2NMVA

Damage detection by the uvrabc pathway: crystal structure of uvrb bound to fluorescein-adducted dna
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
Knots found
sequence length
652
structure length
620
Chain Sequence
DRFELVKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Damage detection by the UvrABC pathway: crystal structure of UvrB bound to fluorescein-adducted DNA
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
total genus 224
structure length 620
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2nmvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA01
1E9AA 3SHWA 3UK6A 2QSZA 4Z51A 4X8OA 2EU8A 2IBMA 2ZR0A 4P0TA 3L0IB 3OEED 2NTYC 2OBMA 3MCAA 3NBXX 3DM9B 4AYWA 1XRJA 3KFXA 3GQBA 4LZZA 4OK6A 4M1KA 3CO5A 1A5TA 5BWMA 2UKDA 1XCMA 3ZQJA 5JI2E 5J4YA 1KK3A 4D4LA 2ZJ5A 1R10A 1XXHB 1SVWA 4LHYA 1TL7C 2EFDB 2QEQA 4Q18A 4M0LA 4N3NA 4B73A 3TR0A 4FCTA 1SXJC 4GZLA 4DVGA 3BXZA 4ZO4A 2C03A 3U7EB 5LPNA 3VFDA 2PCLA 1F3OA 1HYQA 2GZAA 4QM7A 1ESMA 4CEHB 1ZNZA 1R5BA 2XOKD 4ACAA 2ZRLA 1DAEA 2OE2A 5KNBA 3K0CA 3N70A 4XSGA 3DKPA 1LV7A 1NJFA 2NIPA 1G64A 2WJVA 1U0HC 2ZITA 1WCV1 4JLNA 4LYFA 4P4SA 5KSPA 1W36B 3QF7A 3DL0A 1FMLA 3TQFA 4G5RA 1KIMA 4BFZA 4DCVA 4MA4A 2OUKA 2JJ2A 1XD2B 1LNZA 2V1XA 4I1OA 4OL0A 3OEHA 3DEFA 2VHUA 4N0EA 5SZJA 3KQHA 5DI3B 3T12A 2KI5A 2J7KA 5EZ6B 3T5GA 1CBUA 2I1QA 2P6NA 5TB5A 2CNWD 3C16C 2ZSEA 3ADKA 4Q00A 4Q7MB 2X8AA 4S2EA 4B75A 1U8ZA 1MO5A 1R5OA 1Z0FA 1CJMA 1YRBA 1Z83A 4JIMA 2DFNA 2KBFA 2WAYA 2RMKA 4DIEA 4NONA 3VMFA 2VL7A 3QVVA 2J0UB 4PHTA 4QFMA 2OXRA 1CRPA 2WKRA 1K6MA 2IC5A 721PA 3PV0A 2BJVA 2HEIA 4JVSB 3IO3A 4JS0A 4MH0R 1IM2A 2JDID 3WXMA 4AKIA 5EE0A 4YXWD 1OFUX 3TIFA 1N6KA 2OBLA 2QMEA 1ZC3A 3PG5A 2Z43A 3K9LA 4BFVA 3ZDQA 4KSBA 1G5TA 3KJHA 2VLIA 3NH9A 3FKSA 2K5UA 5DGXA 4TL6A 1QHIA 4QGGA 3RSLA 4F91B 4DWJA 4WA7A 1N25A 3C41J 4BQSA 2XJ9A 1KDOA 2EFCB 2I4IA 2QTHA 5KSOA 4TMXA 4CYMA 2BMDA 3B1WA 4HUQB 4Q5IA 4BFUA 1WMSA 1G3QA 4BEBA 3MJRA 4HAUA 1NL3A 3A1SA 1MO4A 1QBKC 5JBQA 1OXXK 2GEVA 1XMVA 2RGGA 3M1IA 1Z29A 3ZVRA 2C04A 3BH7A 1E69A 4C7OB 3LLUA 1HT1E 2B8TA 4Z8XA 2RCNA 1Z63A 2BWJA 3VAAA 3HR8A 3GPLA 2V3CC 1XWIA 1RE0A 2VP0A 1C9KA 3OE7A 1UPTA 2WSSA 4KCGA 4Q9LA 5FR1A 1LB1B 3VR2A 4RZXA 2I3BA 2O8BA 4D4KA 3NBFA 4LUCA 1NY5A 4AK9A 5JEEA 1ZD1A 4A8JC 1DARA 1D8TA 1MRNA 1RJ9A 1FL9A 4TYWA 3AUXA 3P32A 1ZIPA 2W2VA 1G8HA 1VCOA 2BKEA 2ZR9A 1D9ZA 4F92B 5K8TA 1OHHA 1XTJA 3A1WA 4ZIRB 2FDCA 2J0QA 4L16A 4GBMA 2QA5A 2FN4A 5CK5A 2LKDA 4HAZA 5EP2A 2ORVA 4RKEA 4LV8B 5TDHA 1E1QA 2MMCA 2P6RA 2QI9C 1Z06A 1NKSA 4FI3C 2IF2A 4TQAA 2QRZA 4B74A 4GT1A 1N0VC 1T8UA 1RRFA 1COWA 1Z28A 4LHWA 5FUXA 4DHEA 4W5JA 2YJTD 3WP0A 1GL9B 1NN5A 3RS2A 2A9KA 4JLPA 1Q3HA 2CLDX 3LH5A 1IN8A 3U3MA 1E2EA 2F6RA 1JB1A 2D2FA 3Q85A 3ADBA 3ZZ0A 1E1RD 3TRFA 4MRPA 1R8QA 1E2IA 1QDEA 2OCAA 3TMKA 1Y3AA 2CHQA 2RGCA 1GWNA 2VO1A 5JEDA 2IX3A 2C9YA 2F43A 3QPUA 1OXSC 3EC2A 3HJHA 4AY2A 2GESA 2IA5A 2OLJA 1XJCA 3M4YA 4JLDA 3IHWA 2FGJA 4JLAA 1GZSA 1SHZA 1KDPA 4Q19A 1W36D 3GJ0A 3IBGA 3B85A 1AA9A 3ICQB 3IUYA 4Q66C 4Q48A 3UMFA 1JECA 3LBIA 1FPMA 3UKDA 3R7WB 3HU1A 3HYRA 3KFVA 3SJCA 3SFZA 2DPXA 2GVZC 1YKSA 4URUR 2AL7A 2CL6X 3ND9A 4EKDA 3ZVLA 2KBEA 2G6BA 3B9PA 3T5DA 5K8UA 2VHTA 5KDDA 3LXRA 3O8RA 3P20A 2J41A 2IUSA 2LWIA 4PAMA 3GLFA 1HV8A 2ZAMA 4DEXA 1SZPA 3K09C 3IEVA 1RC8A 1W4BA 1GKUB 1W1WA 2RGDA 3K9NA 4HLDA 1A1VA 1RRPA 2GTPA 2QZ4A 1O3YA 2YVUA 1CR0A 1W2HA 2ZSDA 4OYHA 1KAOA 1QF9A 4AKHA 1FP7A 3HDTA 1Z0JA 1KDTA 3KB1A 5TV2A 1OIXA 2JIZD 4B76A 1YR7A 2ZRJA 3GJ6A 1E94E 2ZREA 1D5CA 4PPNA 2B7BA 5LD2C 4AG5A 4X8LA 2CXXA 1DAKA 3BWDD 4TMZA 5C18A 1YR8A 1W4AA 4KAXA 1NSTA 2O8DA 3V4RA 1XEWX 2JJ1A 1N6LA 1TF2A 3LX8A 5FUYA 4FMBB 3X1ZA 4P32A 3OFNA 4GP6A 2OG2A 2ZI4A 2QU8A 4Q03A 2KSQA 4RD3A 1GNPA 1CJVC 4C0HA 3LO5A 5BW8A 2XTNA 2GCOB 3BB1A 4AURA 4BECA 4BFTA 4LJAA 3CONA 4QNMA 4BLRA 2WTUA 2RGEA 1CXZA 2A5JA 2JLYA 1P5ZB 3K0SA 3D3QA 4B32A 2OAP1 4US0R 1A4RA 3BB3A 1Q3TA 3CX6A 4DBLC 1EESA 4DIDA 3C5HA 4QHTA 2C96A 2G77B 4WOPA 4ERNA 5BXQC 1H8ED 4HATA 1TU3A 4HAXA 1NBMD 5FPHA 4JVMA 1GL6A 3P26A 5FOVA 2QTFA 3K9GA 3AV0B 4ZDWA 2C2HA 3RABA 5JI3E 4HZIA 2QG6A 4XIGS 1TEXA 3I61A 1QHHB 2BBTA 4A92A 4IDQA 1FUUA 1BYIA 2DCUA 2BIFA 1R5NA 3EPLA 2PH1A 1LF5A 3OIWA 3MSXA 3GJ8A 5H1YA 2VSFA 2RAPA 5A5GA 1DG3A 1OPXA 1VCMA 4P3YA 2PJRA 4I99A 4WZ6A 5DSZA 3U3OA 3GLFE 2WWHA 4EJSA 2XTZA 3TSWA 1EFHA 2BMFA 3RVBA 5KSYA 5E7MA 1U99A 4LGMA 2WBLC 4B3CA 1JPNA 1BYUA 4Q1FA 2XXAA 1BMFD 1E3MA 1IN4A 3GEIA 4ZCMA 1JR6A 1E99A 4GRAA 4I1VA 2X2EA 3GMTA 3EC1A 4JLOA 3FPAA 1HE8B 3RC3A 4IW3B 5AR1A 3THYA 2NMVA 2V6JA 1ZVQA 3U44A 4B47A 4B2PA 4B6FA 2J5XA 3I72A 1T0JB 1WA5A 4JLMA 3WBJA 1T4GA 4ZKEA 3TW8B 5CLLA 2GETA 5EP1A 521PA 3U3JA 3SNHA 2V9PA 1UDXA 4DT1B 2BEJA 4BGDA 1ZJ6A 4B3BA 1YZQA 1TAGA 5LB4A 1I4DD 3B1ZA 1W0JA 4KXFB 3T1QA 3PXGA 1VG0B 2ZE8A 2PEYA 1OYWA 1Q22A 4C9BA 3VKHA 4DDUA 4W5HA 3W90A 2D3WA 4POAA 1XCGB 1N5JA 5L3VA 5JWHA 3TH5A 4TZ6A 1ETUA 3PEWA 2QP3A 3I5XA 1W49A 2YOFA 1FNMA 5FL7D 4XWOA 4IOLA 5FBWB 2GXAA 4V0MA 1A7JA 2Z83A 2Q0HA 1ZUIA 2BBOA 2QM7A 1U8YA 3QF4A 5DH9A 1KI9A 3QPVA 4BLQA 1KKLA 1G8YA 