWA 4JLSA 4M2LA 3WYFA 3YASA 4CR7A 1CDEA 1JXAA 3HP4A 5G1OA 1NNSA 5F9MA 5M04A 4GO1A 1MC1A 2UKDA 2O3TA 3V1KA 4HXGA 3SS9X 3CSSA 3GH1A 1QH1A 1VDZA 2FPSA 3PQCA 3GNTA 4Q3NA 3RC3A 3TM5A 2I3DA 2ZI7A 3A6HA 4IFEA 1XKQA 3CS3A 2FYTA 4RPKA 1A8HA 3G2QA 4M1TA 1O08A 1L7DA 4F2HA 2A78A 4IXMA 4Y2XA 4HDNA 4OYHA 4ZPXA 3DHEA 4AO8A 4FFRA 3B9PA 1GPH1 4RFSB 5ALJA 1FXWF 2AJTA 3PTZA 3AZQA 4HOYA 4XLZA 1KAEA 2DFKB 1DO8A 1LBQA 1ZNQO 3EAGA 1P6UA 3ODGA 1EQ2A 3OJWA 4H1UA 4WFIA 3W3AA 4AL4A 2IZ7A 3AKCA 3K71B 5HFAA 3W0LB 3K9CA 2AG1A 2OORC 2XT6A 1W0JA 2AEJA 2RGEA 1NP7A 3GYGA 3N0TA 2WIJA 3DKKA 3NP9A 4CIXA 2PKRA 4KWEA 2XRMA 3A6PC 3IL2A 4JXZA 3IBSA 3NDRA 2AFHA 1KMHA 1V5EA 4H35A 1J9EA 5KYYB 2QGZA 2OO5A 3BJRA 3L43A 5D01A 3ESBA 3IV9A 4YFYA 3AKDA 5K6RA 2JLYA 2WZCA 1HT1E 3HEMA 5EAIA 4LQLA 1T5SA 2AUMA 1VJTA 1JLHA 5BN1A 4IIYA 4JBWA 2XWQA 4N40A 2XT9A 3KWJA 2AH5A 5HIMA 2QL5A 4AECA 3QBEA 4NULA 5I7SA 4Q6BA 1ID8A 1R5OA 1K5DA 1LV7A 4IQGA 5E0OA 4LVUA 3W5SA 4KN5A 4KH0A 3RVSA 3M2PA 4AYXA 4W8OA 2H2WA 1B7GO 3ZK9A 2QZJA 4A6PA 3WLKX 1NNI1 1OAOC 4QVIA 2YOHA 5ESDA 1DLIA 1M6YA 1OTYA 3W9YA 1D4ZA 5JI3E 1O89A 2G67A 2JAQA 1ACJA 3FMGA 4DV1B 5CUQA 5IXSA 4BE9A 4DLYA 5DF1A 2IOFA 3WWZA 2HJGA 2AJLI 2FFBA 1FFSA 3MK31 4A2QA 4ZHQB 1UZLA 4AY3A 4TS3A 3DO5A 2OAP1 2VOEA 3VNVA 2AOUA 1H65A 3AEKB 3KXKA 2VYVA 1YVUA 2OHXA 2PXHA 1V3TA 4FILA 3V33A 3E27A 4XX0A 1RKQA 5TJ9A 3GLFE 3FCUB 3FMFA 4FZRA 3SM9A 4MH0R 2H5EA 2AOVA 2XUIA 1LLCA 1KI1A 2RGUA 2VBFA 2YN2A 4GSLA 4JP3A 2Z6VA 521PA 4JVOA 3ABOB 3TL2A 2C3UA 2WHYA 3C70A 2OHIA 1RW4A 5CD9A 2Q5IA 3ZJTA 1TVCA 1C4XA 3X2FA 1HQYE 4F7WA 4IJUA 1L8LA 1Q2XA 4MP8A 5D3MB 1Z13A 4EUEA 2HH9A 1T6XA 1GL6A 3UFXB 2Y2VA 1F7UA 5AMXA 3KE9A 4HMPA 5A9SA 1JHYA 1CY8A 