2NMVA

Damage detection by the uvrabc pathway: crystal structure of uvrb bound to fluorescein-adducted dna
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
Knots found
sequence length
652
structure length
620
Chain Sequence
DRFELVKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Damage detection by the UvrABC pathway: crystal structure of UvrB bound to fluorescein-adducted DNA
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
total genus 224
structure length 620
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2nmvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA01
2PCJA 3L0OA 1JALA 1OHHA 3W8RA 1M34E 2IXFA 3QKTA 1ESMA 3WHLA 2ZTSA 4JVSB 4UJ3A 2RGNA 2PBRA 4BZPA 4GDFA 1HE1C 1OXSC 1GKUB 1LW7A 2ECKA 4FXPA 4L5BA 3ND9A 1E1RD 4B3BA 1E2MA 2BCGY 4NCJA 2DCUA 4N1AA 2ZETA 2PEYA 3MSXA 1L8QA 3E1SA 4X8MA 4GNKA 4HUQB 3S1AB 3LA6A 3GLGB 2VP9A 3QJYA 1TUEA 1G5RA 1W5TA 2ZRLA 4P3YA 3HPRA 5JRZA 1KHTA 3GLHA 2O8CB 2EFEB 1M8PA 2ZSEA 3QBTA 2ZSBA 4CVNA 2O8EB 4IJMA 4NHOA 2BKEA 4CT4B 2MMCA 2J7KA 3A58B 1TTTA 3HYRA 4M1WA 1VECA 3VHXA 5FR1A 2Q3MA 3PR1A 1X1RA 4BUJA 1XTJA 4E09A 3A1TA 1II0A 3GJ3A 1NI3A 2J45A 3KB1A 4EQ6B 1W0KD 2NG1A 1V5WA 1S1MA 2GXSA 4JZKA 5KO2A 1GILA 2BMEA 2Q9AA 3A4MA 4BPBA 5CITA 3BB3A 2AWNA 1M7HA 4OI0A 2P6UA 4XTCS 1TMKA 1R0ZA 5E7IA 3FMIA 4KVGA 3VKGA 5JCZA 4M1YA 4Q4JA 4LV5B 1GNPA 3EZ9A 1XRJA 1E2HA 3CNNA 3UG6A 3TK1A 5JCPA 1ZM7A 2AHOA 3KFVA 5DE3A 4B74A 4LOAA 2CHVA 4QRHA 5TARA 4A0HA 1J90A 4OBEA 1G16A 4PX9A 3AKCA 4AKGA 2ZJOA 5L3RA 2QUZA 4IVQA 4KODA 1E69A 4PSAA 1RYHA 1K8RA 1GAJA 3W6OA 1QF9A 2HXSA 3RNLA 3R8FA 1G6HA 2GVZC 1RRCA 4HAVA 4F93B 1E0SA 1RKBA 4F91B 3RC8A 1UPTA 1G17A 1Z6GA 2RGEA 5KDLA 4YXWD 1WBDA 3SJAA 3NEYA 1TPZA 2JJ8A 5FPTA 3U44A 1QZXA 4RZ2A 5GJBA 1KMHA 2REBA 3BBPA 4G0NA 1NRJB 2F1RA 4GMDA 2W2XA 4TL6A 4GRAA 3B78A 4KHZA 1R5OA 3AP2A 4R7ZA 4PO1A 2G6BA 3IIKA 3WMFA 1AJEA 1KK2A 5DHFA 4D80A 1OIVA 2G0NA 1D9XA 2ZI7A 4BFVA 1KGDA 1U9IA 4EJSB 1E96A 1NY6A 2O8FB 4TLDA 1GSIA 5K8TA 1SXJD 2F1HA 3A36A 2ZRMA 1JEDA 3E70C 4URUR 1KY2A 2W2VA 1ZYUA 3AVVA 4QNRA 1Z6YA 1F6BA 1RJ9A 4UXIA 4DT1B 3BD9A 4YC7A 1ZNZA 4LX0A 5HPYB 3P1JA 4KAXA 4PPFA 1G9XA 3R8CA 1SXJA 4EJSA 3BGWA 2KE5A 2ZVQX 4G01B 2N42A 4ZI3A 2FMXA 1R7RA 3T34A 4BGDA 2H18A 1UAAA 4JLAA 3HWSA 2BKUA 1W46A 2H16A 3THYB 2WJYA 3HU1A 4B75A 3U5ZB 1G4UR 4TMZA 1L4UA 1D2EA 5CK4A 1KI4A 2XJ4A 1S2MA 4B3CA 1PLKA 4CDGA 2JLZA 1CJKC 2ZUBA 3QVUA 4DLVA 5AJWA 1MH1A 3KQUA 5JS7A 4UNRA 3O8CA 3UANA 1N6HA 4NCIA 4Q47A 1KJWA 5GADl 5FOWA 4MH0R 1P73A 1FP6A 2DPXA 4JBWA 2Q3FA 1FNNA 3WBJA 1I2MA 2REXB 3H1TA 3N70A 3C14C 4DDUA 1GKIA 2JA1A 1BIFA 2G83A 2YOHA 2ODWA 4DSNA 5EUQB 5B30A 1NKTA 3U3JA 4MDFA 1G7CA 3WMGA 4A8JA 2QBYA 5CLQA 3HU2A 4PQRA 1MV5A 2DFLA 5H68A 2HLDD 3K70C 1D6JA 4JL8A 4Z1MA 3LVRE 3OIYA 4U7DA 3MUFA 1ZIPA 3W6NA 2WWFA 3QKRB 4DDWA 1AS2A 3FWLA 1W2HA 4DCNA 1W0KA 5JS8A 4KITB 2FN4A 1R4AA 4A0RA 1BMFA 5B2ZA 4P31A 4LPSA 2GZHA 4POAA 4M1MA 3KFXA 3ZVNA 1SVKA 2QAJA 4Q5IA 2VBCA 3CWQA 3UWKA 4A8JB 5IK2A 1LS6A 1Z0IA 3W3ZB 1U94A 2C8VA 5K8LA 2QRNA 3WHKA 3C7KA 1E79D 4QG7A 2OLKA 3IBGA 3Q72A 2ZS7A 1NNEA 1G21E 2ZS8A 1W44A 3ZVRA 3CO5A 5JJIA 3B82A 5FTLA 2ZAOA 1LTQA 3KUCA 3U3MA 2PX0A 5AJYA 4N3NA 3IQXA 4BFWA 3B1ZA 1XXHA 3CBQA 2HV8A 2D7DA 4LHVA 4Q9LA 1VMAA 3CF0A 1XBTA 4TZ0A 2WBLC 1Q1EA 1AK2A 2IUSA 2ZR0A 4ZPXA 5FI0B 4D0GA 1EX6A 3JZAA 1VCIA 3LQQA 4PR0A 4Q1FA 4OHWA 1G7SA 2GZDA 5TDHA 3KJIA 1W4RA 3ADCA 4BEJA 4C3ZA 3W34A 4KJZA 3SBEA 1YR6A 2ORIA 3O8BA 3SQWA 2CL7X 5JLJA 1BH2A 1FUKA 1GFIA 1BS1A 3U6KA 2BEKA 4NL4H 5KSZA 3EG5A 1AQYA 4ACAA 4A6XA 1T3SA 2OBLA 2QEQA 1NJFA 2XXAB 3QOFA 2IYYA 4JVNA 4B3XA 1KI2A 1M6NA 3GEHA 3GJ6A 1VCNA 4BFXA 3TKLA 4IDNA 5H1YA 3EARA 1E4YA 4KFTA 1QHNA 3K9LA 4ZCMA 1Z0KA 2PMKA 1WP9A 4KLNA 3CH4B 3KDSE 5C18A 2CMKA 4LBVA 4B48A 3REGA 4DZZA 1TX4B 1H65A 4H9GA 4ASUD 3CONA 1W4BA 4BASA 4KO8A 1TF7A 4HB2A 2GILA 4EJSC 2ATXA 2DY1A 2RGBA 1FX0A 3SS8A 2FSHA 4LK2A 3PEVA 2B92A 4PHTA 4KU4A 3ETLA 2WTUA 4RKFA 1XEFA 2IUUA 2ZQ5A 2WOJA 5L8VA 2IYUA 4TQAA 1FMLA 4DCSA 5JFGA 3EAQA 5GJWC 2N46A 1XMSA 2ZE5A 3DHWC 1OB2A 3U3OA 2BV3A 1HT1E 5JBQA 4BFZA 5KDOA 3NBXX 3ZDQA 1NVUQ 2G0TA 2OCBA 3V4RA 3HU3A 4IDQA 3EX7C 1TEXA 2C9YA 1JI0A 2VPPA 2PLRA 2FU5C 4L15A 2GXQA 1ZCBA 3WMEA 2C9OA 2ZJBA 3TLXA 4ZIRA 2IBMA 4WW0A 3U44B 1JJVA 4Z51A 3RABA 3TVTA 2ZYTX 2ZSFA 1T8TA 2WWYA 3WRYC 1U8YA 4OJQA 2F1JA 4TLEA 5EXSA 1NN0A 2IYTA 3EZ7A 3KX2A 2ZAMA 5KSPA 2DB3A 1UKZA 3KJGA 3CX7A 2QM7A 3L0PA 4LBWA 1CR2A 1OV4A 4ARZB 1YR9A 1D2MA 3HDTA 1VG1A 5BYJA 1EWRA 3SYKA 1QHXA 1KO8A 3AB3A 2HLDA 3K53A 3T1OA 2EFCB 3GLHE 4PC2A 3K0SA 4MITA 1C4OA 4JSYA 4FIDA 4OK3A 1KYIA 3RHFA 3X1WA 3D8BA 3ZZ0A 1P62B 4HB0A 4RCYA 1G6OA 4UJ5A 4HUTA 2XTNA 5FOTA 3A8TA 3SQXA 2WMNB 2J0UA 1U0HC 3VMFA 1KI8A 2AFIE 1P72A 3C15C 3AP3A 4LC1A 4M8NE 4R98A 4C0KA 4NDZA 2V6JA 1X6VA 3SJCA 1XTIA 3QQ5A 4XD7A 3VQTA 1HH4A 3LQRA 3VTKA 5KNCA 4II7A 3EC2A 5EP1A 1DAHA 1ZINA 3P32A 3S1AA 5J4HA 1BMFD 4Q03A 2D7CA 1H8HA 3CRQA 1CR1A 1XJCA 2RGAA 4DUGD 4EDHA 1TF2A 4P0TA 3WP0A 1KY3A 1N6IA 4PXAA 2PZFA 1GM5A 5J47A 2FGJA 2OSBA 5EE9A 3KKOA 1KDTA 4JS0A 2FSIA 1Z6AA 4Q7MB 4CIDA 1X8JA 