1S9HA 2H8KA 3G5UA 1ZM9A 2B8WA 3AF0A 3NC1C 3LBHA 3WNBA 3AP2A 4A15A 4C0JA 3THWB 2CDNA 1AM4D 1XBTA 1U0LA 1JQLB 4UXHA 4P4TA 1CJKC 1D2EA 2FJUA 3KXIA 1Q1QA 5DN6A 4K46A 2GBLC 4TL7A 4MKHA 3QIAA 2JLZA 2V7QA 3KDSE 1PJRA 2CLCX 1E2QA 3CKLA 4C4PA 1C4OA 1KTVA 121PA 5TMPA 2E9SA 3B13B 4WXRA 3AVTA 5JJIA 2OCYC 3TR5A 3A1VA 3A4NA 5JRZA 2CCJA 5M04A 3OEEA 3E2IA 3EARA 1KMHA 2VHQA 1P7CA 2IXGA 4NE2A 2JLRA 1II8A 1GNRA 3D7MA 2HT1A 5CIQA 1LFDB 2GZDA 2PX0A 4LC0A 5IT5A 1X86B 2W2TA 2ZXUA 2FOLA 3C14C 3TNFA 3PQCA 3PITA 4OQFA 4HB2A 5C1BA 1MABA 4CF7A 2R8RA 4TTQA 5KDLA 2O8FA 3DOEA 4OKSA 2FSIA 4P4UA 1XX6A 2XAUA 4MUBA 1OFHA 4IVPA 3RANA 5CDFA 4PAQA 3GFTA 3NWJA 3QI2A 1Z6XA 5JCPA 4PC1A 3FMIA 3SJZA 4B3XA 2YKGA 1CP2A 2WJYA 2XOKA 2ERXA 2NO6A 3Q5DA 1DO0A 5DYIA 4V0ME 4IOKA 1RKBA 2AFHE 2H16A 4EFMA 1PLJA 2KWIA 4MGZR 4JMPA 3C5CA 3NHAA 4Z8YA 2ZE7A 1M8PA 1XB2A 5A4JA 4JVLA 2MSCB 4A0FA 1XZQA 3W5JA 2HYIC 4KO8A 3BRWD 3MWKA 4Q1BA 3KJEA 4LHXA 2CL7X 3DMDA 4GMDA 3FVQA 4Q9HA 3QKRB 2CNWA 1YHNA 2ONJA 4L15A 1J7KA 2CK3A 3WRXC 4C0QC 3PFIA 2C99A 4PX9A 5L3QB 3EZ2A 1DAHA 1JQJC 3U5ZB 3T1TA 4RD2A 1G3RA 2EWVA 5FR2A 4LBWA 3A1UA 3A8TA 1FQJA 1II8B 1DADA 2CEAA 1UEIA 1PVOA 1G8GA 2FSGA 2R44A 4U02A 2BBWA 2CMKA 4NL4H 4Q47A 2Q21A 3PEVA 2JDIA 1MABB 3W6NA 3CBQA 4MKGA 3PR1A 1NMYA 1HQYE 1CR2A 4YXWA 4M9QA 3O8DA 2OILA 4NBSA 5DYGA 3PUVA 3TK1A 2GNOA 4C3ZA 2QM8A 5AWFC 2WJIA 1CIPA 2WWFA 1IJFA 4MKIA 1XPRA 1DE0A 3SN6A 2OFOA 1E9EA 3LV8A 4CZ2A 1JI0A 2VA8A 3AP3A 1YRAA 1KK2A 1SVOA 4ZCLA 2JATA 1ZM4A 5L3RA 1SHKA 4ARZA 3VNUA 3KL4A 4JYBA 4QRHA 5DE3A 1M7GA 2ZRGA 4Q4JA 4XVUA 3ZVNA 3KTAB 2FNAA 1R2QA 4UKDA 4AKGA 3ZLJA 4EPVA 5FOWA 3CZQA 3K9HA 1US8A 3NKVA 2A78A 1SXJB 2QP4A 3THOA 4A9AA 1XP8A 4A0GA 4B35A 4EIWA 1KDRA 2GJSA 5JWRA 3NEYA 2J46A 1Z0IA 3EIEA 1RW4A 1E2MA 2OFXA 2XNDD 3AB3A 2FG5A 2EWWA 1Z6AA 1T3HA 1E0KA 3BS4A 4XWAA 2E1RA 5BYJA 3LD9A 2AWNA 4DSNA 1SXJE 4EUNA 1OXTA 1UM8A 3EWAA 4GOKA 3ZYCA 1KNXA 1X6VA 2VP2A 5EJEA 4KVGA 1D9XA 3DM5A 4EPTA 2FE4A 1M1YE 4HEJA 2WM9B 1QHXA 4MGIR 3LLMA 4Q7KA 2J7PD 1EK0A 1VHTA 4PHHA 2EYQA 3BK7A 1A82A 2GF0A 4OQLA 3QNUA 3GJ5A 4M4SA 2UZIR 1Z07A 4OQMA 4KU4A 4R7ZA 4WAUA 1Z0KA 2J59A 1IY2A 2W6ID 5EQTA 1U9IA 3OIYA 2ONKA 1G41A 2XZPA 3IIJA 3Q7QA 4TTPA 2EW1A 5SZIA 1BS1A 4LJ9A 1ZCBA 3IQXA 4W9MC 3IIKA 1ZIOA 2BKUA 4LYHA 1XXHA 3HWSA 8OHMA 2NO9A 2VQSA 5EXTA 3R9IA 1JPJA 1VPLA 1YQTA 1KI4A 1AZTA 3MUFA 1K8RA 1E1RA 4W7SA 2LKCA 4Q4AB 5FBQB 3N2IA 1II0A 3CRRA 1DO2A 4RZ3A 2IHYA 4CEHA 4TT3D 3RWMB 3QOFA 3W5IA 4CGZA 2YWEA 4JT4A 1E9CA 4DFCA 4UXJA 3RDPA 4AWXA 4TLCA 4WBSA 3ADCA 2JLUA 1PUIA 1G17A 5EZ5A 5CLQA 2NZ8A 5DHFA 2ZR7A 4QBFA 2GKSA 2V54A 2G1JA 4KFSA 4XH9B 3EA5A 2G9NA 3G82C 1XD2A 4LX0A 1WBBA 1OJLA 1GG2A 1II9A 5H8WA 1H8HD 2ZRKA 5DI3A 4PZLA 1NLFA 2OO7A 3KKNA 3ZS9A 4JLJA 5G3ZA 2OHFA 1GM5A 5JHHB 4NCNA 1G7TA 3CUEF 1F2TB 1GRRA 3J81k 5EUMA 1SVMA 1VTKA 3ZVMA 1ZYUA 3ZZUA 2CL0X 5GVSA 2GCNA 1KZ7B 4YC7A 5KYKA 1Z8FA 2WKQA 4BLOA 2ZU6A 4ZPXA 5C4GB 2J0UA 5FL3A 2JIZA 3RS3A 3FTQA 1J99A 4M9XA 3PIRA 3GFPA 3A4MA 1FW6A 2F9MA 4LJ7A 4D2IA 1X3SA 3R8FA 5EP4A 2RGBA 1KY2A 2A3RA 1E2DA 1P62B 2J0SA 1ZD8A 3BH6A 4JSYA 1P73A 5DNYB 1W0KD 1XNJA 3MGCA 1UBGA 3JZAA 3F8TA 4HLQB 5FPSA 4F38A 2XITA 4QBGB 3I62A 1XXHE 2Z6VA 4CEJB 2FEMA 4PC6A 2J87A 2VHCA 3L2OB 1QVRA 1Q20A 3TE6A 1P2VA 2FH5B 2QPTA 3FMOB 3A36A 4HUQA 1ZD9A 4HYYA 2ZRCA 3G0HA 1B0UA 3SZRA 5CYOA 1E2JA 1SXJD 5JJLA 5ANRB 1F5NA 1PLKA 4M22A 3Q3JB 5C4MA 1AS3A 1KMQA 1E9FA 3KJIA 5D3QA 5DO9A 4U7DA 3ZQ6A 2OCBA 1GVNB 3QKUA 4QC2A 1E9BA 2IS6A 3KKPA 4J0QA 1H8EA 1YR9A 1GOTA 3LVRE 4C7OA 1G4AE 2BV3A 1ZW6A 3GJ3A 4CRWB 4FWTA 1KO7A 1NBMA 5JMTA 3GJ4A 1ZM3A 3CIOA 2GJKA 1NN3A 3AF2A 1Q12A 2YC4C 3PUYA 4LY6A 4E03A 4HB3A 2PCJA 4HLUC 4QHSA 1DELA 2ZU0C 1R4AA 3Q9LA 5KNDA 1SVLA 3BD9A 4Q4HB 4NCKA 2WWGA 3W6PA 1QHNA 4Q7LA 1HEIA 1Z3IX 1HT2E 1NP6A 1CJUC 5G41A 2AXNA 5IK2A 1M74A 4C0AC 3EPKA 3THXB 1NG9A 4CT5A 1OH5A 4ZIRA 4MDEA 3LW8A 4G01B 1S0UA 3D6TB 5BN5A 5FTJA 1G7RA 1BMFA 3WY9A 2Z4RA 1CRQA 1HY3A 2CVHA 3ND8A 1RIFA 2IEZA 1YZGA 4YMSA 2DFKB 2AKAB 2G0TA 2ZANA 3BE4A 1IN7A 1KO5A 3PCRB 5K8LA 3BBPA 2Q3MA 5JLJA 421PA 4PO8A 1ZM2A 4F4IA 4JVNA 4JLKA 4LPSA 1D6JA 1A2BA 1Q21A 2BDTA 5LD2B 4AI6A 3UG7A 4A4DA 1FUKA 2AHOA 2CBZA 3LFUA 5J47A 3I4LA 5F9HA 2G83A 2C5LA 4Z54A 1J8YF 4DKXA 2VYFA 3EAQA 3K70C 1GL7A 3EXAA 2QMHA 3TSZA 2VP9A 4DLRA 2IS4A 4G1UC 4B48A 4Q21A 4UJ5A 2XSZD 5J40A 2J0VA 2QMOA 2BVNA 1XTQA 2REOA 4MGYR 4F4CA 2QAGC 4FMDF 1S9DA 2QL6A 3LX5A 3WBKA 4DDVA 4EDHA 4HAWA 1TNDA 3CM0A 3DPUA 4B71A 1DBSA 5FL7A 2BMEA 2CCGA 2RGNA 1OIWA 3R7WA 3WMEA 3EZ7A 2FF7A 3BH0A 4D4MA 3GJ7A 4DJTA 1QG2A 1WXQA 4PO9A 5EXSA 3SOPA 5L3SB 1NBME 3VR5A 1E2KA 3I8XA 4HAVA 1JNYA 4DC9A 3FWYA 2OLKA 3AQ4A 1O87A 5B30A 3R8CA 2ZRAA 1KJYA 2Q9AA 1MH1A 1G16A 4D80A 4LV5B 1WBDA 3AVUA 1WQ1R 2PLFA 4UNSA 1UEJA 4JL8A 3RNLA 4L9SA 3K0FB 4C2UA 2OCPA 1KNQA 2JAQA 2PZGA 4FIDA 4LPKA 1IN6A 3BFXA 2GVDC 2WWWA 1E0SA 3QBVA 1G8FA 5FOSA 2FPLA 4X8MA 5HE9A 1OKKD 4B34A 2VF7A 3CB4A 3FMFA 1XU4A 3CWQA 4OJKA 3A1TA 3DVLA 5FTKA 3OAAD 1Q44A 5HZHA 2QRNA 3E5HA 3EW9A 4TYQA 2KB0A 5AK0A 4D4JA 2CHGA 3U4QB 4DDTA 2GCOA 1JEEA 3CWZA 1ZUHA 3IBYA 3VX3A 