1C3EA 1KJ9A 1OI7A 4IS3A 4BFVA 1JFTA 4BDSA 1JR3D 2R79A 2I29A 2JK1A 3E9EA 5H4HA 3IAS1 2VPIA 1Y37A 1Z5PA 1ZD4A 2H9AA 3DAGA 3Q6IA 5TPZD 2V5AA 3ZCRA 4CVNA 4LJRA 1WB6A 2VH2A 4OI0A 4JMPA 3OAAA 3TRKA 5DCYA 1W4AA 5J58A 3QVXA 4A6EA 4HQFA 1CE8A 1U90A 3GLVA 3E9CA 1NBME 1NU8A 2H51A 1NBHA 3VNBA 3STYA 3KL4A 3G7SA 4P33A 2D06A 4HN4B 4H7JA 3L3BA 4J29A 2OKCA 1KOLA 4B83A 4NJEA 1J6UA 3BMCB 1A0OA 2DP4E 2FPGA 2GSWA 2H1CA 2ZUCA 3L8FA 2P65A 3QA9A 4GR4A 4XI9A 3IVMA 5EE1A 5FBLB 5AXCA 3U3ZA 2F3TA 2TMDA 3GOHA 5A03A 2QZ4A 4HPJB 2PH7A 1KK2A 4XLTA 4PZLA 2XX3A 3UAGA 2HPAA 1JIIA 1VKOA 3DC2A 3QIAA 4G1CA 3PEUA 3FROA 3R7SA 5AVUA 1NKTA 2B69A 5SY6A 1UXHA 4ZI2A 3U3JA 1GCAA 2K87A 4KDCA 3EXG2 1IQPA 1H85A 3R3HA 4S2EA 4F3KA 1CVLA 4N8SA 2DR3A 2WINI 2Q1TA 4BBZA 2YMLA 2ZSFA 4L08A 3T99A 3TK1A 3V80A 1G5PA 2C83A 3CWZA 5AKLA 5K3BA 1CJTC 2I0FA 4D9CA 1Y8QA 4BUCA 5B1EA 3U7FB 3MB8A 1JKMA 1T9CA 4F9EA 2VJCA 4BFXA 2BOVA 2P1ZA 3WLEA 4BX0A 3P9ZA 4WK2B 1I0IA 4CTJA 2GXAA 1GSHA 2WWFA 4C4YA 4QNNA 1E58A 3G9ZA 4CI0B 4DIUA 1GCGA 5B30A 3P0EA 5K6AA 1KKLA 1O96B 1P3DA 4EG6A 2COKA 3BAZA 3VJKA 4HQOA 1N2OA 4UQPA 1A3CA 3L8GA 1Z74A 4DYVA 3HE3A 3KWFA 5JFOA 5KYKA 2ZRKA 2H5LA 3CVOA 1ST3A 4M1SA 3T7TA 1KO1A 1XUOA 2W00A 3AFIA 5COAA 3Q6MA 1ZRHA 4CM8B 2NVUB 3IAXA 4HDKA 4Q15A 1FJHA 2JFVA 2QOEA 3VI4B 3H5VA 2CUZA 1QFSA 5K3FB 4BVEA 1CYEA 3MOIA 2P40A 3EN0A 5DW3A 2YC4C 1T5DX 2REOA 4ZOAA 4RX1A 5HUJA 3ZWBA 2A9FA 4LWQA 4HSEA 5KWEA 2DM6A 1RYEA 1LBEA 3SFTA 1EE2A 1U94A 5KOHA 1T9ZA 1AMUA 3RADC 1ADYA 1FDTA 5TIIA 4AZ0B 3H97A 1NOKA 2VG8A 5IFLA 1DARA 2YNMC 4KFSA 4EOGA 1TRHA 1BKSB 3IOYA 4XOUA 4KR2A 2EX0A 4P4TA 5GZ3A 3J81k 4IIJA 4BZQA 4XD2A 3EG5A 1G9XA 1NXTA 2QSJA 1W44A 4J1NA 2VUHB 1XE3A 4NEHB 