3CF2A 3H84A 1KDRA 2DBYA 1NN5A 1DAKA 2H5EA 2GEVA 3EASA 4TLBA 3GP8A 2WSSA 1VYTA 1XXHE 5DSZA 1Z28A 2ZPTX 1L2TA 4EQ6A 2C9CA 4HSEA 1P2VA 1X3SA 2IYSA 3UK6A 1S0UA 2HYIC 4L16A 2ZVPX 4MGIR 2GJSA 1PUIA 3GCGA 5HZHA 3TH5A 5KOYA 4LWZA 5FOVA 1N6OA 5H70A 3ZD7A 3KXIA 1L4YA 4MKFA 4TZ6A 1JXOA 4US2R 4D0NA 4W7SA 1E1QD 2RCNA 3TMKA 3LXRA 1VDZA 3SYNA 3TQCA 1G8GA 4XTRA 4N0EA 2PCLA 2G3YA 4JLBA 3D3QA 2O0JA 1G64A 3TJZA 1UDWA 1XTKA 1ODFA 2ERYA 3EC1A 3FFBA 1KNQA 4TSFD 4CEJB 1HY3A 1CJVC 3CPHA 1KSJA 2YWHA 1W4CA 3K0FB 4ZV4A 3PV0A 4JKYA 4MKGA 4KV9A 3IHWA 1SHKA 3JZMA 3LVQE 2J7PA 4NYIR 1DELA 3MGCA 5BN3A 3FMFA 2A30A 3LW8A 3CZPA 4LJAA 3K9NA 1IAQA 2YWEA 5FUXA 3TAUA 1DAFA 1OIWA 3ZS8A 3A1SA 3MWKA 1GWNA 2DWOA 1X8KA 1IOZA 1XD2B 1YHNA 2WV9A 4ZCLA 5KNDA 2BJWA 1P9NA 3C16C 1ZD9A 2HEIA 3KJEA 3PUWA 1Z0AA 1II8A 5L3SA 2EQBA 1EFCA 1QHGA 4FMCF 1Z6TA 3M6AA 2OCAA 3OEEA 4QBGB 2F3TA 3X1DA 3U7HB 3RS7A 1WB9A 4S35A 1XD8A 3K09C 2ZR7A 4DXAA 1ZRHA 3K8YA 5FOXA 5TVKA 4LHZA 1JR3A 1DOAA 2XITA 1I4LD 3CX6A 4Q21A 2O8CA 2VF7A 1G8FA 1PZNA 4DEXA 3PENA 1JJ7A 2CVHA 2LWIA 1XWIA 2ZIAA 1KJZA 2OFXA 4IVRA 3EIEA 3GPLA 1SHZA 5C1BA 4A2QA 1U99A 4QGHA 1Z83A 4ZO4A 4PO9A 2FEMA 4W5WA 4NTZA 1UBFA 3AKDA 3DEFA 4ZDKA 3R9WA 3HYTA 5FUWA 3W90A 3AVOA 4C2TA 1MKYA 1AS0A 2A5JA 4JKIA 421PA 3GJXC 4RD4A 5G3YA 2C5LA 3SNHA 2ODEA 3VX3A 1G20E 5HZKA 4PO8A 4CEIB 2J0QA 2ERXA 3SHWA 1JPNA 4LZZA 4UNNA 2XEXA 2X77A 4LJ5A 2JGNA 2UKDA 4U5XA 3E5HA 4DSTA 2F55A 1I4TD 3BRWD 4PZLA 1E2DA 4DB2A 2V55B 1FTNA 5A4JA 1F3OA 5DO9A 1COWD 3TR0A 4OQXA 4D82A 4URVR 1Q0UA 2YWGA 3DMDA 4F4JA 4ZDIA 2VRWA 3ICEA 1KSHA 3TRFA 2WJVA 3X1YA 2OCPA 2RKOA 3RAPR 5AUOB 4EFMA 1JAHA 2ZRGA 3AVUA 3RRMA 1E6CA 2F9MA 3U61B 2AD5A 3IUYA 2J0VA 2VQSA 5KPDA 2TMKA 2A5GA 4B32A 3AGQA 2GDJA 5EE0A 1YU9A 4I1OA 4ZIRB 2L0XA 3A1VA 4DLSA 1N6RA 3IPXA 1ZUNB 1ZP6A 1SQ5A 1DPFA 3AF4A 4B6EA 5TV2A 4AURA 3SEAA 4FCTA 4LYAA 3SC3A 3ZGXA 1WDTA 1C9KA 4LBZA 4IDHA 4K46A 1E2GA 3RLFA 4QM6A 4LCBA 4M9ZA 3U6BA 2JIZA 5A5GA 2OM2A 4TTPA 2WJGA 3FYHA 4XIGS 4HUQA 1HEIA 4M9SA 2HT6A 2HXYA 3I32A 4ILEA 2BCJQ 5G41A 2AWOA 5JWOA 1Z6XA 4TSFA 2CNWD 5AJVB 1N5KA 1RRGA 1S3GA 2A5FA 4PHHA 2Z4RA 4QGFA 1NIPA 4C0LA 5SZIA 2QM8A 1XXHB 1HQYE 4O25A 1DBSA 1JQJC 2Y8EA 4HLUA 4B3FX 3VNUA 521PA 5HKKD 4NCNA 2Z4SA 2NOAA 4G3XA 1NJGA 4Q1AA 4FMBB 2JLRA 4XSHA 1OKKD 3EZFA 2HT1A 2C95A 1Q12A 4GBMA 4HDQB 3QE0A 2OXRA 3ASYA 4GMXA 2C98A 4HDOB 3NVAA 3KQKA 1AN0A 3QF4A 2DFTA 1W48A 3PFIA 3AKEA 1W0JD 3EZ2A 1P60A 1H8ED 1C1YA 2RGNC 2ASEA 4CZ2A 2J1LA 2YINC 4L4UA 1GNQA 3K0FA 1P9WA 4MYCA 5C2JB 2R6GA 3AKYA 1HE8B 2J3EA 4ASUA 4Q7LA 3QEJA 4OQFA 3WYGA 4AKIA 3HR8A 2Q3HA 3I72A 1J70A 1IY2A 3LRPA 1E9AA 1OFTA 1S8FA 3BJIC 4IOJA 2W6ID 1G7TA 2WIAA 1F60A 4JVLA 4PPGA 1QVAA 3RRNA 4DKXA 2IS1A 3TNFA 5AK0A 5EQTA 3EPKA 1YR7A 3OEED 4OI2A 4G1UC 3OAAD 4LDJA 4O0MA 1E9FA 5FPHA 4RCZA 2ZJZA 3B7GA 4QGGA 1OFIA 4C4PA 4A0FA 3OZXA 1E2PA 2ZRDA 5FUVA 2RGDA 3ZQJA 1U8AA 3IQWA 2KI5A 2QPTA 3P27A 1RE0A 1LFDB 1GITA 2ZE8A 1E9EA 2BHRA 3BH7A 5SZHB 3BFXA 3LLUA 4MYUA 3ECCA 1NKSA 3WP1B 1H8EA 2H17A 2RGCA 2QT1A 1TQ2A 2WVJA 3AV0B 3I62A 2G88A 2WKRA 4QNMA 2ZRHA 4KFSA 4DJTA 4NMMA 2YC2C 4MRSA 5DHAA 1Q1ZA 4A2PA 4A0GA 3I73A 1ZUIA 4XWKA 1CS4C 2PX3A 2GK6A 3EIHA 3FOZA 3SU8A 2GK7A 3BS4A 4IXNA 1P2UA 4JLKA 4UXHA 5J4LA 2P67A 2CCJA 1LF5A 3E2IA 2AK3A 5ANRB 3LFUA 4D4MA 5J4VA 4O2LA 5E95A 2GKSA 1UBGA 4HLQB 1XD2A 1Z0DA 2CXXA 4LV6A 2D4HA 4Q9KA 1RJ9B 1YRBA 2W0SA 3U3KA 1MABB 1II8B 5L3SB 5CYOA 2XSZA 3NIBA 4G5OA 4IW3B 3AQ4A 2P0EA 4Q18A 1N5JA 4XVUA 2R6DA 4HDCA 1XCPA 3DDCA 4DSOA 2ZRKA 1SGWA 1T9HA 1XX6A 3AVQA 4PC6A 1XP8A 1T0HB 4MRPA 1Q20A 2CK3A 3PIRA 3I92A 4KBFA 3W6PA 2R8RA 2JIZD 2XSZD 1NLYA 2GESA 2FFHA 2DFKB 4QBIA 4Q1BA 3RYTC 3OE7A 4MA4A 1VG8A 3SBDA 1E2KA 5FL7D 1QG4A 1F2TB 4DVGA 1XPOA 4BQSA 1MO4A 1PJRA 1FNMA 2QENA 2CE2X 1P61B 3NDPA 1DAIA 4LYJA 5EP4A 1OJLA 1VIYA 3QXHA 5E3HA 4EPXA 1W1WA 3DPUA 2FFBA 721PA 3P4YA 3H86A 2VP0A 3NXSA 4BFTA 1IN4A 5JMTA 4GZLA 3T1TA 1OH5A 1R5NA 3AGPA 4TYYA 3QY0A 2VP4A 3V4FA 4C7OB 2QTVB 2ZSDA 1E0JA 5CJPA 3FMPB 3TSOA 4RKEA 4C0SA 2PL3A 5JSZA 3AF2A 4DLXA 4P4SA 2P3SA 1YZNA 4US0R 2R44A 3OE7D 3VR5A 2YOFA 4HAXA 4RZ3A 3C41J 4TMKA 3X1ZA 3ADBA 4LJ4A 4GSYA 4NYJQ 4KSCA 3TUIC 3F0TA 3GLGE 2GXUA 3FKQA 4QJ5A 3B5JA 2JLSA 1GL9B 1FL9A 2IF0A 2QGNA 3OIUA 1IY1A 4HB4A 2HYDA 4HAYA 2YC4C 4PQYA 4C0AC 4HAWA 4IHQA 3DOEA 2J5XA 1AKEA 3QVVA 3ASZA 4YMVA 3FDIA 3N2IA 3MD0A 3QPUA 4DT1A 3LBHA 2R65A 2OHFA 4HAUA 3Q9LA 3RANA 1G41A 2AKYA 121PA 1KSGA 2FEOA 3LX8A 4CEHB 4X8LA 4NU0A 4LC0A 2BBWA 2YV5A 1X1SA 5EXTA 2QPOA 1VG0B 4DRZA 2BEJA 2OXCA 3PVSA 4JLJA 4EAQA 4EPVA 1TUIA 3FWYA 4Q01A 1YE8A 2X19A 2WAYA 1N0WA 4B2PA 2QI9C 1RRPA 5JEDA 3IHLA 2OILA 4IXMA 2FFAA 3I1FA 4E5UA 1D8TA 1OXXK 5DH9A 4JJKA 4D26A 2IS2A 2VIIA 1Z06A 4QL3A 2J59A 3CLVA 4US1R 2IK8A 2JDIA 4JBYA 3WNCA 5HE8A 1HUQA 2IHBA 2WJIA 2B8WA 2F3RA 2JEOA 3PQCA 5LD2B 2QROA 1OYYA 5EP3A 2HUPA 3GLIB 4EPRA 2V1UA 2QSZA 2FSFA 1TQ4A 4AY2A 4M1KA 4JIMA 1W47A 4FCVA 4D6PA 3PUXA 3GLHB 2FH5B 2KB0A 3LW7A 1JR6A 1ZNWA 1G8PA 4FD2A 4Q1CA 3VR4A 2GAOA 5CIQA 4JYCA 3ZD6A 2V1XA 2EU8A 4LJ9A 4LJ8A 1AZTA 2UZIR 4MRNA 4Y0AA 4BEBA 4X8OA 4JLVA 3WNBA 4PAOA 2ZJAA 3N2EA 1ESNA 1NBMD 4D81A 3RS5A 2I1QA 4D4KA 5KSOA 3DZ8A 1P4SA 2W83A 1U8ZA 2OZEA 2R9VA 1XEWY 3X2SA 5KTYA 4WIAA 4PPNA 1P6XA 4CEHA 2QTHA 4I99A 4PHFA 1DAMA 2FE4A 2Q9CA 3TE6A 4AKHA 4FINA 1CXZA 2YYZA 1ZBDA 3CNLA 1W49A 2W00A 1OIXA 2WPDD 4AK9A 4B2LA 3CPJB 2P5SA 2BMJA 2NO9A 2BMFA 3CUEF 4BLRA 2BM0A 1GVNB 1XF9A 2J7PD 1I4DD 3MMPA 4MKHA 1E2LA 3U3RA 2B7BA 4FI3C 1XMJA 1II9A 1SXJE 2HF8A 2DWQA 1LV7A 3KTAA 4TL7A 1B0UA 1IQPA 4MYHA 5JRJA 2CJWA 2ZRIA 3DOFA 2NGRA 2AXNA 2LKCA 1OSNA 2MSEB 3HPQA 5J4YA 2IYQA 4PQFA 1WE2A 1RYFA 2JAQA 3BE4A 3G0HA 1W7AA 5KHOC 2ZU6A 4P4UA 3TAHA 5FBWB 2VF8A 3L0IB 4HLDA 3OHMA 1IONA 4AC9A 2KBFA 4WVFA 5CYPA 1NVWQ 2F9LA 2ODBA 2XZPA 5J4KA 2G77B 1F2TA 5JECA 2QP4A 4JL6A 4O3MA 5AJZA 5IHPA 4PHGA 3NWJA 1KI7A 1KO7A 2QGZA 3F8TA 4NCKA 1WMSA 3GFOA 1W2GA 4H1UA 5HTKA 1IJEA 2WJHA 2A5YB 4XJXA 4AYWA 3RSOA 2F43A 4LJYA 4G5GA 4D4JA 4C2UA 4RJLA 1SKYE 1VG9B 4FWTA 1XTQA 3I8SA 1E2JA 1JECA 1EK0A 1NLZA 1QHHB 2VP5A 5FH9A 1PLLA 221PA 4UKDA 5UKDA 1KO5A 2QY9A 2VO1A 5F3WB 3QI2A 3NHAA 3CZQA 1F2UB 4FMDB 3GJ4A 4Q4HA 4URYR 5FUYA 1K5DA 2JJ2D 3T1QA 4JLDA 1E2NA 3MFYA 1G7RA 3CIOA 5FPSA 2F7SA 1TNDA 3K09A 1Z63A 4A8JC 1WF3A 3QSYA 4GI7A 3KXLA 1YJ5A 1QG2A 1N0VC 2JLUA 2DR3A 4B44A 3ADDA 5CDFE 2HJGA 3KUDA 2P65A 1DTSA 1JEEA 1DADA 3NG1A 5EP2A 1LB1B 3B1YA 1YZTA 3QIAA 3X1XA 2EFGA 2MMGA 1GKYA 2GA8A 2XOKD 2Q6TA 1XJ0A 1AQUA 4LI0A 3VU9B 3TGPA 1H8HD 2C2HA 2JATA 4LUCA 4Q4HB 1EFRA 1AGPA 3AF1A 4RFVA 3CW2A 3SDZA 1SVMA 2NO7A 3UMRA 4D2IA 2AR7A 3CB4A 4UNSA 4C0QC 1K6MA 1TAGA 2C03A 1EG7A 4WZ6A 1KIMA 1PLJA 3QXXA 3K0EA 4M1TA 1LF0A 4XD7D 4RD6A 4EPYA 2QBYB 5IT5A 5E4FA 5F9HA 5JI2E 2GBLC 4Q4JB 1J7KA 4OHYA 1ZM4A 1QVRA 4Q7JB 5HR5A 1RVDA 2ORVA 2ZYUX 3GLIA 3CR7A 1Z3IX 1SXJC 3MWYW 3A4LA 2H57A 1KAOA 2ORWA 4J0QA 2F43B 1OKKA 2NO6A 3O8DA 1QHIA 5CDFA 1A5TA 4PPQA 1T3LA 2W0MA 3FFAA 3P20A 3RSLA 1DO0A 4Q9IA 2IS6A 4Q1DA 1FFHA 1YKSA 2FWRA 5CK5A 1TQ6A 2WPDA 3RS0A 1AZSC 3LNCA 4M1OA 2FFQA 1RIFA 1NMZA 4G5RA 1OLOA 2QRZA 2IYWA 1E9RA 3PEUA 1KI6A 3THWB 4AKEA 2WSSD 2ONJA 2V6IA 2RHMA 5FL3A 2Z5FA 3B9QA 2C04A 1IXSB 2ZROA 4BRUA 4M22A 1V43A 2X8AA 2IYRA 4TT3A 2XB2A 2B21A 5TY0A 4E03A 1ONBA 4H1VA 4XVRA 3IILA 5CLLA 2QAGA 1BYIA 3T15A 2GEUA 3MG9A 3PUYA 1R0YA 3RRYA 1FP7A 3VHLB 2IYVA 2Q21A 2JJ1D 2IX3A 5DYIA 2E9SA 2O8FA 5DGXA 1GRRA 2GJ8A 3QKSB 2VHCA 3UWOA 4W9MC 3SJBA 4B6FA 3A1UA 1JR3E 3D6TB 3B1VA 4QBHA 4OK5A 3ZJYA 5EUMA 3VR3A 2FPLA 2ZJ5A 2XXAA 2O8DA 2OBMA 4QM7A 3IO3A 4B35A 3W3AA 4AD8A 3NHBA 4ZKEA 3BORA 2WWHA 1E4VA 4JJZA 3RS2A 2XGJA 1S96A 2VLIA 1U98A 2OAP1 3BOSA 3DM9B 4QBFA 3ZZUA 2BVNA 1J8YF 1UFQA 2EYQA 2BDTA 2CL6X 3QG5A 3OIVA 3LV8A 4I81A 1P3JA 3RDPA 3KTAB 2F6RA 1QRAA 2FX3A 3RS3A 3CRMA 1KMQA 4LBYA 3TVDA 2ZI6A 2Q9BA 2V4ZA 3DKPA 2IC5A 3BC1A 4DLZA 2PEZA 2VA8A 2AL7A 5GVSA 1JR3D 1SVIA 2WICA 1UEIA 4YMUA 1EESA 4TLAA 1BYUA 4HLCA 1N5LA 2NO0A 3D7MA 2AN9A 4X8HA 2A3RA 5JWHA 4OL0A 4TQUS 1ZJ6A 2VHTA 1M7GA 3TSWA 4AIIA 4LJ6A 2QP9X 3UIEA 2PT7A 2KBEA 4B3DA 3QUSA 4A4DA 5EZ6B 3EIQA 1NBME 4F4IA 2CLCX 4ARZA 4IOMA 5KUTA 4L9WA 1OH8A 1D9ZA 2JLWA 3I5YA 4DB4A 2PZEA 4Q9JA 4Z8YA 2YJTD 5AR1A 1UDXA 2V7QA 3ZVLA 3GQBA 4URZR 4PFSA 5IF9A 2EVWX 1N0UA 3CKLA 4I4LA 5G40A 1MO3A 1NF3A 1US8B 1A1VA 2N1BA 3QKRA 3FE2A 2QN6A 1S3SA 2FDCA 2ANCA 5DN6D 2FA9A 1Q3TA 4M9XA 1JPJA 2GJKA 2OFWA 4OHVA 1TEVA 4LGMA 1E79A 5C46F 4P32A 4NKRA 4TWZA 3LBIA 3RWMB 2C77A 1WBBA 2GWHA 2G9NA 4V0LA 2ZU0C 3BB1A 4BLPA 5L3QA 2GETA 4ESVA 1NN3A 2JCSA 4Q9HA 1JQLB 2V54A 1OYWA 3UATA 2YZ2A 5D3MB 2O8BA 2OV2A 1UJ2A 4G5SA 4V0KA 2ZSAA 4C0JA 3SOPA 1Q3HA 4PSVA 4BFUA 4MGZR 3TUJC 1RC8A 5FTMA 1EXMA 3BXZA 4PAMA 3F3YA 2XZOA 3U4QA 4A82A 2IYLD 3FHCB 1VCOA 1SXJB 4KBGA 2ZJYA 4PSKA 1MRNA 1XMVA 2VP6A 5BN4A 3UMFA 1CIPA 1IN8A 3O47A 3CNOA 3GMTA 1EWQA 3KJHA 4YXWA 1N25A 2W6JA 3UMSA 3R9XA 1OT3A 2KJQA 4V0NA 3B13B 4R9UC 1UEJA 1ELOA 1DAEA 4WZBE 3LY5A 2J46A 3K0AA 5D3QA 4HB3A 4NE2A 1M74A 1GL6A 3SFZA 3M1IA 3T5DA 4Q4AA 2X2EA 1VKJA 3UPUA 1XPUA 1XEXB 1T0JB 2BMDA 2W6JD 3RC3A 4V0MA 1ZAKA 3UXMA 2CDNA 5A0FA 5JSZB 1T5LA 5IRCD 3PJRA 1TQDA 3GJ8A 2H1LA 2ODNA 1NVVQ 1R8QA 1Q1BA 4MYTA 4ACBA 4N0DA 5DNYB 4CEJA 1ZC3A 2WZQA 5KPJA 5FTKA 2XZLA 4TL9A 4A15A 1HYQA 1GG2A 5EXPA 4EKDA 2UVQA 1E1RA 3FB4A 3IDQA 1DARA 4M0LA 2NTYC 1U90A 1T3HA 2H92A 4BFYA 4NYMR 3NEJA 1IXRC 4RFSA 3NH9A 2WWWA 1G5PA 1Z22A 3QBVA 3R7WB 1EFTA 1XCMA 1XTSA 4UXJA 1ZU4A 1R6BX 2NZJA 1E9CA 4KYUA 4OQLA 4MQBA 5B64A 2GBLA 2MSDB 5LD2C 2OT3B 1FTSA 4GL2A 2NZ8A 3FKSA 1SKQA 2DYKA 5CB8A 2QAGB 3K70D 3ZVMA 3WNDA 2CJWB 1OF1A 1ZD1A 3AF0A 3I4LA 4BFSA 4D25A 5EXXA 2QL6A 4OHXA 3H4MA 4ZDWA 1CJTC 1U0JA 4IFEA 2QORA 4BZXA 2VYFA 3IEUA 3NBZC 1ANKA 2GJAA 4PTLA 2IWRA 4NYJR 1XNJA 1KTVA 3Q3JB 2AKAB 4D0LB 3I61A 4NCHA 3L8YA 2HDNB 5DLQC 1U9IC 1A82A 4RD1A 2O8EA 5AUNB 1XU4A 2C96A 2IA5A 2QU8A 4XOIA 3OAAA 4URXR 5DYGA 5JWRA 3QKUA 1OHHD 4YMWA 8OHMA 2C78A 4RD3A 2WOOA 3IBYA 4HZUB 1T6NA 1NLFA 1E2FA 4DHEA 4L9SA 1XTRA 5J5CA 3FKSD 4YMSA 4GOKA 5F2EA 4DIEA 2NPIA 1GUAA 3GJ5A 1XCGB 3EZ6A 4Z54A 3LD9A 2B8TA 2J0UB 4JLPA 1G3IA 5JJKA 5CIWA 6Q21A 1YZLA 3AF3A 3ZIAA 1CF4A 4AG5A 1EFHA 1P2TA 3FMOB 3MWLA 2ZITA 2WM9B 4XWAA 4WA7A 1DS6A 1LY1A 4OYHA 3R7WA 5IK2D 5FBRB 1F2UA 2HCJB 4WAUA 2RHDA 4LHYA 3AVWA 4JYBA 2E87A 1CU1A 3BH6A 1D5CA 1GTVA 4NYIQ 1VYUA 2VP2A 2X1VA 2VEDA 4TYQA 4F38A 4E07A 3T5GA 5LDDC 5L3VA 2MSCB 4Q66C 2IYXA 5AJXA 4Q00A 4QOSA 4GZMA 2O0HA 3OESA 4QGAA 3CRVA 3B60A 3T06B 1EGAA 4DLWA 3K1JA 2H7VA 5FBLB 5TMPA 1A2KC 1CTQA 3EA0A 4TYNA 3DVLA 3P4XA 4B2IA 2CHQA 3FPNB 2B7CA 4GT1A 3SN6A 4TMTA 1KMHB 1Z29A 3Q85A 1J99A 1HT2E 2IXEA 4BE7B 4ZDJA 2EWVA 2CK3D 3M4YA 2BJVA 2GHIA 1G3RA 2DWPA 4LYHA 4OI4A 2W2TA 2G1KA 5HCIA 1G1MA 4GFDA 4NP6A 1OB5A 2GXAA 3PITA 2BWJA 3KKMA 3WBKA 3G5UA 3OF5A 1W4AA 2IEYA 2QA5A 1Z0JA 4RY2A 3VNVA 5FOUA 4ZKDA 3THYA 1DG3A 1RFLA 1P7CA 4QC2A 3TBKA 1OE0A 2WIBA 3CRW1 3MRSA 3AVPA 4AI6A 2NIPA 2O5VA 2W6IA 4KI0A 1FQKA 1ZC4A 5KYKA 3PG5A 4GP7A 3W9YA 2QT0A 1GRNA 4FMCB 821PA 3BFVA 1AA9A 1WA5A 3B2EA 5JZVA 3OIWA 2OESA 1VIAA 4JLMA 3ADKA 4JVMA 4QHTA 5JEEA 1KI6B 3THWA 1KK3A 4DDTA 4NH0A 1S1CA 1MO5A 2XNDD 3A1WA 4NPHA 1CULC 1DO2A 1R8SA 1GNRA 3ND8A 4A92A 3JVVA 3TIFA 621PA 5HKKA 3Q5EA 3KL4A 3KQNA 5TB5A 2CE7A 1CP2A 2BBSA 1Z08A 3T35A 1KDOA 2FOLA 1A4RA 3KB2A 3ZH9B 4Z8XA 3HJHA 2OE2A 2YWFA 1E94E 1WCV1 2RGXA 3CPEA 3C4JA 2PLFA 4PC3A 2OCYC 4GOJA 2IUTA 1OH7A 4JLOA 5G3ZA 4QHSA 2ZE7A 2AFHE 3WRXC 2WWIA 1N5IA 3LAWA 2PH1A 3CRRA 3K9GA 1G5TA 4NONA 3KKPA 3A37A 4DCVA 3VU9A 5C4GB 3ZQ6A 3BERA 1CJUC 1G3MA 1NG9A 1G291 3NKVA 3QG1A 3FHTA 1ZD8A 4HI0E 2JLYA 1UF9A 1EFUA 2FZ4A 1G18A 5F9FA 3VX4A 3TSZA 2ZI9A 2FPKA 4F7WA 2WJJA 1HA3A 2ZRBA 1NN1A 1S9DA 3P26A 4JSTA 1FZQA 2GF9A 1S9HA 3H2YA 2CVFA 3ZIAD 3ZS9A 2W58A 2FZLA 2QP3A 4I1UA 3VR2A 4HLUC 3PUZA 3WXMA 1TU4A 3Q5DA 3WYFA 4AYTA 5KU1A 3CF6R 2FNAA 1NBMA 4IEEA 3NBYC 1HURA 4BECA 3K70B 4PC7A 4WXRA 2FSGA 4A9AA 4B43A 4ERNA 1G3QA 1TF5A 2JASA 4WOPA 4DBLC 4OQNA 3FGNA 4LYFA 5CM9C 1T4GA 3BAFA 1T91A 3LH5A 4RVCA 2R6AA 3FHOA 2B6HA 1SVSA 3WYAA 1IBRA 1UADA 4KFUA 3Q8XB 1S4QA 4PZYA 3L0SA 1GL7A 1KKMA 2HF9A 4AWXA 4DFCA 1Z07A 2AX4A 1ZM9A 2PT5A 3B9PA 3IKJA 2YOGA 1VPLA 2KSQA 1P5ZB 3VMAA 1TADA 2EW1A 1ZNXA 3GJ7A 1GIAA 3K0CC 5LBIA 4TTQA 4DLTA 4LSGA 4IEIA 3VR1A 3SZRA 2GNOA 4TL8A 3VKWA 3BH0A 3L43A 4QKQA 2NQ2C 1OPXA 1OW3B 1E9DA 2J41A 2IT1A 2XB4A 4MDEA 3DZDA 1J2JA 2D62A 2Z6VA 1IN5A 1ZM2A 3MWJA 3B1XA 1GDDA 1N3BA 2WAXA 1E98A 2HJVA 1UM8A 1NP6A 4V03A 5F98A 1M2OB 3AVXA 2O52A 4DEYA 1E32A 1PUJA 4MUBA 4TYWA 4A6PA 1Q1QA 3MJRA 3AUXA 3SI7A 2ONKA 1CEEA 4P33A 1XJQA 1CBUA 1XZPA 3G82C 3BIFA 4GPTA 1KJYA 4B76A 3B6EA 1XDBA 1KI3A 4V0ME 3OEHD 1XFAA 3MCAA 3EPLA 1Z8FA 5K8UA 4M4SA 3LX5A 4R2HA 2YKGA 1XMIA 4PZZA 2V9PA 2A9KA 2IHYA 1ZNYA 3NH6A 3C5HA 1RW4A 2H8KA 3AEZA 4Q4LA 4BRWA 1VYVA 3PUVA 5FTNA 3QENA 1BKDR 4V0OA 1NL3A 1HQCA 4C30A 3T12A 3V00A 1YZGA 1G4AE 1T8UA 1CR4A 3QPVA 2ZRPA 3B8HA 1N6NA 2QE7A 3L8ZA 3BWDD 1O3YA 4EUNA 1LS1A 1KO4A 2WKQA 1KOFA 2ZYVX 1Z2CA 3QXJA 1ZCAA 3AM1A 4B3GA 4TN1A 4W5HA 1AS3A 4WZAE 1A2BA 1E9BA 5GJCA 4DLRA 2ZXUA 3AVTA 2ZUDA 5AWFC 2GCPA 4C9BA 4RD0A 3UKDA 5K8IA 2Z43A 3SYLA 2J9RA 2QQEA 3D31A 3OEHA 4M21A 2ANBA 1W36B 2FG5A 2WWGA 1RRFA 3EWAA 3VFDA 2P6RA 4PC1A 4BWYA 1A7JA 3KQHA 2IL1A 1IXZA 3BFKA 3K9HA 4YDSA 2AD1A 1NMXA 2YVUA 2E1RA 2OBNA 4F92B 4KSBA 4RZUA 4DDVA 1NVXQ 2O0KA 3CR8A 4RD2A 3RVBA 3BB4A 3SHFA 2RAPA 4M1SA 3U7EB 1N6PA 5LB4A 2VL7A 1R2QA 4JMPA 1MOZA 2WKPA 1SZPA 2BM1A 1QBKC 1E2IA 5ELXA 4A36A 1XPRA 3O8RA 4ESHA 3A4NA 4I1VA 1F5NA 2LCFA 5FBQB 1IN6A 2GJ9A 5B58C 4Q02A 2VHJA 4MGKR 1DAGA 1OFUX 4LHWA 4EFNA 2EWWA 1KK1A 4QFMA 4TMWA 1P75A 1J8MF 2JDID 4R2IA 3GEIA 3QNUA 2QQ0A 1IM2A 5TXGA 3KQLA 3LWNA 1TL7C 5LPNA 2GCOA 3SJZA 1JAIA 5DI9A 2BBTA 3RWOA 3TQFA 2QG6A 1Z47A 3K0CA 3Q7PA 2UZ3A 3QF4B 2QTFA 3U7FB 1KK0A 2PZGA 2PJZA 1Q22A 4MRRA 2J0SA 4K8OA 1G8HA 4OJKA 1KZGB 4DSUA 4XWOA 1JBKA 2ZS9A 3HR7A 3OFNA 5EZ5A 4OQMA 1LVGA 1NSFA 4M2LA 1SVWA 3DM5A 2CLSA 1KSFX 4GP6A 4I1SA 2ZRJA 1W5SA 2QAGC 1R10A 3FTQA 5BQ5A 1OH6A 1AIPA 4P4TA 1YZKA 4YQFA 3GFPA 4CF7A 4OK6A 4PANA 1CRQA 3ZYCA 1SULA 5E7JA 4EFLA 2NPFA 1X86B 3SFVA 3PCRB 2O8DB 4KFRA 5FI1B 3HJNA 3GJ0A 1BOFA 2JLXA 1SVLA 1UBCA 4KCGA 1XEWX 2IXGA 4XSGA 2ZANA 1KI1A 4ITRC 2IYZA 1FW6A 2NO1A 2XNSA 5EJEA 5EE3A 2ZI3A 2WSMA 4V02A 4DC9A 2ZR9A 4NZYA 5HCNA 1CR0A 1DG1G 1MT0A 4NYMQ 1FX0B 2NMVA 2R2AA 4IVPA 4YLGA 4A2WA 4HYYA 3DL0A 3NBFA 3AP1A 4IDOA 4R71A 4CEIA 2GCOB 2GRJA 3ONWA 4RZXA 1N2CE 2ZRNA 1MR3F 1NVVR 3I3SR 1WQ1R 2J87A 4JT4A 4U00A 3VR6A 2VSXA 4E22A 1VHTA 2GCNA 1FMJA 3IIJA 2RH5A 3EPHA 1YZQA 4B71A 1M7BA 1L7VC 1XB2A 2VSFA 4MUAA 2O8BB 1EFRD 3PXGA 2QMOA 4D4LA 2GAAA 1ZU5A 1YVDA 4F4CA 1KZ7B 3W5IA 1DVRA 3FVQA 3U2QA 3DMNA 2CLDX 3U60B 2ZI4A 1G3UA 1NG1A 1VHLA 3AUYA 3T61A 1ZIOA 4JT2A 5EE1A 4QJ3A 1GZSA 1ZMXA 4Q7KA 4FCWA 2PMDA 4KYIB 4BLSA 2SHKA 3LDAA 1KO1A 4C0BA 5AUPB 5DI3A 4ON9A 2OLJA 2ZRAA 4HATA 4TYPA 5KDDA 1FPMA 1R0XA 4Q48A 3IEVA 2V8OA 5DN6A 1E3MA 4OHZA 3KKNA 1Q44A 3NC0C 4JBXA 5SZJA 4TMVA 4LJ7A 4B33A 1JXMA 1R5BA 3NDBB 2X2FA 2KWIA 5C4MA 3C8UA 3R20A 1Q21A 3NTUA 2GF0A 1D2NA 1CRPA 2RB4A 5BN5A 3IGFA 1U2RA 4M53A 3LLMA 3THOA 1KNXA 1UKYA 1QDEA 2D06A 4Y0VA 3EA5A 1X8LA 1E2QA 1Y63A 2RMKA 2VSOA 2OAQ1 2QSYA 4W5JA 2A7QA 2CL0X 2Z83A 2ZJ2A 3QPWA 2BBOA 3QXCA 5D3MA 3TW4A 3GLFA 5BXQC 3N5CA 5G53C 4DCTA 5KSYA 4KXFB 1W36D 3HP1A 1ZUHA 5FPYA 