3QKSB 3RS0A 1N6OA 1BH2A 2OEPA 4HSEA 5J5CA 1JR3D 3HPRA 3QVUA 4C30A 5FH9A 2ZSAA 1XEXB 3QXSA 1F2UB 2WPDA 2IYSA 1KKMA 1EGAA 2V8OA 3GFOA 3K53A 1MO6A 3SR0A 3SQXA 5D3MB 2SHKA 4URVR 3GLHB 4XD7D 4JLBA 1MRSA 3REGA 1NIJA 1X1SA 2A7QA 3NDPA 2P67A 4Q1EA 2B21A 2C78A 1E96A 1W7AA 4V02A 4Q7JB 5KDOA 1C1YA 4XVRA 3QY0A 1ODFA 3LBNA 4AG6A 4PSAA 4FCWA 3GLHE 1XDBA 2ZRHA 4HZUB 1QHHA 1U0JA 2IHBA 4YLGA 2WKPA 2VRWA 5FI1B 3L0PA 4QGAA 1EWQA 4DZZA 2DHRA 1EFUA 1XCPA 1OH8A 2NZJA 4BE7B 2ZI5A 4NPHA 4RY2A 2P5TB 3O8BA 4IFEA 4ITRC 1M2OB 2WVJA 2NO7A 1TQ4A 3FWLA 1NVVQ 4IVRA 3SYKA 2BMJA 4RFVA 2Q3FA 4B43A 3N5CA 4TN1A 2JLWA 2H92A 2PZEA 2VSOA 2WMOB 4OK5A 3QENA 1IAQA 2OAQ1 2CLSA 3PUXA 5AJVB 3MWJA 3AM1A 3PUWA 2HLDD 5JJKA 1HE1C 3NC0C 1EXMA 3K0CC 4KLNA 4X8HA 4UNRA 1KJWA 4M9SA 4XVQA 1KGDA 1ZUNB 4LHVA 4NP6A 1TTTA 3DKVA 1V43A 3EZFA 1Z5ZA 3CRW1 3EZ9A 4FWIB 2XZLA 2ZJBA 5FTLA 4HDOB 4O2LA 4DT1A 5FOTA 3P4YA 1KAGA 1TUIA 1TF5A 2A30A 3A58B 3MFYA 2X1VA 2FFAA 3QSYA 4Q1CA 1CU1A 4EFNA 1OB5A 3KZ1E 2F1HA 2GHIA 3QG5A 5GJWC 1E2GA 3LVQE 5BN3A 2IYVA 4Q9KA 2X77A 1G20E 1KO8A 2NPFA 2ZRMA 3O47A 4G3XA 3FOZA 5CJ2A 1G5PA 1JEDA 1LVGA 1UKYA 2A5YB 2RH5A 3OIVA 3HYTA 4GMXA 3VU9B 5KU1A 2GXSA 3LXXA 4HDQB 2WJJA 4DLXA 4IOMA 1PUJA 4YMTA 1OH6A 2ZS7A 1Z6GA 1BO6A 2GRJA 5JZVA 1DVRA 4MKFA 2F7SA 4DLVA 3FGNA 2O8CB 1NVWQ 4YMUA 1AIPA 3F0TA 5IF9A 2XNDA 3B1YA 2XJ4A 2GWHA 4AYTA 3THWA 3VKWA 2VEDA 1FNNA 1P72A 3BERA 2FX3A 2FMXA 4OI4A 3KX2A 2QGZA 1VIAA 1GKYA 2BHRA 2ERYA 2IWRA 1ANKA 4YMVA 1EX6A 5KSZA 4D26A 3SYLA 3M6AA 1VIYA 4JT2A 3VX4A 3WNDA 4DB4A 1R7RA 4IXMA 2GJAA 4BEJA 4G5GA 1SVSA 4IDOA 4PPFA 4XJXA 1W44A 1P61B 2J7PA 4FMDB 4ESHA 2FSHA 1LS6A 3DHWC 3IIMA 3Q5EA 4B3FX 1D2MA 4KLZA 4RKFA 1YU9A 4MDFA 1I4TD 2FFBA 5G53C 1HQCA 4KFUA 4PC7A 4A6PA 3TW4A 2HXSA 3ECCA 2WOOA 3CPEA 2JASA 3NHBA 5JFGA 2ODWA 2W6IA 1I2MA 3KB2A 3B8HA 3JVUA 2P65A 1NVXQ 2ZAOA 3CX8A 1DPFA 2HUPA 4F4JA 4UQOA 2PJZA 2C9OA 1E79D 3NVAA 1RFLA 2EFGA 2QT0A 4IFBA 3I1FA 5DLQC 4QOSA 1KSGA 1ZC4A 2RGAA 2OXCA 4IRUB 1Q1ZA 4RSGA 3ZJYA 3U7GA 1UKZA 4TMKA 4NCIA 1NN1A 1YJ5A 2V6IA 5F98A 2A5GA 5LDDC 2FWRA 3WNCA 1PV4A 4O0MA 2WWIA 1KZGB 1TQDA 1GAJA 2FU5C 1G7SA 4GFDA 1AKYA 1KSHA 4TT3A 3NIBA 1QHYA 5KHOC 4A2PA 5F9FA 2X2FA 3IQWA 1TX4B 2Q9CA 4ZI2A 1VECA 3MWYW 2GILA 2TMKA 4V0LA 1K5GA 1N5IA 2MSEB 3OE7D 1JAHA 1QHSA 3U7FB 2GJ9A 3PJRA 4US2R 1K5DA 5SZHB 3UWOA 1HURA 3E1SA 2R6AA 5IHPA 1EFRD 3LW7A 1OXUA 4HLCA 4YDHB 4IDNA 1UBEA 4O3MA 1H8HA 2YWGA 2NO1A 3BB4A 3CZPA 4MRVA 1XTKA 1DAIA 5KTYA 3P4XA 2ZSFA 1NVUQ 1M6NA 3EG5A 4LC1A 5C46F 4TLEA 4LRWA 3QKRA 1G7CA 4XTRA 3MG9A 3WMGA 2BJWA 3T1OA 4PQFA 5EE3A 2J45A 4DSUA 1UFQA 3GLGB 2D7DA 5BN4A 1Z47A 2QN6A 1AN0A 4QXAA 5L3QA 5AJYA 4OHXA 2HYDA 1E4VA 2GZHA 4BFSA 1P2SA 1GP2A 3K0AB 5CB6A 1AKEA 4I81A 2R9VA 1P2TA 1E9RA 2O0HA 5CM8B 3SE0A 3ZGXA 2ZPTX 4Q02A 4H9GA 5L8VA 4E22A 1KOFA 4RJLA 3W9YA 3RS4A 2ZRBA 1OV4A 4RCYA 3GLGE 2R65A 4D0NA 1IOZA 4FINA 4PO1A 3UANA 2IS2A 2IS1A 1KYIA 4M1OA 4II7A 1ZBDA 3GEEA 3L43A 3OESA 3RRMA 2YC2C 1OXVA 4B33A 1N5KA 4N1AA 4OHWA 2BM0A 2ZE6A 3EZ6A 1W0KA 1U8AA 3FHOA 5LBIA 1E2FA 4RZUA 4V03A 5CM9C 1GIAA 1VYUA 2W58A 3WP1B 3KQNA 4C2TA 3AVWA 4E09A 2ZEJA 1FZQA 5KUTA 2EVWX 3MWLA 5AUNB 4URYR 3TUZC 3KTAA 1AJEA 4NU0A 3VNVA 1Z0DA 4LCBA 1G6HA 1SXJA 4R98A 2EYUA 821PA 4L9WA 2VBCA 3AKYA 3LY5A 3MAAC 2JCSA 3QJYA 1Z6YA 4A6XA 1Q0UA 3AKCA 5FPKA 1BOFA 2P3SA 5KNCA 2O8EB 1E2LA 2CE2X 2XB4A 3ZH9B 4TYYA 5LB2A 5DISB 1N6NA 1P9WA 1SVKA 5SZKB 2PT5A 2MMGA 1UAAA 4NKRA 3RRYA 3KXLA 1MO3A 1WE2A 1W5SA 2H17A 2OM2A 4L4UA 5HZKA 1UADA 1MV5A 3DDCA 4PAOA 3GCGA 3WMFA 5KOYA 4L5BA 4BZPA 1XJQA 3QUSA 4K8OA 3K1JA 2V55B 3X1DA 4QGHA 1IQPA 2OT3B 2RB4A 2JLSA 1NN0A 1ZU4A 3CNOA 4P31A 4R9UC 1AQYA 3FE2A 4RD6A 1UBCA 2G1KA 5G3YA 2GA8A 3QEOA 4PSKA 3H4MA 1E2PA 1J70A 4C0LA 2FPKA 5EE5B 3OFND 1TPZA 2F3RA 4EPYA 4HI0E 3CF2A 2EQBA 2GK6A 1G8PA 4URZR 3SEAA 2A2ZA 5J4VA 4RD4A 3AVVA 1WP9A 1XMJA 3FPNB 2W00A 4EPXA 4EPWA 4OI2A 3RWOA 5EXPA 4AIIA 4OQNA 3JZMA 3IEUA 2WICA 5AJXA 2DWPA 4CT4B 4S35A 4Q4AA 3TGPA 2WSMA 1XZPA 5B64A 4LDJA 4TQUS 4FXPA 3EA0A 3D31A 1N0WA 5JS8A 1OW3B 2XSZA 4RCZA 4BFXA 1E9SA 2O0KA 4EJSC 2DB3A 3ONWA 5IDVA 3RC8A 5BQ5A 4LJ4A 5JSZB 1AZSC 1ESNA 3AF1A 3AVQA 2IYLD 3QKTA 1G18A 1NG1A 4LJYA 3TSOA 4AKEA 3LDAA 4YONB 2D62A 1RZ3A 1GKIA 1OSNA 3KUCA 4M53A 4N0DA 1KI6B 4PSVA 3S1AB 3V9PA 4CEIB 2NO0A 3H84A 3W3ZB 4XTCS 3KUDA 1RRGA 1KK1A 1WRBA 3AH8A 2DWQA 3TLXA 1SQ5A 3VHXA 3MLEA 4LJ6A 4A0HA 4YMWA 1I4LD 2GEDA 3VKGA 1FX0B 4TLAA 5AJWA 4B6EA 1F2TA 2XNSA 3NH6A 2VP5A 1OE0A 1GRQA 4AD8A 4QGFA 2BCJQ 1P9RA 3WRYC 1TMKA 4ACBA 1W48A 4M8NE 1YZLA 2ZRDA 3I73A 4Z1MD 4M21A 4ESVA 3IDQA 2YNMA 3SFVA 2AKYA 1KI2A 4IKEA 1W4RA 2ZUCA 2QAJA 2WOJA 4CW7A 1OKKA 1OLOA 4NYJR 1QZXA 1VMAA 5CK4A 4LBZA 2ODBA 4UJ3A 2RHDA 2ZI3A 4RZ2A 3OAAA 1W47A 4OJQA 2LCFA 5E3HA 3BJIC 4WW0A 1D2NA 4PPQA 2B2NA 1R0ZA 1DS6A 3RLFA 2D4HA 2HF8A 3FDIA 4RFSB 4CEJA 1TUEA 5HKKD 3T34A 3DOFA 3QXJA 4EQ6B 1I2DA 4HDCA 4OK3A 5B57C 2OZEA 2MSDB 5TVKA 1P60A 2GF9A 1XMIA 1CF4A 2GDJA 1B23P 2W2XA 5JS7A 1L2TA 2FFHA 4GP7A 2GCPA 3SHFA 4XD7A 3BAFA 1XEWY 2ZRIA 3QE0A 3ETLA 3K70B 4HB0A 1P4SA 1SULA 4B3GA 4WXPA 1ZCAA 2ZVPX 4ZDKA 4D25A 3CRVA 1ZP6A 1WB9A 1E0JA 1OYYA 3GEHA 1G4UR 4ON9A 4GPTA 3AVYA 3I8SA 3RHFA 2GAAA 3WHLA 2QAGB 4LJ5A 2EFEB 3L82B 4KVAA 1BKDR 4OQXA 4PR0A 3SQWA 4Q4HA 1IXSB 1XPOA 3SJAA 3LWNA 4FMCF 1L4YA 5JCZA 4KBGA 4GL2A 4G5SA 4NYIQ 1L8QA 1AQUA 4A8JB 2ODNA 2Q9BA 3H2YA 2F9LA 1IHUA 4KYUA 3THXA 2PT7A 1KO1A 3NEJA 4QL3A 4TSFD 3B1XA 5JHGB 1ZM7A 1M34E 2C77A 3K09A 2ODEA 1VCIA 4IDHA 4PZYA 2V1UA 4QBIA 1VDZA 2HLDA 4BPBA 2ZS8A 3QG1A 2HCJB 1E2HA 3GLIB 2AWOA 3DO6A 4Y0AA 1SVIA 2IYQA 2WMNB 2QE7D 5AJZA 2RGXA 2IW3A 3AP1A 1VYVA 4H1VA 3OF5A 2G3YA 4QKQA 2OFWA 1WDTA 4NDZA 4NYMQ 4WVFA 4XSHA 4PPGA 1M7BA 1AS2A 2IYUA 2JA1A 2ORWA 3JVVA 3NBYC 3GLIE 4DLWA 2ATVA 1KY3A 1HTWA 2PBRA 4EAQA 4JKYA 3KQUA 1RPZA 1N0UA 3LAWA 4KSCA 2FZLA 1JR3E 2QTVB 4JL5A 2JGNA 3CF0A 5FTNA 3KKMA 3CF6R 2HT6A 2QY9A 3SC3A 3ZIAD 3DZDA 4NHOA 2ZM5A 2PLRA 1G3UA 2ZUBA 1TU4A 4E5UA 1E98A 3HU3A 2ZJ2A 3MD0A 1GDDA 3WYFA 3IO5A 2J3EA 3CPHA 2QBYB 2XB2A 4M1TA 1LW7A 2GXQA 4GOJA 4NYJQ 2FPMA 1P3JA 2BEKA 5L3SA 2P0EA 1PLLA 3P1JA 3X2SA 4JJZA 2E87A 3H0KA 2JLVA 4CIDA 1QVAA 2Z5FA 2ZYWX 1RRCA 4TL8A 2JJ8A 1ZNWA 2CK3D 1XTIA 1S2MA 2IYXA 4B2LA 2QROA 2ZI7A 1IXRC 3U2QA 1JJ7A 3K0FA 1FTNA 3N2EA 3RS5A 3V00A 4LBVA 2VP6A 2QGNA 2A5FA 3AVXA 3VMAA 4WIAA 5FUWA 4MYTA 5CJPA 5GJVC 1R8SA 2WHXA 3BFKA 2REBA 1FQKA 2IL1A 3EWSA 1NY6A 1F48A 3BGWA 3T06B 3WYAA 1X8KA 2IXFA 1P2UA 1EFTA 2P6UA 2VP4A 2ZJZA 2ZRFA 1Z2AA 4DXAA 3EPJA 2QORA 3M0EA 4PHFA 1NVVR 2WZQA 1P6XA 4M1SA 3AGQA 4A0RA 3VHLB 4MRSA 2XEXA 1T0HB 4GNKA 3I32A 3EIHA 3U4QA 2VH5R 1KJZA 1E79A 1NRJB 5EP3A 1U98A 3QKSA 2QPOA 1NIPA 2JEOA 3AVOA 4PQRA 3AKEA 3WYGA 1XEXA 4D0GA 1F2UA 5B2ZA 1S3SA 3L0SA 4P4SB 4U5XA 4UNNA 2H1LA 2RHMA 2WJGA 4JYCA 5D3MA 1YVDA 3GLHA 1EFCA 2BOVA 1VYTA 3BC1A 1LF0A 3HP1A 4LSGA 3K70D 2WJHA 1GUAA 2GXUA 3PEYA 5H70A 1MT0A 3U60B 1G3IA 4QJ3A 4NCHA 3EPHA 4DSTA 1LS1A 2YINC 4V0NA 1G6OA 5FUVA 1TADA 2EFHB 1G19A 4V0OA 2HCBA 4TLBA 5CB8A 4HZUA 3VTKA 1ONBA 4DLUA 2FV8A 1S1CA 3FYHA 1U9IC 2FFQA 4DUGD 2O0JA 3H86A 3GD7A 4LK2A 3CRQA 4AC9A 2KJQA 3UATA 4PHGA 1EFRA 4PXAA 3CH4B 2ANCA 4O25A 1X8JA 4M1WA 1KI8A 5AUOB 4I4LA 3D8BA 3UWKA 3ASZA 1GSIA 1NLYA 3B78A 3L0OA 3ZD6A 2YV5A 2W6JD 4QJ4A 3T1VA 3V4FA 4GDFA 4EQ6A 2QENA 1Q1BA 2QPAA 4IJMA 2ZVQX 4MGKR 1AGPA 2OESA 3C4JA 1N2CE 3FFBA 3RYTC 1S8FA 4U00A 2GBLA 3WHKA 3I5YA 3ADDA 3C7KA 3B6EA 3QBTA 4TQ9A 4JBXA 2AD1A 2B6HA 1GRNA 4ZDIA 3FFAA 1SKYB 2F55A 3AVPA 4FD2A 1W36C 2FA9A 3U61B 4DCNA 1QG4A 2YHSA 3TVTA 4M2LA 4TLDA 2R6FA 2VHJA 4KYIB 4FMCB 4ILEA 2AX4A 4C0KA 2AK3A 4ASUD 2ZYVX 1VG9B 3CH5A 4US1R 3Q8XB 6Q21A 2ZETA 4OHZA 2Q6TA 5AUQA 3VR6A 1J8MF 1G1MA 3R9WA 4F93B 1L7VC 3LA6A 1SKYE 1X8LA 3AUYA 2PMKA 3ASYA 1W46A 2QSYA 2J9RA 5HTKA 2FZ4A 4BFYA 4UXIA 3VU9A 1KO4A 3FMPB 1Q57A 1OB2A 2O8BB 1CKEA 1G3MA 4NZYA 4CVNA 4DSOA 1DEKA 2O8CA 3X1XA 3QXHA 1RJ9B 1GFIA 2AD5A 3SS8A 4BRWA 5KPJA 3ZD7A 2L0XA 2R2AA 3X1WA 1W2GA 1YE8A 1XMSA 1VHLA 2CVFA 4IVQA 4BZXA 4F7WA 4P33A 2J1LA 1E0AA 5EE1A 1R0WA 2IYZA 5J4LA 1E6CA 1SGWA 1QHGA 1G21E 4QG7A 2F1RA 3U6BA 1VKJA 2IYYA 1CR4A 4MRNA 5ELXA 1DG1G 2ATXA 2DFTA 3DMNA 3KQLA 2IXEA 5JRJA 1IY0A 3MMPA 3SBDA 3B9QA 1R0YA 4RVCA 3X1YA 4HB4A 1NKTA 5DI9A 1IXZA 3NTUA 2X19A 1KSFX 5UKDA 1AS0A 1ZNXA 3CNNA 1N6IA 3BIFA 4GSYA 1Z6TA 1UF9A 2VF8A 2HV8A 4FN5A 4BUJA 5B58C 4JLVA 1EG7A 5G40A 3CPJB 2ZJ8A 2N46A 3P27A 4Y0VA 2NQ2C 5FOUA 1E4YA 1W4CA 5GJBA 2HDNB 2F43B 1FP6A 4GI7A 2ZRNA 3UMRA 4LOAA 1U94A 2PEZA 1GTVA 3FHCB 4DLSA 2A5DA 1QRAA 4KFTA 5GVRA 1N6RA 4MYHA 2ZIAA 1XPUA 3B2EA 2QMUA 1T91A 2CE7A 1A2KC 2D7CA 2WAXA 5FPTA 3VR3A 1P75A 1KI7A 3B60A 4TZ0A 2YYZA 5EE9A 2JJ2D 1IN5A 4TL9A 2QQEA 3B82A 1S3GA 1F60A 3EASA 3OEHD 1MOZA 4KBFA 1V5WA 2KE5A 2R6GA 3TUJC 4DLYA 4HAYA 2N1BA 2FGKA 3TBKA 4G5QA 1JBKA 2YOGA 4KI0A 3B7GA 4EPRA 2ZS9A 3L8ZA 5H68A 3HJNA 3GLFB 3KJGA 3RS7A 4OHVA 1OH7A 4L8GA 4OBEA 1PZNA 5F3WB 2HF9A 1MR3F 1U90A 4TMVA 2H7VA 1H65A 3SBEA 3K0EA 2G0NA 1OT3A 1FOEB 1VCNA 1J90A 2GK7A 1R0XA 3I92A 4BRUA 1TQ6A 1F6BA 5IK2D 4OHYA 1UKVY 4IOJA 3TJZA 1ZAKA 4HUTA 2ZYTX 2DY1A 4QJ5A 2CJWA 3F5FA 1Y63A 3HU2A 2ZJOA 4URXR 3GLGA 1DAGA 2DR3A 3AF4A 2O8DB 1N6PA 2JLXA 2CHVA 5K8IA 3QQ5A 4TMTA 4MITA 3LNCA 1XEFA 3K0AA 2VIIA 1YZNA 3A4LA 3MRSA 3EIQA 4UNQA 4Q9IA 4Z1MA 5JWOA 1DAFA 1JXOA 3PUZA 1JXMA 1OFIA 4WZBE 2IYRA 3FKSD 2AFIE 4M9ZA 2NOAA 1NNEA 3QXXA 2NGRA 5FTMA 5P21A 5HPYB 1Q1EA 1VG8A 3PENA 2HJVA 4GZMA 5FBRB 1IJEA 2Z0MA 3TQCA 4PQYA 3CX7A 2RGNC 1ZU5A 1FFHA 4DRZA 3ICEA 4ABYA 1YZTA 1T3SA 4NCJA 3CNLA 2RKOA 4BLTA 1TF7A 1ZMXA 3CRMA 3SU8A 2IWHA 1TQ2A 3REFA 3W8RA 5KO2A 2UVQA 2IK8A 2YWFA 4D0LB 5HKKA 4O2RA 4DDWA 1KK0A 1L4UA 1OIVA 3SJBA 1HH4A 4YDSA 1GITA 2R62A 5C2JB 2D2EA 2YZ2A 4WZAE 4IXNA 5TXGA 3TVDA 5BYKA 4NH0A 2F3TA 4PANA 3T61A 2W83A 2WSSD 5E4FA 3AEZA 2H57A 1S96A 1T5IA 1E32A 1T5LA 1RYHA 3KKOA 2ZSBA 3QPWA 1JJVA 4R2HA 2VSXA 5A0FA 2N42A 5FBLB 1IY1A 3LQQA 1KI1A 4M1YA 1KI3A 2ZROA 5TY0A 2I1VB 3CR8A 4UNPA 1CJTC 1CULC 3U6KA 2XGJA 2O8EA 2ANBA 1OHHD 4EJSB 4DB2A 2CJWB 1S4QA 4DCUA 1SKQA 4A36A 3NBZC 2AR7A 4DCTA 3U7HB 1NMZA 4JKIA 3ZS8A 2XXAB 1BIFA 1ZNYA 4KFRA 1E1QD 3PEUA 2W0SA 2QT1A 1DOAA 1FMJA 5KPDA 221PA 5DIFA 4A82A 4QM6A 3THYB 2G88A 4QNRA 1COWD 3NXSA 2NPIA 