4E4YA 3ILXA 3U4QB 2HQSA 3NHUA 4W6QA 3TWOA 4DMGA 2BFAA 4O4LA 5CW2A 3E8MA 1GAWA 3KQQA 3O90A 4KPGA 1PWXA 4HEA1 1J21A 4WESA 4YXWA 4I8DA 1L4KA 3RUDA 3UA3A 2I3GA 1GR1A 2WIBA 1BRMA 4DSAA 5BSKA 1ZUHA 3SR3A 1SWVA 2BEUA 4D4HA 1HLFA 3FWNA 3KSZO 2XUKA 1WWKA 3I2GA 1MH1A 3KHTA 5JNWA 1SXGA 4MWOA 5EESA 1E5LA 3MGGA 4KB5A 1XZJA 3SYNA 4ZDIA 4PPFA 3UVEA 5BXYA 2O7RA 3M1YA 2DUNA 4KWCA 3ED1A 1WPRA 4Q1VA 3FF1A 3VAZA 2HHLA 2D2VA 4YRTA 5H7XA 2NGRA 2X4LA 4O4IF 4IWYA 2XTZA 3MJDA 5CEFA 1DG9A 5DRYA 3QVLA 4BBPA 1OC4A 1Q57A 5KMGB 1Y4ZA 2YZ7A 3NIBA 4X9XA 1TAQA 1DG1G 3DP7A 3E9YA 3RFVA 3CRMA 1FRNA 3E82A 1LDMA 3P0FA 4BWVA 5ESRA 3BUSA 1QH8A 3TZ6A 5H70A 5K0GA 3WHPA 2ZUBA 1LDYA 5JH7F 1PFWA 4TSKA 3IXLA 4BP3A 2QVXX 2ZIUB 2YV1A 1PG5A 4S0ZA 4U2DA 1TW3A 4LMBA 2G7MC 3DTVD 1Y7PA 3ISTA 4GE0A 1G0OA 3CW9A 4LCEA 1KZ1A 1OYOA 1VJRA 1X92A 3HWRA 3SK0A 3BCHA 5BQ5A 4HNQA 2BFOA 1N3BA 1XCPA 4KLCA 3VXKA 3ZH2A 3WICA 2D62A 3P9RA 2XCIA 2C2XA 2CJPA 4Q6WA 1GIAA 2MSCB 3BWXA 3KEGA 4F21A 2EW2A 4C22A 1P72A 2CCGA 2O5VA 2OFPA 3CVJA 1U8YA 4II3A 5JARA 1UOPA 4B4WA 4NOLA 4PC7A 2HPZA 3I2YX 4B4VA 1R7RA 2FRDA 2Y1DA 2B1IA 4RD0A 1L1FA 1YDWA 2ASEA 2GN0A 3CLRD 4BCDA 5D85A 3KJEA 4Q7MB 5ECDA 1A5SB 3NNSA 4NYJQ 1FFCA 3GZ4A 1YMVA 1TVMA 2VQFB 3QMPA 1D1QA 1US8B 4L78A 1EU1A 2R9VA 4Q0MA 4REQA 4BPRA 1RADA 1T8WA 5EINA 5B58C 2BD0A 5JXJA 1A5AB 3LY5A 4JR1A 1PDWA 2JH3A 3I6QA 2I78A 3IUMA 1TL7C 4ZGGA 4MW4A 2F9LA 2G1AA 1SC3A 2YFKA 4L9RA 2JGJA 3U37A 4B87A 3Q6NA 1PYGA 4PVCA 3T9CA 3GGSA 4FCTA 2Q3FA 2AOWA 3OHMA 3KKMA 3D1LA 5JOQA 3O2JA 1XL0A 5FQNA 3B3JA 4Q03A 2QTWB 4XWTA 3CJRA 3BH7A 3GCGA 3B1KA 1P9OA 1D8TA 2NYRA 4J9VA 2XGOA 3OD1A 1GVNB 1LBSA 3OFND 4U6NA 4Z8YA 5FIUA 3ZQJA 1YI1A 4C4TA 2C00A 5B4VA 1ECLA 