4Z1MD 1QHSA 2IS4A 4HZIA 3FPAA 5CB6A 4LRWA 4FWIB 2K5UA 4QHYA 5FBVB 2GEDA 2A78A 4Q1EA 1ETUA 1IJFA 2OG2A 4L8GA 3ZZTA 4QJ4A 4RFSB 2ZRCA 2ZYWX 2P5TB 3VAAA 4HEJA 2HCBA 1US8A 5CM8B 3GLFB 1VCMA 2ZM5A 3THXA 2QNRA 2XAUA 4TQ9A 4ABYA 1YQTA 2I4IA 5JHGB 4B47A 1ZVQA 4JL5A 1BO6A 1IN7A 2XOKA 3IO5A 3OFND 4TTRA 2GZAA 2IEZA 2OO7A 1KKLA 2XNDA 3KZ1E 1M1YE 3MAAC 5DISB 4FN5A 4BLOA 2VTKA 1E0AA 1WRBA 2ZUCA 4LV8B 2CEAA 4B73A 5HE9A 4BLTA 2WMOB 1OFHA 1Y3AA 5P21A 4YMTA 1R0WA 5FFMA 1I2DA 3GLGA 1Z5ZA 2FGKA 5J40A 2D2EA 1PVOA 1SVOA 4ZI2A 3CH5A 4AG6A 2JLQA 4KVAA 2DHRA 5JJLA 1Z2AA 3I8XA 2P2LA 4CW7A 3GFTA 5H8WA 2IWHA 5B57C 2I1VB 2QPAA 1E1QA 2JLVA 1Z0FA 3IIMA 2I3BA 2V3CC 4RSGA 5JHHB 5JI3E 4DWJA 2D74A 1CKEA 2DFNA 4UQOA 4DCUA 4O2RA 2GTPA 4IKEA 4URWR 5GVRA 4KLZA 4TMXA 1OXUA 2IF2A 1K5GA 1NY5A 3ZLJA 4IDPA 4IOLA 4TLCA 3GD7A 5SZKB 3LXXA 3W5JA 4S2EA 3SR0A 3TR5A 4MKIA 2FV8A 1NSTA 1DE0A 2JJ1A 2VH5R 1IHUA 4XH9B 5GJVC 1RZ3A 4Q4AB 2Z0MA 3B85A 1XD9A 3LBNA 4DIDA 4PAQA 4DLUA 3LO5A 5KNBA 2B2NA 2BC9A 2CNWA 2WHXA 1AM4D 2A2ZA 3CM0A 1OXTA 3QF7A 5E7MA 2V7QD 5FTJA 3R9IA 4CYMA 3THXB 4TT3D 1EX7A 3Q7QA 3KKQA 3QKSA 5DIFA 3TUZC 2RGGA 1E9SA 2D2FA 4ZCIA 1FUUA 1AGRA 4C0HA 5BWMA 4CRWB 3F5FA 3PEWA 1IY0A 3A6PC 2OUKA 1P9RA 1E2EA 1G8YA 1U81A 4MRVA 1LNZA 2JJ2A 4CT5A 2FF7A 1XZQA 2REOA 3IPYA 4EPTA 3QXSA 2YHSA 1P2SA 4FMDF 3NC1C 2LKDA 1W0JA 3EXAA 4QXAA 2ZJ8A 4YDHB 3M0EA 5FR2A 1MABA 2QE7D 2EFDB 3EW9A 3BK7A 1GRQA 5AUQA 2OFOA 2A5DA 4IOKA 1UBEA 2QZ4A 2C99A 4MGYR 1VTKA 1KDPA 2QMUA 1YZUA 3AH8A 2CHGA 4B34A 3W8NA 2ATVA 2D3WA 4CGZA 1WXQA 3MLEA 3V9PA 4A1FA 2Q0HA 1AKYA 2ZI5A 5EE5B 2AK2A 3CX8A 2YNMA 3RRZA 3U7GA 2OEPA 2P6NA 4LY6A 1ZW6A 1Q57A 1KAGA 1T5IA 1O87A 4BLQA 2FPMA 4IFBA 4U02A 1FQJA 1GP2A 4HAZA 1YRAA 2R62A 4BZQA 2IW3A 1COWA 5DI3B 3JVUA 4WXPA 1RPZA 4JLNA 4HZUA 5BW8A 5FL7A 1CJMA 1MO6A 4LHXA 5FOSA 5IDVA 2CCGA 4C7OA 2VHQA 3TW8B 4XVQA 4LPKA 4WBSA 3DO6A 1N6KA 5LB2A 2FJUA 3EWSA 5L3QB 1DEKA 3L82B 4G5QA 4AYXA 3EPJA 2CBZA 4NBSA 3GEEA 1CLUA 4Q19A 1FOEB 1B23P 3C5CA 2XTMA 4UNPA 4DUGA 2VHUA 2R6FA 2R6CA 1ZM3A 1QHYA 2BIFA 2ZRFA 4OI1A 5CJ2A 3KXKA 1HTWA 4IRUB 2XJ9A 3VKHA 4P4SB 3ICQB 2AXPA 2F1IA 4DLYA 1UKVY 3H0KA 3DKVA 1NIJA 2BOVA 4FW9A 3WY9A 3PEYA 1QHHA 4EIWA 5FPKA 3GLFE 1JNYA 1KI9A 3QEOA 1MRSA 2ZEJA 3REFA 3RS4A 3GLIE 2QMHA 3J81k 1PV4A 2EFHB 3T1VA 1XEXA 1U0LA 1JB1A 3AVYA 1SKYB 4EPWA 2ZREA 4YONB 1NMYA 1W36C 2CCKA 2QMEA 1N6LA 2XTZA 1OXVA 1TU3A 1YR8A 2WWXA 2XX3A 3CWZA 5M04A 1E0KA 1HV8A 4OKSA 3MJHA 4M9QA 3UG7A 2GVDC 3L2OB 4GOXA 3I5XA 3U4QB 5BYKA 2ZE6A 1F48A 4UNQA 2EYUA 3K0AB 1E99A 2G1JA 1UKEA 1GOTA 3SE0A 3B1WA 1G19A 2PJRA 4K81B
chains in the Genus database with same CATH superfamily
3AB7A 4LGYA 2QX7A 3T3MB 2IXFA 3BF7A 1ESMA 4KX5A 5DWQA 3LGXA 4X1KB 4ZMBA 2ZTSA 4H3HB 4BO1A 5EJAA 2RGNA 4YAUA 1RYBA 1AF4A 2QVGA 1O1YA 1OFVA 3RC2A 4UCXA 1ZL2A 1LW7A 1E3QA 3DT6A 3DVAB 1IIRA 1JFFA 3PFCA 4KK3A 3CMCO 2ECKA 1M5UA 1PQ4A 1PQWA 4P3OA 4ENSA 3ND9A 1E1RD 3K9FC 2WJWA 2X7XA 3L79A 5FWXA 1YF3A 1NBAA 2J48A 3V4VB 3LTEA 1UJBA 1FW8A 1BW9A 3AL3A 1OXBB 3EPRA 2VDUE 2ZSKA 3IP6A 3L7OA 3S2GA 4DG5A 2F90A 3PHCA 4OQPA 1L8QA 3SM3A 3PXEA 1I0ZA 4GNKA 2D8AA 4B3HA 1RHMA 1VLMA 3IKVA 4ZTUB 2WMDA 4FYWA 3QOWA 4ZHQA 1G5RA 1W5TA 4P3YA 4CL8A 3HPRA 3HL0A 3C3YA 2OBYA 2EFEB 2ZSEA 2COEA 3V2IA 2VRCA 2ZSBA 5EAIA 5MN5A 2QVYX 3C3EA 2PS9A 4CV0A 4ZCTA 2VQ6A 2BONA 4A16A 1NYLA 5I3CA 1SQ0A 1PT5A 3LSTA 3A58B 1NLMA 1X7ZB 2I6FA 3HYRA 4PYKA 2VA9A 4GUAA 3SPXA 2Q3MA 3PR1A 1X1RA 3IE1A 1G2IA 1XQXA 4TTIA 2OZLA 4IGFA 2XGGA 5L3ZA 4XGIA 1II0A 1AU9A 1NI3A 2J45A 1IVSA 4O2AA 2ODQA 4B5LA 5AI9A 3MMZA 1WNFA 5EJ2A 1PX0A 3NUQA 4JZKA 5IZCC 1U2TA 4JELA 1U3FA 4EEXA 1T0UA 3EXG2 1XA4A 5F73A 3T0IA 3UMGA 4EG5A 3D0RA 1UK9A 2K7ZA 1YB2A 2A67A 3QWHA 3L8CA 1MB4A 2MIIA 4BE4A 1M6YA 4FXOA 1R0ZA 2XDAA 5E7IA 3UH1A 4KVGA 3AHHA 1L4BA 3BCSA 2ORYA 3HYLA 1F51E 1VE7A 1ZJYA 2GJ4A 4GPBA 5K20A 3EZ9A 1XRJA 1E2HA 4QPPA 4JR0A 3UG6A 4OMFG 4XEHA 1WM1A 1CFJA 3I45A 1WUTA 1DKUA 2CHVA 2HRCA 5TARA 4A0HA 4EVQA 1J90A 3THXB 4IFTA 4CBVA 4AKGA 5DLYA 1ZD4A 3LHDA 2SKEA 4PLYA 4R8KA 3FVVA 5ESRA 4IVQA 2FXIA 4L72A 5K3FA 5JO0A 4PF1A 5INTA 1RYHA 3MWFA 4H4CA 1Y8RB 1P0MA 3R8FA 3CKMA 4BV8A 2PKXA 1RRCA 2X22A 1UPTA 1G17A 3MBIA 1Z6GA 3GIWA 4ZXPA 3SJAA 3R7BA 2YQ5A 2H7CA 2HRQA 2JJ8A 3BWVA 5LQCA 2E4XA 1PFQA 2H2IA 4EMTA 2B5WA 2DBVO 3RADC 2BKXA 1KMHA 1T8RA 1VHDA 1JLHA 3ECSA 2REBA 3HCPA 3IJEB 4MW0A 3BBPA 4B79A 2F1RA 3MILA 4GMDA 2BN4A 4B45A 2Q1YA 3LL4A 3TLMA 4M83A 3B78A 4Y2TA 5JAMA 1JEOA 5L7YA 4HWGA 3OIFA 1KPHA 1PUXA 4R7ZA 3LIPA 3PEFA 4UFPA 3IIKA 4EKYA 3NBUA 1AJEA 4IMIB 5DGTA 2B61A 3ABZA 4YAGA 2R5NA 4D80A 5LMNB 1U9IA 4MPPA 1KMMA 1Y7TA 1YNOA 2C2MA 3OZSA 1R8JA 1YDWA 4GDMA 3D5TA 3UH0A 2R00A 1SXJD 1RQPA 2K4MA 1QH1A 3A36A 3KQWA 3SSAA 2ZRMA 1GN8A 1TUGA 2HL6A 1ZITA 3QOYA 2Q3CA 1KY2A 1JHYA 4Q0MA 4RIFA 4WJKB 1KQOA 4YJGA 1UZAA 4D9GA 2EJCA 4QNRA 4ZI7B 3AVVA 3BGSA 1A98A 4BCCA 3SFTA 3TTWA 1WZCA 2HU5A 2NXNA 3NV9A 4YBZA 1HI9A 4XARA 4OAQA 4UXIA 3D1LA 1XKLA 3SZ3A 2BEVA 1DIBA 3TDKA 4M87A 5C1DA 1MPXA 4G9BA 1XTTA 1YOBA 3NHYA 4QNNA 3F5QA 1R4MB 4TM8A 1PYOA 3R8CA 2ZT6A 2GWRA 2KE5A 2ODPA 1S01A 