1AGRA 2WV9A 4Q1DA 4TSFA 3U44B 5FOXA 3B1VA 2PZFA 4GOXA 2ORIA 4I1SA 2JLQA 2BBSA 3HPQA 5E95A 3VR4A 4ZDJA 1XTRA 3A37A 1NSFA 4NMMA 1NI3A 1CEEA 4AYXA 2HJGA 3OHMA 1N6HA 4D6PA 4URWR 1N3BA 1R6BX 3FB4A 3LQRA 3T35A 2P5SA 4JJKA 2F1IA 2QE7A 1WF3A 5GADl 4CDGA 1U81A 1AK2A 3W34A 1YZKA 2WPDD 1ELOA 1N5LA 2ZJYA 5GJCA 1J2JA 4BASA 5J4HA 2H5EA 2V4ZA 2QQ0A 3Q7PA 4TWZA 4BFWA 3VR1A 1YR6A 4PZZA 3QF4B 2ZE5A 4OI1A 2PX3A 2BCGY 4IEIA 2C95A 4ZI3A 3ZIAA 4PC2A 2D74A 1Z22A 2QNRA 4KJZA 2IF0A 4XWKA 3NDBB 5JSZA 4LV6A 5FFMA 3SYNA 4JL6A 2Y8EA 4EFLA 2FSFA 5FPYA 4IEEA 1G9XA 3S1AA 1KI6A 3UIEA 2WIAA 4LHZA 1FTSA 3HR7A 4CEIA 1XTSA 1T6NA 1MKYA 3MJHA 3OZXA 4FW9A 621PA 1VG1A 1IONA 1XJ0A 3BOSA 3R20A 3BFVA 1FX0A 4K81B 3TAUA 2IYWA 4ZV4A 1NMXA 1GILA 5HE8A 2D06A 2IUUA 3TUIC 2JJ1D 5HCNA 4MUAA 2Z4SA 4HLUA 2VTKA 2DBYA 1S1MA 3RAPR 3GP8A 2ZRPA 1KMHB 3W3AA 2NG1A 5E7JA 5EXXA 1XFAA 4PC3A 1CTQA 2BC9A 3C8UA 4BLSA 1G291 3TAHA 4A1FA 4KITB 3CLVA 2REXB 1LTQA 4TYPA 3H1TA 3KXKA 1GNQA 3I3SR 3Q72A 2ZTSA 4KHZA 4NYIR 2PL3A 2IUTA 4KV9A 4LYJA 1HA3A 1UDWA 2XTMA 2H18A 2P2LA 3K8YA 3QEJA 4BWYA 1T8TA 2QUZA 3CW2A 4LI0A 1E9DA 4V0KA 4MYCA 3VQTA 4DLTA 5F2EA 4ZCIA 2O8FB 2CCKA 2B7CA 5FBVB 3RRZA 3TKLA 3ZZTA 4JBWA 4RFSA 2AK2A 1IBRA 4FCVA 3U3KA 5AUPB 1LY1A 2YOHA 2R6DA 3IHLA 2HXYA 3BORA 3IGFA 1KHTA 3IKJA 3KKQA 4IHQA 4A2QA 1CR1A 2ZQ5A 3QXCA 3GJXC 1JALA 3SI7A 4YQFA 5CDFE 4QBHA 3E70C 2ECKA 4D82A 2ASEA 1CS4C 1OFTA 4Q1AA 2IEYA 3B5JA 1P9NA 1UKEA 3RRNA 4E07A 2QP9X 1G5RA 4C0SA 2OBNA 2IT1A 4BZQA 3FHTA 3UMSA 4RD1A 4NYMR 2ZYUX 3EX7C 3PVSA 5HR5A 4JZKA 4LJ8A 1XD9A 4G5OA 2ZI9A 4MRRA 2XX3A 4W5WA 1T9HA 2QAGA 1OF1A 2C9CA 2OV2A 2Q3HA 1DAMA 1UBFA 1RVDA 2IYTA 3AKDA 4QHYA 2AN9A 3W8NA 4DUGA 5HCIA 2ZJAA 3UXMA 2WWXA 4TMWA 5CYPA 5E7IA 3RSOA 1UJ2A 4A8JA 1T3LA 4JSTA 2FEOA 5CIWA 4LYAA 2W0MA 3R9XA 3IILA 3OIUA 4G0NA 2GAOA 2W6JA 2GJ8A 5DHAA 1E2NA 1W5TA 3IPYA 1ZRHA 1KSJA 4I1UA 2XZOA 4Q9JA 3SDZA 3UPUA 1XF9A 3U3RA 4DEYA 2UZ3A 1EWRA 5J4KA 2B92A 3AGPA 1W0JD 1CLUA 4H1UA 3GLIA 4LWZA 3O8CA 5FI0B 3IPXA 2O5VA 1JR3A 4DCSA 3C15C 5TARA 4ARZB 5EUQB 5CITA 4Q4JB 4A2WA 1Z08A 4IDPA 4ZKDA 3LRPA 4B44A 2ZI6A 3AF3A 2PMDA 4KODA 1M7HA 3T15A 2WWYA 1US8B 2GEUA 1ZINA 4ASUA 1NF3A 5JECA 3CR7A 4MYUA 2BM1A 4M1MA 5IRCD 4R2IA 2C8VA 4MQBA 1YZUA 2DWOA 3NG1A 3FKQA 1Z0AA 2DYKA 4PTLA 4XOIA 3W6OA 4C0BA 1JAIA 1EX7A 2O52A 2VPPA 4LBYA 1NLZA 1DTSA 4RD0A 1TEVA 4D81A 1HUQA 2QBYA 4JBYA 3UG6A 2DFLA 2F1JA 1Z2CA 2OSBA 2WIBA 3F3YA 4DLZA 3DZ8A 4PFSA 5DN6D 1X1RA 4TYNA 4B2IA 4TTRA 2V7QD 4R71A 1NJGA 3L8YA 1XD8A 4NTZA 4OI0A 1U2RA 4B3DA 3KQKA 1RYFA 3A6PC 2AXPA 4Q4LA 2C98A 2R6CA 4Q01A 2ZUDA 2YWHA 4BLPA
chains in the Genus database with same CATH superfamily
4RL4A 1TZJA 2HAEA 2ODTX 4D8WA 3JQ8B 4B9AA 2EU8A 2IDJA 2IBMA 1UZMA 1X7ZB 5AOVA 3C3KA 3F2VA 3NBXX 3BBLA 1JMVA 2DFPA 2OORA 3KELA 2QQGA 3IMEA 5LQRA 3BJRA 1XRJA 3KFXA 3KZOA 3ZWQA 3NNDA 3CO5A 4PYLA 1VE1A 1HNZB 1FFWA 2HNBA 1UQTA 5LFAA 2UKDA 1KEKA 2AW3A 2CUZA 2OO5A 3AZPA 3KE9A 3R3HA 3WJAA 3ZQJA 4IZOA 1EA7A 1Z4KA 1XXHB 4MO2A 3WLIA 1TL7C 2QEQA 2I2FA 2BLLA 3NHZA 3H6HA 4KW7A 1Z15A 1ZJ4A 2XUJA 4FCTA 4BKQA 1SXJC 4MKXA 3RAFC 4GZLA 4OB8A 4LXYA 3R5XA 4DVGA 5KB3A 3TYXA 2PY6A 3ME5A 3UWDA 3D8SA 3CW8X 2XIQA 2CT8A 1KZ9A 2QTBA 1F3OA 1GVHA 3EVZA 3IP1A 1HYQA 3LMKA 2HA2A 1U9JA 2XOKD 3A27A 4IHAA 4K3UA 4N7RA 2ZRLA 3HHPA 4J03A 4U2GA 3K0CA 3JQFA 4BB0A 9GPBA 1YT5A 3QVXA 1NJFA 4HNRA 1QYWA 2NIPA 1VJTA 3MCWA 2O2SA 1QQTA 1U0HC 3OLYA 1PGOA 1URPA 5HVNA 2WQ6A 4JLNA 4HNVA 1W36B 3DE2X 2G28A 3W5CA 1FMLA 2OHHA 4G5RA 3AW8A 4IBOA 1KIMA 4M98A 5IAOA 1FTGA 3ZJVA 4MA4A 2OUKA 4OL0A 1XWFA 5E1OA 2AJ8A 2VHUA 5SZJA 3HA3A 2DBVO 2JVKA 5I9SA 2I5PO 3GXBA 4UHCA 4BX9A 3T5GA 4DA0A 4GGOA 3FSEA 2P6NA 5TB5A 1X2BA 3EGDA 3ZDFA 3C16C 1TUBA 3FZEA 4Q00A 3MS4A 4MNTA 1KMMA 1T13A 4S2EA 4OM8A 2JIRA 1U8ZA 1G98A 2MR6A 3I12A 1IQ0A 1Z0FA 1CJMA 1YRBA 3LVBA 3NPAA 4OB6A 3KJNA 5CRIA 3WLMA 3E6AA 1CK4A 5K6TA 1I5RA 3QFHA 4BFCA 1DX4A 4LZNA 3MCUA 2DY0A 4WZZA 4DJFC 1IOWA 2WJAA 2VL7A 3F47A 4IIYA 4JQZA 2XVZA 2HRQA 2PUCA 3VZDA 2WKRA 3K1TA 1K6MA 5E4JA 3PV0A 4JDUA 4KH1A 3R7BA 4YCBA 4JVSB 2PX4A 4MH0R 4MQEA 3DO5A 4MR9B 4G5XA 5EL0A 2ZZKA 4UM9D 4YXWD 1MC8A 3KPYA 3QMVA 3SM9A 3FAKA 2P40A 2IKQA 5JBIA 4EKYA 4D0SA 3EA4A 5D87A 3TOZA 1HXHA 2XMZA 4RK5A 3P9KA 3VNQA 4A7PA 4ZHQA 3NH9A 3IT0A 5DGXA 4AF7A 1RKVA 5I7OA 4HQLA 4W1QA 3DKIA 4TL6A 4QGGA 4UD2A 1ZZGA 3PD7A 4DWJA 4FEYA 1KDZA 1Z3CA 1J49A 4BQSA 1PGPA 4JI0B 1DT5A 4DCOA 3SYKA 2AMYA 3ZE8A 1JQBA 2BTQB 3BJMA 1X1CA 4TMXA 3V3TA 2BMDA 3FKJA 4BEBA 1D2CA 1G3QA 1WMSA 4A0SA 5F35A 4O2AF 5ECGC 1NVFA 3KXDA 3STVA 1YKGA 5BWNA 1QBKC 1B0ZA 2FTKE 3C3PA 1OXXK 3WBFA 3ZV5A 3DW3X 3HNOA 4IIJB 1XZ8A 2K87A 4MYDA 4OYYA 4XGIA 2IY7A 3SXPA 1CNEA 2WB4A 1W4ZA 3R24A 3BH7A 4W9NA 1UK9A 2R00A 5HF8A 3T5MA 3COJA 1MB0A 4KQ9A 1RZUA 2I03A 4NBRA 3SXUB 2RCNA 3QV2A 2BWJA 3VAAA 3CXRA 3INTA 3VAYA 3CCBA 5CVEA 1M6VA 5FR1A 4OTZA 1LB1B 3PSHA 1VE5A 1VC2A 1FXSA 2ORED 3DA8A 3G8YA 3N0VA 3NBFA 4AK9A 3G17A 4D4KA 2CZCA 2QX4A 2YNMC 4UEQA 4A8JC 1G21A 4B8WA 1D8TA 4GKJB 1NXVA 2WI8A 4WY8A 3CPSA 1QP8A 2PG3A 4CTKA 4GE3A 5FLKA 1ZIPA 3DZFA 4WINA 1OXMA 4YV2A 1VCOA 1Z8HA 4A23A 1D9ZA 5K8TA 1XTJA 1G42A 4L16A 4X5OA 4HAZA 1HSZA 4GVXA 1J0CA 1HLPA 2EGHA 4M76B 2P79A 3OM0A 2PL1A 4C2AA 2NADA 5LQNA 2P6RA 4KDCA 1Z06A 3GRKA 3SBOA 3CG0A 3QEMA 4IDAA 4XFDA 4F4HA 3E7PA 3PKIA 2Z5GA 2IF2A 4TQAA 4PGMA 3A4YA 1N0VC 5TC4A 1T8UA 1COWA 1XYYA 3RO7A 4DHEA 2G25A 1A5ZA 2AEEA 5LSAA 4PHCA 3UKJA 1KPHA 1WCYA 2CLKB 2CUNA 4PBTA 4CMGA 4CWAA 1EPUA 4N5IX 3RUFA 3U3MA 1E2EA 5CXSA 3EZXA 2F6RA 2GUWA 2P2YA 4O8ZA 4RH1A 4XGRA 1DCFA 1X1BA 2WIJA 3ADBA 1YZYA 3VUEA 1Q2XA 2EQ5A 4EBFA 2FMKA 1GG8A 1E2IA 2OCAA 1LRJA 3HGTA 3QVTA 3QVLA 1DKUA 3AM3A 4IS2A 1GWNA 1YMQA 3BIJA 2H1VA 3LT5A 1SBTA 1WMDA 4RV4A 2JGDB 2IH4A 3ER6A 5AVZA 3TNDA 4H17A 4IQ4A 2TECE 3FPBA 4UZEA 5DTJA 4AY2A 2X5OA 3IUEA 4XE5A 3M4YA 4JLDA 4CM3A 1F2DA 3Q0TA 4CMIA 3PDHA 5B58T 4FGWA 3AF5A 1VRCA 3MYYA 4Q19A 3B85A 1LNSA 4IQ0A 4Q66C 5E0KB 5HDBB 3UMFA 2BUCA 3WIVA 5CMLA 2ZBDA 5A7FA 5IBCA 2WD9A 1QQ5A 3NNNA 3HYRA 1KZ6A 3LHSA 5IS2A 2C4TA 1LWOA 5JFOA 5JZMA 1YL7A 2P91A 1PG5A 1I6WA 2GF2A 3EHDA 3LUAA 5A4AA 2AL7A 3L6OO 3D4BA 3DMTA 2CXSA 4MCJA 1NF2A 1PR9A 2KBEA 2W2NA 2Z2ZA 2P77A 3HN7A 4OH7A 3T5DA 2ZYAA 1VHDA 4CDMA 4E2ZA 1TK2A 3ANXA 3OUUA 4B82A 3WWDA 1NMQA 1G2PA 1U5CA 1UDRA 2LWIA 4CKCB 1CRLA 3GROA 3A6EA 1PZHA 3DYIA 1TVKA 4IYJA 4DEXA 3QLUA 4L28A 4QULA 4JQSA 4TRJA 1OPRA 2I3AA 1GKUB 1U3CA 3K9NA 3H5TA 4FQ7A 4QUEA 1P4HA 4BV3A 4HRAA 5LOVB 1O3YA 3EUFA 1CR0A 1U7PA 3COSA 3I9MA 3ZVKA 4OFBA 4UTOA 4OATA 2CWDA 3O3NB 1GADO 2JZCA 2ONCA 4IJUA 5AW2A 2DC1A 3EXG2 3OH8A 2ZRJA 1MDBA 3PLRA 2Z2YA 4HFJA 2MSNA 2B7BA 4FYWA 4YRJA 2JFPA 4OMDA 4AG5A 3C2QA 5M2QA 3RYCB 2R96A 5EI5A 1YDHA 5CH8A 5FORA 1NSTA 3SQNA 2O8DA 1CWUA 4D3DA 1VPTA 5FUYA 3OQMA 4O08A 2NUAB 4MUJA 3HWX1 4DA4A 2A9VA 2X9LA 4I5GA 5TT0A 5SYMA 4Q03A 2KSQA 4ROTA 4C0HA 3OCYA 4M0MA 3LO5A 3RVSA 3BXPA 5BW8A 3DEJA 4MQ4A 1ZVVA 2XPCA 3A1FA 2C0QA 2E0IA 3S4YA 4YEDA 5JDIC 4DV6B 1JLLB 5AOBA 2ISQA 3GAFA 2XNKA 4UATA 2OCGA 2JLYA 3R6DA 3AUFA 4UE3S 2PV0A 4OOFA 3PE4A 2FMFA 4ZOBA 3V7NA 1VLLA 1K8YB 1F6WA 2JI9A 4L9AA 1GNTA 3AUTA 4Y2PA 4DBLC 2D6FA 2GERA 1EESA 4OXNA 1Y4DE 2C96A 2V3WA 4P92A 3S0JA 5A0VA 1G8JA 1UK8A 2AOTA 4BMZA 1BKSB 3QWHA 4MYSA 2XWPA 3W78A 1JXAA 1GEGA 1WCWA 4G36A 4UARA 3N9IA 4X7PA 3UJNA 2X23A 2YY6A 3KD2A 1S6YA 1QVZA 4QTTB 4B3HA 4TKMA 4DZRA 2QTFA 2CFCA 1MTOA 3AV0B 5AKEA 2EKPA 3ABIA 1C9MA 1YH3A 3QE2A 5CR9A 3IAM1 1POWA 5DNWA 4PE5B 3EQ9A 3PKZA 3UOAB 2JFXA 4OLFA 1LF5A 3OIWA 3MSXA 4GPD1 3GJ8A 5H1YA 1OPXA 2HNKA 4Q3BA 5JSHA 1J42A 3U3OA 3GLFE 3CUYA 2WWHA 3NGLA 1BDBA 4I7EA 3RCBA 4Z4IA 3GOHA 1FFDA 4K9MA 1YAHA 2GJ4A 5DNDA 5TMDA 2I4MA 3WG9A 4ZPJA 1GUDA 3Q11A 2AGVA 4G26A 2C83A 3AL0C 1J06A 1BMFD 1JR6A 4BNMA 1E99A 4QSMA 3UMYA 2QRVB 3GMTA 4MJ3A 2DPMA 3K9FC 3FFWA 1PYGA 1Z5WA 1UP4A 1HE8B 3K30A 4IW3B 4OJYA 4L75A 4YO8A 3THYA 3GVCA 2NMVA 1ZI9A 2V6JA 1WXEA 3ZIDA 3F4LA 1CG6A 3HKDB 5BR7A 2F90A 1HT0A 2HMSA 2WRZA 1SK9A 1T0JB 3FVRA 5F77A 3KLMX 4CM8A 1OLXB 4MVCA 2P8JA 3DMHA 1A9OA 1J21A 3GT0A 3TW8B 5EP1A 4AWBA 2ABWA 1Y5LA 1FQOA 2V9PA 1JR2A 1L7DA 2V7GA 1CY2A 2V3VA 2P7HA 3LVFO 1KRHA 1L8XA 2YL2A 4RETA 3VPGA 4A0HA 4GOOD 3BMQB 3DS8A 4NDAA 3ANNA 1XQ1A 1W0JA 5CBKA 1XMQB 1X7HA 3T1QA 3WLQA 3ONFA 1OYWA 4C9BA 1UIMA 2RHTA 3SYRA 1Q0LA 4L27A 2PSEA 3P96A 2Z3VA 3QX9A 2YR0A 1KQNA 1K75A 4POAA 1N5JA 5AT1A 5T6MA 2Z1DA 3QA9A 3TH5A 1BQ4A 2D2XA 3QKIA 3I5XA 4GKKB 1IVSA 1QNFA 5D5HA 2YOFA 5ED4A 4XWOA 4F6RA 3QFSA 4NOKA 4XYGA 1OGJA 1CF2O 2QRQA 5B1YA 1ZUIA 2BBOA 2G9QA 4EMSA 3O2JA 2W22A 4LFAB 5DH9A 5IAAA 2ST1A 3EB9A 5AXCA 3TEJA 3ZHYA 4L8YA 1HKHA 4BLQA 1RWVA 1UK6A 1V6AA 2H8KA 3QU2A 4E08A 2QD1A 3NC1C 1ULSA 2PBLA 3WNBA 1RWQA 4LOJA 4A15A 5LMNB 3AJEA 2CDNA 4R7TA 3VPDA 1K4YA 1XBTA 4B4VA 3Q3IA 4UXHA 3NTOA 4R2JA 1VA5A 1U31A 4FFSA 3H9EO 1M0WA 3NC4A 3HFSA 3RFTA 3EAGA 5DIZA 1KAEA 1ZISA 1V5GA 2GBLC 2Q8NA 2WYOA 2JLZA 1BMDA 2CNNA 2V7QA 1GG5A 3PNBA 4YYEA 2RJ3A 4IUYA 1R3DA 5LYJF 3CEMA 2CLCX 1E2QA 4OL9A 4LMRA 4RSHA 3CFYA 5IYZF 4UZSA 5TMPA 2AN5A 2E3JA 2E9SA 3B13B 5CVCA 1CEYA 1PR2A 1U7ZA 1ABBA 3P2EA 3KDPA 3JPWA 2IXDA 2OCYC 4GX1A 4XWTA 3RT9A 3TX2A 1R9GA 1ACMA 2LP4Y 4EQZA 2RHLA 2I6TA 3EARA 3OEEA 3G02A 1G9TA 3NXKA 1P7CA 3OECA 5CNMA 6PFKA 4NE2A 2DH6A 4LVNA 3DW1X 1GNRA 4IWXA 3O9MA 1MB9A 4JGIA 1N33B 3IL2A 2GZDA 2P9ZA 2PX0A 1X86B 2RARA 3VKFA 2I4LA 4AROA 4Q34A 1MZPA 4R1LA 1G5QA 5C1BA 1MABA 1PR1A 3D3JA 3FGPA 4L3WA 2FW6A 4M7OA 4RVGA 3WV5A 4WEOA 4WK4B 2XB8A 4B7AA 3PLNA 4MYRA 4K9QA 4Q82A 5B12A 2P2SA 4IVPA 3RANA 4XB2A 3NWJA 3QI2A 3GAZA 4RDIA 3IPLA 1I7SB 2VEOA 3N87A 1QFZA 2EJCA 3OZCA 1CP2A 4DXDA 1BXZA 3JQ9C 2CDBA 3Q15C 3Q5DA 4AN0A 4DR2B 5DYIA 4F84A 2R1TA 4W99A 4BYGA 2DLDA 1JKJA 4E94A 2YTZA 2ZW9A 4EFMA 1YS7A 1DJNA 1PLJA 1XDDA 1XQVA 3JQEA 2OHJA 2BGJA 3ZDXB 2E55A 4JMPA 5HJ2A 2EARA 2ZE7A 2ZJ0A 3QJGA 2IIVA 4JVLA 4K9OA 5BVHA 2HLPA 1Q0RA 4ZZ3A 2NZVG 5ED0A 4MLDA 4H08A 4PX5A 2HYIC 1BFKA 3LP6A 1RWNA 4RIHA 4Q1BA 4L5AA 5I7WA 3KJEA 3V33A 2XQIA 4EY8A 5JANA 4GMDA 3FVQA 3D1LA 1A9XB 4G4GA 4X92A 3MBIA 2CNWA 2ZBFA 2DUUA 3USES 4GPBA 1C7EA 5E9AA 5BN4B 4EHFA 4N18A 1JQJC 3RVRA 1IUKA 3NO4A 4HBGA 4DG8A 4M1QA 3WYCA 5B4VA 2JD1A 5H59A 1P31A 1OZGA 2EWVA 2Q45A 2ZCVA 3C3XA 4LBWA 1ZH2A 1FQJA 2JCXA 