2VHYA 4M86A 3RBXA 2R48A 1UPAA 2XA1A 4DCPA 2XYRA 3S3TA 1KIAA 4DT1A 4HLUC 2W6JD 4DDTA 4O1HA 2I4OA 1XQVA 6NULA 5CYFA 2PD4A 5AFSA 3F4BA 2HIAA 4KXWA 3KLNA 3AM5A 1IVYA 1R37A 5LP6A 2PL3A 1DAIA 2WJ3A 2C88A 3MIIA 3KG2A 5T3YA 3HCCA 2ZR0A 4TS1A 2IZOA 1THZA 1IH8A 5KYWA 4NE7A 1SIBE 1YF3A 4IXNA 4G63A 4JOQA 2ISSD 4GXRA 4IIDA 4HZUB 4F4IA 3UFBA 2C5BA 3LHDA 2ZVJA 3IBYA 1A82A 4UXHA 1I3OA 4CEHA 4DLUA 3WADA 4M60A 2ZRFA 3LP5A 3N1UA 3ZU2A 4MWSA 4GLJA 2CFOA 3R1IA 4EKNB 3IAM1 4EF5A 2GRUA 4C7MA 4NHEA 2HU8A 3LQRA 4HAWA 4J3NA 1YB5A 3HDJA 1X1QA 4HEJA 1DL5A 4LF5B 4NG5A 1P17A 4Z9XA 2UU9B 3CF2A 4R51A 3B6MA 1P5HA 4ID3A 1ZVVA 4XWWA 1U2GC 4TPKA 1RLIA 3W2HA 3DEFA 1G63A 3ONDA 3NAQA 4U9HS 1GL7A 1E62A 3U09A 4C7VA 4MW1A 2C4NA 4G85A 1QVWA 2BY4A 4TSFD 1G20B 1IHYA 4YTEA 2YJTD 2P9CA 2RH4A 3FPHA 1JEEA 4TLCA 2VEOA 3HWX1 4G56A 3VOAA 4W5OA 4ON9A 5C0OE 1VKZA 2PKEA 4BMCA 3JWGA 4WKBA 3HU5A 3WJ1A 4FKBA 1I1NA 3Q3VA 1J0DA 2JW5A 2GCOA 3F8TA 3PZBA 4ZO6A 1TEZA 5TV2A 1GPDG 2NSHA 4MVJE 3HGQA 1G98A 5FTWA 1XXHA 3GAMA 3KLPX 1Q0UA 5FL3A 4ZV9A 3MHTA 4G26A 1VBFA 1QYXA 1GPUA 1RM4A 3GLUA 1D2EA 4B33A 1Q7EA 2PTHA 1II0A 4CZ2A 2C7RA 1XHLA 2QRJA 2GAFA 4YB8A 4CMEA 3E2PA 1B0PA 4A91A 5IC4A 5T4HA 1OI3A 1OXUA 3HKBB 4IDOA 3BD7A 3U3MA 4FDAA 1JP7A 3L9WA 3T95A 1E59A 4C29A 4L22A 3GFRA 2V6BA 1M7GA 4TXLA 4EHFA 3D31A 4AMVA 1P6XA 2BELA 2ZKIA 1VIMA 1TE2A 4J4BA 2Z83A 3U48A 1RPJA 1J8MF 3I0MA 3KV3O 5AH0A 5FT9A 1Y3BE 3EWSA 4HGNA 4L07A 4MUFA 2JIQA 4BOYA 3MSCA 4IZHA 1HYEA 2REXB 3CQ9A 3M1AA 2JGNA 4FGKA 4MCJA 5F7JA 3RTDA 1CNMA 3WRYA 1U5BA 2XCUA 4KMMA 3V34A 4WIAA 2VPZA 1T9DA 2CNWA 4YBZA 4ZJYA 1N2XA 3FWLA 3FWKA 1HPLA 1XZMA 1EX1A 2FJUA 2NU8A 2OCPA 3FUCA 4D92A 5FR2A 4NARA 1JEAA 1MPTA 4NQRA 