2FMXA 4G84A 3VC3A 4QFDA 3T34A 3TLCA 1M54A 3GCWA 3PYXA 5JPCA 1RTKA 1W46A 2Q8NA 4TLMB 2ZUTA 3RTAA 1YRYE 1W34A 2CDAA 1KP2A 5IYZF 4UPVA 1G4UR 3MNFA 1D2EA 2GBGA 3HB0A 5KVCA 1EDDA 1PJSA 3Q41A 1PLKA 1DJNA 3Q5GA 4X54A 2JLZA 5BSKA 4DLVA 2GKOA 4EI8A 2YWJA 1MH1A 5THKA 2FCAA 1XU9A 3AL2A 1E64A 4M0DA 1KDYA 4AM8A 3NCHA 3TGWA 3UANA 3TVYA 3WFJA 2RKBA 4Q47A 1Q17A 9ATCA 4MH0R 1U8EA 4WXHA 2JIRA 4UCFA 3DKIA 2PKCA 2Q3FA 2FK7A 2FW8A 2ZJ7A 3HSSA 1I2MA 2REXB 3CZ5A 3GY0A 3H1TA 2Z2YA 4GR5A 5E3IA 5FLEX 3UJ7A 2O0MA 3S8MA 5LZ7A 5IEJA 1H6CA 2CZGA 2YOHA 4JA2A 2A1UA 3BFPA 4P9NA 4TKVA 2X9GA 1FJHA 4DSNA 1G2OA 2ZYSA 3R0XA 5EUQB 3ANLA 1CUEA 2C2ZA 3RC9A 3TFQA 3OJ0A 1G7CA 1K5PA 1DPGA 3TW6A 4OH7A 1BJTA 2XYRA 1AO3A 4XWWA 3G2OA 4ER3A 4A73A 3ESDA 4ED9A 4DIUA 1D6JA 1OLSA 5F12A 1XF1A 3L6CA 4PW0A 4R8VA 4DFDA 4W5QA 3R7DA 2GCGA 3OIYA 4YPVA 5EHZA 5FBHA 2WWFA 3AR3A 2E21A 4DCNA 1I51A 4KWCA 2OGTA 4AF8A 3N76A 4L4SA 4EGAA 2P9EA 2XV1A 4MV3A 3E8MA 4LPSA 4P31A 4M1MA 4QXRA 4H1WA 1QZ3A 3ANTA 1LDEA 3EDMA 1QPZA 2VBCA 1BQ3A 4AZ0A 1DX4A 4H7HA 5A3RA 3D2CA 3W3ZB 1DRJA 1H2BA 1PNOA 1EGHA 3QVOA 4JP2A 3RYCA 2QRNA 1E79D 4QG7A 1A4UA 2NNLD 3ZV7A 3JVDA 1G21E 4IY1A 1NNEA 4JI6B 1YHZA 4IDFA 5FUMA 5B3LA 2NU8A 5JJIA 1QTRA 3B82A 2ZAOA 3PC4A 4PYNA 4RF2A 4AJIA 1JLSA 2WNIA 3KSMA 2PX0A 2XCIA 4OJTA 4Y3UA 3B1ZA 4F9TA 1RMQA 2I2AA 6YASA 4DR7B 2HV8A 5GM1A 2D7DA 3V7NA 1GQYA 4P0PB 3BHJA 2QVBA 4G85A 2WBLC 2HIGA 1K66A 3DAPA 1QBGA 4R7GA 1YV9A 1RZUA 5KYUB 1OWLA 3OF2A 4OOEA 2H1HA 4PR0A 4F9FA 3W2FA 3I3OA 2CD9A 5F3DA 3ADCA 3EAFA 4BEJA 2W43A 2C5SA 2H48A 3SBEA 4J0KA 5JLJA 4M0UA 3KLMX 3KTOA 3MS4A 2EERA 2H29A 3U6KA 4NECA 3CLSC 2BEKA 3WGQA 5EPEA 1MOSA 1F5SA 3EG5A 1EUYA 1JDNA 2OBLA 3OT4A 3ELYA 5HUQA 3CW8X 5ITVA 4Z4CA 2XXAB 1J5XA 2IYYA 1Y6QA 2OXIA 3RROA 1M6NA 3CTPA 4QDOA 4B3XA 3F3KA 1SOWA 3TDNA 4EA8A 1LJUA 2XKBA 4X24A 3EARA 2YICA 3R3XA 4ARSA 3K9LA 1BE8A 3WLJA 4JKOA 1OWNA 5EI5A 3S1SA 4E4TA 1HKUA 4HHEA 4NBTA 2I8CA 4J0IA 3CNHA 4B48A 4G5YA 4DZZA 1R6TA 1YC5A 3OZCA 1PJ8A 2V6MA 5SV2A 1W4BA 2AEFA 4BASA 3HJBA 3KZXA 1TF7A 4JYPA 4EF6A 1Q84A 2DY1A 3AEQA 2OZKA 1NLUA 4B09A 3P2OA 3SS8A 1AG9A 3B6ZA 4KO3S 4LK2A 2X6RA 4WK4B 3ZCUA 1WHSA 4I4TA 5JCOA 3RYCB 2AVDA 1MX1A 1UL1X 2EIXA 1J56A 3JTMA 4R2LA 4JP8A 5HILA 1UT5A 4FKZA 3EVNA 2OMKA 1WZNA 4J9UE 1J0AA 1P18A 2IUUA 2O7RA 4AJHA 4UTRA 2ZQ5A 1TZKA 5U4QA 4HGYA 4O4IB 3ET5A 2FN8A 4PZ9A 3MM4A 4DCSA 5KCMA 1FFBA 3USES 1OB2A 1IL0A 3NQ41 3I9V6 3RF7A 2OO5C 3U3OA 4J16A 3ZWDA 6ABPA 4HDRA 1P44A 2XYPA 4BFZA 5JBQA 1UC8A 4MVJD 2HIMA 1NVUQ 1EB8A 2G0TA 2GUWA 3MS2A 5DX0A 3EX7C 1TRKA 3PQ3A 3VU3A 3DW1X 3CRNA 3CLKA 1J22A 4MJXA 4YVFA 4DA4A 3ZHXA 5BWBA 2Y0EA 3IUMA 1U3CA 3RS8A 4BLUA 4QLBA 1JTFA 1V8ZA 4CMEA 5JNTA 2ZJBA 1EZ4A 4OSPA 2JHAA 3TLXA 4EZIA 4ZIRA 5IBCA 1I32A 1DTWA 4WW0A 1JJVA 1ZUNA 2J3DA 1V2HE 3RABA 4RXUA 3D02A 1MEOA 2OB1A 3TVTA 2C9BA 2EL9A 4LKRA 4MICA 1WW8A 3V4LA 4CM6A 3JCZA 1UR5A 3HDGA 3K1AA 5EXSA 3NAMA 4PBSA 1AV6A 1WULS 1AE1A 2IYTA 1JU3A 4XQ9A 1U0EA 2PKYX 2ZAMA 3KX2A 5IS2A 1UKZA 3KJGA 4LBWA 1CR2A 4LF9B 2VDWB 1SUSA 1DHTA 4OTZA 2F8LA 3RUEA 3B2QA 5EESA 2HLDA 4OGGA 2EFCB 3GLHE 1USIA 5COAA 3J81A 1C30A 4FOLA 4FTWA 4JSYA 4OK3A 3ZZ0A 1MNQA 4E33A 4HRYA 1RHJA 2B3TA 4QTXA 1M2JA 1T4BA 1MV8A 1PG2A 5K3SA 4HUTA 1EFPA 4OL9A 4UFNA 3AWDA 5FOTA 5HFNA 2AFIA 2J0UA 2JFGA 3BG5A 3OT1B 4UUMA 4G41A 1H94A 1P72A 3C15C 5FWAA 4HVCA 4KZPA 1FMCA 1XALA 5TGDA 1QIHA 2O7NA 4M8NE 4MGEA 4E3WA 2BSAA 4C0KA 5F7ZA 3N0RA 4A7PA 3GV0A 4R51A 3LQRA 5DHUA 3PXUA 1W9HA 1VKZA 4TS1A 5A62A 2ZZKA 1BE1A 1BMFD 1C0PA 4Q03A 1U4NA 4B7AA 4EECA 4CQJA 4DUGD 4EDHA 5JARA 2CUZA 3FIJA 1TF2A 2VI5A 2WD7B 5GONF 1KY3A 3PF9A 2CFSA 3GK3A 4PXAA 4X41A 2VYVD 4GLJA 1GZUA 3PQ4A 3WJ7A 5EE9A 3NOOA 1VE5A 3V1NA 2EJUA 3EULA 3P9PA 3ZWAA 5LP1A 2YHIA 4CIDA 1X8JA 3CF2A 3FPLA 3H84A 2RGRA 3DBRA 5C37A 4IH1A 2XQFA 2WSSA 1TI7A 4AWBA 4GVPA 3GT4A 5DSZA 4E5VA 1X8XA 3TL2A 1UXJA 2F00A 2C31A 2ZPTX 1J23A 2C9CA 3GU3A 3KRTA 1XHFA 1F2DA 4GYJA 3DDWA 3M9LA 3NS7A 4BL5A 1S0UA 2X5JO 3KJNA 2OQIA 5TSDA 3TB4A 4GS5A 4MYDA 3FOAA 4MGIR 2QIOA 4DS3A 2HYIC 5KOYA 1LLDA 1QQ5A 3MCZA 1I7DA 5C34B 4G9EA 4B84A 1ZR2A 1PZXA 2W6OA 1K7EB 1L4YA 1P45A 2A9RA 1PJZA 4PSDA 1HF3A 4L95C 2WE7A 3P45A 5C52B 1E1QD 2RCNA 1VDZA 2QXYA 1IZZA 1G8GA 1Z13A 2Y1GA 3L0ZA 3MWEA 4FX5A 4OY3A 4IX9A 4RPGA 4XTRA 3LBAA 3TFOA 4D1YA 3PD0A 3M4ZA 3D3QA 5JFTA 2ETXA 1QUEA 1JIUA 2YCLA 3DL7A 4JSRA 4K3VA 2ERYA 3EC1A 3PZBA 5ALTA 3FFBA 1W93A 4IIXA 4H4EA 4CEJB 4DSAA 4YQEA 1CJVC 3ZOKA 1KSJA 3K0FB 1W4CA 2X6TA 2NYAA 1CDOA 3QA3E 1ZFNA 4KV9A 5HF8A 1H1LB 2BY4A 1RMTA 2JCVA 2GNPA 2J7PA 2IBSA 1DELA 4BOYA 3RIMA 3H2BA 3MGCA 5BN3A 5BNZA 3NJ8A 2CLLB 3PA8A 4H60A 1EINA 3NU1A 4F6RB 1M33A 3K9NA 1IAQA 3MOGA 2PVPA 5J58A 1DAFA 1OIWA 1W8IA 1T8WA 3A1SA 5TS2A 1XZKA 3BXOA 4IZOA 5E8RA 1I2CA 2WV9A 3GYGA 3ZDRA 1GT6A 1HL3A 3K16A 4MPTA 4O8ZA 5JNUA 4BFYA 1D7AA 3F9RA 2M1XA 5HRUA 4JLSA 3GJQA 3PUWA 3C98A 4OXXA 4F2WA 1II8A 3PDHA 1GV0A 4MVJA 4C20A 4DF3A 1O94C 2J4CA 3DBRB 4XQGA 2BFCB 1NJ8A 3LE8A 3M6AA 2R751 5TT0A 1NFFA 3X1DA 3U7HB 1OA1A 4HGNA 4PXSA 4S35A 3K09C 3N2YA 4QUEA 5BQOA 4F3RA 4NV3A 4IGKA 3ZHSA 5IBPA 1FK8A 2XZDA 5AKJA 5FOXA 5TVKA 1DOAA 1JR3A 1L5VA 4ZYWA 1YVRA 2IE8A 2VF7A 2DH5A 4NK4A 1L4EA 1SKUA 5KTKA 1JJ7A 2CVHA 4AMYA 3IMKA 1OC2A 2ZIAA 3LT2A 1Y81A 3ZIUA 1T9GS 1ULHA 1TAQA 3NB0A 3GPLA 1R0CA 4WZBB 5KVSA 1ULSA 5C1BA 2O8NA 1U99A 1ULZA 3S2EA 4OJNA 4PO9A 3HKEA 4BNXA 3VR4D 3DKRA 2P5UA 3AKDA 4K05A 3DEFA 4Y2XA 2W6PA 1SXGA 4G5FA 5KHAA 3HYTA 3BQ9A 1RM5A 2QD3A 3HSKA 1JN0A 3W90A 4NU8X 5KTRA 2I7TA 4JKIA 3RJ5A 3TCXB 4BU0A 3SNHA 3T7AA 2ODEA 3R4VA 3L3BA 3FPGA 1XRPA 2A14A 4B3SB 3SHWA 3EUAA 4UNNA 3D3WA 4MLZA 2JGNA 4M89A 4C08A 5ICGA 2WB4A 3L9WA 1UPAA 2PBFA 1RAFA 2YRFA 1MN6A 1VHWA 2JI8A 3IMFA 3OOYA 4GKVA 5ERXA 4DSTA 1V45E 2V55B 3O4JA 1QWOA 1JUDA 4L8WB 5A4JA 1F3OA 4Q4DA 2VWPA 2RJ3A 2LZ0A 3STWA 1COWD 4R5MA 3TR0A 3UCXA 3L7LA 1Q0UA 2GD6A 3SVZA 2BHNA 4F9GA 2NM0A 1ZVMA 5DSTA 5BVHA 1W5BA 4CLOB 2BFCA 3PGVA 1C4WA 3HA5A 1E7YA 2J0VA 2VQSA 3OQ6A 1GXSB 2TMKA 2X0KA 5C7YA 2A5GA 2NYVA 3IUEA 4GLBA 1MJNA 2AOWA 1EWVA 2GDJA 3FCXA 3L7IA 1YU9A 4I1OA 4S1OA 5E38A 1Z4NA 3A1VA 5EE0A 4DLSA 1CIJA 2ZSJA 1LBEA 1ZP6A 3FDZB 2X3UA 4KLRA 4MCHA 3HVIA 3ZWYA 5CNMA 2EDCA 4LK3A 4MK4A 2AFHA 3ZGXA 4G07A 1DBQA 1NXWA 1EP2B 2BEWB 4JT9A 3WRVA 4LCBA 3F67A 3KELA 4L22A 2HPZA 2RH9B 2JIZA 1ODJA 1OD6A 2EZ9A 2D13A 3KO8A 5EZYF 2W6MA 2XKKA 1PZMA 5IZCA 2QW8A 3DTYA 4I50B 5DHSA 4NAHA 4XIGS 4LQDA 3SX2A 4HUQA 3PHIA 3G5LA 4C03A 2NADA 2O7SA 4CHGA 1ZVKA 1RRGA 1U80A 1USVA 4PHHA 3N2LA 2QGFA 4QGFA 4C0LA 1T2FA 5SZIA 4QTUB 1NQVA 4LY3A 3AYXB 2GZRA 4OFBA 1PTKA 5TEVA 4QUHA 4LFCB 2YY7A 4QU8A 5C7OO 4DUZB 2YR0A 4BEVA 2JGLA 2D5BA 1I5OA 1Q12A 2P35A 4FFVA 4HDQB 4QULA 4U0JA 4LXTA 3FFXA 5EHIA 3IV9A 5AVTA 3F5MA 3V6MA 3DB2A 1RWKA 4HH4A 3CFYA 1KDZA 4XASA 2JZCA 1W2WB 3EGWA 3AKEA 2PNFA 1KYWA 3DEIA 3B38A 3ZGYA 3K30A 3QW2A 4XFDA 2RGNC 5DHTA 4CZ2A 4B40A 1FFEA 1UANA 2YINC 1JILA 3QYJA 4DUPA 1E20A 2QI9F 3UWPA 5BN1A 1XYYA 2X1HA 1SC4A 2R6GA 3U9SA 1DUVG 2MR6A 4Q7LA 2VF2A 4L7QA 5TQVA 1WPGA 3HR8A 4O6VA 4YJFB 1DKQA 2H7YA 2Q3HA 3OZVA 7YASA 4ZAWA 4UVDA 2JL1A 1VJTA 1KDVA 1XVVA 4CU2A 4IOJA 5KQSA 2WIAA 2Q4DA 3AEYA 3C3JA 1JU9A 3E7XA 4WWHA 2KS6A 1K4MA 3H5LA 5AK0A 1ZN7A 5EQTA 3P8ZA 4PNZA 4ENPA 1I3NA 2O0LA 2RARA 3JWEA 4OI2A 1O6GA 2B98A 2Q6LA 5EYPB 4OQYA 2QX9A 5COQA 5FPHA 4NULA 2OSVA 1VZ2A 3DTVB 3MZ0A 3VPFA 4QGGA 3JZFA 3ZY5A 4BV3A 2JKVA 4DV4B 4DA7A 1DNPA 3C1OA 4W6QA 5AVJA 2RHCA 2AHRA 1YBMA 2KI5A 3AFNA 4FQ7A 1PZEA 2DT8A 1LFDB 1GITA 1T6YA 2ZE8A 1FE8A 3ELDA 2WHEA 2Z2IA 4MYUA 1O96A 4OHRA 3MW8A 4F5YA 2C29D 3U7QA 3I9MA 1OC4A 1Z7EA 4PIVA 3WP1B 4RXTA 3TMAA 4JITA 2QIPA 3NDRA 3I62A 3N0VA 3UAGA 4DQ0A 4EB0A 1DIHA 5TQJA 4JY7A 2XKJE 4QNMA 2ZRHA 5FWXB 3WMXA 3ZWXA 1NVEA 1AX9A 2XIJA 4H3SA 4MRSA 1OXMA 1G5QA 1Q1ZA 4I9NA 5DHAA 4EZEA 4AJJA 3GFVA 4JUDX 1QVZA 3FOZA 5IXSA 5F5XA 3BS4A 3C8DA 3SU8A 4K26A 3DUFB 2VNJA 1JVBA 5K0SA 1KRXA 2CCJA 2PMBA 3V7UA 1LF5A 3S27A 3E2IA 5HKLA 4D4MA 4YDQA 1IXKA 1DJLA 4R3WA 4TRNA 1OQAA 1L5FA 2IQ5A 5G1PA 4HLQB 3TSCA 2IV7A 1Q0HA 1Y8QB 2D4HA 4ZVRA 1RJ9B 2ZJ6A 3ZK9A 1MABB 4FSDA 5EPUA 3ETNA 2BCEA 4O1MA 1SUWA 5DF1A 1H3EA 1GLVA 3K4HA 5AKEA 1H2RS 3D8UA 4XVUA 4HDCA 3LQ4A 1X1QA 5KTTA 5ARDA 3FRHA 3M49A 3NT2A 4AAYA 2WHPA 4F2HA 1WG8A 3NIFB 4B6QA 1XX6A 4A6DA 1CYDA 1C7FA 3SQNA 3FUVA 4C3UA 2Z56A 4BQOA 3LPDA 3I92A 3U9TA 1A71A 1A9XA 1ZJ5A 2XSZD 1NLYA 1X70A 3HBFA 2G5CA 2GESA 2IVFA 3GMIA 5A7FA 4F4DA 1H9BA 3HGTA 3ZDXB 1MW8X 1VG8A 1N1DA 2FWPA 1BA3A 3L1VA 3T7RA 1E2KA 1SQFA 5D2CA 1DFHA 1E6KA 2AV6A 2C0QA 5A5EA 2JFFA 1ISJA 1MQ8B 1XPOA 3MHPA 4G86A 4W1QA 3K9QO 2HK6A 3DZCA 1WMDA 1FNMA 2BGKA 1FFXB 3LY9A 1X2BA 4P35A 4LX8A 4LYJA 5ED4A 1Z37A 4DLLA 2IU0A 3QXHA 3EYAA 1A9ZA 3L7CA 3GMSA 3IDAA 3NP9A 3P4YA 1RD4A 2Q1SA 2VP0A 3H86A 3ROFA 5ALXA 1JA0A 1ESDA 1CERA 5HG0A 4MVJM 4EVIA 1N2ZA 4V2IA 3ZU4A 1Y8ZA 2J30A 4QDJA 4Y7DA 1NJ2A 4C29A 1ML4A 2DHQA 2VP4A 3KQVA 1QG0A 4UM8B 2QTVB 3I2GA 3R75A 3VSDA 2O3UA 1KYZA 1R18A 2EL7A 3TSOA 4RKEA 1KA9H 5ALLA 3G2HA 4GE3A 2EFJA 4MV0A 2V97A 3KBBA 5JSZA 3WWCA 5BMOA 3U26A 4P4SA 4DJ5X 4W6ZA 5AW0A 3AUFA 4UM9D 4HAXA 3WNZA 3C41J 2AH5A 2BLLA 2B25A 2D1FA 5E6UB 3NETA 2MCFA 5IM4A 3TUIC 3CEHA 5FNVB 5C8YB 2NU9B 1JWAB 3SY8A 4NPAA 3UJ8A 1O6FA 5DCLA 2GEFA 2RD2A 4C7VA 3PZRA 4PLVA 2IKQA 2WDZA 4DA9A 2IPOA 4Z4QA 5ILGA 3U5TA 1KP3A 4KR2A 1QC5B 2YC4C 3HKBB 4HAYA 4L5JA 4PQYA 3DXZA 1MJGM 3H9UA 2JFPA 4HMQA 1KWKA 3G2PA 2J5XA 1ADYA 1RXIA 4ZQBA 5C5CA 4RTPA 1DC4A 1C0IA 1OUMA 1UPXA 2IZ7A 3R6TA 2M9MA 2QRMA 1FZTA 2R65A 4KGXA 4HAUA 4WFKA 3Q9LA 4OOFA 4BP8A 1ZOOA 1KHHA 2RC6A 121PA 2YWDA 2VZ9A 4KN6A 1CP3A 4OB7A 3FCAA 3LX8A 2GMWA 3AI1A 3BWXA 2CYCA 4HP8A 2Y4OA 4NU0A 2KLBA 1D0SA 1F38A 3A9UA 3JSAA 4ZCRA 3NOQA 4U6QA 1MAVA 1VG0B 2OC4A 4UMEA 2OXCA 2W2MA 3GFQA 3LPNA 3N59A 4EPVA 1TUIA 4A26A 1OCEA 2WAYA 2VAWA 3E3AA 3FFTA 2LNDA 4R40A 5T3YA 1RRPA 4P6VF 1G21A 2FRVA 2VHEA 4IXMA 2DHDA 4FLEA 4P0QB 4E5UA 2AFIB 2PLAA 3SE7A 5TE9A 1D8TA 2ICAA 1OXXK 4S0XA 1E6EA 5IULC 3L40A 1NVAA 2HNAA 1K1EA 1CRLA 1N0IA 1YL7A 2VIIA 2NN3C 3L04A 4BMZA 3DLBA 4W8GA 5AXCA 1J97A 3FI0A 1OASA 4JBYA 3AY0A 2Y99A 1IBKB 2FB9A 1HUQA 2IHBA 4YRKA 2JEOA 4ZAXA 5BUQA 5LD2B 1X80A 2ZKIA 4GSLA 5EP3A 4DNPA 4RK1A 4GIBA 1J2YA 4EPRA 4AJ2A 1HNXB 2I4TA 4LYYA 3I53A 