2NMVA

Damage detection by the uvrabc pathway: crystal structure of uvrb bound to fluorescein-adducted dna
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
Knots found
sequence length
652
structure length
620
Chain Sequence
DRFELVKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/dna
molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Damage detection by the UvrABC pathway: crystal structure of UvrB bound to fluorescein-adducted DNA
pubmed doi rcsb
source organism Bacillus subtilis
total genus 224
structure length 620
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2nmvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA01
1YHNA 2FWRA 5JLJA 3HR8A 1G8GA 4KCGA 4KFRA 1NBMD 1OFUX 4EPWA 1W2GA 3LBHA 2OT3B 1P72A 4PO1A 4XSGA 2ODBA 3CB4A 3MFYA 4A2PA 2XB2A 3AP3A 3AVUA 1KDTA 2MMCA 1XRJA 1P9RA 1TQ6A 5JS7A 2EFCB 1ZM7A 3TKLA 4MYUA 1ZU4A 3P1JA 4R9UC 3U5ZB 1FZQA 4NYJQ 3W6NA 4B75A 3GCGA 1N3BA 2ZUCA 4GOJA 4YMUA 3G0HA 1II0A 4RFSA 4D4KA 421PA 4M1TA 1IAQA 3WMGA 3C14C 1UEIA 2YV5A 5AK0A 5E7MA 3UMSA 2WWXA 1JJ7A 4IDHA 4UJ5A 3U3OA 4BE7B 3UATA 3P20A 4JSYA 2FJUA 4PSAA 1BYUA 4M9SA 2V1UA 1KSHA 1GL6A 4GP7A 4GZMA 4M1KA 4AKEA 5JI2E 2L0XA 5KPJA 4TTRA 3M4YA 3TQCA 2QT0A 4A15A 3TR5A 4N0DA 1IXZA 2IXFA 4BZPA 1LVGA 1OXTA 3AV0B 4G1UC 1OXXK 4YLGA 3K0AA 5CITA 2WJYA 1HT2E 1ZW6A 3OESA 1Z6GA 4A2QA 2LWIA 2WSSD 4BFTA 4A9AA 4I1VA 4YMVA 3GLHA 4IEEA 2BKEA 1G6OA 2AWNA 5AUOB 2QGNA 1TADA 4CGZA 5FR1A 4US2R 4I1OA 4BFYA 3A1UA 4A36A 1SHKA 1XD8A 5FBVB 2IUUA 5CDFE 4OQMA 4EKDA 3VR2A 4Q1CA 4FMCB 1DG1G 2F1RA 3GQBA 3H84A 4HSEA 1S0UA 1Z08A 3B1XA 5G40A 2I1QA 1E2DA 4RSGA 3IQXA 1N6IA 2IYUA 2XX3A 3TBKA 1NNEA 3ZLJA 3ICQB 2ZJOA 3OZXA 2QENA 1KI1A 2OFOA 4KO8A 4P32A 2O0JA 2ZJ5A 4O3MA 1P60A 2XITA 5F98A 2O0HA 2G77B 5JBQA 1E2IA 1XX6A 3RYTC 1R8QA 4PHHA 3FTQA 2ODEA 1HEIA 1Z8FA 4HB2A 2HCJB 1XTKA 1CKEA 2ZSEA 1G8HA 1FTNA 5TDHA 4RZ3A 2GESA 5DISB 3U6BA 1KSFX 3DEFA 2J46A 3T1OA 1G8FA 5EUMA 3UMFA 3K70D 2EWWA 3FYHA 3MD0A 4LJ6A 3QG1A 4JLNA 4X8OA 1RYHA 1SVIA 3DKVA 4L4UA 3W3ZB 4OQNA 3JVUA 2R6DA 2WICA 2ZSFA 3VR6A 1CTQA 2FZLA 3FHTA 4IDNA 4CT4B 3KFVA 1W46A 3BIFA 5FUWA 1JJVA 3BE4A 4PC1A 2VSOA 3T15A 3F0TA 2CXXA 2NZ8A 2ZI6A 3BB3A 5D3QA 4OK3A 4Q7KA 3SJCA 4DSTA 1GUAA 1GL9B 4MKHA 1KI2A 3IEUA 4OK5A 1DG3A 2WWIA 3KUDA 3LVQE 2C78A 4WZBE 3GLIE 1W5TA 2V9PA 1CR2A 4BRUA 2QBYA 1W47A 4F4CA 1NIPA 5KTYA 2GF0A 4U02A 2VP6A 2CL7X 3Q85A 4HLCA 4TMTA 4V0NA 3VR3A 3U7EB 4DVGA 3TE6A 4BECA 3AKCA 3U6KA 5BN3A 4UNSA 4PANA 1E2LA 1QHHA 3B82A 1S3GA 3G82C 4JT4A 2J9RA 5KSPA 4NL4H 2CVHA 4EQ6B 1VTKA 1U90A 2ZRAA 4MGIR 2J0VA 4BWYA 1BH2A 3KDSE 4YXWD 1NI3A 2YVUA 3CO5A 4K8OA 3ADDA 1G41A 4U5XA 2GAAA 3OEED 1KI7A 4AK9A 3UG6A 3IEVA 1PVOA 4JL5A 1EX7A 1OFHA 2NOAA 4IW3B 4F92B 5HZHA 1Q20A 1VPLA 2OAQ1 3RANA 1D9ZA 3O8RA 2ZYTX 1FQKA 3FB4A 4G01B 1K5GA 1NMYA 3A1SA 3HU1A 4GFDA 5G3YA 3L0IB 4CEIA 4C0JA 1Z6XA 3VKHA 4TL7A 1UKYA 1OIXA 3ND9A 4D0NA 1ZUIA 4URWR 2RGXA 4G5GA 2FX3A 4L9SA 1T8UA 2F6RA 1G64A 1KOFA 1P2VA 4JBXA 4QGFA 4DDVA 1T0JB 1RE0A 2WWYA 4TYWA 5B64A 4PFSA 1MKYA 3OHMA 4Q1FA 4AYWA 4ZI2A 5KUTA 3K0AB 1MT0A 2OESA 3LW7A 1E9RA 5KDLA 2DFKB 4W5JA 2W2VA 1JXMA 2BEKA 1G3QA 2GJ9A 2IS2A 4AYTA 1HQYE 1LF5A 3R9IA 3W5IA 2C04A 2Z43A 3I73A 4IFBA 4XJXA 2JAQA 1KJYA 2ZQ5A 4EFLA 3LW8A 1X86B 1ESMA 2XNSA 1Z2CA 4TLEA 4IOLA 3V4FA 2FSHA 4Q18A 4GPTA 4GDFA 3Q72A 4CF7A 4KITB 2XZOA 1AZTA 1OHHD 2XB4A 4KSBA 4EFMA 3QKRA 4M9ZA 3TJZA 3UG7A 3QXCA 4JLKA 3AVPA 3DZ8A 1G17A 2IS4A 3I92A 4XWAA 2W83A 4A0GA 1GSIA 1MH1A 3FFAA 3RS5A 2VF8A 1D9XA 3AKEA 3CX8A 1MR3F 3A4LA 4AC9A 1NLFA 3AVQA 4Q21A 1MO3A 3IHWA 1MOZA 2RH5A 3VKGA 3X1DA 4F4JA 3EZ7A 2IT1A 4PHFA 2J7KA 3PUVA 4FMDB 5K8TA 3L0SA 1ZC4A 3T35A 1ZM4A 2XNDA 4TL9A 1D2MA 2ZITA 2ZSAA 3CBQA 2F3TA 1UM8A 4O2RA 5C4GB 2VBCA 5CB6A 3B2EA 5BQ5A 1XXHA 2BWJA 3QKUA 1XPOA 4PO9A 3ADBA 4RZUA 2R2AA 5A4JA 3CZQA 4UXJA 1T5LA 2BOVA 4K46A 4LJ9A 2QL6A 1KI3A 4HLDA 4OQLA 4QGGA 5EE0A 3LLMA 1DPFA 4B43A 1R4AA 4C9BA 3E70C 5H70A 3AF4A 2CHVA 2ZRBA 1C1YA 1IONA 2XXAB 1II9A 5FR2A 1JR3A 1TUIA 2ZYVX 3ETLA 2VH5R 2XZPA 2ZE8A 1FQJA 4ILEA 3WXMA 3OFND 4FXPA 5JEDA 3ZS9A 2ZRCA 3TAHA 1AQYA 4JVSB 2OBLA 1L4YA 1XTRA 4OL0A 5FL7D 1U81A 4FCWA 1E1QD 4QGAA 1N6HA 3LRPA 5KSZA 3FPAA 3SR0A 4JMPA 4OKSA 3CRW1 4BZQA 1MABA 2ZRJA 3WHLA 2ZREA 4C0AC 2D62A 1QHHB 3EWAA 4MRPA 4XTRA 1W49A 4RD4A 4JLBA 2J7PD 1V5WA 1ZNXA 4D0LB 2QTHA 3CR8A 2HF8A 1GVNB 3IBGA 1NJFA 2ZI4A 1G8YA 3H2YA 3P4XA 4NCIA 1COWD 4CT5A 3R9XA 4MYHA 3N5CA 1RRCA 3ASYA 3K0CA 5E4FA 5JSZB 5AJVB 4CEHA 4TMXA 1G291 1KSJA 5FPSA 1QBKC 1Y3AA 1D6JA 3BS4A 4GT1A 1A2KC 1AA9A 3NBYC 1I2DA 3OIWA 3KZ1E 1LY1A 3ZD7A 2JLWA 2ZU6A 4QM7A 3Q3JB 3SHFA 2WJIA 1WBBA 1E2HA 2AKAB 2JJ1D 3CF2A 2RGCA 5CYOA 2Q9BA 2ZTSA 1E1RA 4NHOA 2X2FA 2QGZA 3NHAA 2CHQA 3GEEA 1Z0FA 1K6MA 1U9IA 2ZI3A 2H57A 1W0KA 3TVDA 4IVPA 4GRAA 2P6NA 1ZCBA 2J59A 3QF7A 1KI8A 2LCFA 1P4SA 1SKYE 3KB1A 4TYPA 2AXPA 1UDWA 5CYPA 2PZFA 3GP8A 4GSYA 3QE0A 4KHZA 1KJWA 1GOTA 4BFVA 3WBKA 2MSCB 1JEDA 5J4HA 3SJZA 2ZYWX 3UWKA 1E79D 1ZIPA 4AIIA 5L8VA 2IS1A 1W0JA 4LC0A 3QKRB 1CRPA 4HEJA 2AWOA 2DB3A 2IA5A 5KDDA 2HXYA 2VLIA 2C9YA 4LBYA 2RKOA 1DAMA 