2QIOA 1O2DA 5JAQA 1YS7A 1NVWQ 1Z29A 2X40A 3G17A 3IDZA 4IQFA 2DUJA 2WUVA 3MWFA 5EWJA 5JY1A 4R1MA 1W8IA 2NU6B 2RJOA 4Q7QA 3L01A 1NVKA 3G13A 3SKVA 2GCEA 1B26A 4I14A 4B4KA 3IV7A 3RVOA 3WNCA 3WE7A 2WF6A 3E3NA 5BMOA 4PYRA 3R6DA 2VJYA 1L5YA 3O84A 4H60A 4R1NA 4U2GA 4CMIB 1DKRA 3KJFA 4B3GA 2C7PA 4AQDA 5CPFA 3NH9A 1Z83A 3NV7A 5EE3A 3EODA 1AQIA 5C9ZA 1JHUA 2JI9A 1DV2A 1K6IA 1H6DA 2WFLB 3C3EA 3GT7A 4IRMA 4NCIA 4NVRA 2XEXA 4B45A 4C1BA 8AT1A 1MZPA 2AEEA 2AOTA 3LO8A 2B61A 2Z2XA 4DXAA 4J0KA 2RHWA 2WJWA 3E70C 2I6GA 5AKXA 3BIFA 3RT1A 2VPPA 3HJUA 1HETA 3NALA 4BO8A 4BNUA 4QUGA 1R9NA 2JAUA 3GDHA 3L0DA 5KJ1A 1S2IA 3NLLA 3ZBUA 5B12A 3F1KA 1DHRA 2PX4A 3K9HA 4ZIRB 1HUQA 4ZI7B 5G3ZA 1ISRA 3P45A 4Q4HB 5LD2C 4Q1DA 1ISMA 1T36A 3H4IA 1LRJA 1OKKD 2QRUA 4I3HA 2Y1GA 1I4WA 1NFRA 4HRAA 4UTRA 1TD9A 4OYRA 3GMDA 4Q3KA 2PV0A 3H1BA 5ADHA 2B9EA 4BQIA 3ZWMA 1TQHA 1V9CA 3D6TB 4N0EA 5BVHA 4L8FA 1G64A 5IN4A 1O94A 4R1OA 3A9RA 4RPGA 4PZUA 3D7KA 1VLVA 3OCVA 2EYQA 1Q77A 2FMUA 2V3WA 3PQ2A 4IV0A 5FRDA 1KSGA 4C30A 2H1HA 1J8VA 3R0XA 5H81A 1VPLA 2MHCA 1KDTA 1QH1B 4GWLA 4PINA 3RWMB 4DSTA 3L07A 4R2MA 5IARA 1QYWA 1NJ8A 1JEJA 3W4JA 5JBNA 2AG0A 4YAJA 1TCUA 2G5PA 4UVGA 5HDQA 4HDNB 4L2IA 4E5PA 1RI1A 3PRJA 4YS6A 1ZHOA 1JNXX 3ZNNA 4YUZA 2R6AA 1OB5A 3AF5A 3DOIA 3LXRA 2RGRA 1WTAA 3DWEX 1XSEA 1E89A 1ZKDA 4HGYA 5EJAA 3AR7A 3MGBA 3EG9B 3FIJA 3FTDA 3LQFA 3L05A 1PEDA 3AHGA 3HDGA 3FSGD 1JHPA 4U2EA 1PSDA 1MAAA 5I4BA 4WECA 3G59A 2JFXA 1J2RA 4YPFA 1W2WB 1AGXA 3B1VA 2HMSA 3WI7A 1ZVMA 4NPHA 4P7JA 3MRTA 2BGWA 1NBEA 1R0RE 3BXHA 4AG6A 2AFHB 1KMHB 2Q6VA 5CLGA 3TW0A 2DFDA 4ZQCB 3AERA 3MLAA 4RK5A 2W4QA 1ZI8A 3CX6A 1OOEA 3HWWA 4FD3A 4D45A 1RZ3A 3KEOA 4IDDA 1MKYA 3JQDA 5CVJA 5U9CA