2X8LA 4XIYA 2QUKA 4QSMA 4KDCA 5TPZD 3D7SA 3U3ZA 3OZ7A 3GVHA 4F6LA 4FCVA 3PUXA 3GLHB 4EF4A 1A5ZA 5I01A 3LW7A 2E37A 3S29A 2PX5A 1A7KA 5IYZA 5IH3A 5J9FA 2AQKA 5FNVA 5C8YA 3ITKA 4X65B 4WJLA 5JS1A 1CYEA 3EF3A 5JQGA 3ZD6A 2G17A 3D2AA 1W19A 3G68A 2UZIR 4C7JA 5KOJB 1YL6A 3ZE0B 4GQBA 1ZLXA 1RS0A 1J2TA 3NIWA 1DIGA 2FR1A 3L41A 1NRIA 5ERYA 2Y27A 5B7PA 4IIBA 5ENDA 5BUSA 4BXOB 3GC6A 3IVAA 1LZLA 2W48A 4UEOA 3QX8A 1RE1A 2O1WA 3TLKA 5JTTA 1DV2A 1NBMD 2V7UA 4D81A 1BCRB 4D4KA 1JP7A 1M2WA 3EE6A 5A9SB 1XK6A 1L9KA 2W83A 5IMSA 5KTYA 1DDGA 4RVSA 5AW4A 4I99A 4AKTA 2COKA 2FE4A 2Q9CA 3DH0A 1LC3A 1HDZA 2XRYA 1HOXA 1JGTA 2YYZA 4FINA 3WGTA 3T3DA 4DA0A 2EXXA 1UXHA 3N6RA 3OZAA 4GBGA 4AICA 4PN3A 3KPWA 2AC7A 4UVGA 4WK0B 3ORQA 4JB8A 1V5IA 3CUEF 2BMFA 1G21B 3P0HA 2P40A 4WJZA 1D2AA 5CLHA 4BLRA 1I4DD 4BHTA 1QIKA 1E2LA 1IMOA 2BGTA 2C3UA 3WLKX 2ZQYA 4EA9A 3U3RA 4EI2A 2GEJA 3ZGZA 1UP6A 1UDRA 2B4YA 1TYZA 1POWA 1ULAA 2HF8A 2OBBA 1H2ZA 1ULTA 3FAKA 3O26A 4KO1S 1AMOA 1L5NA 3PX7A 2DP4E 2XNCA 3OI7A 1B0PA 4DY4A 1IQPA 1H1LA 5IW8A 2CV2A 2WNSA 3LRTA 1E92A 3H9GA 3GEPA 3IJRA 1W88A 1PR6A 1M8KA 3V55A 1RYFA 2FI1A 3TQSA 3VHQA 1PEYA 3HM9A 3SSOA 4ZVQA 4FEAA 1W7AA 5JCOC 1FLNA 4ZOQI 4HL6A 1HFKA 4Z4IA 2BI8A 1RVV1 4FFDA 1BZYA 3QTBA 4EGFA 2JH9A 4EQZA 3TKAA 4BVAA 2BGJA 3TAHA 1CNEA 2XE6A 3WSWA 4MS4B 2VF8A 2HJ9A 5DYYA 3L0IB 2ZB4A 4CF3A 5K0CA 1E2UA 2X9VA 3OHMA 4AC9A 1A9YA 3LRXA 2FPPA 3KYDA 1THMA 1Y8RA 2NSLA 3R2JA 5T5QA 4BE9A 2P78A 1QRTA 1NVWQ 2QPLA 4L8YA 3EIUA 4CKCB 4L27A 2HQSA 1HYEA 1NYTA 1UJ4A 3MWDA 2QP4A 4IMPA 3P0RA 1XJ5A 1PGOA 3AR6A 3MUEA 2I1WA 5AJZA 5D85A 3GMDA 1FSPA 2PYZA 4LW8A 4P4GA 2VNAA 1ZW1A 1Q0SA 1FSGA 2RE8A 1M8JA 4CG1A 3FM9A 4Z4FA 1WMSA 3GFOA 4H1UA 2PN1A 2XR1A 4D8WA 2WJHA 2A5YB 1OREA 3P2IA 4IDBA 3RSOA 1AKQA 1MTOA 3KT0A 4ZT2A 4EM6A 3NWPA 3OKCA 1SKYE 3EDRA 1XTQA 3SD7A 1E2JA 3G49A 4KPEC 1JECA 3RVSA 1EK0A 3C3WA 4MV6A 3K2QA 1RWQA 1UBMS 3HB1A 1A8QA 5AD1A 5FH9A 2B4QA 2DPLA 1SIUA 221PA 2OP0A 2GB4A 2AOTB 3E9MA 4YXFA 1VL8A 5F3WB 2FKAA 1JMKC 2WUFA 1KYYA 2YQ4A 2ZT8A 3TQOA 3GJ4A 5FUYA 2JJ2D 3MTQA 3I01M 4QUAA 5FPSA 1RXCA 4IILA 2F7SA 1Z63A 3LFTA 4RL4A 4D9IA 1KRWA 1QCCA 1WF3A 3JYPA 1CUCA 3ORRA 4RTQA 2FPRA 3KR0A 3KXLA 2EP8A 1MFZA 3JYQA 2EATA 2JLUA 1SBHA 4XIJA 2HJGA 3IPRA 3L1JA 4KR3A 4JOSA 1DTSA 2QJTA 1DADA 3BD6A 4ALMA 2VTVA 4NY1A 2EFGA 5IAEA 3DC7A 4Y1EA 4Z0NA 2NXEA 1R88A 1ZI9A 3IB6A 1AQUA 5F23A 4YJ3A 3CQ9A 3PRHA 4WV3A 1ZI6A 3C4QA 1Y5IA 2JATA 4LUCA 1EX9A 1GKKA 1SUFA 2MT9A 1WF6A 4BMDA 2QMQA 1XRQA 1ZH2A 4PLCA 3T5CA 3NBMA 3ND7A 1RXEA 3JQGA 1VA5A 3QYPA 4UNSA 3CLRC 4OHUA 1K92A 1D09A 1TAGA 1EG7A 4WZ6A 1PLJA 2PH5A 4M1TA 4MVYA 2FY8A 1GQFA 2QBYB 4LRQA 5E4FA 4ETMA 3WLHA 2OBFA 2FWBA 1E1MA 4X6YA 4OHYA 4B3TB 2ORVA 4M1ZA 5TQ2B 2R87A 5JD5A 4LVOA 5EIXA 3VPXA 1N2HA 1QGDA 1UKBA 1Z3IX 2YN0A 4H4DA 3A4LA 2FUCA 5F2KA 4J0QA 3I04M 3O8DA 1TJ5A 5CDFA 3BCHA 2PGOA 4V0RA 4UPEA 2E55A 3P20A 5D6OA 4F3KA 1DO0A 2VXOA 4Q9IA 4ZHQF 1YVEI 3UMMA 2GYUA 5IAJA 4FOSA 3S8EA 3WZLA 4H7FA 4MV4A 3RTCA 4CN8A 2AFRA 1AZSC 2CBGA 1PE0A 3KUUA 4UHFA 4EHJA 3SC2A 1EM8B 2E5WA 5E6SB 2I0FA 4J49A 1XDWA 4EY8A 3L7BA 1E9RA 3QITA 1Y1TA 5GONB 4UUNA 3WTCA 4CKBA 3DR5A 4QXQA 1OA0A 2Z5FA 5I7UA 1C0EA 2C04A 3MGAA 2QTGA 3STYA 4DN6A 4O4HB 3HN7A 4M22A 1WV0A 2X8AA 2M32A 4CLHA 1T10A 2B21A 4WY2A 2PTGA 3RVRA 1IRXA 4MYSA 4R8LA 1BYIA 4RHTA 3D6FA 1KVQA 1EJBA 2HMTA 1TM2A 1W30A 2O19A 4RELA 2H8GA 1YUBA 4QDZA 4HGQA 1TM7E 4YT5A 3RRYA 4ZJZA 5FEUA 4IF4A 1QFMA 1X1EA 2Q21A 2W70A 5DYIA 4FFMA 1XWWA 3H0EA 3QKSB 1Z15A 4BNMA 5ILQA 4W9MC 2UV8A 4A8HA 3ZJTA 3IE0A 3O2JA 2NUPA 3BN3A 3W5BA 2XRZA 3DE2X 3M1YA 2BGRA 1V9LA 3D6TB 2PSDA 3ZJYA 3GGJA 3CUVA 1LV8A 3DDUA 5EUMA 1LPPA 1F8YA 1L7PA 4CJXA 3ISTA 5EIEA 3KOUA 2B35A 3QPBA 5CX1A 1V96A 3BGVA 4Y2SA 2XGOA 4AF7A 3W3AA 1BX1A 1UPCA 4CQMD 4C1BA 3ER9A 3DV0B 3PKZA 4H15A 1S96A 2VLIA 1UBJS 2GD0A 5SY9A 1QGYA 4DWVA 2BM8A 1EFVB 3DM9B 3H17A 1EK2A 1CETA 2VH1A 2JI9A 1SG6A 2JBWA 3QG5A 3S70A 1N2BA 4CIBA 3A04A 3ZHOA 2CUKA 1I6WA 2H2FA 4OUDB 4UAJA 5D5HA 1JA1A 2A0UA 3FNHA 1KMQA 4RM3A 1HTTA 2V4ZA 2FUNB 3BC1A 3OQ1A 4DLZA 4JNKA 3PNBA 4F11A 1NC3A 5GVSA 1N9KA 2YBDA 5FB3A 3GVPA 3PQ6A 3VV3A 3WADA 2E85A 5IMBA 3ZD9A 3L4KA 1Z34A 3B3AA 3I12A 3D7MA 3A0UA 3M6FA 5K0NA 3PI7A 4EDFA 4OL0A 2W2LA 4LNUB 1ZJ6A 4S1PA 2VHTA 3M6UA 3S0JA 4UARA 3TSWA 1M8FA 2FF5A 4LIPD 2C7GA 2KBEA 3QUSA 3ROEA 4WHMA 4IUCS 1NBME 5DBFA 3DLTA 3GNSA 1GAXA 4IOMA 4C89A 3SLKA 2OZLB 3I5YA 4DB4A 3G89A 4J6FA 2GN8A 4TV8F 2YJTD 1UDXA 5BNTA 2V7QA 3ZVLA 3PBKA 4PTYA 3UAWA 4URZR 3ZQ4A 4RIIA 3N8NA 1N0UA 1XVAA 2ILTA 5IKPA 1CB7A 1A9QA 3ZZMA 1CJBA 2WR8A 3QKRA 2QN6A 2FDCA 1LBQA 1RADA 4DLKA 3AW8A 3E9QA 4GZ3A 1TYAE 4AXBA 1Q3TA 4M9XA 3KKLA 1HEUA 3W5DA 4OHVA 3SS7X 1WB6A 2C1ZA 4L5YA 1E79A 4QUIA 1Z5VA 4TUYF 4ZO8A 2B4KA 4YQZA 1E3IA 2ADFA 2AUTA 3GEGA 3ML1A 3RG8A 2C77A 1OBVA 3PEEA 2WUVA 3W3AH 2ZU0C 3BB1A 3H5AA 3AMVA 2V54A 1OYWA 1JDUA 4QOIA 3UATA 1UQUA 2YZ2A 2O8BA 4XX1A 2A9OA 3QMMA 4WKGA 5HOQA 4JUIA 4RV4A 4TXJA 1Q3HA 3FTFA 3TUJC 3P0EA 3HJFA 3KE8A 1OWOA 5FTMA 2ES4A 4R1TA 3U4QA 2EBHX 4RPHA 2Z1MA 4TS4A 2C7BA 3FHCB 3T7SA 1VJ5A 3BJEA 2ZJYA 3M6WA 4PSKA 5FHRA