2GHIA 2X8AA 5G3ZA 3CIOA 1Z29A 2MMGA 1F60A 1Q12A 3PUYA 1AN0A 2FSIA 2WMNB 3K8YA 3LNCA 4TL8A 1NVXQ 2E1RA 4WA7A 3D7MA 4FCTA 4DIEA 4BASA 4BLPA 4B2LA 1KIMA 2VSXA 4Q1BA 1VECA 1AGPA 4FW9A 1HE1C 1EWQA 3B8HA 3FMIA 3SE0A 2HLDA 1XXHB 1UPTA 2BCGY 4JBWA 1Q1QA 4DDTA 4KBFA 1E6CA 1DVRA 4RD0A 3OIYA 4Q9JA 1A1VA 1UAAA 2RGGA 1SXJD 4QC2A 1S1MA 1BOFA 5J40A 1NBME 4RFVA 3AVYA 4HUQA 1P9WA 4WOPA 3MWLA 5FH9A 2YKGA 4C2TA 3AEZA 1CP2A 2OCYC 2A5JA 2RGBA 3C5CA 2PEYA 1U98A 2PMDA 2Z0MA 2C98A 1NMXA 3GJ7A 4R2IA 3QKTA 3RDPA 3ZD6A 4FWIB 2VIIA 1SKYB 5AR1A 1CULC 3ZGXA 2GNOA 2CE7A 3TAUA 4TSFA 3X1YA 2D4HA 4MKFA 1XMSA 4XOIA 1TF5A 2D7CA 3CH5A 4A92A 4Q4HA 1VKJA 4XVQA 1N2CE 1IXSB 1DAGA 1R5OA 1FX0A 2X77A 3B78A 1JBKA 4FMCF 1B23P 4OHVA 1MABB 2O8DA 4OJKA 4DKXA 3A4MA 5GJCA 2XSZD 1VIYA 3VHXA 3T5DA 3THWA 2FV8A 2P6UA 3BERA 4JL8A 3PEVA 1OKKA 1VHTA 2ZIAA 4PZYA 2Z6VA 5LBIA 3AH8A 1BKDR 1E2NA 2Q3MA 3TVTA 2PLFA 1ZJ6A 3CM0A 2AD1A 5TB5A 4ZDJA 4W7SA 1AM4D 1US8A 2FGKA 2A5FA 3OE7D 1I2MA 4JJZA 4Q7JB 4Y0AA 4Z1MD 5HPYB 4CEHB 1ZBDA 3ZYCA 4URVR 3I1FA 1KO5A 3BH6A 5FTJA 4A0HA 3CZPA 3NKVA 4OI0A 2I1VB 5FOWA 1DARA 2F43A 4NONA 1N6NA 3R8CA 2XTNA 4FIDA 3SN6A 2QM7A 4PXAA 5IDVA 5FUVA 1WCV1 3BH0A 3A1WA 4QBIA 3ZQJA 3EA0A 1XZQA 1Q1EA 4DLVA 3DHWC 2WPDD 3KKOA 4TLDA 1GKIA 1N5IA 1X1RA 1T3LA 3TSZA 1Z07A 2RHDA 1DOAA 1G21E 2ZAMA 3SNHA 4YMTA 3EW9A 3OF5A 4HAXA 2FPKA 5DLQC 1QHYA 4KFTA 5TY0A 2GA8A 4LHXA 1DO0A 1X8LA 3MCAA 3LX5A 1AQUA 1GNQA 3KB2A 5CIWA 1N5KA 5IK2D 1GIAA 3K0CC 3TIFA 3PXGA 1GNPA 5EP2A 1KDOA 2ZUDA 3Q9LA 1SVWA 2AK3A 1YR8A 1WE2A 2W6ID 2ZE7A 4TTPA 5DHAA 5AJXA 5HKKD 2EFHB 3DOFA 1IY1A 1TF7A 4MUBA 4RCZA 3VFDA 4AKGA 2GVDC 2A5YB 1R0YA 1G7SA 3HYTA 4QL3A 3SBEA 3HYRA 3EX7C 1OB5A 3PUWA 2G9NA 2QTFA 5DGXA 4D26A 4M1SA 1PJRA 4B73A 1CR1A 4F7WA 3UKDA 1Z0AA 2VHQA 4WW0A 3RS3A 1WXQA 1DBSA 3TUZC 4NMMA 2PCJA 1U9IC 2Z4RA 2IF2A 3PR1A 2GF9A 1P5ZB 5FPKA 2FE4A 1L4UA 1E9CA 3BAFA 5GJBA 4DT1A 2GCOB 3K0SA 1CEEA 3X1ZA 2FPMA 2NO0A 1GRQA 5FPTA 4S35A 3BWDD 2QT1A 4AKIA 2G88A 3ND8A 2ATXA 3IQWA 4JBYA 3SQWA 4C0BA 4XTCS 2B92A 1EFRD 1D5CA 3Q7PA 1GRNA 4B44A 3RLFA 2JDID 2F1IA 1S2MA 1GILA 3QKSA 1TQ4A 2JJ2A 4G3XA 4R2HA 1R5BA 2BM0A 4URUR 4DZZA 1KNXA 3D8BA 1VCOA 3HU2A 4DB2A 2IL1A 1F2UB 1P7CA 2Q3FA 4B2PA 2GXAA 1S96A 3FVQA 3L0OA 3EPKA 2ERXA 2JIZD 1UBEA 4LJYA 2ZJ8A 5L3SB 2O8FA 1ELOA 4LYFA 2D7DA 1G7RA 1FX0B 5H1YA 1XD2A 2AN9A 2D2EA 2WWWA 2WOJA 3P27A 2IYWA 5A5GA 721PA 4Q01A 1NVUQ 3ZH9B 4OJQA 1NJGA 2GILA 3CNNA 4M9QA 2IX3A 1HYQA 2CNWA 3THWB 2P5SA 2HJVA 1WDTA 2NGRA 2QA5A 2ZR0A 2ZUBA 3DMNA 5JS8A 1ZIOA 4JKYA 1ZYUA 2R6AA 5EE3A 3TSWA 4PR0A 1EGAA 1O87A 4RD3A 2RB4A 5JHHB 3EG5A 1Q1BA 1US8B 2IXEA 3V00A 3U3KA 3CF6R 5HZKA 2QNRA 3H1TA 4OQXA 4FMDF 2JATA 4PX9A 2QRZA 2NQ2C 1G3IA 1EX6A 2IYZA 1F6BA 4XIGS 1JEEA 3MMPA 4Q5IA 1DAHA 5IT5A 5EZ6B 2F43B 1XEFA 4C30A 1NY5A 2B8TA 1F48A 4PSVA 1LNZA 3R9WA 1XZPA 1JALA 3U4QA 2Q6TA 2OUKA 3RC8A 3EZ9A 3H0KA 1R0WA 4EDHA 2P0EA 4PQYA 1KK1A 5EP1A 3WMFA 3L82B 3T5GA 1VCIA 1YVDA 2WMOB 3HDTA 3CPHA 1XTIA 3GFOA 2QI9C 1G6HA 1BO6A 1CJKC 5DN6D 2YOHA 2WHXA 4Z51A 1P73A 3ZIAA 1KO7A 1HUQA 2CJWA 2FMXA 2H18A 2QE7A 1R7RA 1G5TA 2B7CA 2WZQA 1IN7A 1TEVA 2CCGA 2CVFA 3M0EA 5CJ2A 1ZINA 1NLZA 4KXFB 1SULA 3I62A 1ZD9A 2FPLA 1EG7A 1FUUA 2YC2C 2ZSDA 2XOKD 1KDRA 2QEQA 5KNBA 3CX7A 2IUSA 2V6IA 3ZQ6A 4PTLA 2WBLC 5TXGA 4IRUB 4D82A 2R6FA 3CKLA 1AS0A 2OBNA 3QEJA 4KJZA 4UKDA 2X19A 3PFIA 3HJNA 5DYGA 5FBLB 1AZSC 4Q7MB 5CLQA 1JPNA 5JWOA 4W5WA 3FHOA 2JJ8A 5P21A 3LV8A 2FSFA 4XVRA 3B60A 5SZIA 2BC9A 4YMWA 3VX3A 4DCTA 4P3YA 3UK6A 2HT6A 3C4JA 4TT3D 4C3ZA 2ZR9A 2JLZA 1MRSA 1U2RA 3GLFE 1XPRA 2EWVA 1BYIA 1S1CA 1F5NA 4DT1B 2BMEA 2W00A 1LF0A 2ZJBA 2VPPA 5KHOC 4V0ME 2G3YA 1CJMA 1M34E 2GCPA 2QAJA 4TL6A 2CE2X 1H8HD 4YDSA 3QI2A 5DIFA 1HA3A 3GLIA 4UXIA 1SQ5A 3DM9B 4FINA 4TZ0A 3REFA 3F8TA 3CWQA 1EFTA 3ASZA 4Q4JA 3A1TA 1N5LA 3QKSB 5FOSA 4MITA 4IHQA 3GJ8A 5B30A 1IY0A 4V0OA 3X1WA 2FFHA 4FI3C 3TMKA 4LYAA 4EFNA 1W36B 4N1AA 2JASA 2O8FB 5J4KA 1P6XA 2VSFA 4EIWA 2QP3A 2AFIE 2VYFA 1XD2B 1Q44A 3QJYA 4XWKA 4BFXA 4B3GA 2AFHE 4NH0A 2BMJA 1Y63A 2CLSA 1EFUA 5GVSA 1YR6A 5JCPA 3LH5A 2ZROA 3B1YA 1MV5A 4URYR 1J70A 4CRWB 4B47A 4B6EA 1KK3A 1GFIA 1FW6A 3WNBA 1Z0KA 1XCMA 4CEJB 3DMDA 4XD7A 4Q9IA 1ZM3A 5AJWA 1E2KA 4I99A 1AK2A 2AL7A 4JT2A 3GLFB 1JNYA 2V6JA 3LQRA 4MH0R 2ZXUA 1CS4C 3VMAA 1QG2A 1C9KA 1BMFD 3C41J 4ZV4A 5DI9A 4B3BA 2XGJA 3MWKA 2QY9A 4WVFA 1IBRA 3PITA 4AWXA 2CK3A 3NH9A 2O8BA 4Z54A 4PC2A 4BLOA 1W36C 1KY2A 2PCLA 3U4QB 1E4VA 1FP6A 2WIAA 4US0R 3WHKA 3RRYA 1TU3A 2WKQA 1ZUHA 5HR5A 4P31A 2XXAA 4GOXA 2BHRA 1CBUA 1WP9A 1XTJA 1NIJA 1FP7A 3Q5DA 3OAAA 2QORA 3EARA 4KYIB 3NTUA 4Q1DA 5F3WB 1ONBA 4FWTA 821PA 1RVDA 2V55B 4BZXA 5J47A 3EXAA 4E22A 4OHWA 1XP8A 2CJWB 4P4TA 1T5IA 3IDQA 4LJAA 3TNFA 3C15C 3T61A 2KBEA 5EUQB 2QROA 1SXJE 2CBZA 3RSLA 2GKSA 3SEAA 4Q66C 4YDHB 2J41A 2NO1A 5BWMA 2F55A 4NCKA 2ZI9A 3A6PC 1CRQA 3B1WA 5EQTA 4Q02A 4QJ5A 1HE8B 1XMIA 5HCIA 2GZAA 4BPBA 5LB4A 3V9PA 3BH7A 1VG1A 5CB8A 2OSBA 1E69A 4LHWA 1QDEA 5JSZA 5C1BA 5FBQB 1YJ5A 3FFBA 1E0AA 1GZSA 3CRMA 3MJHA 2IYQA 1SHZA 2WSMA 1I4TD 4Q9HA 2V7QD 3FMOB 2JCSA 4GNKA 1HTWA 4NU0A 2W0SA 3VX4A 5E3HA 1DAEA 4LRWA 4O25A 2FFBA 1YE8A 4PAMA 5DH9A 4X8MA 2IS6A 4C0HA 2VP4A 1IJEA 3N2EA 3GMTA 5FOVA 2YWHA 5J4LA 3ZVRA 3W6OA 3W6PA 3FWLA 1QHXA 3FKSA 4BLQA 3GLIB 1XEWY 2DHRA 2CHGA 2OM2A 2ATVA 2WWFA 4HAZA 5JECA 1GITA 4HZUA 4Q4JB 4KU4A 2IYRA 3IPXA 4LJ4A 4Q1EA 5CK4A 2YJTD 2VHTA 1VG8A 2W6JA 2GRJA 1II8A 3H4MA 4DSOA 4HDQB 1S3SA 1TEXA 2MSEB 4J0QA 4NPHA 4Q00A 3TK1A 1SVSA 4MA4A 1N5JA 2WKRA 5E7IA 3QSYA 2IXGA 1S9DA 3VR4A 4QGHA 1JR6A 1Q21A 1NKTA 1RYFA 1H8EA 5BN4A 1SXJB 2Z4SA 4S2EA 4XH9B 2A9KA 4PQRA 2GZHA 2ZI5A 3I5XA 2HCBA 1E2QA 1MRNA 2WV9A 1Z0IA 3RNLA 2FU5C 4MQBA 2ASEA 4DSUA 5AUNB 1TPZA 2EVWX 5EZ5A 2KWIA 4JLOA 5TMPA 1SKQA 1Q3TA 5EXXA 4PSKA 2JLVA 2ZRKA 1NMZA 1E98A 1LTQA 4QNMA 4AI6A 1E9EA 4HLQB 1VG9B 5C46F 5TVKA 2RGDA 1KSGA 1QVAA 4KV9A 2GJAA 3OEHD 4D6PA 4DXAA 1VHLA 4LBVA 4EPXA 4DB4A 4B6FA 1NRJB 4D4LA 1Z63A 2HUPA 3ICEA 5GJWC 3JZAA 3HPQA 3R20A 5H8WA 1AS3A 3AF2A 3ZVMA 3IGFA 4RD6A 1G5RA 2O8BB 2WJHA 2OBMA 2REXB 3EA5A 1RFLA 4A8JB 4B3DA 2GK6A 2VHJA 1U0JA 3MG9A 4MKGA 1SGWA 4D2IA 4BFUA 3EIQA 3QY0A 5KPDA 4JZKA 1Z6AA 1W44A 4NCJA 4D4MA 4A0RA 1KY3A 4ASUA 5KYKA 3SDZA 3CWZA 4PPGA 2GAOA 2JLSA 2WIBA 4TLCA 4WZAE 3A1VA 4IJMA 2DBYA 1QZXA 4OBEA 4ERNA 5BN5A 2H7VA 3GJ5A 5FFMA 1Z5ZA 2PT5A 4MRVA 2V8OA 4M4SA 3VU9A 1EK0A 3QEOA 1QVRA 2B7BA 2C9OA 1FUKA 4LJ5A 2QQEA 1EWRA 2K5UA 4OQFA 1F3OA 1QHSA 1IY2A 2W58A 3B6EA 3RS2A 3TW8B 1YQTA 521PA 4W5HA 4DUGD 3TW4A 3UWOA 2WTUA 1YZUA 1ZM9A 1WRBA 2P3SA 4URXR 1E2GA 2C77A 3ZS8A 4US1R 1IM2A 3RS7A 4Q9KA 2OG2A 1G7TA 2OFWA 4TMZA 3EPHA 1XPUA 4GP6A 4OK6A 4QJ3A 5CIQA 4H9GA 4IVRA 1Z83A 1HY3A 3RS4A 2FZ4A 4CVNA 2CLCX 1XTSA 5EP4A 5L3RA 3L43A 5JZVA 2HDNB 3NIBA 1K8RA 2P65A 5EP3A 3TSOA 2B8WA 1KKMA 2ORWA 3W3AA 2O8CB 3MAAC 4DLZA 2IYYA 3LD9A 1NBMA 1XMJA 2OXCA 1SVMA 4PC6A 3A58B 3K09A 3U2QA 1E9BA 1K5DA 4CIDA 5G53C 3I61A 3BFKA 4AG5A 4TYNA 4XSHA 3HWSA 4PZZA 4HZUB 2YWEA 4GZLA 1FNMA 1G9XA 1KTVA 2QMUA 4IDOA 4ZO4A 2H17A 2HJGA 2C2HA 1SVLA 5FBWB 1YZGA 4M0LA 3UMRA 4HDOB 1II8B 1L7VC 1YZKA 5EE1A 1IOZA 4DLUA 2FF7A 2NZJA 4DCUA 5JFGA 1N6LA 4FD2A 5K8IA 4JVLA 5FPHA 4HB0A 4RJLA 2WJJA 2BMDA 2OFXA 2IWHA 2OE2A 1P2TA 4L16A 5FTNA 1ZM2A 3QBVA 2QP4A 1DO2A 2HV8A 1KDPA 4ZDWA 2WSSA 2V54A 2J0QA 1G18A 3I72A 4Q48A 4MUAA 2BVNA 3B13B 3CONA 3K9NA 5KNCA 3MLEA 3KXKA 2ERYA 1RW4A 1CIPA 1YR7A 4M21A 4QKQA 3NVAA 1YRAA 4RKEA 1RRPA 2R44A 3EPJA 2WKPA 3WMEA 5B57C 1NVWQ 2DFNA 1ZD1A 2QSZA 1ZC3A 2OXRA 3DKPA 2GCOA 3O47A 4HB4A 4HAUA 5EXTA 1Z28A 2WJGA 4M9XA 2BDTA 2PLRA 5C18A 1X1SA 2CDNA 5IF9A 3MUFA 3S1AA 4FCVA 1O3YA 4GBMA 1A7JA 2HF9A 4LC1A 1W4BA 3KQLA 1Z6YA 2VRWA 1VIAA 3C5HA 4R98A 1PLLA 2QPAA 4D25A 1XDBA 3CX6A 1TMKA 4BLTA 1L2TA 1F2UA 2CCJA 3BXZA 2YZ2A 4P4SA 3WRYC 2DWOA 3SQXA 4PO8A 4KYUA 5JCZA 5L3SA 4R71A 4LY6A 5DHFA 2QTVB 4LWZA 2DWQA 4JVMA 1R2QA 4E03A 4QG7A 2DFLA 4O2LA 2FNAA 1OT3A 4JL6A 3VU9B 1KZ7B 2ZE5A 2ZRFA 2IYVA 1E9SA 1WF3A 3IILA 1N6RA 4B35A 4BQSA 4Q9LA 2GDJA 1OYYA 2AHOA 4Q4LA 3NG1A 3Q8XB 3W9YA 3DOEA 4NCNA 2VQSA 1KO4A 4G5QA 4B3FX 2MSDB 3ZZTA 3NBXX 2OCPA 1OSNA 3GEIA 1NVVQ 1VMAA 5J4VA 1KO8A 2HXSA 4Q19A 3THXA 3HPRA 4B71A 4LCBA 1Z6TA 1XF9A 2A2ZA 1NN1A 1P61B 4PC7A 4I1SA 4CW7A 1OYWA 1GL7A 1HH4A 3FWYA 3KJIA 4YXWA 3AVWA 4B3CA 4EJSB 2YOFA 3REGA 3OEEA 4UQOA 1XCPA 2IF0A 5LD2B 3BORA 3SYKA 4F4IA 4GMDA 5BYKA 3BRWD 3BD9A 2ZU0C 4LV5B 2G1KA 3EC2A 1N6OA 4JIMA 4QHTA 2QMHA 3QOFA 3K9HA 3HR7A 3MJRA 2QPOA 3PENA 3U7GA 5HTKA 1T9HA 1RRFA 3CPJB 1RKBA 4DDUA 2QZ4A 2KJQA 2RAPA 2X1VA 4MRSA 4Q4AB 1E4YA 1EESA 2YWGA 3IPYA 2ZAOA 5EXPA 2PMKA 1IN6A 6Q21A 3BB4A 3CUEF 1GRRA 2ECKA 1X8JA 4JLVA 3AP1A 1JI0A 2ZRPA 1M7GA 1AJEA 2XEXA 5FI0B 3QPWA 4LOAA 4A6XA 2XZLA 2AK2A 4LPSA 5LB2A 4B32A 4POAA 4A82A 2OCAA 1Q3HA 3RWOA 4V03A 4M8NE 1JECA 4GL2A 2FG5A 2F1JA 1A2BA 1XJQA 2ODNA 3T06B 2W2XA 1GG2A 1T3SA 1KYIA 3CF0A 1OFTA 5CLLA 5LD2C 3QXJA 1KZGB 3LA6A 2GJSA 3K09C 4Q7LA 4V02A 2ZJZA 2GK7A 1N6KA 1N0WA 1PUIA 2R62A 3AF3A 4N0EA 5SZHB 3T12A 3NC0C 3CPEA 4UNRA 1UKVY 2YYZA 3H86A 3IHLA 4ABYA 8OHMA 3RSOA 1OHHA 4EPTA 2EFEB 2PH1A 1ANKA 2FN4A 1JAHA 1W48A 2F3RA 4HAVA 4EPYA 2B6HA 1PV4A 1E2MA 2N46A 2VEDA 3S1AB 4EPRA 2V4ZA 5F9HA 2ZRLA 2PEZA 4WAUA 1KI6A 4ARZB 4F91B 3PVSA 1GP2A 2G6BA 2KE5A 5JJKA 5HE9A 1LS1A 2VA8A 4A2WA 4IOMA 3ZZUA 4B76A 3QF4A 4CDGA 3NDPA 4LK2A 3K70B 1QRAA 3AVXA 1IXRC 5AJZA 1R0ZA 5FUYA 621PA 3U7HB 3AF1A 4P4SB 3THYA 2PZEA 5AWFC 4YC7A 3U3JA 3NEYA 4CYMA 4JYBA 5AJYA 4YMSA 4KLZA 3AKYA 3EWSA 3OIVA 2FDCA 1RC8A 3I5YA 4DCVA 3LWNA 2RCNA 2VTKA 4F38A 3R8FA 3GJ3A 3ZVLA 1OXVA 1E9DA 2UZIR 1N0UA 3QNUA 3D3QA 4C4PA 4DLRA 2ZEJA 5BYJA 5FTLA 3P4YA 2GJ8A 2XNDD 3BFXA 3OFNA 2KI5A 3QPVA 3UANA 4ESHA 4CEJA 1YRBA 1G4UR 1OW3B 5FL7A 4DHEA 5M04A 2CCKA 3IO3A 1E1QA 5FTKA 1QHIA 1CJVC 1UDXA 3THXB 4LYJA 2ZRNA 1I4LD 1UKZA 3EAQA 3GLFA 3WRXC 2AX4A 1RRGA 2ANBA 2HT1A 3B1VA 2J7PA 3QENA 4KBGA 2R6GA 1EFHA 3K70C 2QG6A 2A78A 4EPVA 4V0MA 2FFAA 3AKDA 3KKNA 3KX2A 1XEXA 5EXSA 4IDQA 4NTZA 4NYIR 2WWHA 3GD7A 4II7A 3EPLA 1NL3A 3VAAA 1JR3D 4D4JA 1COWA 4QOSA 4H1VA 1BIFA 3B5JA 3KKQA 1VYVA 3K1JA 3PG5A 2QSYA 3LQQA 3RS0A 1VCMA 4D81A 221PA 2BBOA 2OEPA 4NZYA 5G41A 1OXSC 1S4QA 2A30A 4OHYA 4FMBB 4NDZA 2A7QA 2ZETA 3AVOA 1JXOA 1UFQA 3B7GA 3PV0A 3I3SR 5FPYA 3RRZA 3WP1B 1KMQA 3QPUA 1Q22A 2JJ1A 2WVJA 3KJEA 3NBZC 1B0UA 3KTAA 4ON9A 3EC1A 2C99A 3M1IA 4LJ7A 1G4AE 2YOGA 3FMPB 1TU4A 1ODFA 2BJWA 5D3MA 1R8SA 1HT1E 1WMSA 2IEZA 4TQAA 2C9CA 4L8GA 2EYUA 1MO6A 1T6NA 1G1MA 1VYTA 1X3SA 1EFCA 2TMKA 3AUYA 3K9LA 1EXMA 3QVVA 4Z8XA 5JWHA 1KHTA 2R65A 1X8KA 2VO1A 3QBTA 1NG9A 4XVUA 1G8PA 2NTYC 3W8RA 1GM5A 4HI0E 5J5CA 1E79A 2R8RA 5KU1A 1E1RD 4MDFA 3L8YA 2R6CA 4MGZR 2PJRA 1IQPA 2PT7A 4LYHA 4AURA 4Q1AA 4QRHA 2LKDA 3FDIA 4DLSA 4NYIQ 4B33A 4G5OA 3F5FA 3GEHA 4OYHA 3VKWA 3LBIA 3IKJA 4NE2A 5SZKB 1W0KD 5DO9A 5FBRB 4BUJA 1KMHA 1OV4A 4KAXA 1KI6B 3EIEA 2VP2A 4KLNA 4DLXA 1E94E 5GVRA 1SZPA 1ZCAA 1ZVQA 3QF4B 5KOYA 2ZRIA 4LBZA 1XJCA 4ZDKA 1UF9A 3EASA 2QQ0A 1I4DD 4IOJA 5KNDA 1ZAKA 1ZNWA 2ZANA 5AUPB 3THYB 1Z47A 1W0JD 3GJ0A 1YR9A 4LGMA 2F7SA 4MDEA 3LVRE 1C4OA 1J8YF 1G7CA 3SYNA 1SXJA 1U94A 3WY9A 4P4UA 1A5TA 1Z2AA 1J7KA 2PZGA 2QRNA 2NIPA 1CU1A 2ORIA 3ADCA 2F9MA 5IHPA 4G0NA 1RZ3A 1AS2A 3DPUA 4TYQA 1OIVA 3KQUA 4HYYA 2ZVQX 2ZRDA 4JLJA 3AM1A 4A0FA 1RPZA 3UXMA 2VP9A 1E0JA 4RZ2A 4X8LA 2YWFA 3W8NA 3C8UA 1GDDA 4P0TA 2ZSBA 4QHYA 3NC1C 1TAGA 2IHYA 4OI4A 4BFWA 2CL0X 2HLDD 3N70A 5J4YA 2ZJAA 1NY6A 1J99A 1D2NA 2H1LA 3OIUA 3QVUA 3TRFA 1W2HA 2EW1A 3I8XA 1D8TA 5JJLA 3FHCB 1XMVA 2DCUA 2WAYA 2XSZA 2WOOA 3MRSA 5FTMA 1FNNA 2KSQA 3RRMA 1YZTA 4RZXA 1WBDA 4ZKEA 1XEXB 3SJAA 1G3UA 2FFQA 1YU9A 4MGYR 2OLKA 1NF3A 4HATA 4CZ2A 3CRRA 4A8JA 2DR3A 1ZMXA 1XWIA 4C0QC 2P6RA 2EU8A 3EZ6A 4DEXA 2PX0A 4TSFD 2FOLA 2H8KA 4WXPA 2X2EA 5KO2A 3GJ4A 3OE7A 4Z1MA 1KNQA 4IOKA 2ZS9A 3P32A 4DEYA 2GTPA 1N0VC 2NO6A 4TQUS 4BGDA 2JEOA 3HP1A 4BLRA 2J87A 4PZLA 5AUQA 1OLOA 3QXSA 4HZIA 1QHGA 1TF2A 3I8SA 3SI7A 2C03A 1W1WA 2OLJA 1LFDB 4LV8B 1NSFA 3KTAB 4HDCA 1KKLA 1Z22A 3K9GA 2Q9CA 4UNPA 2D2FA 1OKKD 2DPXA 4KFSA 3VQTA 1OF1A 1T3HA 3CW2A 4AKHA 5JRJA 3C7KA 2WM9B 2DWPA 5D3MB 2WPDA 3GLHE 2FH5B 2OCBA 3PEYA 4EAQA 3U3MA 2IK8A 3A8TA 4ZPXA 3T1TA 2O8EA 1IN8A 2OHFA 3DDCA 2XAUA 3HJHA 1NN0A 2AXNA 2GBLA 1M6NA 3PEUA 4QHSA 1S9HA 2IHBA 4TMKA 3VHLB 3EIHA 4ZIRB 4JLPA 3ADKA 4QXAA 3IIKA 4C0KA 3PEWA 3O8BA 3HU3A 4PC3A 5SZJA 2IYLD 2A5GA 5IK2A 1YZNA 3U3RA 4KVAA 1UADA 2O8CA 3CNLA 4DLWA 3B1ZA 5ANRB 4H1UA 1WB9A 1OH5A 5FL3A 2A5DA 2W6IA 1PZNA 3AQ4A 2VF7A 5HKKA 4YONB 3I4LA 2QP9X 3GJ6A 1KMHB 1R0XA 5E7JA 2XTMA 3PQCA 2ZI7A 1AKYA 2ONKA 4PHTA 4TMWA 3RAPR 4RFSB 2VP5A 2P5TB 3ZZ0A 3NWJA 1KK0A 3LO5A 1CF4A 3DZDA 5L3VA 2DFTA 3FMFA 1X6VA 2PJZA 2RGAA 2D74A 3MWYW 1Z3IX 1DE0A 3KKPA 1MO4A 3X1XA 1VG0B 3LXXA 4RY2A 4ACAA 1E2PA 1IJFA 1ZUNB 1G20E 3CH4B 4RCYA 1EFRA 1FPMA 1VDZA 3QQ5A 4HAWA 4MGKR 3W5JA 4C0SA 2H16A 1OH8A 2FGJA 4KSCA 4MRRA 2JDIA 1OIWA 3GLHB 1R5NA 4BEBA 1KK2A 4PPFA 2WWGA 1G16A 1CJTC 1N25A 2ZRHA 5E95A 1UJ2A 3NH6A 1TUEA 2SHKA 4D80A 3SZRA 2QU8A 2ZRGA 3NBFA 2EYQA 1DAKA 2RGNA 2JIZA 2GETA 3LAWA 4TLBA 2ZJ2A 2GJKA 2Y8EA 1UBGA 2ZJYA 3CRVA 4TZ6A 3KKMA 3RABA 1U8YA 4DCNA 4HLUA 2QAGA 2ZYUX 1DAFA 3MWJA 3PIRA 4Y0VA 4LI0A 3K0EA 2QMEA 4LHZA 5FOTA 3L8ZA 3IO5A 5DI3A 3B85A 1XNJA 2BBWA 2JJ2D 4X8HA 3TH5A 3SS8A 2Q0HA 4UJ3A 2B2NA 4DJTA 1OJLA 1E9FA 1SXJC 3KFXA 1ZU5A 5KSYA 1W36D 3DL0A 4TQ9A 1TX4B 3BK7A 1E99A 1RJ9A 5CJPA 5K8UA 1J90A 4JSTA 1F2TA 3D31A 3E5HA 4B74A 1P75A 2AR7A 1PUJA 4PHGA 4M2LA 4BFZA 4IKEA 3KQKA 1GAJA 1FL9A 5B2ZA 4TTQA 2CNWD 1OXUA 4LHVA 4ZCIA 1JB1A 2BCJQ 3BBPA 1FMJA 1VYUA 3DO6A 2QBYB 1U0LA 3E1SA 3BOSA 3QXXA 1FMLA 3B9QA 2IYSA 4QNRA 5FOUA 1KJZA 1W4AA 3F3YA 2REOA 2O8EB 4NBSA 2CMKA 3RRNA 3BC1A 3GFTA 4HB3A 3SU8A 2G0TA 2PX3A 2IWRA 4BLSA 5DN6A 1IHUA 2YNMA 3GJXC 2XTZA 4JVNA 4A8JC 1E9AA 2CLDX 1ESNA 1SVOA 3GLGA 4M53A 4ITRC 4QBGB 4LJ8A 4DRZA 1JQJC 3IUYA 3T1QA 4EJSA 2F1HA 2G0NA 1E32A 1CXZA 2FEOA 4M1YA 2GCNA 2XOKA 4JS0A 2J0UA 3P26A 2UZ3A 3MGCA 4LUCA 1OE0A 4I81A 4QBHA 3ONWA 1M7BA 2AD5A 3DM5A 3T34A 2RGEA 3U61B 2E87A 1PLKA 3AP2A 4CEIB 1NLYA 4L15A 1U8ZA 2RHMA 4UNQA 1PLJA 3ZIAD 2QPTA 2IW3A 4PAQA 2QE7D 1JPJA 3IIMA 1XXHE 4TLAA 4YQFA 4Q4AA 3PCRB 3G5UA 3QUSA 5JMTA 1KGDA 4TT3A 4BEJA 3V4RA 2Q9AA 2IC5A 1XCGB 4AY2A 2ANCA 3GFPA 4NKRA 3TGPA 3VNUA 1DELA 4JLAA 2PBRA 1FTSA 4BRWA 2GBLC 4IXNA 2IYXA 3WNCA 1P3JA 4IFEA 4C0LA 3ZJYA 2BJVA 1H8HA 3AVVA 1R10A 1W7AA 2QUZA 1T4GA 3EZFA 3VR1A 3KL4A 3ZVNA 1UEJA 1JR3E 2J1LA 3LFUA 3ZDQA 1MO5A 2HYIC 3IBYA 1G19A 1IN4A 4ZDIA 4LHYA 2GXQA 2AKYA 1Z0JA 1YZLA 1LV7A 1XBTA 1HV8A 1T91A 2IUTA 3D6TB 4ACBA 2N42A 2BMFA 1TL7C 4DC9A 1TTTA 2JLYA 3LDAA 2R9VA 1NVVR 1N6PA 2B21A 3FE2A 2UKDA 2NMVA 1M74A 5H68A 3TLXA 1Z0DA 3UPUA 4IDPA 4TMVA 2VP0A 1R6BX 3THOA 5K8LA 2WAXA 4JKIA 1DTSA 5CM9C 4DIDA 4ZI3A 5DYIA 1TNDA 3QG5A 3GLGE 4HAYA 2BM1A 2QAGB 5GADl 2JLQA 3R7WA 1ZNZA 4L5BA 4JJKA 3AGPA 1P2UA 5LDDC 4V0KA 1M7HA 4ARZA 5DI3B 3RC3A 3FKQA 1QHNA 5F2EA 4WBSA 5C2JB 4UXHA 4G5RA 4MKIA 2ODWA 2BKUA 3BGWA 2Q21A 5GJVC 1J2JA 4B34A 3NEJA 2ORVA 3KQHA 3SOPA 2VHCA 1OFIA 3O8CA 2JLUA 1XB2A 1OH6A 2JLRA 1RJ9B 5EJEA 1F2TB 2C96A 3W34A 2O52A 2REBA 1GWNA 4BFSA 3VTKA 2DY1A 2NO9A 4GOKA 3SBDA 3N2IA 3QXHA 2E9SA 3FPNB 2OO7A 3MSXA 4B48A 5C4MA 3RHFA 1BMFA 4KI0A 1NP6A 2HEIA 4TWZA 3U44A 1VCNA 2EFDB 5BW8A 2I4IA 4OHZA 1CJUC 2RGNC 4AYXA 5KSOA 3TR0A 2XJ4A 1ZRHA 4QBFA 1HQCA 1GNRA 4GMXA 4C7OA 4P33A 2FEMA 1G5PA 1E2JA 4HLUC 3AF0A 1AGRA 2QAGC 2YC4C 3KQNA 4XD7D 2F9LA 3KUCA 4GI7A 4IVQA 4D0GA 4IEIA 2ZRMA 4OI2A 5JRZA 1RIFA 1XJ0A 3K53A 3K0FA 3L0PA 4ZKDA 2H92A 3SFVA 5HE8A 1ZP6A 1WQ1R 2EQBA 2QN6A 3LBNA 2EFGA 5DNYB 2HYDA 2GXSA 2BEJA 1E2FA 3KJGA 1OB2A 4RD1A 4RD2A 4F93B 1W4CA 1TQDA 2G1JA 3BFVA 3TQFA 1L8QA 3SYLA 4B2IA 3GLGB 2UVQA 3RVBA 4QFMA 4Z8YA 4DSNA 4DLYA 2CK3D 5DE3A 3I32A 3JZMA 121PA 1E2EA 4M22A 4URZR 3WYGA 4W9MC 1V43A 5DSZA 3L2OB 4MRNA 2IYTA 1OH7A 1ZD8A 4TYYA 2J0UB 2J3EA 1E0SA 5JJIA 3OAAD 4K81B 5FOXA 2LKCA 2BIFA 2IBMA 1GTVA 4G5SA 4MYCA 3WNDA 2OZEA 1DEKA 3O8DA 4I1UA 2GWHA 2JLXA 4DDWA 3U60B 1NG1A 4V0LA 2NPFA 2VL7A 2V7QA 3WBJA 3U7FB 1CLUA 1QG4A 5JI3E 3AGQA 3UIEA 1GKUB 1KO1A 2DYKA 3A4NA 5UKDA 1ZNYA 2ZM5A 3C16C 4A1FA 1NKSA 2NPIA 4FN5A 2IEYA 1G3MA 4C2UA 3X2SA 1CR4A 2GEUA 3AB3A 4U00A 2OAP1 3GPLA 3TUIC 4RKFA 2J0SA 4AG6A 2YINC 4ZCMA 4M1WA 1BS1A 4NP6A 3AUXA 2ZS7A 4U7DA 1A82A 4KODA 3BJIC 1DAIA 3J81k 4XWOA 3WP0A 5L3QA 1OPXA 4LX0A 4EJSC 3VNVA 1U8AA 3IIJA 4HUTA 3CNOA 3EZ2A 4LDJA 2ZVPX 5A0FA 2BBSA 4DBLC 3FOZA 1XU4A 2I3BA 2O5VA 1DADA 3LLUA 2ZR7A 4RVCA 3LXRA 1DS6A 1KAGA 4M1MA 4NYMR 1E3MA 4DLTA 3FKSD 3R7WB 1JAIA 3Q5EA 2C5LA 1T0HB 5TV2A 2Z5FA 3SHWA 1W5SA 1WA5A 1TQ2A 4DWJA 2QMOA 3TUJC 2O0KA 4DCSA 1QF9A 1XD9A 2A3RA 3M6AA 1GKYA 2Z83A 2W6JD 4E07A 4LBWA 4PPNA 4O0MA 3NHBA 5FI1B 4PQFA 2C8VA 3PJRA 3VMFA 4JLDA 4WIAA 1H8ED 2VHUA 3PUXA 3OEHA 4N3NA 1NSTA 4LPKA 2GEVA 5EE5B 3U44B 2OV2A 4HUQB 2FA9A 2GXUA 3AVTA 2V3CC 1FFHA 1YZQA 4A4DA 3A36A 1KI9A 4OI1A 2ONJA 1M8PA 4PAOA 3JVVA 1JQLB 2W0MA 1D2EA 3QIAA 2BBTA 4KFUA 4C7OB 2FSGA 3E2IA 4KVGA 2G83A 5B58C 1CR0A 2D06A 1Q57A 1U0HC 2JGNA 2N1BA 3SJBA 4Q4HB 4E5UA 1E0KA 4LSGA 1P9NA 3K0FB 4LZZA 5JEEA 1LB1B 2XJ9A 3Q7QA 2JA1A 2GEDA 2V1XA 3KJHA 3RWMB 2O8DB 1LW7A 1J8MF 1UBFA 1KI4A 1KAOA 2P67A 1NN5A 4M1OA 3PUZA 4E09A 4QJ4A 2P2LA 2WJVA 3WYFA 1AIPA 2CL6X 2J45A 2RMKA 4NYMQ 3B9PA 5EE9A 1W4RA 1Q1ZA 5CK5A 1U99A 2PL3A 4ZCLA 4MYTA 5TARA 1T8TA 3LX8A 1XFAA 1M2OB 4OHXA 3KXIA 1P62B 2W2TA 4Q03A 3CLVA 3CR7A 4A6PA 2QM8A 3BB1A 4DUGA 2H5EA 1Z06A 2YHSA 4NYJR 4R7ZA 4IXMA 4WXRA 3CRQA 1ETUA 4ASUD 5KDOA 1E96A 5JHGB 1LS6A 4JLMA 1S8FA 2D3WA 3SFZA 3W90A 5HCNA 1H65A 4Q47A 4QM6A 2GVZC 5IRCD 2KB0A 4PPQA 4WZ6A 2ZE6A 4AD8A 5CM8B 1NN3A 2ZPTX 1FOEB 5LPNA 2C95A 1P2SA 3SC3A 3VR5A 2BV3A 3DVLA 3T1VA 1Q0UA 1UBCA 2CEAA 1M1YE 2Q3HA 4I4LA 4ESVA 4B3XA 3FGNA 3WYAA 5F9FA 1HURA 5FUXA 3A37A 2J5XA 5CDFA 5BXQC 1XEWX 1XTQA 2NO7A 4UNNA 2KBFA 3NDBB 5ELXA 3ECCA 4LV6A 5JWRA 1YKSA 3LY5A 1AKEA 5L3QB 4JYCA 2GZDA 2NG1A 1A4RA 1G3RA 4TN1A 4L9WA 1SVKA 4NCHA 2OILA 1UKEA 2ZS8A 4ZIRA 1IN5A 3NXSA 4EUNA 4DFCA 4EQ6A 3KXLA
chains in the Genus database with same CATH superfamily
1TVKB 4Y6SA 4QXPA 1PFYA 1YHNA 1U3TA 1Y5MA 3OZRA 5IT0A 5A7FA 2XMDA 3DBLA 3JYPA 1QB7A 4H3SA 4ABTA 2F59A 1XC7A 1W2GA 1R0BA 1T26A 3LBHA 3R41A 5JQWA 1P72A 2C7QA 4EQZA 5BQPA 1ORRA 3CB4A 2XB2A 1NW7A 1KVTA 3PGJA 2MMCA 4IH9A 1P9RA 4D56A 1BD3A 4NRDA 3UC5A 1WNFA 3I5YA 3UA3A 4YIKA 3DCIA 3QLEA 4BQPA 4YMUA 1EKXA 4LGCA 4P2BA 3OI7A 1II0A 1QH9A 5KAPA 421PA 4E6PA 3G0HA 1QRRA 1IAQA 2FN3A 1KKUA 3OFKA 4LJSA 4OJNA 4UJ5A 3K1AB 4BE7B 1HKUA 3UATA 1KJNA 3MOIA 1ISRA 2FJUA 1JT9A 2IVZA 1H3FA 1E3TA 1KSHA 4MPPA 5KYXA 2L0XA 4O4LA 5CFPA 5ENDA 4TTRA 5AK4A 3M4YA 3CH6A 1HEUA 3TTYA 4FMPA 4YAIA 2IXFA 1ULTA 4E5DA 4Q9DA 4WZBA 3SHTA 3Q3GE 1LRJA 3G13A 1HKHA 2JI6A 3E3AA 4TVBA 5FA6A 1HT2E 3ITKA 3UXYA 5E9AA 2WSSD 3I3OA 3LXMA 2XYRA 5AUOB 1O4WA 1TADA 5FR1A 3OU2A 3H5RA 4I1OA 1JTEA 3H05A 4BX3A 1XD8A 2XQKA 4ND6A 2IUUA 1ILEA 3X2FA 2H85A 3OFJA 4Q1CA 1GCGA 1MG5A 1YMQA 3B1XA 3VVLA 1CSEE 1YDFA 4EI2A 2I1QA 2DC1A 5CFMA 1YDWA 3G88A 5LA6A 2RHCA 2YZGA 2IYUA 4DHWA 2XX3A 3TBKA 1H3EA 1OFGA 3AZPA 1HX7A 2X2PA 2ZJOA 1A76A 3RVNA 3BEOA 3FOFC 1KI1A 2OFOA 3LUKA 1XF1A 2C4MA 4KO8A 4UM8B 3WQSB 2ZJ5A 3IELA 4MMZB 1P60A 1OZ0A 3EDQA 1PZXA 2G77B 3I01M 4IGFA 4QTTB 4H17A 4AVYA 3ELDA 2YMMA 4A0QA 3M4NA 1SHUX 1JDBC 2W7TA 2WF7A 1WKBA 1ZIYA 4HB2A 1KXJA 3I42A 1CKEA 2ZSEA 4Q39A 4EHJA 5BUQA 2VR1A 3OCYA 4NBNA 4DLLA 3DEFA 3QX7A 2R1TB 4YJ3F 3T1OA 1G8FA 4DNPA 2JGJA 2V03A 3FYHA 5A4AA 4EF5A 1RYHA 2X15A 4S1VA 5ICEA 3W3ZB 4OQNA 3N76A 4PS1A 3JVUA 4Z6KA 1XRSB 3VR6A 2CNKA 4JCCA 4KUGA 3BULA 2FZLA 4WK6A 4ZOBA 3ZE7A 5I3ZA 2JGAA 5JS1A 3EUAA 2QJWA 4XFKA 1K27A 1YR3A 3C0KA 3NJ4A 4D9JA 2CXXA 2J6HA 3BB3A 3U7QA 4FT4A 5AYVA 1CVLA 1F9EA 1HTBA 1U3FA 1KI2A 3BF8A 3L07A 1IUNA 5JNTA 4JR0A 1I3MA 1SCJA 1Z7GA 2YWRA 3LVQE 4QDXA 4WZBE 1TGVA 4OQYA 1W5TA 2V9PA 1CR2A 1ZMTA 4PLWA 1F0YA 5BN1A 5JQGF 1V9CA 2FEAA 1J21A 4HRAA 3DQPA 4NBRA 1T1JA 1HTTA 1DXYA 1NIPA 1JBEA 2C9ZA 5FOXA 3F2VA 1Q16A 4X1IB 1U2ZA 3BRWA 4M0DA 3Q85A 1GGNA 2A0XA 1D0SA 5B1HA 4V0NA 4ER5A 1VSUA 1UL1X 3UKOA 3IOCA 3U7EB 1XWWA 4ESEA 4HQ0A 3TE6A 4ZVLA 3AKCA 3R0XA 3A6GA 4GPIB 2CT8A 1CY0A 5EFOA 5BN3A 3PYXA 1EDOA 3IVXA 2JAWA 4RK7A 3GGCA 5IDWA 1E2LA 4Y1FA 2C97A 2OPBA 1V39A 3MMZA 3ONDA 1XE3A 4JXXA 1U2QA 1KMNA 4EQ6B 1S2LA 5DLPA 1O95D 4BWYA 2CNOA 1EVLA 2YVUA 5FIUA 3D8SA 2J5RA 1P3Y1 4U7WA 3T54A 1QIIA 3ADDA 1KI7A 4UTVA 4W7IA 5KOJA 1IQUA 1OFHA 4F92B 4YJHB 5EWLB 4KPEC 3EXFA 2HH9A 1Z5PA 1QCDA 2FLVA 2GYYA 3H0EA 2F3SA 2FETA 3KBBA 4IRXA 3RANA 3LKBA 4B3HA 2VC2B 3DAPA 5IJ9A 4G01B 4H59A 3KJNA 2VRNA 4C0JA 3VKHA 3KC2A 3D3WB 1KORA 3PUKA 5I8ZA 1T8YA 4CV1A 1UKYA 2O06A 2Z2ZA 3VPCA 5I7AA 4EO7A 2B25A 2BD0A 1MORA 2PO7A 5D86A 1IBMB 4D8VA 1KOFA 3PGVA 1EXNA 1P2VA 2IY9A 1SBIA 1NW5A 2AXQA 1G5FA 4DDVA 3GNSA 1U0RA 1RE0A 2WWYA 3KR0A 1N5OX 3UV7A 3I58A 3UEOA 1CUSA 4C14A 3OHMA 3SE7A 1QTIA 2Z6QA 5KUTA 1GZUA 3K0AB 1V3TA 2OESA 3R6DA 2YQZA 2XUPA 3IDOA 4YK7A 3V8RA 3ZHBA 1G5IA 2ET6A 5I8PA 1SUEA 1G3QA 1VLHA 4Y1RB 3WYEA 3E8MA 1MC4A 1R4NB 2G9UA 4G41A 3W5IA 1U5AA 2WQ7A 4E2FA 4WN3A 4P6VF 1RTKA 3MWDA 3QLTA 5CG2A 4XJXA 2J30A 1RWBA 3LDHA 3LW8A 5H16A 2ACWA 1X86B 4FDTA 2XNSA 3EK2A 4TLEA 4IOLA 2GN9A 5AW8A 2QJFA 4KVFA 4Q18A 4XE5A 1J00A 3FH0A 4KITB 4IINA 4INOA 3L84A 4KSBA 1OHHD 2PGLA 3QKRA 4KQ6A 4M9ZA 5FADA 4I55A 5AXAA 1M9NA 3H18A 1USIA 3QXCA 4JLKA 3N53A 3VOSA 3AVPA 3O4JA 3ETHA 1L9XA 3O6VA 1Q1GA 3HXLA 3I92A 3OUUA 4ER3A 3RFFA 4LSMA 4DF3A 5BVGB 5DCLA 1GSIA 3TLCA 1LPMA 1RM5A 2E21A 2FQ1A 2VF8A 1D9XA 5FULA 4BP8A 4TVSA 1KEVA 3A4LA 4D44A 5FCDA 1NLFA 5CG1A 5TRTA 5J9FA 4BB9A 3IHWA 5LQAA 2RH5A 3VKGA 2NACA 2UUCB 4D9MA 4PHFA 3U3ZA 3LECA 3O8OA 4QTUB 3SGLA 2C31A 4FMDB 1ZK1A 3FN4A 4DEVA 1GKKA 4YRCA 1OGYA 2ZITA 2ZSAA 4YCAA 3FUCA 1UM8A 2H4HA 5B7QA 4I50B 1KVSA 2W6MA 4PLZA 1GPYA 1YZ3A 2BWJA 2G28A 1WUHS 3DFKA 4OMCA 1NATA 1Z73A 3JQ8A 1W75A 4XB6B 4RZUA 3L0BA 3KT8A 3TPZA 4L7QA 4P36A 4PIPA 1I0IA 1G1AA 2HY7A 4K46A 3PDIA 1KI3A 4HLDA 2FP3A 1H1DA 5ER6A 4ALJA 3LLMA 3IXLA 4CCYB 3EOAI 3E70C 5JYCA 1QK3A 3X1JA 3RGWS 2WQZA 1IAVA 2XAAA 2IXBA 4MKRA 4XAQA 1C1YA 2XXAB 1Z8DA 1II9A 2AR0A 2G0AA 4RDCA 1WXGA 4L3WA 5FR2A 5A7HA 5C7LO 1WW2A 2Y71A 3BL8A 4Q3CA 3ZS9A 2YASA 2ZRCA 4MUMA 2Q0XA 3M82A 3PVZA 4NV1A 3TAHA 5FUQA 3ZWOA 4B4VA 2OBLA 3L7AA 3EMBA 2ZYSA 3ZX5A 3PGMA 1ZD4A 2XRYA 3ZK8A 4Y1GA 3CO0S 1JEYA 4C76A 3URMA 4BVFA 2ZRJA 4BZQA 1QHHB 4XTRA 1PQYA 2OAEA 2C3YA 2GI4A 1ZNXA 1K4KA 2J7PD 5H80A 4UUMA 1T1GA 3KQTA 1IRXA 2BKLA 1Q92A 4GX0A 1KVUA 1SBQA 1R6TA 5ALFA 3IBGA 3L46A 1IN1A 1U7OA 3RASA 3L6UA 2ES4A 5ICFA 3P4XA 4HVCA 2GN1A 1XAGA 1JWAB 1W2WB 2ADFA 2GBFA 2V6MA 3BKXA 1L5OA 5A5VA 1XNQB 3R9XA 3N5CA 4W1PA 4CM9A 4YUZA 3NGXA 3DH0A 1T3GA 3K0CA 4HDAA 4EUSA 1U6JA 3QWIA 2GRUA 3DOUA 4TMXA 1G291 1T8SA 1QPGA 4RNCA 5CX1A 4GT1A 3BS4A 4BAUA 5JU6A 3BSSA 1I2DA 1S2OA 5BOVA 4D8WA 1LY1A 3ZD7A 1CEYA 3ESBA 1NU6A 3VO1A 1N77A 2OOSA 2WJIA 3S6JA 4I9FA 2LIPA 3L6CA 3OM9A 1NYLA 3C3XA 1Y4AE 3PDWA 2VHWA 1OI4A 1WXHA 4DV4B 1OPRA 4QRIA 1QIKA 3RI3A 3A1NA 1U2PA 2WTXA 2ZTSA 1E1RA 2YN2A 1E3EA 2X2FA 1J4AA 1OZGA 4HRVA 4LYYA 4PYLA 4QDJA 2HFKA 4X6YA 4MP8A 3W9BA 2ZPUA 1LPBB 3ZWDA 3G02A 4D6XA 1Z0FA 2QMZA 3TS1A 2GD0A 1U9IA 1U4OA 2MR5A 3DDSA 4CCWA 4Z9AA 3TVDA 3ZWBA 2P6NA 4NENA 4DZRA 3SIWA 1KI8A 1M2WA 1SKYE 3KB1A 2WZDA 3HJAA 4XPZA 2GHRA 1UDWA 2E6KA 2G5GX 2OGTA 3F9CA 4R84A 1ZEMA 4EMBA 2PZFA 2G4VA 1DIOB 1KY5A 1N2CA 4B1FA 2OD7A 1DIHA 1OXKB 3QE0A 2F4NA 3TQRA 2ZBVA 6REQA 4FJ2A 3RT1A 3LL7A 1JQ5A 4PLPA 3ONVA 1RHKA 5CR9A 3OU6A 4CKEB 2I2FA 1E79D 3H2JA 3NEPX 1QGUA 5F1YA 1CQJA 1W9HA 2IS1A 3VISA 4F2DA 5I45A 1CRPA 2AWOA 4TTTS 3GVIA 4IPTA 4A7PA 1IPEA 1F8FA 2C9YA 3LSYA 4LBYA 4EY7A 4R2LA 4ZZ1A 1DAMA 2A14A 3SC2A 5JSHA 3IVRA 1H42A 5G3ZA 5FUMA 1R0CA 2MYPA 1AN0A 1FTWA 1RMYA 2YYAA 4FKBA 4QT4A 5CDHA 3BJRA 3K8YA 5JNRA 4MVJF 5JRJA 4LF5B 3ENKA 4MW6A 4TWJA 4FCTA 4WLUA 4DIEA 3V1TC 4NXNB 4IIBA 2H9AA 3RD5A 1RCUA 4Q1BA 3LFTA 4NPCA 1RZUA 3UJDA 2WKWA 1HE1C 5LDGA 1EWQA 4UE6A 2EGGA 2EIHA 3KDAA 3OSUA 3PBKA 1ETHA 3FUXA 4KOEC 4KFCA 3FMIA 4K9PA 4TVOA 3TDMA 4LRXA 1FXWF 1UT8A 1YDHA 4DDTA 3M2TA 4B81A 4DAOA 1OGIA 1DZIA 1UAAA 2VHVA 2RGGA 4R8LA 4QC2A 2RHTA 3TXXA 1S1MA 3WISA 3H5OA 4RFVA 3QSGA 3T5PA 1VBNA 5CT9A 1AKMA 1ZDMA 2UVPA 4QUEA 2YKGA 1N2OA 4RHUA 3NV7A 2EJWA 2RGBA 3C5CA 3I2FA 4OH1A 4A6DA 2PMDA 4H6XA 3ZY4A 3GJ7A 1NMXA 4R2IA 2AYXA 5CLJA 2VIIA 2BHSA 1UOQA 2X0IA 4JASB 4PLYA 4HV4A 3QV1A 1P45A 5AI5A 3D8UA 4X6XA 3LY9A 3X1YA 3ZGXA 4DMLA 3EN0A 4RVNA 1TD9A 4I3FA 4YV1A 5J23A 5AVJA 1XMSA 1GPUA 3D7LA 4A92A 4O5AA 4EOGA 5EJMA 4OQPA 5KB3A 5KX5B 3O2SB 2WQ6A 1J42A 1N2CE 4Z0NA 1R5OA 1FX0A 3B78A 1QHEA 2Q0QA 4FMCF 1B23P 2WD7A 5BORA 1L5KA 1MABB 3LLCA 2VPWA 4AT1A 3ZHTA 4BMSA 2QSJA 4WHMA 2RH8A 2NP6A 1XZCA 4RPGA 1TJ4A 1W5EA 3ZK7A 2I3ZA 3AESB 1JTFA 3C6XA 3RIGA 1HC7A 5JCJA 2HA6A 3UVEA 1UBHS 4GBGA 2ZDGA 4V38A 1YS9A 1R9NA 4DV7B 2OWEA 1BKDR 1E2NA 5IAEA 4XR9A 1WMFA 3CM0A 3ILHA 4ATNA 1BX3A 2PGIA 5IJAA 4R3WA 3SF8B 4C03A 1MQSA 5ERXA 1M1NA 1UCFA 3PFCA 2E4WA 4OQ4A 1LTKA 2VQEB 5D5QA 2A5FA 3HQ4O 4RCVA 4H7KA 4JJZA 2BDUA 2QRKA 3QELB 4UBMA 2PKEA 3TN7A 3FPGA 1B8NA 3OZBA 4N82A 5D1NA 5JS2A 5FTJA 2FVXA 3GT3A 3CZPA 1CF2O 3NKVA 1KWGA 5HCUA 3DTTA 4OX9B 1DARA 1IZ8A 5LIPA 4IIDA 3OLXA 1PGNA 4QUIA 1TCUA 3E4DA 2QM7A 1REQB 5EL0A 4UAUA 3BH0A 4KWEA 1TKAA 1Q1EA 4JXKA 2PUWA 3STVA 2VTEA 4LRTB 4MUXA 1WU7A 4CUKA 5CB0A 1JPVA 1P2GA 3NEAA 3RCBA 4F85A 2RHDA 4OHBA 4K3VA 4YQZA 3HRKA 1RYEA 3C3DA 4F1JA 2ZAMA 3SNHA 2FX5A 1JLSA 4X5OA 3FJOA 4BO4A 2RG1A 2F2TA 4G4IA 4KFTA 4Q12A 5TY0A 3ZI4A 1YRLA 4DS3A 2Z5LA 5HJ7A 5KOIA 1K89A 1E3JA 1EM8A 1EP1B 1U3DA 3Q87B 2O4UX 1DO0A 1E7QA 3MRVA 4MULA 4RHYA 3MCAA 1AQUA 4X6LA 4QGSA 2I22A 4MUYA 1GIAA 1FNSA 1S7GA 2VUSA 2X86A 2EP8A 3K0CC 3M9WA 4LY3A 3TIFA 1NUSA 2IH5A 1UMBA 2QYOA 1ARZA 3KYJB 2AK3A 1YR8A 1R15A 1F8UA 4JB8A 4TTPA 3M5PA 5DHAA 4MVJA 4D96A 2NXWA 2RI1A 1IY1A 4FC7A 4PTZA 1CY6A 1HFWA 4RCZA 2PZMA 5BWCA 2X3FA 2QW0X 2GVDC 3NBAA 4B8WA 2TYSB 2B4RO 4DCPA 4E7PA 1A8UA 4P82A 5ESXA 4Y67A 2DF8A 5BQOA 2G9NA 1MTOA 2QTFA 3AHDA 4M1SA 1PJRA 1CR1A 3UKDA 2VNHA 4H77A 4R2MA 1R18A 1XKLA 4EBBA 4RF3A 1FXWA 2ZKIA 1WXQA 1XDGA 1YUBA 2IYPA 2XW6A 3DO8A 3HKDA 4AJ2A 1U9IC 1ODJA 4LHEA 5H83A 2V7BA 2R60A 1MDBA 4AMGA 1ADYA 3E5MA 1TA4A 3VO2A 2Q0SA 2ZBGA 2CNNA 4DTIA 1CEEA 2DMRA 1IEWA 1GRQA 3GRAA 4S35A 5FPTA 3T6KA 3F67A 5LWQA 4PYRA 1QB8A 4Z3DA 3JQBA 3A27A 3KT3A 5T4EA 3RU3A 1WX1A 1N2JA 5J63A 4RDXA 3P0JA 1RWQA 4U8HA 4MJ7A 4N4AA 1GRNA 4B44A 4C7XA 1JAYA 3KSUA 1X2EA 1H6AA 1TW3A 2F1IA 2P90A 2D5LA 4NATA 3OKPA 3QLJA 4GX5A 3G5TA 4QRDA 2PUBA 1O77A 1GXSA 1NBHA 2AQIA 2JJ2A 3HGTA 3BSYA 2Q5CA 3N2GB 4N39A 3OSZA 2C83A 1H5NA 2LD4A 5KTRA 3D8BA 4QYTA 4V2IA 4HPWA 4UTNA 4DB2A 5BV8A 2EX4A 4HBGA 1QGED 1RXEA 2Q3FA 1M33A 3D4NA 1N8SA 1S96A 2J0EA 1YVPA 3NHUA 1Z4MA 2JIZD 3H1PA 1SJ9A 3NUGA 2ZJ8A 3IQZA 5B3JA 1BEZA 4QUDA 1J2TA 1XLUA 3IVAA 4MUKA 5KYYB 5ILQA 4FSHA 1BA3A 2J3JA 3VC2A 1KR2A 2ZSHA 3ISTA 3H4TA 1JHPA 4LGVA 3E9DA 1D4FA 3OCUA 1NJGA 3CNNA 4KV7A 2H2IA 3A1FA 4LXTA 4M9QA 4UUBA 4Y2UA 2IX3A 1PV2A 2LDXA 1H6DA 2DETA 1WZUA 1DTEA 5AVOA 5ERGB 2NGRA 2ZR0A 5JS8A 3ANMA 3K7EA 3DZBA 4COOA 1ZYUA 4MVJH 5EPUA 5K0JA 4BCCA 3QP9A 5K3EA 4PR0A 1O87A 3EYWA 3LXUX 3OMLA 1KYZA 3OQIB 3HGQA 3KHKA 2JCVA 1W73A 3EG5A 1Q1BA 4Q82A 4XQEA 1QPZA 2D2VA 4KN8A 3KG2A 2QNRA 2C8KA 3H1TA 3WL5A 1YR2A 1FDRA 1LZLA 1MW9X 2NQ2C 2QRZA 2Z1NA 3IVGA 3VJRA 4YGYA 3GFGA 2EIXA 3TD9A 3ZE9A 3MMPA 2Q7OE 4F9EA 1D2AA 1M6HA 5EZ6B 4WEQA 4HN4B 4JOCA 3I6MA 4MO2A 1SN7A 5I7RA 3WLNA 4MVXA 2QDXA 2VPTA 1XZPA 1AKWA 1JALA 1NYQA 4I46A 2Q28A 2PH5A 4IS2A 3VH4A 3U4QA 2YIDA 2DJ5A 3EZ9A 4G81A 4IBOA 2O05A 5AM0A 5T4HA 1N9KA 1R0WA 4E51A 4O3MA 4FQ7A 5K4GA 5K7SA 4AFNA 4FR0A 4PQYA 1ZPDA 3FPCA 4X7MA 2IZ6A 4BIMA 1KS2A 3DXYA 3PDUA 3HRHA 4DGSA 1Z9BA 3DXXA 3UWPA 3EF1A 1I0LA 2QRHA 4D9EA 3KVVA 1IQRA 3GFOA 4P3PA 3ZHZA 2WR8A 4YHBA 5DOVA 5DN6D 2HK9A 2YOHA 4LX8A 2CMGA 3IIIA 3ZIAA 1HUQA 4EHNA 4J2OA 4KXQA 4MPJA 1GAEO 4OBWA 3SEQA 2CVFA 1OLUA 4IDFA 1QIDA 2R6HA 4G65A 2AW3A 4AUNA 2AFHA 3O21A 2YZMA 4KXFB 4MWBA 4AJJA 1SULA 4DILA 3C3AA 3OE4A 1CDDA 3BXEA 2FPGA 4EABA 4DIBA 3F7TA 2QM3A 3CX7A 4AS2A 5L95A 3SHOA 4CIBA 3HCBA 1SC3A 2AE1A 4DGQA 2WBLC 3WGNA 1KAHA 2O57A 5TXGA 3CKLA 5FYDA 1Q0QA 2HU7A 2R1VB 2XQFA 3DDOA 5EIBD 3UJ3X 3HJNA 4Z0HO 1EBBA 2H6EA 3OMWA 3EWNA 3BMQB 5EJ9A 1OCEA 2JJ8A 1FMTA 1Z68A 1L1RA 2BC9A 2ZUUA 4DSTA 1LDBA 5J59A 4IUYA 3UK6A 1CNFA 4GL4A 4HRYA 3V6LA 2Y67A 5DM60 4I08A 4M60A 2EWVA 3QUBA 3MS7A 4JCOA 4JP5A 5FEUA 4OLHA 4XR4A 2HMTA 5EIHA 2HPVA 3SNKA 5KHOC 2E6UX 4V0ME 2GM4A 1CPYA 3MWGA 2J6IA 4TL6A 1H8HD 4LE0A 3O4VA 1HA3A 3ITDA 4PG5A 5J2TA 4HGOA 4UXIA 3TRJA 3ERCA 3DM9B 4FINA 4R1UA 3REFA 5BW5A 3N2NA 2ZIFA 1DI0A 1I36A 3CWQA 4Q4JA 5K8LA 1Q83A 4BMYA 1EE1A 1B0ZA 5DNCA 1IMOA 1SOAA 1Y9ZA 3GJ8A 1RLOA 3FCEA 4TUYF 2CYCA 1B6SA 1N2EA 2CVOA 2QZSA 3X1WA 4BXOB 1GT6A 2FFHA 1BC5A 4X85A 3TMKA 1FVXA 4LYAA 3MMNA 1YACA 3ONNA 3IQIX 1W36B 2JASA 1PYDA 3GF4A 4G67A 2PV0A 3KE8A 2VSFA 3OQNA 1LPSA 1PGPA 4NXMB 3NONA 2AFIE 2VYFA 1XD2B 3PNBA 3WK4A 4F1KA 4XWKA 4BFXA 2CGEA 5EJAA 2AFHE 1UJ5A 2SCUB 2CLSA 3EG9B 2AS0A 3JYOA 2QX9A 1MB9A 3RFCA 1EDDA 5AW3A 4YHHB 5JCPA 4FFOA 3PCXA 4LXGA 3W1WA 1KMCA 1X38A 1QP4A 1YJCA 3U39A 3DYBA 4M8SA 3NTLA 4GAEA 1YB4A 4Z4EA 1IHXA 1J2YA 1S01A 1VXOA 4MCJA 3CUYA 3N58A 1FW6A 1PW5A 1Z0KA 4OU4A 1L5RA 2X2OA 1VJTA 1WHTB 3JQBC 3S28A 4TGLA 5JIBA 4Q9IA 2XDQA 1IPHA 5CIYA 5AJWA 5CCXA 5B3LA 5KQRA 3ETGA 4QDTA 2Z08A 2D8AA 1RXIA 2B82A 2RHOA 3AI3A 4B80A 2J8ZA 3S27A 4KXNA 1RTTA 1L5WA 3I64A 3U4GA 4NZNA 4ZZIA 3LQRA 1QM5A 3JSAA 4JWKA 4KIJA 1C9KA 1EU1A 4NG4A 3C41J 3JR7A 4N48A 1E6WA 4B3BA 1J9ZA 3LHSA 1VIVA 2D0DA 3K31A 3AILA 4ZHQB 4DUZB 2JEYA 1EK5A 1TUBB 2J3LA 4AP5A 1YWGO 2CDAA 1CNMA 4IHJB 4AWXA 4QEZA 4Z54A 1KY2A 2PCLA 1E4VA 4Q16A 3WHKA 2XVZA 3K94A 5B3JC 2WKQA 1ZUHA 4NFYA 4BE9A 10MHA 2I1LA 1G60A 3Q88A 4K88A 2B5VA 2A88A 2HF2A 2BHRA 3I9FA 4GOXA 1WP9A 5KOHA 3Q5DA 2OXTA 4Q9NA 3FNGA 1MA3A 1KH2A 3EARA 3EEYA 3WGZA 2G5CA 4BP1A 3K16A 4HEHA 4OHPA 5DM1A 4ZAVA 1AHPA 2CYBA 4P4LA 1MA0A 3BIOA 3M5CA 3PPVA 2JHCA 3A6KA 821PA 1RVDA 5LD2B 2YFQA 1RI5A 3WDSA 5KIAA 2AX3A 2I78A 3EXAA 4BZWA 4E22A 2CJWB 4LDZA 4QUGA 2O9JA 4P4TA 3AETA 4TOIA 3TNFA 4E2WA 4YPOA 2D00A 3C15C 2H4ZA 3T61A 1C9EA 1YI8A 3C3JA 5F5XA 5FJIA 3I0NA 3RKSA 4UOEA 3JWGA 1YBMA 3TMAA 4D3DA 2J9FB 3RSLA 3DLAA 2GKSA 2DUJA 4DDKA 2J41A 1GUBA 3B1WA 4XVHA 4QJ5A 5EQTA 1HE8B 5HCIA 5IJ0B 1YRHA 1VG1A 2GLUA 3BICA 3ZDZB 3CKKA 1E69A 3NKLA 1Y8ZA 1CUCA 3IT2A 4S1NA 1SURA 5LYYA 1UMDB 4ENUA 1W76A 5U1PA 2GZ2A 5C1BA 3TD2A 2YN0A 3FFBA 2NU8A 2XCOA 1L7XA 3MJHA 5A71A 3ZDDA 1LFAA 2CF6A 2P41A 4JBNA 4X90A 5ITWA 1AY0A 2Q2QA 3SBXA 1YTUA 2V7QD 1IJKA 3FMOB 2HK7A 5E8RA 2PFSA 2W0SA 2EAUA 2SKEA 1DAEA 2FW9A 2IUEA 2WWRA 3TFQA 4LRWA 3TLMA 4O25A 1EJ6A 1E1DA 1A9XB 3B2NA 2RKBA 3NBMA 2R4TA 2XHEA 1SCUB 2W6PA 1HZZA 1IJEA 2VP4A 3GI1A 4K28A 5FOVA 4DZTA 4F04A 1H4SA 4ME6A 3A9TA 4RTNA 3Q98A 4BLQA 3V55A 3GLIB 3HLTA 1M83A 1DMRA 1XQWA 2CHGA 2DHRA 2I6FA 2OZVA 2Q7XA 5DCWA 4MUHA 5HMMA 4G0UA 1M8FA 1ODTC 2X6QA 3LPAA 1V25A 1SELA 5L9AA 1Y8RB 2D1QA 2VYVA 3P97A 1XQ6A 4LJ4A 4MVCA 4PVCA 4Q1EA 4NBVA 4RPIA 3GZTB 1VZ3A 2W6JA 2H7CA 3DWIA 2GRJA 2FN8A 3A1CA 2FUG1 1E58A 1II8A 1V9SA 2EERA 2XYVA 1V7ZA 1YHYA 3KEOA 2HRZA 4DSOA 5JZOA 5LWHA 3U4MA 1TEXA 4RTJA 2MSEB 4Q00A 1O6BA 1ECJA 5BSEA 3S8EA 2WKRA 1S9DA 3K32A 3OZVA 2V0CA 4KHPB 2E48A 1RYFA 4X84A 5D5HA 1H8EA 1X1TA 2Z4SA 3UJBA 4S2EA 4YR9A 3MT7A 1UWCA 2GZHA 4MO9A 5CPFA 1XZHA 2MSWA 2WEKA 3JASB 4L8YA 1MRNA 2WV9A 3D5TA 1D2HA 3GIWA 2ZYHA 3OCZA 4BYGA 1UIMA 3EH2A 4LXIA 1C7JA 3ELYA 2NU7A 1QS0B 4DSUA 1DKLA 3ZW8A 3ER8A 4P92A 5B12A 1RS0A 4GEKA 2FUNB 4HTAA 2QX6A 5CBPB 5TMPA 2XVYA 1SKQA 3DDUA 3KBOA 5D3ZA 2WTBA 2JLVA 1YO6A 1F14A 1XTUA 2C7GA 3BCHA 4UEWA 5CFRA 4RULA 1FJXA 3HRIA 4ESOA 4H7PA 5EJGA 4M37A 2RGDA 4QU8A 1V41E 5AKYA 4A0SA 1KSGA 3C6ZA 3PFFA 4H7EA 1YAJA 2LXNA 1JEAA 4LRYA 3OEHD 2I9PA 4LBVA 4EPXA 5ALGA 3WIDA 4XGQA 4BNDA 1NRJB 3CSDA 4XD2A 3H5NA 2H51A 2HUPA 4H0NA 2DZDA 1OZFA 5GJWC 3S8MA 4RH1A 1C2YA 5HF8A 1ONNA 1GZDA 1X3LA 3AF2A 3DYVA 3TIXB 3QHQA 1ZESA 3UYKA 4EYSA 4JI4B 4R8MA 4JKOA 2WJHA 2O8BB 3QEMA 4YBRA 2P9QA 5K4HA 3EFOB 4IR7A 1IOLA 4S2UA 4F9TA 1VKNA 2XE6A 2FEPA 4FZ5A 4AY4A 2R8XA 4LOJA 1IZ9A 2F3QA 3HDGA 4L4YA 5DCUA 5AKHA 3EIQA 4BFUA 4JZKA 1Z6AA 1QMGA 1W44A 4YRKA 4F6LA 4D4MA 3WB9A 1LTHR 4M86A 4ETWA 2GAOA 3COPA 3BE6A 3A3OA 2P9TA 3EPRA 4WZAE 3CXUA 4BNTA 4REQB 3A1VA 3QTLA 4W82A 4OBEA 5HGXA 1BD4A 1YCDA 1SPBS 4QNNA 5FFMA 3K0BA 3OG9A 4PBTA 2ZSIA 3QEOA 2V7EA 2C9OA 3LTEA 1OD6A 4Y6OA 3FVTA 1EWRA 1PNRA 1QBGA 5BOSB 3WFIA 1HE5A 1UBOS 1IY2A 3RS2A 4BNIA 1I1OA 1YS6A 3DFZA 1YZUA 2AJCA 1KVQA 1PWEA 2WD8A 1KJ8A 2PVSA 3G7NA 4H4EA 4XASA 3T8YA 3UA4A 5B2EA 2O3QA 2WTNA 1NZFA 4US1R 1IM2A 3RS7A 1X0VA 3GVPA 1PHRA 1RI4A 3INNA 4I3HA 1EDZA 1MAUA 1J8DA 4C7BA 4WK2B 3CNHA 3K9BA 3GZ4A 5EIOA 2Y2UA 4H9GA 4IVRA 2EP7A 4JELA 1Z83A 2FZ4A 4CVNA 3TIGA 4Z5XA 4UBJA 4FKMA 3L43A 5JZVA 4B6GA 1GPNA 4EY6A 2Q1SA 4ZT6A 1K8RA 2P65A 4X3OA 3DULA 2PUJA 3DO5A 3CA8A 4X24A 4BNKA 5CYFA 2O8CB 1P74A 1QWSA 1NBMA 2PGNA 3L0YA 3EGIA 4MS4A 2P3OA 2OXCA 1SVMA 4PC6A 1P31A 1GYPA 1AN9A 4IJVA 5IDYA 3FNQA 1E9BA 3K92A 3D5QA 2VDVE 1K5DA 4KR0A 1QFZA 2E2WA 2ZWOA 5G53C 2R7LA 4PYMA 5AI8A 2X8WA 5AVUA 3PNKA 4AG5A 3K4QA 2PN1A 2NV6A 2QN9A 4ZREA 1VBMA 3MUNA 4JU8A 5IU6A 1ZZEA 2YWEA 3D4IA 1G9XA 1U0NA 4AN4A 1EUYA 4G86A 4YALA 2QMUA 4IDOA 4E5NA 5IDXA 1DC7A 4WXHA 5FBWB 3RAGA 5ADWA 3FA2A 4HDOB 3S5UA 4LNUA 3TEJA 3MJSA 2FF7A 1NMSA 1HDYA 5ER9A 2HJHA 2DBQA 4DCUA 1GARA 2QT9A 1Y3BE 2QTRA 2V6GA 3LC2O 3NPAA 1KA9H 3DW1X 5DWVA 5LBTA 5FPHA 3ZTWA 4KSYA 3QU9A 4WDRA 1NOKA 2OFXA 3UTCA 2PUDA 4X7PA 1E8NA 1PSWA 1ZM2A 3QBVA 2V45A 1XLVA 1KYVA 1TYCA 2YUIA 3L9XA 2J0QA 1WD7A 5HG0A 3DOIA 3I72A 4Q48A 4CKZA 4R31A 1K66A 4FDVA 2JNWA 3B13B 4XGIA 4EFKA 1HNWB 2DBRA 3K9NA 1RLUA 1GQ2A 3PC2A 3ED1A 5AKGA 2ERYA 1HZZC 2MOKA 1CCWA 4LXXA 4K6GA 1F4LA 5LXTF 2ODAA 2ID8A 2IEGA 4M21A 5JCOA 3WJ2A 4DR6B 2ARKA 4B84A 3W6UA 3MVEA 2J3QA 1WLYA 1KAQA 2WKPA 3A6ZA 1NVWQ 3SEZA 3FBTA 3G2MA 1ZD1A 2ISCA 4U39A 3TYXA 3H8VA 1Q5PA 2AC7A 3DKPA 3O47A 1GU1A 4HB4A 3MXTA 4HAUA 4MIYA 1Z28A 7AT1A 2F48A 2BDTA 3P52A 3ZXXA 1X1SA 3HYLA 3UJ7A 4JFAA 5EGSA 3GA5A 3ORFA 2GD2A 1PU2A 2HF9A 2I55A 3CZMA 2PUVA 2YXNA 5AKZA 3JRWA 1JW9B 3H4IA 2A33A 3TNJA 4M7OA 5HIKA 3IOMA 1O6FA 1FF9A 1Z56C 2PTHA 4GM4A 4KQMA 3ROGA 3ZEIA 3C5HA 3WRXA 1PLLA 2VDRB 5L7WA 1W5AA 2C54A 2CFCA 4MP3A 1T10A 2PPVA 4YB8A 4DVJA 4JHXA 4GGPA 4L6AA 1O8CA 2APJA 2JIOA 1F2UA 3BXZA 3O92A 5DM4A 3IP7A 1HYEA 3ANSA 4XXHA 2YBDA 1DTWB 4KYUA 5FLYA 3T7KA 1AX9A 1Z25A 4HFNA 4WFJA 1JFFA 5DHFA 1C1DB 3EE6A 4E03A 2C1XA 2JCBA 4PY2A 3EVGA 3COWA 5EZSA 5BN5B 2P9HA 4EX7A 4LECA 4S0XA 3SX4A 1YB5A 3MMXA 4OMUA 5CEFA 1N6RA 5EESA 3PT5A 1KR5A 3KHTA 4NEGA 3RR2A 4AICA 3I9LA 1J0DA 1RQLA 5AVYA 3FTCA 3KQPA 1OYYA 2VXBA 2P2SA 4ZJPA 4GOOD 1VKOA 4BN0A 1HNNA 1CY4A 1PS8A 3DOEA 4BVJA 1CY1A 3TB4A 1ODIA 2XCLA 2QG4A 2MSDB 1MGPA 1IM8A 1OSNA 3UCXA 5KVVA 4JNKA 4BJHB 3R4VA 3GFBA 4J7AA 2HXSA 3DUFA 5LJLA 1HNXB 4YEDA 3V4PB 4GYKA 2WF8A 4R9VA 5FLKA 4ZYVA 4AO7A 1XZIA 2A2ZA 1J56A 1NN1A 3SVZA 4CBVA 4BOYA 3CVXA 1JS1X 4PC7A 1H2HA 4CW7A 5H81A 2ETXA 1QP8A 1IL0A 3WQBA 4CM7A 1YTLA 3MTDA 4G07A 5TE9A 1JA1A 4KK3A 3KJIA 3MGAA 4YXWA 5CDUA 2AG1A 3HA7A 4B3CA 4LVNA 1LU9A 1YOVB 2BGKA 2Y05A 2FB9A 2YOFA 3LQKA 3OJXA 4GMKA 3OEEA 4INJA 4LRUA 4MCIA 2Z8XA 4MZDA 4RH3A 1D4ZA 4UQOA 4F21A 4F5EA 3GCXA 3RREA 3SYKA 2IHVA 3QEAZ 2JGEA 4LGYA 1OV6A 2BKVA 3EC2A 3FSGA 3FCXA 3O84A 5BRAA 3HR7A 3PENA 3U7GA 4KPGA 5HTKA 3CPJB 1BDMA 1VPEA 4DDUA 4TV9F 1DQRA 3NOOA 2QZ4A 2JGRA 2KJQA 2JI4A 4MRSA 2RFLA 1E4YA 3NOVA 4FYJA 2TMYA 3S55A 1EESA 3BWMA 4EW1A 1AH2A 3M4ZA 4H1HA 2GPWA 2PMKA 4J6EA 3F7OA 4C21A 4QUBA 4JDPA 1D09A 1X8JA 5HQJA 1N78A 2OC9A 1JI0A 2ZRPA 1M7GA 2H4YA 3E9QA 1YXMA 3ESXA 2XEXA 3O2JA 5COBA 3QPWA 4K9KA 4MVJM 1NR5A 1GADO 2CVZA 5FI0B 4D02A 1S02A 2R8OA 1M5RA 1JAXA 4HDSA 2DECA 3A1DA 3GN1A 3A4YA 1C4XA 1JFRA 4X1KA