3F90A 3ZI4A 4L2IA 4B8YA 3OM9A 3PWSA 2VDKB 4D1YA 1PVOA 1T36A 4UUBA 2C7RA 1G8GA 2FSGA 2I4TA 2E1PA 3CZCA 3OBIA 2VK1A 4MQLA 3V8VA 5AVQA 3L05A 3QEAZ 1P3Y1 4Q47A 3I01A 2K7ZA 2ICAA 2Q21A 4POOA 3PEVA 3JQDA 3CBQA 1EI9A 2G9ZA 3VXKA 4XVHA 5BNTA 3VR0A 5KOJB 2QRLA 2FSVC 2YJ6A 4M9QA 3CINA 3M5WA 1YRYE 2OILA 3NV9A 4YMGA 3BYZA 3PUVA 4IIGA 1BXRB 2GNOA 1CUUA 1OBOA 5LZ7A 3TK1A 4ARIA 3IX7A 3EFHA 2O3TA 4Z5XA 2W6PA 1MG0A 1IJFA 3WLEA 4MS4B 1XPRA 1DE0A 3SN6A 4AP9A 1CQPA 2XYRA 5JS1A 1L4GA 1JI0A 4NENB 1RYZA 4YR7A 5B3JC 3G7UA 4AMZA 3PHHA 1SVOA 4D9BA 2MINA 5IPFA 5L3RA 1SHKA 1T2VA 1W88B 2HGZA 3VPCA 4XVUA 4F5DA 1GPH1 3E2MA 3ZE9A 2FNAA 2QX6A 4YXFA 3VJKA 3ZLJA 2ZYIA 4FZ5A 4MGEA 4CXMA 3K9HA 1AMOA 1IJBA 1US8A 2N0SA 2VZ9A 3TM5A 2FWAA 1DTEA 1SXJB 3AY0A 4GPZA 3THOA 4A9AA 4U6SA 4A0GA 9ATCA 2IU4A 5AVRA 2C7QA 5ER9A 2X76A 4NBTA 5IYZA 3S29A 2F8LA 3PNVA 2FFJA 2XNDD 3AB3A 3RVMA 1JLHA 4EHBA 3BMNB 4JKOA 5EFOA 1KEEB 3C6BA 1IRXA 4HDRB 1ULAA 3CVJA 3VZCA 1ZONA 4FLMA 5BYJA 1YGYA 4C5AA 2PR2A 1O97C 2YVKA 1LGYA 4C4TA 4EUNA 1UM8A 1BVRA 1Z4MA 1M2WA 2FW9A 1SCBA 5EJEA 4KVGA 4H7IA 1D9XA 3IEIA 2VSNA 4DR6B 4IGFA 2FE4A 4MUYA 5TJ9A 1CUFA 1M1YE 3KAJA 1R12A 4HEJA 4IIJF 1EINA 3FDZB 4WNCA 3BHIA 5KU7A 1XAIA 2R47A 3LLMA 4QQNA 3PX3A 4YT8A 1PT9A 2ODAA 1ADFA 1VHTA 4FGLA 4H1HA 1WWKA 1UXIA 1MIOB 2BL4A 2GF0A 1XVAA 2AVNA 3JQ8A 3QNUA 1X7ZA 2UZIR 4OQLA 4PNZA 4RLFA 5ECYA 4F5WA 2DHQA 2PLWA 1IY2A 1NSYA 1RXIA 3BL6A 1YE3A 4I4CA 1JEQB 2B61A 3KFLA 3WI7A 4DMUB 5LKRA 2ONKA 3D5EA 1G41A 1NOKA 4PBRA 3IIJA 4LZAA 3IQHX 3ULKA 1REQB 3ZCTA 3AQIA 1DKMA 3EIXA 4XFJA 5IJ0B 3PEFA 2C5FA 4FT2A 5GMOA 3AY7A 4BP3A 3AUSA 1XXHA 1ENPA 3NTQA 4C7MA 4YQFA 4IWYA 1JPJA 3DLAA 2GZ3A 1YQTA 4GUAA 1KI4A 2GPSA 1AZTA 4W7SA 1PJQA 1M10A 2IZOA 2AKEA 1KBZA 1AQLA 2XUIA 4WECA 2CLIB 3FZYA 1V0JA 2TRSB 3DONA 3ZY4A 2AEJA 3FETA 4MP8A 5A4FS 4YT4A 3ELBA 1E9CA 1Y48E 3TQOA 4CGZA 4UXJA 4Y1GA 2R79A 4LVUA 3MHTA 1QMPA 4QDZA 3VC7A 3E0XA 2A0YA 5JZ9A 1SKMA 4WBSA 2W6NA 4G65A 2JLUA 4OP3A 2R87A 2HMAA 5EZ5A 4L5JA 3C74A 1V96A 2ZR7A 4QBFA 4BTLA 2GKSA 4RAQA 4NK4A 2QDXA 3WC4A 4A26A 4DMHA 1GG2A 4NBWA 5H8WA 2B4KA 1S3IA 2ZRKA 1A69A 1N2ZA 2J3MA 1TGVA 4HGYA 4QDXA 3AG5A 4AM8A 1L7MA 5G3ZA 2OHFA 3GGGA 3TZBA 4KO3S 5JHHB 2AI1A 3TINA 3PSAA 1GRRA 4ZYUA 1SVMA 3A3KA 1EE9A 4BU0A 1EDBA 1I0IA 1ZYUA 1V71A 4WKBA 4QOIA 5GVSA 3OE5A 3VYSB 4HP8A 4G89A 4RK6A 1UFOA 4YAWA 3DBLB 3RSZA 1FPQA 1XCOA 1YV9A 4QARA 2PQ0A 1X3LA 1UK7A 2C1EA 2RH8A 4GO1A 4BLOA 4Q93A 4EA7A 5FFFA 3F6PA 2G72A 3CNBA 3GJRA 1V3UA 5C4GB 3FZQA 3RLIA 4LJLA 1ZIYA 5AOAA 3O6VA 1RYEA 3CU5A 1J99A 4M9XA 4DM4A 3CY6A 1K06A 4MR9A 2C7GA 1X3SA 2IYEA 4ER7A 1RXSA 5EP4A 2A3RA 3UW3A 2QTTA 5EXEA 5BYBA 3BH6A 1VMIA 4YK7A 1QAQA 1YMUA 2HH9A 4HLQB 5LOVF 1U28C 2C3OA 3DP7A 2VJMB 3F8TA 1P1HA 3JZAA 4FFMA 2ZYRA 4OXRA 4E5YA 3P5SA 3RJMA 3U7RA 2J67A 5JC1A 1MEEA 3OLWA 1RHQA 3AINA 1AKQA 3L2OB 5CT4A 4GI5A 4UCFA 1K3UB 2BTQA 2QPTA 4H0NA 3V1MA 1CHNA 3FMOB 3KQVA 4KXQA 2P9YA 4FZ3A 1B0UA 1WABA 1C7QA 2PKWA 2M6RA 4R1NA 4C88A 1UXJA 3H0CA 2PUEA 1PNTA 3M49A 3UCXA 3VYVA 3HXOA 10MHA 5CUQA 1XJ5A 1AS3A 3H9QA 5C4MA 1ZEJA 1J33A 4IIJA 5EMLA 3MVEA 4WKOA 5FYQA 4U7DA 3WSWA 1VL8A 1H93A 2QKYA 1E9BA 4LISA 3KKPA 3SHQA 4J0QA 4Z3OA 1H8EA 2Q5OA 3DVRX 4WNYA 3RHSA 1UL1X 4GS5A 3SXUA 3GJYA 1NBMA 4XARA 1L4KA 5IARA 3ZCQA 3CIOA 4PX3A 5J2TF 3UBTA 2DMRA 1CUWA 2DTEA 2QYOA 3BTSA 3CJRA 3KZXA 2EJWA 3P0RA 3O8NA 2PCJA 1E3DA 4BO1A 1K66A 1QIFA 2HMYB 2GPWA 2WF9A 2ORYA 3DTNA 1R4AA 1ZN8A 3RV3A 4YAUA 1HYEA 4C07A 4G07A 4CG0A 4F71A 4XUEA 3W6PA 1OROA 4FYIA 2OL4A 3KTFA 4MLZA 1HEIA 1SRQA 1TVMA 1HWYA 1NP6A 3IALA 5DGHA 4C0AC 2AXNA 5IK2A 2GK4A 3GG2A 3H8JA 3EPKA 3H2IA 3WA7A 4DPLA 4CT5A 3ER9A 1IRIA 5FQOA 5K4GA 4LF6B 5I9NA 5DZSA 3SLGA 3PPWA 2X8BA 3DAOA 4AS3A 1WPXA 1OYVA 2REQB 3RS8A 4ERXA 2VXBA 2Z4RA 1BCRB 1HY3A 2EZUA 1AY0A 1ISSA 3BN3A 2AKAB 2R7MA 3U7QB 1KO5A 3PCRB 4DGQA 2ACEA 1N34B 3TB6A 1JG6A 5JLJA 4PO8A 4KQEA 2YICA 4JVNA 2J9YB 2I71A 3EZNA 4OVKA 2Z57A 5BWCA 1D6JA 1A2BA 2QTZA 1RTTA 4AI6A 3UG7A 3PNQA 4A4DA 5GINE 1QU3A 4OGWA 4AJIA 2CBZA 2ZG6A 3I4LA 2C20A 1SUPA 3EXHC 1C0IA 3UXYA 4ZT6A 5G4KB 3K70C 1GL7A 4IRMA 1DBRA 1PI3A 5BSRA 2JGDA 5KJ6A 4ZMSA 5J40A 2VJAA 1QG0A 2J0VA 4OLHA 1XTQA 1J20A 2QVLA 3PCXA 2ZXEA 5ALPA 3ZWCA 1G2OA 2D2VA 1XLWA 3TQQA 1OBFO 3UJ7A 4F4CA 1TD9A 3GEPA 3HSSA 1PHRA 4HAWA 1JIKA 2Q0SA 3DPUA 4PZCA 3UM9A 4DN6A 5FJJA 4ISBA 1UDAA 1LA2A 5EJ4A 3O74A 1EK2A 4FTWA 2HSJA 4NLLA 2OQVA 1P1KA 4D4MA 1A2OA 2I6XA 3BSYA 4ND1A 3UK1A 4DNOA 4DY6A 4QUDA 1MQSA 1UWLA 1R88A 1SBHA 3PPVA 5L3SB 3I8XA 1LBHA 1JNYA 3T3HA 1UJBA 3AQ4A 3GT7A 2AEMA 1O87A 4A5OA 3BDAA 2F00A 5KTPA 1RCUA 3K8QA 3W7BA 1JI3A 1KJYA 4YJGB 1GY8A 2Q9AA 1G16A 2QG4A 4LV5B 3SCZA 2DX7A 4I0WB 1SXGA 2IJGX 3FTNA 4F85A 2FOXA 3ZYZA 5LOVA 3SEQA 5J1SB 3B6KA 2VATA 4L9SA 5DOVA 1TFUA 4C2UA 2OCPA 3LZ6A 4NMLA 2PZGA 2ZJ4A 4FONA 4RJIA 2Q1XA 5EJ5A 1WXIA 2VDJA 1IN6A 3OOJA 4LNAA 2Z30A 4W1RA 1ODSA 4AMUA 1E0SA 2IODA 4TS1A 5JV5A 4I3FA 3RODA 1KORA 3ZDCA 2FZVA 5B53A 1L4HA 2B3DA 1QNLA 2FPLA 3WTBA 4FYMA 3WGZA 2NVOA 2ZP1A 3TKAA 5DRYA 2RBGA 1T1JA 1ZD4A 4ADSG 1V3VA 4B34A 3RYCA 3FMFA 1XU4A 4OJKA 3NRCA 4I6GA 3EBPA 4JROA 4N12A 2ZTLA 1CDOA 4MMXB 3VSBA 4EGSA 1FRVA 2BMAA 1IZYA 2EF1A 5HWSA 2OHGA 1UAYA 3FNEA 4M1EA 1H4QA 2J9ZB 1CNFA 3W6UA 4DMCA 4H6XA 2GN4A 2HK6A 5AK0A 1UBKS 1N2OA 3FCYA 5HK9A 2H07A 2Z2XA 2AN1A 4QBTA 1PZGA 2Y0EA 4AF6A 1HDOA 1GU1A 2GMWA 2HXGA 4HSEA 4AJOA 5J5CA 1OFUA 3BRQA 1JLLA 2PMCA 1G59A 5KVSA 3UUWA 5FH9A 2ZSAA 1XEXB 2DPGA 4FOLA 2IZZA 2WF8A 4ZVTA 5A9SB 4C7JA 2XQGA 1IOLA 5SICE 4DMRA 1SUWA 4NXNB 1Z74A 3WO0A 5D3MB 1QV6A 2GCIA 4URVR 4HBZA 1WETA 3TZLA 1NW3A 2AT1A 2SKCA 3MS7A 3W0LB 3G1WA 3REGA 4UTZA 4I9UA 1X1SA 2Q1TA 3H75A 4Z49A 1Y8AA 1CPYA 3DE3X 3W4JA 3MOIA 3A11A 2GBFA 1S2NA 3A32A 1W7AA 1Y7TA 1ZOPA 1NXWA 5KDOA 1JFSA 3TI7A 2R68A 4AKTA 4XM0A 1ODFA 3LBNA 1SD2A 1XDGA 5DRTA 3TI9A 3ZDAA 2NW6A 3GLHE 1XDBA 1DFIA 4R8RA 1JDPA 1ZN7A 3L1VA 1U0JA 3A7EA 3DC2A 2FHPA 3GEBA 5LDHA 3SDBA 1EE2A 3L7LA 5F7ZA 2C42A 4FHZA 4GKBA 5GZ6A 3L0PA 4EHNA 5K8UA 4AKSA 2JLCA 4QGAA 4TTIA 1RI3A 2JJQA 4DZZA 1EWQA 3BRWA 1PQUA 3N6XA 4DV7B 4TM8A 4Y2SA 2JFBA 3NHUA 3THRA 3L5OA 4NPHA 1Q5PA 1XCBA 1KZ4A 3RIHA 1CD5A 4U6NA 5IUKC 2NO7A 3PGMA 4IVRA 1JSRA 1U7UA 3GV0A 1J24A 3O26A 2QRHA 2OBFA 4JOSA 4KMOA 1T9KA 4RFVA 5HZGA 2D0IA 4MMYB 5L7YA 4TN1A 4NDNE 1E5TA 3G2IA 2QRVA 2H92A 3I6QA 3ND5A 3R6TA 1IHDA 2EC5A 3L7IA 4OK5A 2CLSA 5AJVB 3MWJA 5JVDA 3F3KA 1JA1A 1DNPA 5TPZA 3RFFA 2HLDD 4CHGA 5JJKA 4RNCA 3NCHA 4O8CA 1O6BA 4OB7A 3RADC 1Y1KE 2HRRA 1PK7A 3D7SA 3HKDA 1KJWA 1NR5A 2VJNA 1ZUNB 4PPYA 4XVQA 4YRQA 4DQXA 5HCNA 4A6EA 3B1KA 1OLXA 4FWIB 3TW8A 3TJRA 1JIVA 2ZJBA 3L0BA 5FTLA 4HDOB 5D2CA 3PXUA 3AM5A 4DT1A 4GQBA 1KAGA 1TUIA 1TF5A 3GFBA 3A58B 5JAIA 3BMQA 1EGMB 1R9JA 2Z9CA 3VYRB 1DZIA 2I4RA 3DOJA 3TD6A 4JYAB 3B12A 2VJLA 3PXEA 4HYTA 4XPIB 2F1HA 3DO8A 4MVJD 4OBWA 1LVHA 3OETA 1F7VA 1BW9B 1F9AA 1NJ5A 2C2MA 2V7PA 3PPIA 4KQXA 1C9JA 1Y82A 3C0KA 3EY9A 4I6EA 5KU1A 3E18A 3QP9A 3LXXA 2C2OA 2WJJA 4MICA 4MX8A 2YRWA 1W19A 3AUKA 3GNTA 4FGKA 2GFHA 2I7VA 1U3FA 2GRJA 5H3CA 3ZD8A 4QYWA 1DVRA 2II6A 2UYGA 3GAAA 3FGNA 1BD3A 4OQYA 2M6SA 4ALKA 2O8CB 1AIPA 2NYUA 2JHFA 3H4IA 3NVMB 3OKPA 1BWSA 4BQRA 2XCUA 4NBUA 2WSYB 2O1WA 4PAWA 3PTAA 4KDEA 4Z4FA 2J48A 3VZRA 2FMXA 1F14A 2PFSA 4IDGA 1VIAA 3ASUA 5JZSA 2FPSA 4IJKA 2IWRA 2RKWA 5DM70 4YMVA 2PD3A 4C43A 1GA4A 1H6BA 4OXXA 6CHYA 3K0BA 4ZQGA 4X7BA 4Q05A 1KH3A 1ODIA 4EG4A 3ZU2A 4G5GA 1SVSA 3FVTA 2I67A 4PPFA 4F86A 5AM5A 2J7PA 1R6TA 3KWMA 1LS6A 5BUSA 4IQGA 1YRHA 2ECQA 3Q5EA 4U2BA 1VJRA 3ESBA 4RKFA 2QRMA 3BIOA 2JRLA 4I2NA 4HY3A 5FCDA 5JMWA 3GRRA 4QD3A 2VJBA 3AV3A 2JASA 3HXKA 3NHBA 4YAEA 5B5SA 4M0EA 2W6IA 4JITA 3UBMA 1GZ5A 1VLVA 1YR1A 1YVPA 1VA4A 4KIUA 4PCAA 1VMEA 3JVUA 1ESZA 2ZAOA 4YAIA 2FUEA 3S2IA 1TM7E 2XUGA 2Y76A 4F4JA 2FUNB 1ENYA 2WV7A 2PJZA 4GSLA 4JQYA 3SVLA 1E79D 1RFLA 3AR6A 3CURA 3FWNA 3GLRA 4EYSA 3ANSA 1HLGA 5DLQC 1ZRSA 4ER5A 2ZSKA 3NJ4A 3PC6A 2G5PA 2L2QA 2RGAA 4RSGA 2HMVA 2GCEA 4TMKA 2LE0A 2OBBA 4BUCA 3WOHA 4RVNA 1YJ5A 4RS4A 5EVJA 4MVJI 2AEFA 3A6HA 3ZWVA 1X1TA 5LDDC 2FWRA 2P69A 4BWVA 2HV9A 2VN8A 3HJUA 3TS1A 1WUIS 3TXXA 3DV0B 1ML3A 2WWIA 1KZGB 4BMNA 4ZWNA 1G7SA 2GM9A 4K6HA 1WG8A 4I9GA 4MVJH 4TT3A 3NIBA 5B7PA 4WNAB 5HEKA 2H7CA 3MSCA 3CF4A 3SIWA 1B1CA 2R11A 3T7AA 2RAUA 3A9WA 2GILA 3MWYW 4K8RB 2C1ZA 1RPAA 4XB1A 1K5GA 3EZYA 3MUNA 2CF6A 2MSEB 4BO4A 1RCTE 4D02A 1EFVB 1QHSA 1QZUA 3LQFA 1PU2A 4R6WA 4R84A 3U7FB 5AYVA 5SZHB 4RY8A 4US2R 1QTIA 4INAA 4E5KA 1SZDA 3UWOA 3WK8A 2O3RA 3DE6X 3OTGA 4D3FA 1OBHA 1OXUA 4CQNA 4IDNA 2CV1A 4O3MA 3E0QA 4WHMA 2I6UA 4EJ0A 2NO1A 4ZYZA 5KTYA 2IPAB 1DAIA 4N47A 3P4XA 5LNK1 1NVUQ 2P0AA 4OQPA 4QPJC 5C46F 1A9XA 1IULA 2AOWA 1NQAO 3MG9A 1XHFA 2HK8A 4N7JA 5CHYA 4C6TB 4PQFA 5JFTA 4DSUA 4PLGA 4XX1A 3U3ZA 3GLGB 5BN4A 3AX6A 4GKVA 2C4VA 3V6MA 3V7YA 2RHGB 3IHKA 3PJGA 1H3FA 5AJYA 1AK1A 1ODLA 2JKVA 4JUDX 2AG8A 4FDAA 4PLFA 3K0AB 2ZBUA 1FDWA 1PR6A 3K2BA 2POQX 5CM8B 1EAMA 3ZGXA 2CXOA 3OTHA 4H9GA 3RFCA 3S6JA 4LY9A 1CZNA 4YUVA 5IHXA 3WR5A 2X9GA 4HPWA 4MEAA 5DLYA 5A2GA 4GSKA 3QITA 5T3UA 1OV4A 2NTEA 4RCYA 3IFSA 5BPHA 1J9EA 1WNTA 2FB9A 3HLKA 3E9CA 4HGPA 4HNQA 2IS2A 1L7RA 2MTBA 3ROTA 1EVYA 1KYIA 1TYCA 4M1OA 2J33A 3A2LA 1E89A 3BIXA 3L43A 4P93A 1N78A 2NYAA 4XQEA 2H4FA 1N5KA 1Y0BA 2BM9A 3ONVA 3ID6C 4OHWA 1FXWA 4JJIA 1BXRA 4P38A 2XW6A 2O2DA 5CVUA 4BFLA 4U2DA 1Q0QA 1KEZA 1W0KA 3OBBA 4MS4A 4IS3A 1JVSA 1E2FA 3LTEA 4NMXB 4PZDA 2FW1A 5K1ZA 4NENA 1GIAA 1VYUA 4R2WA 1KH2A 3OTIA 4O2BF 3H9UA 4HWPA 1FZQA 3ZWNA 4C4RA 3MWLA 4HQRA 1W88A 3ZWKA 4DJDC 1D04A 5AUNB 3L8HA 5AHXA 1IZZA 4CQJA 5HFJA 3TUZC 3B3GA 1BA2A 1AJEA 1JNXX 2UAGA 1Z0DA 3GGSA 1YWGO 3AC0A 1AVTA 1O2DA 1SXJA 3A3PA 3CNQS 2NU8A 5KQLA 5L4SA 1ZL0A 2GD6A 3C3AA 3HJGA 3DLIA 2XXBA 5BN1A 5IAKA 4P0PB 1M2KA 3Q0IA 4BN4A 1QGZA 1RHKA 5EXDA 2NV0A 1Z6YA 1ZQ1A 3DGEC 4PYQA 4WN9B 1DJLA 4FM9A 2OOSA 3BMNA 1QJCA 1KEEA 4HDRA 3FSGA 2P5YA 5KNCA 4RENA 2O8EB 3IRVA 1I2BA 1E2LA 3E8MA 4NAVA 5JAQA 1OZHA 3NTVA 2SICE 1N6NA 4IMJB 1TKCA 4JYZA 4PLCA 1P9WA 1SVKA 2A5LA 2MMGA 1B26A 1ORHA 1RXWA 3KXLA 5TT1A 3BRCA 1WE2A 3PFCA 4QIHA 3X3HA 2PJDA 4J29A 4G0MA 3LWDA 2Z3WA 2H17A 3ROMA 3UT5B 1WSWA 1LV8A 1AXEA 2COKA 3DDCA 1I33A 2O14A 3EDCA 3FBWA 3FDZA 3WMFA 4ZK6A 3ZU5A 5AVJA 2HIMA 1XJQA 2OCDA