The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
224
|
Knots found |
|
sequence length |
652
|
structure length |
620
|
Chain Sequence |
DRFELVKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Damage detection by the UvrABC pathway: crystal structure of UvrB bound to fluorescein-adducted DNA
pubmed doi rcsb |
molecule tags |
Hydrolase/dna
|
source organism |
Bacillus subtilis
|
molecule keywords |
5'-D(P*TP*TP*TP*TP*T)-3'
|
total genus |
224
|
structure length |
620
|
sequence length |
652
|
other databases |
KnotProt 2.0: Artifct K 41
|
ec nomenclature |
ec
3.1.-.-: |
pdb deposition date | 2006-10-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00271 | Helicase_C | Helicase conserved C-terminal domain |
A | PF02151 | UVR | UvrB/uvrC motif |
A | PF04851 | ResIII | Type III restriction enzyme, res subunit |
A | PF12344 | UvrB | Ultra-violet resistance protein B |
A | PF17757 | UvrB_inter | UvrB interaction domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Penicillin-binding protein 1b fold | Penicillin-binding protein 1b domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |