2NMVA

Damage detection by the uvrabc pathway: crystal structure of uvrb bound to fluorescein-adducted dna
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
Knots found
sequence length
652
structure length
620
Chain Sequence
b'DRFELVKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Damage detection by the UvrABC pathway: crystal structure of UvrB bound to fluorescein-adducted DNA
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
total genus 224
structure length 620
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2nmvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA01
2JJ1A 4JL5A 1ZIPA 3LW7A 5FUXA 1S0UA 3ICEA 2W58A 5TDHA 4HAYA 3FYHA 1OKKD 2FSGA 4MA4A 4BLOA 4F92B 4LI0A 4IFBA 1DVRA 1SXJC 2WJHA 4Q19A 1FQJA 521PA 3FWLA 1KI8A 1QDEA 4Y0AA 3U3JA 5J4HA 1MV5A 5L3QB 2CL0X 5SZHB 2J3EA 4WZAE 3WP1B 2JASA 3EZ6A 4D2IA 1CR1A 4JJZA 4G5OA 4LCBA 3HJHA 2ZRMA 4V0ME 4B43A 3SQWA 3Q72A 4FCVA 4XSGA 4DLZA 4QHTA 2EW1A 2BV3A 4UNQA 2G6BA 2OEPA 1GWNA 1YU9A 1KDRA 2GZDA 3MUFA 2HXSA 3FHOA 3QXJA 3WNDA 4A2WA 5EZ5A 4RD1A 1J2JA 4W9MC 2XB4A 2GCOA 1UM8A 1JALA 1P62B 1ZU4A 4EIWA 1YRBA 1OYYA 2H16A 1GG2A 1UDXA 2NG1A 1N0UA 2ZRGA 3CRVA 2JJ2A 3KB1A 4KV9A 4Q9KA 2R6FA 3OHMA 4PQFA 3AF3A 4WXRA 4B3CA 2IWHA 3IIJA 4WAUA 3N70A 4LHVA 4NCIA 1G3MA 1T4GA 1QHHA 2ZYVX 3QXXA 5EQTA 5EP3A 2R6CA 2YZ2A 4B44A 3V9PA 5FI0B 3SJZA 2QL6A 1JJVA 4OQNA 3V4FA 1W0KD 4V0KA 5JZVA 2F6RA 4PSKA 1T3LA 1KO1A 1LS6A 3Q85A 2IA5A 3AVXA 3CX7A 5GVRA 1ANKA 2ZJ8A 3BC1A 2H57A 4NCKA 5FOUA 1E9CA 3VX4A 1RFLA 1EXMA 4F4JA 5CIQA 2OLKA 5EJEA 1JAIA 3SJAA 1E9DA 2CHGA 1T0HB 4FW9A 3VKWA 2QAGB 3EC2A 1FX0B 4TL7A 2D74A 1LF0A 1KAOA 3NIBA 2XXAA 4EPXA 1OT3A 3CX8A 3JZMA 5F9HA 1N0WA 3LLMA 5LB2A 1QBKC 1XDBA 1AS3A 4BFVA 1ZIOA 4HUQA 3G82C 4O25A 2QPAA 3LBIA 1U2RA 1PJRA 2OBMA 1SXJB 2B92A 1T3HA 2QM7A 1F2TA 4A9AA 4V0MA 4FMDF 3ZD7A 5DNYB 1ZNYA 3WYAA 2RHMA 2ZI4A 4ZIRA 4G0NA 2GVZC 4DSUA 1ZD9A 2QZ4A 3KUDA 3C5HA 2RAPA 2ZJAA 2HF9A 2ZRJA 5FUYA 1E2JA 2IYWA 5J40A 2OUKA 4JLNA 1AS0A 2O0KA 1G5TA 2V6JA 3TUIC 4DEYA 1LTQA 1UEJA 3OE7A 3K0SA 1CLUA 2OT3B 3BBPA 1UAAA 4URVR 3FPNB 2W6JA 2SHKA 3VU9A 3B1XA 3WY9A 3TK1A 3V4RA 1Q22A 2JLZA 3GJ3A 3H84A 3HR7A 4CT4B 1SKQA 2GXQA 4GOJA 2WAYA 3B6EA 5DI3B 5GVSA 1KI2A 2NTYC 1OF1A 1S2MA 2WWGA 3U4QA 1JBKA 1G3IA 3UWKA 2W2TA 4N1AA 2ZS8A 4BLQA 1PUIA 5KSPA 4HLCA 3ZZUA 3OEHD 4QNMA 3RWMB 4DHEA 1SVMA 4WBSA 2GVDC 2HXYA 2VQSA 2ZR0A 3DEFA 4KLNA 2WPDA 3TRFA 5DIFA 3TUJC 1Q57A 2C8VA 1QF9A 4GP6A 3IPYA 4OI4A 1ZNZA 1OE0A 3CRRA 4M1KA 3THWB 2P0EA 1OKKA 1Q1QA 2QT0A 2XNDA 3QXHA 5JSZA 4KVAA 1VYUA 4GMXA 2GEDA 4YLGA 4P31A 5FOXA 1OH6A 4FIDA 3IUYA 5CLLA 1SVOA 1KDTA 5FPSA 5DHAA 4AYTA 5GADl 1Z8FA 2F1IA 4A2PA 4AKIA 4A0HA 4LRWA 4F4IA 4GZLA 1X86B 2CVFA 5CJPA 4MUBA 4QG7A 4BLSA 2DPXA 3PVSA 5FUVA 4TMVA 4DDTA 4JVSB 2FZ4A 1Z6TA 3GP8A 2QORA 3TJZA 2AKAB 1NLZA 4BLTA 5FPHA 4OI2A 2J1LA 3GJ0A 1KKMA 1R5OA 2RMKA 2ATVA 3EPKA 1IY1A 2GJ9A 1NG1A 3CW2A 1J70A 4HAXA 2ZJYA 1XZQA 4TYWA 3NXSA 1TQ2A 3P4YA 2RKOA 3PFIA 5TMPA 3BH7A 1GM5A 2LKCA 1W36B 3W90A 1ETUA 1WE2A 3U7FB 1OLOA 1UKVY 4HZUA 2Q3FA 3AQ4A 4ON9A 2W0SA 4PHHA 2PZEA 4P0TA 2OCPA 5KU1A 3BFKA 5CK4A 4NCJA 4DCUA 4CEHA 3QF7A 1HH4A 1XCMA 4RKFA 2AWOA 3NH9A 2ZROA 4KSCA 3D6TB 2I1VB 2JLRA 1I4LD 1V43A 4RCYA 4OHWA 4W5HA 4TN1A 1U90A 3Q5EA 2ODNA 3RS0A 4HB4A 4PFSA 1KKLA 3C41J 4OBEA 2QBYA 3G0HA 2KI5A 2QRZA 5FTLA 2O8BB 1WBBA 3AKCA 1E1RA 1BH2A 3IGFA 4HEJA 1PZNA 3VQTA 1KZGB 2IF2A 1UBEA 2YC2C 4QBFA 3KUCA 4KI0A 4N0EA 2QA5A 3QG1A 5BWMA 1XTQA 3MSXA 4B3FX 4C0QC 1U0LA 3SHWA 821PA 2NZJA 4Q7JB 3SR0A 4D80A 1DEKA 1EFTA 3LBHA 1K5GA 1YR9A 1VYTA 3QKTA 4P4SA 4IJMA 3KKOA 1U8YA 5E7JA 3KJIA 5CIWA 2ZXUA 2YNMA 3BWDD 3N2EA 1JB1A 4W5WA 2AXPA 3NBYC 4V0LA 3FPAA 1R0WA 4JL6A 4DKXA 4B3DA 3OIYA 3HYRA 2QP4A 4A8JB 1EFHA 4CGZA 2IYZA 3B1ZA 4FD2A 1YHNA 4NPHA 2NO6A 4G01B 4PR0A 4OHVA 4B75A 5E7IA 4C3ZA 4X8MA 5FOSA 1GUAA 2J7KA 4IFEA 2WICA 2ZU6A 2CBZA 1RW4A 3TQFA 1DAMA 3R7WB 1WRBA 4E09A 1E94E 2JDIA 4TL6A 3IEVA 4P32A 1XTSA 2WAXA 2GCPA 2V7QA 1HQYE 2I3BA 2FFBA 4LV5B 1EX7A 5BYJA 2QUZA 3UMRA 3QBVA 2CCJA 3CR7A 5KDOA 1EG7A 2J7PD 1WXQA 3MD0A 3O47A 1MKYA 1TF2A 5BQ5A 5CYOA 3SFZA 3GEIA 1GL7A 5FL3A 2HUPA 3LX8A 3TIFA 1G18A 1K6MA 2QTVB 5JBQA 3R8FA 1X1SA 3GJ7A 3TSOA 2P6RA 1D2MA 2FPMA 2MMGA 2HDNB 1L8QA 4CIDA 1KK1A 3Q5DA 4KBFA 2YHSA 4C30A 3THXB 1LF5A 3WBKA 1NP6A 2CNWD 1Q1ZA 1XTJA 2YWFA 1A7JA 3EC1A 2G3YA 4Z8XA 1Z0AA 3EA5A 2H5EA 1N6HA 3EZ9A 4RZ3A 2WZQA 5K8LA 3LH5A 2BMEA 3ZQJA 4M9QA 4MKIA 2BBTA 4DCTA 1EESA 4B34A 4JSYA 4ILEA 2CLSA 3S1AA 3AVTA 2C2HA 3KTAA 1W4RA 2VP9A 3TW8B 1D9XA 2YWHA 1Z63A 2P2LA 1ZCBA 4ZDWA 4C0HA 4NYMR 4PC7A 4WZ6A 5TARA 2O8FB 1SVKA 3THOA 1QHSA 2ZRPA 4M9SA 3FB4A 2QEQA 3QJYA 1FOEB 3MFYA 4X8OA 4IDPA 1DELA 3GLFB 5ELXA 4RY2A 1E9BA 1SQ5A 3LDAA 2E9SA 3BB4A 1OIVA 1VHLA 1Q1BA 4KSBA 3EAQA 2ZUDA 4R2IA 1TU3A 4DLYA 2C9OA 2UZ3A 3Q3JB 3TSWA 4E5UA 2GDJA 1W48A 3W5JA 1OPXA 2WSSA 1W0JD 2QE7D 1P73A 2NO0A 4U02A 3B9QA 1KY3A 1IJEA 4Z1MA 1CJMA 4M1SA 4MKGA 5DN6A 2CMKA 1HYQA 1R6BX 4B74A 1NBME 3DKVA 1NVVR 3KL4A 3L8ZA 1RZ3A 2VEDA 3JZAA 1CULC 4RVCA 3RLFA 4Q48A 3I8XA 4D0GA 2IYSA 2GJSA 1Z0IA 3DPUA 4Q7MB 4HAUA 1Z3IX 2GHIA 1XU4A 1GITA 2G0TA 3WHLA 2HYIC 5EUQB 3DMNA 2FPKA 3EPHA 3EIHA 2JGNA 3CWQA 3EPJA 2XNSA 4EJSB 3A1SA 4XSHA 2J0VA 1HV8A 2Z4SA 3H4MA 2OHFA 1IXRC 1VCOA 4LC1A 4D4KA 3A58B 4ZI2A 1EGAA 2ZIAA 1N6OA 5TVKA 3C15C 3PUWA 2C98A 3IDQA 2XOKA 2QMHA 3L43A 3AM1A 1P4SA 1P7CA 3A1WA 4UNNA 4TQ9A 1GL6A 3ZYCA 1G1MA 4OJQA 3ZVRA 3KKPA 3X1YA 4TSFA 3I92A 5D3MB 3RSLA 3I8SA 3L0PA 3PV0A 4OJKA 3U60B 3RRNA 4B47A 1U98A 2QP9X 721PA 5M04A 1E2MA 3KJGA 1R5BA 4ASUD 4BLPA 2CJWB 3J81k 3OF5A 1DADA 4LYFA 2EU8A 4O0MA 1P61B 1GP2A 3SC3A 1U8AA 1E2PA 4BZQA 1HA3A 2OFWA 3SN6A 3DOEA 1T91A 3EASA 4URZR 2EFGA 3T35A 4B3XA 4DB2A 2IEYA 1E9RA 4X8LA 1I2MA 1T5IA 3M4YA 1YZTA 5AWFC 1IN7A 3P20A 1E79D 1IXSB 1YKSA 3MJRA 4TT3A 1OH5A 1KNXA 2QPOA 5IF9A 1VKJA 4Q4JA 2B21A 4NYJR 4EPYA 1EK0A 1NBMA 2HT1A 2FF7A 1CKEA 4XD7A 4KFSA 1WCV1 1OXXK 1ZM7A 2QPTA 2P5SA 5L3VA 2EFCB 1PLLA 2YWEA 1UEIA 2W83A 3LVQE 1FP6A 5EE1A 5JI2E 2ZUCA 3GPLA 2JAQA 1W2HA 4BFTA 1FNNA 4HUTA 1VPLA 2FG5A 3C4JA 5SZJA 2A5JA 2C95A 2O0HA 3HWSA 1KK2A 4QHSA 4LHYA 3IQWA 1P9WA 2RGXA 1Q12A 3I4LA 4HB2A 1GNQA 1E96A 1ZM3A 4NP6A 3PQCA 3CB4A 5FTMA 4XVUA 3QSYA 3KQUA 1KDOA 2OAP1 3FKQA 5L3SB 4PHTA 1QRAA 2JCSA 2ZE7A 3VTKA 3K9NA 3U2QA 3U7HB 1DARA 1VIAA 3E70C 4A15A 3BD9A 3GJXC 3PUZA 4TL8A 4KYIB 3SEAA 1OFIA 4LJAA 3CF6R 1X8JA 3K70B 4D4JA 2X77A 1ODFA 3BB1A 4LJ7A 3SNHA 2FWRA 2PX3A 3FMOB 1KYIA 2V4ZA 3QEJA 3QUSA 3QKSA 4A6PA 1YR7A 4MH0R 2ZI9A 2X19A 1NRJB 4CEIA 1G8YA 1CRQA 4G5QA 5FBQB 3UIEA 1E4YA 4JIMA 3LVRE 2NOAA 2F7SA 2H7VA 1KY2A 3OAAA 3QXSA 4P3YA 3QY0A 3AVPA 2QU8A 3AVQA 3VHXA 4IRUB 2FDCA 3UG6A 1E0KA 1KMHB 1DO0A 3X1WA 5L8VA 2D06A 1OFHA 3H2YA 2J0QA 1RC8A 1XD8A 2WBLC 2R6DA 3SOPA 1EFRD 1COWD 1R0YA 2WMNB 2HLDA 3HU1A 3KXKA 2OBLA 4LJ6A 2BMDA 5JJLA 3AP2A 3PIRA 3FE2A 1Z0FA 2B8TA 4HYYA 4MYCA 2V3CC 4TMTA 5K8IA 4B3GA 3DVLA 4CZ2A 4UJ3A 5LD2B 3U44A 1W5TA 1H65A 2WIAA 3O8RA 5J5CA 2Q6TA 3T5DA 3TQCA 1R5NA 2JJ8A 1XEFA 2QGNA 2D7CA 3SJBA 5C1BA 4QHYA 5DISB 4F7WA 4A2QA 2BCJQ 5EXXA 3WNCA 3KFVA 4I81A 2ZEJA 5FOTA 3M6AA 3QNUA 4AC9A 3MG9A 1OV4A 1C4OA 3EW9A 3P4XA 3SE0A 4E22A 2FSHA 3KKNA 4BFSA 5FH9A 3IKJA 3I32A 4P33A 3W3AA 1ZM4A 4DUGA 4QKQA 3ADCA 2CCKA 5KSOA 3RS7A 1AA9A 1TEXA 3KKMA 3BAFA 4KHZA 5FPTA 5E3HA 3FKSA 3QXCA 3B78A 3THYA 1HT1E 5C46F 2RHDA 4HB0A 1G64A 2IHBA 3QF4A 4BWYA 1QG2A 1VCNA 4TZ0A 1II0A 3LFUA 2ANCA 3AUYA 4B73A 3K1JA 3K0FA 4AYXA 4JVMA 1W5SA 3K9LA 1G7SA 1E2LA 1E9AA 4QGGA 4URWR 3MGCA 5H1YA 3SHFA 4ZKDA 5TY0A 1BYUA 4Q1FA 3GLHE 4OI0A 3RANA 2OESA 2BJWA 2GA8A 3C14C 4UXJA 1R7RA 5HKKA 5KYKA 4DB4A 4V03A 4ZDKA 3RC8A 1S1MA 4HAWA 1NNEA 1E79A 1J90A 1KO4A 2ZSDA 5IK2D 3X1ZA 2HT6A 4G5RA 4MKFA 3K9GA 5HPYB 4MITA 4OQXA 1A1VA 4TMZA 4GZMA 4MYUA 2ZYUX 1GRQA 2J0UA 3C5CA 1MOZA 1FMLA 2ZRAA 3OIUA 4RD3A 2GCOB 2HYDA 5EP4A 4HAZA 4BZPA 2YKGA 2ZSAA 1XTRA 4KODA 1TF7A 2ONKA 4L16A 3WMFA 2XAUA 2CLCX 1G4UR 1T8TA 2WJJA 2ZRFA 3ND8A 2FJUA 4TLCA 1P2TA 1AZTA 3QVVA 5HE8A 5KHOC 1SXJD 1N6NA 3FGNA 4OQLA 4EUNA 4RKEA 4ERNA 1GKIA 2I1QA 1GOTA 1QZXA 3CRMA 3K0AA 1U8ZA 1NN5A 4LUCA 2QNRA 4MKHA 4KFUA 2DB3A 2KWIA 1QHHB 3LBNA 1FNMA 4J0QA 4QC2A 2XSZA 2YINC 3ZIAD 1XX6A 3FMPB 5JWOA 2V8OA 4A0GA 1HE8B 4IVRA 1J8MF 1G3QA 4ITRC 1A5TA 1D2NA 4L9SA 5G3ZA 5FOVA 2D3WA 3LW8A 1MO5A 3OEED 3PUYA 4NYIQ 4OYHA 5KPDA 2ORIA 2GESA 3KX2A 3QPWA 4X8HA 4D6PA 2AFHE 1RYHA 4M0LA 2GJAA 1FZQA 1R0ZA 2ZYWX 2PL3A 3IBYA 1G5RA 3WNBA 4B6EA 4ACAA 4UQOA 4LDJA 1S3SA 5HZHA 2QP3A 4K8OA 2J45A 1DAFA 2AXNA 3D3QA 2ZU0C 4LSGA 2WWYA 2F55A 2XXAB 1UADA 1N5JA 1H8ED 3PEWA 4I1OA 2W6IA 3GLHA 3EZFA 2BM0A 1S8FA 2H17A 4HUQB 4DJTA 2OM2A 4RFSA 3CPHA 3LLUA 1XD9A 1TQDA 1OXTA 4Q4HA 1TQ4A 3CF2A 4MRRA 4YC7A 1G8GA 3P27A 1DAKA 4XVRA 4ZIRB 1IN5A 1OW3B 4XWAA 4NBSA 3RNLA 1SKYE 1UF9A 1A2BA 2YOHA 2PCJA 4HSEA 2ZITA 2EWVA 5J4LA 4GT1A 4QJ5A 4D81A 1KI4A 1IQPA 1XEWX 4DLUA 5G41A 1WMSA 1KI6A 1Z6AA 3MCAA 4JLMA 4PPNA 4Q7LA 1RYFA 3E2IA 1CEEA 3CONA 1PLKA 3VU9B 2C03A 1Z08A 2QSZA 1ELOA 2QGZA 1CJKC 5FL7A 3ZDQA 2NZ8A 1AKEA 3IO3A 1H8HD 3QENA 2XJ9A 2IYQA 4NCNA 4ZI3A 2ZRLA 2BC9A 1P2SA 1D5CA 1E2DA 1IAQA 4PC6A 1MO4A 2QN6A 3NEYA 3U4QB 1Z0JA 3B60A 2REXB 2C96A 2IC5A 4BPBA 3SQXA 1CXZA 4JSTA 5BN3A 4BRWA 4GPTA 1ZJ6A 1QHXA 5HE9A 1FQKA 3GLGE 1NF3A 2AL7A 4AKEA 1DG3A 3V00A 2XJ4A 1KZ7B 3CKLA 4QFMA 4KU4A 5KPJA 1Z29A 2XB2A 1N5LA 1G8FA 3TUZC 4FMCB 1W36D 2GZAA 1US8B 5JECA 2B7BA 3AKDA 5JSZB 1HEIA 1I4TD 4RD6A 2QROA 2PX0A 4UNSA 3SYKA 2P6UA 3VNVA 2FU5C 1Z47A 1E2QA 4UKDA 2J87A 2WKPA 3SBDA 1X3SA 3N2IA 3W5IA 1ZCAA 4I99A 3GFPA 3TH5A 1XJ0A 4AY2A 2B7CA 4JMPA 1WA5A 1IXZA 3HJNA 4LWZA 4MRSA 2QRNA 2BBSA 4P4TA 1I2DA 1RE0A 1D6JA 4JLKA 1R10A 1ZD8A 1ZVQA 4KCGA 2FNAA 3F8TA 4IOKA 2R9VA 4EPWA 2O8EA 3BERA 3VX3A 1G21E 1JECA 3ZQ6A 5GJVC 4C0KA 4TL9A 5CM8B 5K8TA 4DCNA 1A82A 1DAHA 1QHNA 4HI0E 1X8LA 1M6NA 4KJZA 2A5GA 3RHFA 1DOAA 5EXPA 3AV0B 3NC1C 1G7CA 1ZAKA 3T1TA 1HY3A 1OXVA 3FTQA 1E32A 2YVUA 1NSFA 1TAGA 3T1OA 1S4QA 2HV8A 3B1YA 5EE3A 2QMUA 5EP2A 2GF0A 1RRFA 2NGRA 4TLBA 1Q1EA 5LDDC 1UKZA 2VHJA 5B57C 4OK5A 1XZPA 1YE8A 3QE0A 2XITA 2IWRA 2V6IA 5KSZA 1LS1A 3B1WA 4B76A 2IS4A 1QHIA 1IN6A 4BFWA 2WWWA 1E2FA 5AJWA 2FV8A 1E99A 3U6BA 3IQXA 3T15A 2V1UA 2YC4C 4DIEA 5J4VA 4ZCMA 5CK5A 1TTTA 2FSIA 3GLGA 2CDNA 4LBZA 1G3UA 4U5XA 2YOGA 5JWHA 1XMVA 2ODBA 1Z07A 1ZYUA 2HJVA 5DI3A 4JKYA 3GLIE 1YZQA 2BMJA 5FR1A 1M7HA 1D9ZA 2IS2A 2JIZD 1R4AA 1OIXA 5EZ6B 2OBNA 2FFAA 3ZD6A 3AP1A 3R8CA 3H1TA 1QVRA 3P1JA 4DC9A 3KQKA 2QBYB 3TLXA 3QBTA 4DWJA 4JLAA 1RVDA 3WMEA 4US1R 1P60A 4TYNA 5EXTA 3TVTA 3VR4A 1L2TA 4A0RA 5JS7A 1U0HC 1NVUQ 1W0KA 4FINA 4TQAA 4KITB 4DCSA 2K5UA 1XWIA 3PEUA 4US2R 2IL1A 3UKDA 4A36A 3ZLJA 1Q3TA 3T12A 2BM1A 5E7MA 5IRCD 2B6HA 3TAHA 2CE2X 1OXSC 1NIJA 1II8A 4YMTA 2BEJA 2IYVA 4ESHA 1NI3A 4IDHA 4NH0A 5BXQC 3LD9A 4MYTA 4E03A 1CBUA 3WRXC 4MDFA 1JJ7A 5AJZA 2FH5B 4PZZA 2G88A 5LPNA 4ZCLA 1VG1A 3DM9B 2QY9A 1HT2E 3QKUA 2RH5A 3O8DA 2JLWA 1KO8A 2GXSA 2VP4A 1LY1A 2WWHA 4Q01A 1ZUHA 4TTQA 2GJ8A 4IOMA 3U3RA 1XBTA 5FI1B 3HR8A 4G5GA 1E3MA 4LPSA 1WDTA 3DMDA 2IXEA 3DOFA 1B23P 2BOVA 1NJGA 1GIAA 3RYTC 3AEZA 1VTKA 4C4PA 4KO8A 1BOFA 1GL9B 3MJHA 3OZXA 1S9DA 1II9A 3EZ7A 1S3GA 2YYZA 2C78A 3HP1A 3IEUA 4ZV4A 3SYLA 1Q20A 1LV7A 5FPKA 2H18A 2OFXA 3GLIA 3MWJA 4HLQB 4JLDA 4M4SA 1VIYA 3N5CA 1YR6A 3ZZ0A 2ZAOA 4HDCA 3GCGA 4PANA 1IY2A 3UMSA 4ZCIA 3DL0A 3AF4A 2CHQA 5IT5A 2WTUA 2JLUA 1PUJA 1JNYA 2VIIA 4O3MA 2QQEA 5AUQA 4D82A 1XXHB 4ESVA 3OFND 3NTUA 5HCNA 4YMVA 1RRCA 1U9IC 3OEHA 3S1AB 1UJ2A 4GFDA 1KI1A 2VP5A 3KTAB 5JLJA 4HAVA 2GBLA 2C5LA 4QRHA 1R0XA 4PAQA 2WOOA 1R8SA 1IY0A 1E2HA 1OB5A 1P9NA 5FPYA 5JHGB 2O8BA 4K46A 1E6CA 2FX3A 4RD2A 4Q1BA 1DS6A 4AKHA 3GJ4A 3VR5A 1VG8A 1OFTA 1XJQA 4LYHA 3T61A 3VR1A 1OHHD 3LQQA 3AVOA 2MMCA 4RD0A 5DSZA 4DT1A 3G5UA 2XTNA 3W8RA 4C7OA 2O8DA 2A5YB 3ZGXA 3NKVA 3I5XA 4QM6A 2G77B 1L4UA 1G17A 1G20E 2HCJB 2VH5R 4V0NA 2DFTA 1SVIA 1SVLA 4RJLA 2CK3D 2RGAA 1TU4A 4NONA 1MT0A 4JBXA 1G8HA 4UNPA 3BXZA 4QOSA 4W7SA 1SVSA 3U3MA 1KK3A 5D3QA 1P3JA 1YVDA 2JIZA 3L0OA 3P32A 2JLXA 5JHHB 1E4VA 2XZPA 4V0OA 2Z6VA 4HLUC 3TNFA 4EPVA 3RWOA 3I1FA 2ZJBA 5JI3E 2IXGA 1MABB 2Z43A 1G3RA 2NMVA 3AVUA 2YJTD 3B85A 2NQ2C 3BOSA 1CJVC 4FMCF 1JR6A 1XF9A 2IYLD 4LY6A 1JR3D 1X1RA 2JLYA 1N5KA 3LA6A 3ECCA 4RCZA 1YZUA 3W34A 4D0NA 1XCPA 2ORWA 1GRRA 4LYJA 1TL7C 2ZR7A 2AR7A 2OCYC 3AF1A 4W5JA 3BJIC 3CPJB 4CT5A 5KTYA 3HPQA 4N0DA 5AJXA 2BMFA 2FOLA 1D2EA 1NL3A 1ONBA 2G1JA 5UKDA 4OI1A 4GL2A 3AUXA 3JVUA 1MO3A 2G83A 1KI7A 4L8GA 1FUUA 3AF0A 1P72A 1W4BA 4BUJA 2Y8EA 4I1SA 1XPUA 2VSOA 1S1CA 1MRNA 2Z0MA 4RZXA 3K70D 3BIFA 2ZUBA 4S35A 1HUQA 4Q5IA 4U00A 3MRSA 2WJGA 1OIWA 4PC3A 5FBWB 3UANA 3Q8XB 3SS8A 2WWXA 3UK6A 4Q4JB 4E07A 3UXMA 1T3SA 4XWKA 2VSFA 2ZRHA 4JLVA 1XP8A 1VECA 2QQ0A 3C7KA 1G9XA 1G4AE 2A5FA 4M53A 4QBHA 1AGPA 3CH5A 4AURA 1U9IA 5B64A 1G19A 1NY6A 1AM4D 4CEJA 2QTFA 5B30A 3DM5A 4QNRA 4XIGS 1NVWQ 3TBKA 4XTCS 3A4NA 1N3BA 4OK3A 4A82A 3I3SR 3K8YA 2W00A 621PA 3EG5A 2ZJOA 5AJYA 3I61A 1EFUA 2Z5FA 3KZ1E 3NHBA 4I4LA 2GETA 4PHGA 4XH9B 2RB4A 1JEEA 1ESNA 2KBEA 2Q3HA 5JJIA 3OFNA 3FVQA 3T1QA 4AI6A 1KJWA 1XMIA 2ZRIA 1HURA 1BKDR 2ODEA 1N6PA 3F5FA 5CDFE 4YMUA 2OO7A 1CU1A 4DDUA 3KXIA 2J7PA 4HLDA 1P5ZB 1UKEA 3ADKA 2C77A 2BDTA 3L2OB 3ONWA 2GAAA 2J9RA 2FSFA 4JL8A 4YMSA 1F2UB 3A6PC 1KOFA 1EX6A 2OSBA 3BS4A 4ARZA 3QKSB 2VSXA 1N5IA 2FN4A 2Q21A 3NBFA 2IW3A 2ERXA 2WKQA 4Q4LA 4DEXA 2JLVA 5G40A 1KGDA 4IDOA 3X1XA 2JLQA 2WJVA 4M1OA 1NMZA 4XVQA 2ZRCA 2UZIR 4CEIB 3GJ5A 2KB0A 1ZD1A 1ZMXA 2XZLA 1JEDA 5FTNA 4D26A 5H68A 5C18A 1T0JB 1OHHA 2CNWA 1E2NA 3R20A 1YZKA 2VF7A 4FN5A 4JLBA 2C99A 3WRYC 1GZSA 1MR3F 4QJ3A 3EIEA 4OHZA 5IHPA 4G3XA 3D31A 2AK2A 4HLUA 2IHYA 4R71A 4PZLA 4NDZA 3RS3A 2BIFA 2QMEA 2VHUA 4Q03A 4TQUS 2A78A 3IHWA 4AKGA 2A7QA 1R8QA 1XEXA 3WP0A 2VTKA 3NDPA 4WW0A 5KDLA 5AUPB 2IYXA 2JLSA 1RJ9A 4Q66C 1G6OA 3AP3A 3VFDA 2Q9AA 2BHRA 3U44B 2Z4RA 5BN4A 4NU0A 1P9RA 2JEOA 4ZKEA 5FBRB 2R62A 5B2ZA 3ZVMA 1BYIA 2F43A 2LWIA 2DFKB 1ZBDA 3CNLA 1E2GA 4MQBA 4Z51A 3IHLA 2D2EA 2BVNA 2DYKA 5EE9A 2REOA 4Q4AA 1N6IA 4WXPA 3W6OA 2VHQA 2ATXA 1F6BA 4PSVA 4Q9HA 4D4MA 2X1VA 1W0JA 2QE7A 2ZSEA 3OIVA 3DHWC 2GEVA 3PXGA 4H9GA 3GD7A 2WV9A 3ZJYA 1JR3A 3CRQA 2RGEA 4QGFA 5CDFA 1EFCA 2IUSA 3THYB 4WOPA 1XMSA 4GP7A 4C2UA 2ZVPX 3QF4B 1C9KA 5FOWA 3QKRA 1Z0KA 4M1YA 3RAPR 3CF0A 2WSMA 4GRAA 3ZZTA 2XGJA 3TSZA 2CL7X 3LY5A 1Q21A 4A0FA 2NO9A 3VAAA 1W1WA 4MUAA 1E9FA 2QENA 3FDIA 1K8RA 1GVNB 2O52A 1F60A 2PEYA 2D7DA 1S96A 5C2JB 3FOZA 4IOLA 2ZRDA 1XEWY 4MGZR 5TB5A 4JT4A 4BRUA 1DAEA 1KAGA 4IVPA 2R6AA 5FR2A 4B48A 4LPKA 1DAIA 3DZ8A 4TMXA 2PT5A 3ADBA 1DAGA 2AD1A 2FEOA 1FTSA 3K53A 4QGAA 4LJ4A 4YMWA 4II7A 4RZ2A 1NN1A 1MO6A 4EDHA 1N25A 2F9LA 2O5VA 3FWYA 3HU2A 2J0UB 4M21A 1KJYA 2IXFA 2ZR9A 4PC1A 4DDWA 1QG4A 1LFDB 3AH8A 4PAOA 1NG9A 4ASUA 1W4AA 1JQJC 4Q9IA 1N6RA 2WJIA 3HU3A 1NLFA 1AQYA 3R9WA 1AQUA 3I62A 1HTWA 1SHZA 4EQ6A 2ECKA 2ZRKA 4JVNA 2J41A 4MGKR 4PO1A 4DSTA 3K0AB 3PENA 4B33A 4JBYA 4AG6A 4IXNA 2F3RA 1GNPA 2IYUA 2UKDA 4UJ5A 4MGYR 4BE7B 1CRPA 1KI9A 1XB2A 2R2AA 3B2EA 2VHTA 1XD2A 2OCBA 3ETLA 1YZGA 2WVJA 2EQBA 3F3YA 1W47A 3OE7D 2PMKA 2W6JD 4PX9A 3ASZA 3ZH9B 4LJ8A 1GTVA 1VCMA 3K0EA 3VKGA 3CNNA 2IYTA 4LV8B 1WQ1R 3AKYA 1E69A 2J5XA 1FW6A 3LXRA 1CJUC 1R2QA 4PQYA 2O8CA 2VYFA 1W4CA 3RABA 2MSEB 2A30A 2KE5A 2H92A 1CS4C 4GOXA 4WIAA 4DLWA 2FGKA 4TYPA 4FI3C 3GLHB 4M1MA 3CX6A 4A4DA 1NKSA 4DSNA 3B8HA 1WF3A 2PT7A 2QAGC 2VP6A 2ZREA 4IEIA 3AVVA 2YOFA 4LX0A 1M1YE 4Q4HB 3KQHA 1OH7A 4P4UA 3SU8A 3KQNA 2PJZA 2WPDD 1I4DD 3K09A 1G5PA 2H1LA 4QGHA 1OSNA 4MGIR 4DZZA 4PC2A 4C0LA 3LO5A 3QVUA 2XNDD 4L9WA 2DBYA 5L3RA 3UATA 4V02A 3VR2A 3BGWA 3PEVA 1P2UA 2ZE8A 4GDFA 1QHYA 2DFLA 2GWHA 4C2TA 3RDPA 4F93B 1KI6B 2JATA 2HCBA 3EWSA 4Q1CA 2IF0A 4BECA 2EVWX 4XJXA 5EE5B 3CH4B 3L82B 3QI2A 3EARA 1CIPA 1KK0A 3K0CC 4OK6A 3AGQA 1Z83A 4QBIA 4JLPA 1T8UA 2VHCA 4H1VA 4MYHA 2FGJA 1DPFA 1NIPA 2ZRBA 3NDBB 1RPZA 2B2NA 4LYAA 4FWIB 4WA7A 1E1QD 5EUMA 4HDQB 3TW4A 3KQLA 3ZVLA 3JVVA 4D25A 1F2TB 1EFRA 4GI7A 4EKDA 1COWA 3A1TA 1DE0A 2FFQA 1J99A 3VMAA 4O2RA 5JCZA 5K8UA 2ZE6A 1CTQA 1IBRA 1XTKA 1AN0A 1CF4A 4DLRA 3U7EB 1UBFA 4BASA 3ICQB 4DCVA 1O87A 1TUEA 2P6NA 2VRWA 3GQBA 3KKQA 5TV2A 2G9NA 2EYQA 4NYMQ 5L3QA 2CEAA 4KBGA 1BS1A 4Z54A 4M22A 3OESA 5JMTA 4RZUA 5J4YA 5SZIA 4Q21A 4B2LA 2PH1A 1M7BA 2X2EA 3TR0A 2A2ZA 1SXJE 1NSTA 4UXHA 3PEYA 3IILA 4K81B 4TYYA 1O3YA 2CE7A 3B13B 4PZYA 1ZUIA 3BH6A 2RCNA 1E9SA 2BJVA 2EWWA 2QI9C 1IJFA 3TE6A 2GK6A 1KHTA 4MDEA 5DHFA 3W3ZB 5H8WA 2ORVA 3A4LA 3A1VA 3PR1A 5DE3A 4AG5A 3BRWD 3E1SA 1TUIA 1UKYA 4L5BA 2F1JA 1SKYB 4GBMA 4UXIA 1W49A 3CWZA 4PTLA 4AWXA 2O8EB 1NVVQ 1OB2A 3CNOA 1IM2A 1OH8A 3R9XA 4OKSA 1KDPA 1TF5A 4NCHA 4NTZA 4Q18A 4BFXA 1KI3A 2REBA 1TMKA 1EWQA 4DFCA 5LBIA 1E1RD 3TAUA 2WKRA 1TNDA 5EP1A 3ADDA 2E1RA 2IYRA 2R8RA 1L7VC 1RRGA 2ZI6A 5A0FA 2FMXA 2GEUA 3GMTA 3CO5A 1SVWA 1CR0A 1PV4A 1G7RA 4LZZA 4OHYA 5FTKA 5IK2A 1AJEA 1E0JA 1E0SA 5JEDA 5KNDA 2HEIA 3LX5A 2IK8A 1A2KC 2QAGA 4DXAA 4L4UA 1FX0A 2GKSA 4DLXA 1W36C 4PSAA 3GLGB 1GDDA 4OQFA 2XTMA 2D4HA 1Q44A 1ZC3A 3CBQA 3I73A 3FHTA 4CYMA 3U5ZB 4JS0A 2C9CA 1P6XA 1SXJA 1Q3HA 2PLFA 3NBXX 5H70A 4B71A 2JDID 3BE4A 3CPEA 3X1DA 5CM9C 2OXCA 2ZSBA 2D62A 4U7DA 3A8TA 2V7QD 2ZE5A 2N46A 3EZ2A 2IUTA 4CDGA 3U7GA 5GJWC 3ZIAA 3LWNA 1CP2A 4B32A 3QEOA 1FTNA 2PEZA 3K0CA 5C4MA 1GSIA 2ASEA 2GBLC 5IDVA 5DH9A 4HZUB 1X6VA 3IIKA 3E5HA 2J59A 1N6KA 5CJ2A 3OEEA 1IOZA 5E95A 3NVAA 3K9HA 1JI0A 3LV8A 1US8A 4CEHB 4NYJQ 3T1VA 1HE1C 1D8TA 1KNQA 4BGDA 2WIBA 4IHQA 1II8B 2F1RA 4BEJA 1PVOA 1N6LA 3RRZA 3GJ6A 5FFMA 4AIIA 4PHFA 3W6PA 4LJYA 3A37A 4WVFA 2QSYA 1Y63A 1P2VA 2AWNA 4GSYA 5HR5A 4OL0A 3AGPA 1NN3A 4M2LA 1H8EA 1JXOA 1QVAA 5GJCA 5DI9A 4TLDA 4AK9A 1BIFA 2GTPA 2NIPA 1T6NA 2AD5A 2V55B 5DYGA 2ZPTX 4PAMA 4Q02A 1ZRHA 4B3BA 3KFXA 4N3NA 3C8UA 2VPPA 1W7AA 1E1QA 2DWQA 5KUTA 3H86A 2IUUA 1KTVA 1AKYA 4A8JC 2WOJA 4MRNA 4CRWB 1IHUA 2Q9BA 5JCPA 2GF9A 2MSCB 3IIMA 4G5SA 3O8BA 3THWA 1KMQA 1LVGA 3AVYA 1JPJA 1M8PA 1G8PA 4P4SB 4TLAA 2FE4A 2VP0A 5FUWA 3EA0A 3U3OA 3CM0A 1FP7A 4PO9A 4TTPA 4ABYA 4BQSA 3I5YA 1EWRA 4XWOA 2ZQ5A 3VNUA 4H1UA 1OXUA 3Q7QA 1U0JA 3GLIB 2XEXA 4EPRA 3B9PA 4KFRA 2WSSD 5J4KA 2QAJA 2BBWA 3BH0A 4CF7A 3SI7A 5BN5A 3IPXA 2TMKA 4QM7A 3EXAA 2BKEA 4Z1MD 1H8HA 3PUVA 1BMFD 5DN6D 3AF2A 5JJKA 1JQLB 2RGNC 4TMWA 3W9YA 4NKRA 3CUEF 2DHRA 3KJHA 3FMFA 3Q7PA 4LOAA 2FEMA 1BO6A 1M7GA 3WYFA 1NLYA 2A3RA 1ZC4A 1E9EA 2OFOA 3WHKA 2P65A 4M8NE 1YZLA 3EWAA 3I72A 4B35A 4TZ6A 2G1KA 2WWFA 2ANBA 3U3KA 2QTHA 1G41A 4YXWD 1LB1B 2CCGA 4IOJA 2F9MA 4XTRA 3SDZA 4B2PA 1VHTA 2O0JA 2EFEB 4GOKA 1ZU5A 2ZJ2A 4LV6A 1XXHE 1XMJA 5CB8A 1V5WA 5JWRA 4JYBA 1ZINA 4A1FA 2XOKD 1W2GA 3C16C 1WP9A 1U81A 4HDOB 3ZS8A 3MWYW 4F91B 2X8AA 3VR3A 1T9HA 1NMXA 5BW8A 5F98A 2OV2A 2F1HA 4ACBA 1ZUNB 3M1IA 4DT1B 1UFQA 2VF8A 1IN8A 1KSFX 2L0XA 1OJLA 2IYYA 3GEEA 2CL6X 4R2HA 4BLRA 3SZRA 4TSFD 3D8BA 5JS8A 4C7OB 2O8DB 3VMFA 1P75A 3WMGA 3KJEA 4Q1EA 2ZYTX 4JLJA 2GK7A 2VA8A 2DCUA 4MRPA 3T5GA 1XPOA 1KO7A 3Q9LA 3TMKA 5KNCA 1NMYA 2IT1A 4TTRA 2GAOA 2ZTSA 3SFVA 3TKLA 1IONA 4YONB 3RS4A 3UWOA 3CIOA 3GFOA 3RS2A 3TVDA 5G53C 3T34A 1ZW6A 3SJCA 3RRYA 1YJ5A 4OHXA 2F3TA 2XTZA 1M34E 1KJZA 2FA9A 4TT3D 1WBDA 4NYIR 1MH1A 4IXMA 1TX4B 2C04A 4LHWA 2Q3MA 121PA 1Y3AA 2NO1A 1NBMD 3NC0C 4XD7D 2A9KA 3WYGA 4AYWA 4KLZA 4JKIA 4NZYA 1YRAA 4IW3B 4R9UC 2X2FA 2PZGA 3GEHA 4RFVA 4M9XA 1KSHA 1UBCA 1VYVA 3T06B 4L15A 3GLFE 2BCGY 4EJSC 4ZDIA 4B6FA 4A8JA 4S2EA 2ZI3A 1M74A 4PQRA 4DLSA 2XX3A 4IKEA 2VO1A 2NPFA 4HB3A 4R98A 4JT2A 4Q9JA 1RKBA 2VL7A 3R7WA 1W46A 2OILA 3A4MA 4EPTA 4BFZA 2ZJ5A 5F2EA 1M2OB 1XXHA 3NWJA 4NL4H 2VBCA 1SHKA 2Z83A 3PITA 1XRJA 3UMFA 3DO6A 4LGMA 3KDSE 4Q47A 3OIWA 4LJ5A 1U99A 2C9YA 4EFMA 1FMJA 1Z28A 4MRVA 2RGBA 2QT1A 2IS1A 4HATA 1TEVA 2RGNA 4DBLC 2PLRA 1YZNA 1G6HA 4EFNA 4Z8YA 5E4FA 3B1VA 3MLEA 3MAAC 1GAJA 3THXA 4JYCA 1Z22A 3CR8A 1C1YA 3OAAD 3MWKA 4Q9LA 1JPNA 2YWGA 3FFBA 3QIAA 4CEJB 3H0KA 2KJQA 1HQCA 3QPVA 4NHOA 1DTSA 1A4RA 2W2XA 4Q7KA 3F0TA 5AJVB 4C0JA 5AUOB 5B58C 1XFAA 2AN9A 2PMDA 3FHCB 1Q0UA 1L4YA 1BMFA 2IEZA 1RIFA 3P26A 2CLDX 4FXPA 2QM8A 4C0AC 2DR3A 3CLVA 3PG5A 4LK2A 1XPRA 5TXGA 4LHZA 3FMIA 1OFUX 2HLDD 4A6XA 1YQTA 2ZM5A 2R44A 1FFHA 3SYNA 2Q9CA 4M9ZA 1TADA 1CR2A 1MRSA 2E87A 3QOFA 3LAWA 3WXMA 2O8FA 1XJCA 3CZQA 4Q00A 5A4JA 8OHMA 4D0LB 5FTJA 1VDZA 1Z6XA 2ONJA 3GLFA 3QPUA 1KSJA 2LCFA 4UNRA 2P5TB 5CB6A 3X2SA 4D4LA 1GNRA 1S9HA 4QXAA 1TPZA 3RSOA 4ARZB 4YXWA 4GMDA 4YQFA 1CR4A 1OYWA 1MABA 2QMOA 2GZHA 2W0MA 1Z2AA 3K70C 4DUGD 1XCGB 1KO5A 1UPTA 1VG0B 1F3OA 1F48A 2WWIA 3PUXA 2A5DA 3REFA 3FKSD 4RSGA 2IX3A 2GXAA 4TWZA 5DLQC 3RVBA 5KDDA 3M0EA 2GNOA 2QG6A 1X8KA 3TR5A 4R7ZA 3REGA 4C0BA 5A5GA 5AR1A 4DSOA 2J46A 1ESMA 1GRNA 4URXR 3VKHA 1AGRA 2AKYA 1JR3E 1LW7A 2ZAMA 2GRJA 2JA1A 4KAXA 1N0VC 2RGGA 1U94A 2LKDA 3EIQA 4KXFB 5F3WB 3R9IA 2RGCA 2ZRNA 1XEXB 3HYTA 421PA 4I1UA 2J0SA 1G7TA 2V9PA 3RS5A 1RJ9B 2ZANA 2NO7A 5FBLB 5EE0A 2P67A 3BK7A 2GJKA 3U6KA 4TYQA 5HCIA 5GJBA 4EJSA 2HF8A 3LRPA 2ZI7A 3DKPA 5EXSA 4Q1AA 5HKKD 2F43B 3NEJA 1K5DA 5JEEA 3ZVNA 1DO2A 4AD8A 4ZPXA 3KXLA 4OQMA 4Q4AB 3L0SA 3LNCA 5KO2A 3IO5A 4LBWA 2CVHA 1AZSC 4PPGA 2YV5A 4CW7A 1E2KA 4O2LA 5LD2C 4FWTA 5KNBA 3QQ5A 1E2EA 1NVXQ 3D7MA 4FCTA 4IVQA 3NG1A 2ZS9A 1E98A 5LB4A 4B2IA 5D3MA 5KSYA 2WMOB 2JJ1D 3TGPA 1N2CE 3AB3A 2V54A 1T5LA 2I4IA 4WZBE 2CJWA 1XTIA 4FMDB 5JRZA 3QKRB 3BFXA 2CK3A 3LQRA 1B0UA 1G16A 1VG9B 4BEBA 5CITA 1ZM2A 4Y0VA 1Z2CA 4LC0A 3KB2A 1KIMA 1UDWA 1WB9A 2XSZD 4DIDA 2FPLA 4PXAA 1PLJA 3GJ8A 3CRW1 3UPUA 2MSDB 1LNZA 5CYPA 5SZKB 5DYIA 1KSGA 4CVNA 1Z0DA 4FCWA 3K09C 2R6GA 1FL9A 3MWLA 2ZJZA 4A92A 4F38A 4URYR 1GFIA 2ZS7A 4JVLA 2EFHB 4PO8A 3PJRA 4QL3A 1UBGA 3AKEA 1RRPA 1F2UA 2PZFA 2DWPA 3WBJA 4BZXA 4RD4A 3L8YA 4G1UC 3FFAA 4HZIA 5F9FA 5DO9A 5BYKA 4I1VA 2JJ2D 4TMKA 4EFLA 1Z6GA 4US0R 4C9BA 2GXUA 1FUKA 1Z5ZA 2KBFA 2W6ID 1J7KA 3K0FB 4NMMA 4ZO4A 2N42A 5CLQA 3U61B 3ND9A 3AVWA 2CXXA 4M1WA 4ZDJA 1W44A 5L3SA 1TQ6A 4YDHB 1VMAA 1J8YF 2BKUA 4EQ6B 2IS6A 1JAHA 5DGXA 2GILA 4KFTA 3HDTA 3ASYA 2OAQ1 2KSQA 1E2IA 2VP2A 4LJ9A 2V1XA 2RGDA 2H8KA 4IEEA 1GKUB 2NPIA 4EAQA 1XD2B 4F4CA 1IN4A 3EX7C 2G0NA 2OZEA 4URUR 2ODWA 4BFUA 5FBVB 2OCAA 1G291 1ZNWA 2DFNA 1YR8A 2ERYA 2WJYA 4GNKA 4PPQA 4QJ4A 6Q21A 1GKYA 4IDQA 1Z6YA 3B82A 4JZKA 4NE2A 3PCRB 2CHVA 2FFHA 4DDVA 4QBGB 2ZSFA 4DRZA 5FL7D 2N1BA 1XNJA 1QHGA 1NJFA 3B7GA 2EYUA 3HPRA 2XZOA 3O8CA 2UVQA 5AK0A 5AUNB 3CZPA 4IDNA 2O8CB 1KMHA 3MMPA 5J47A 1SULA 2AX4A 3RC3A 3ZS9A 2DY1A 1ZM9A 4TLEA 3VHLB 4DVGA 5KOYA 1SZPA 1ZNXA 4FMBB 3BFVA 4LBYA 1VCIA 5C4GB 2AFIE 3BORA 3W8NA 3NHAA 1GILA 5JFGA 1DG1G 2BWJA 4Q1DA 3L0IB 1SGWA 1Z06A 3IBGA 1NN0A 2AK3A 3QG5A 4M1TA 4DLVA 2OXRA 1AIPA 1JXMA 3W6NA 3B5JA 2Q0HA 3LXXA 3BB3A 5ANRB 2P3SA 4JJKA 5P21A 1NKTA 1E0AA 4JBWA 4LHXA 5G3YA 3SBEA 4KYUA 3DZDA 4XOIA 2ZETA 2ZVQX 3GFTA 3NH6A 2IBMA 4KVGA 2HJGA 4LBVA 4YDSA 4PPFA 2OLJA 221PA 2WHXA 3DDCA 2VLIA 5HTKA 3RRMA 1NY5A 2W2VA 2WM9B 4BFYA 2GCNA 1AK2A 1FPMA 2D2FA 1AS2A 4C0SA 2AHOA 1CJTC 2DWOA 2R65A 2ZI5A 4JLOA 3VR6A 4DLTA 3EPLA 1DBSA 5JRJA 4RFSB 2EFDB 3A36A 2B8WA 1F5NA 2OG2A 2BEKA 4POAA 2PCLA 2FZLA 2BBOA 2PBRA 2OE2A 3NBZC 5HZKA 3A1UA 1ZP6A 3UG7A 2PJRA
chains in the Genus database with same CATH superfamily
2JD0A 3LW7A 1Q0ZA 1S0UA 5C8DA 1CNEA 3HVIA 3FF4A 3EG9B 3ICEA 2B1IA 2W58A 1CLEA 3IVMA 3Q3GE 3KQYA 1IMJA 2FSGA 3LUPA 2ABWA 4UEOA 3TTVA 1O94D 4EMUA 2RBKA 3P7MA 4BL5A 4Q19A 2NUBA 1CUEA 1FQJA 3G6WA 3JS5A 521PA 2OO3A 3RJ9A 1QDEA 4L5AA 1LQUA 5L3QB 3GZNA 1YR1A 2CL0X 3HUTA 3UCXA 4DJ5X 3U16A 5J9FA 3HA5A 2C9DA 4ZI7A 4RVOA 3BQMB 3EZ6A 1E18A 1OYOA 4UQOA 4G5OA 3VH2A 2ZWVA 4LRQA 1EK5A 1IZ9A 2DY0A 1MZVA 5E6UA 1AB5A 1I33A 3Q72A 3W2EA 1YBVA 1FTGA 2EW1A 1R6TA 1XLTA 1N9GB 2BV3A 2HF2A 1O6GA 3RT7A 3R5FA 2Q3EA 1EK2A 1GWNA 3QBDA 1KDRA 1ISHA 4AS2A 3DNPA 3FHOA 4PQEA 3WBFA 2ZT6A 1VXOA 3GXBA 2XB4A 3H65A 4Q3KA 3UOGA 1FMCA 2GASA 2I22A 2UVPA 1JALA 3N8DA 4NMXB 1PZFA 4KI7A 1EP1B 5JAMA 4XWWA 2H16A 4KV9A 1P5JA 2R6R1 1GTJ1 1YMQA 1D4AA 3AR4A 2ZDQA 3CVXA 4OM7A 2AZTA 4NFSA 4B6OA 1HYEA 3UB4A 4ZZ1A 1I13A 3R9XB 4FHZA 4XJTA 4LHVA 2XPCA 1SCKA 3CLUC 5HUJA 3DE3X 4C7JA 2VNAA 3QXXA 1M0SA 1QHHA 1YSCA 2ZYVX 3GCWA 2R6CA 3M9XA 3OLZA 5EP3A 5EQTA 3V9PA 4B44A 1HKUA 5K1ZA 2QL6A 3NOOA 2EEPA 3A4YA 3CR3C 1UZLA 1W0KD 3JQ9C 4FCCA 5G0VA 3TM4A 4PSKA 4E6EA 1KO1A 1BXGB 3HYCA 3C3DA 3L6OO 4KQIA 5J2UB 5JASA 3Q85A 4M1QA 2DHCA 1FTQA 4QLBA 3RASA 2GN6A 3S7ZA 2IA5A 4GI3A 5INTA 3AVXA 3A2KA 2O2YA 2YRWA 4N7MA 1IPEA 3CX7A 1XZNA 4DZRA 3CBGA 1IHXA 1EGVB 2JZCA 4M6WA 1PSWA 3OUUA 1EXMA 1FXUA 1ZZGA 3E22A 3OPYB 4BV9A 4EY4A 3QEAZ 3A1FA 1N32B 3SKXA 1J56A 4NSNA 2WA1A 2Z04A 4QNNA 2QAGB 4RGVA 3EVFA 3GH3A 2OD7A 3SYRA 1FX0B 5ITWA 3QFTA 3AM4A 5IDYA 3IPCA 5JBNA 1DEAA 1KAOA 1QV9A 3FZNA 1IOWA 4YA6A 4EPXA 3N8IA 1FFDA 1UFRA 2YYSA 3CX8A 5F9HA 3LLMA 3VGPA 9MHTA 4R6XA 4BFVA 1ZIOA 3MB8A 4F21A 4O25A 2QPAA 3FCCA 4UCFA 3VXKA 3ZGOA 2OBMA 2J3KA 1SXJB 1T3HA 4O4JF 3FKJA 5E2BA 3EGIA 3U7QA 3NS7A 1TAHA 1VGRA 1XQ6A 2CVOA 5LYJA 1ZNYA 1YONA 2ZI4A 2ZZMA 4KOEC 2GPJA 3ADOA 2A1TR 3KUDA 3P2MA 4CFYA 4RJTA 1F51E 4R41A 1VRCA 4JOBA 4Y1GA 1EE1A 5FUYA 3H2GA 3ZDAA 2IYWA 1ZOOA 3ZTWA 5LIPA 1CE8A 3KHTA 1G5TA 2YNMD 1CQIA 4LXTA 3BCRA 3EAGA 4A2WA 3RFXA 3BL5A 1UAAA 3BBPA 2OLEA 1L4KA 3KVNA 4ID9A 2VAMA 2EJWA 3DOUA 1CHDA 3UW1A 3BWVA 4CXMA 1KVSA 4D1YA 2AR9A 2PWPA 2XYPA 1V7PC 3NGMA 3OKPA 4ZGWA 5GONB 3T5PA 1Q2XA 4FFLA 5DV9A 1UKBA 1WVMA 4MPRA 1GSOA 4RKQA 1SKQA 2ZW9A 3IB6A 2RARA 2XWBF 3IQGX 1U1EA 3D3NA 3PLRA 1GGKA 3K73O 3SC6A 2G40A 3DLBA 3FDJA 4B3SB 1N2HA 1I1OA 1VCHA 2B3TA 2GLUA 4IH9A 1JBKA 3BG5A 2W2TA 1CQJB 3QLJA 4MWGA 1K5PA 2H4FA 1I6KA 4ND4A 5KC9A 1PUIA 5P8WA 1XQXA 2W6OA 5JCXA 1B76A 5EZYB 3RWMB 1ZHOA 1CEXA 4OATA 4UU0A 1QUFA 1U7UA 2GVDC 2HXYA 4Q12A 5DIFA 1Q57A 1SC3A 2JANA 4GP6A 3KT8A 4YLEA 3IPYA 3H04A 3I1JA 4Z0TA 2OCLA 2IPXA 1JPVA 2WTEA 5GMOA 3THWB 3S40A 1OKKA 1Q1QA 4CWAA 2XNDA 1T9CA 5JSZA 1DNPA 1C8BA 5AKGA 1VLJA 1BGXT 4KVAA 4YLYA 5SY9A 1VYUA 3D6NB 2EJUA 4P31A 3T3HA 3V80A 3GD5A 3K0BA 5FPSA 5DHAA 5GADl 2GO1A 2YKGA 1XMQB 4KFCA 4AKIA 5KOHA 1Y6GA 3B36A 4IH1A 4UAUA 3IEXA 4P93A 4WN3A 1SG9A 2CVFA 1JJIA 3CISA 3NGLA 3OX3A 3OCCA 5K0FA 2Z57A 4J16C 4QODA 4XDHA 1JX6A 5A5DA 3PVSA 1NJ2A 3D4PA 4TMVA 5FUVA 2WQ7A 2X5XA 5I7VA 4D8UA 5G0TA 4C03A 2QLLA 2X9VA 2QORA 4X54A 1AZWA 1GD1O 1OFVA 3FM9A 2AKAB 3NT5A 7MHTA 5M34A 2I3GA 4EKIA 3DE6X 1Z75A 1NLZA 4FGUA 3HUUA 4OI2A 1UOEA 5DX8A 2J1LA 2ZJ3A 3SMQA 1R5OA 3TBFA 2RGRA 3BL8A 2C7BA 1LX6A 2RI1A 4GXNA 4LZWA 1T8WA 5DWQA 3PDUA 5FWDA 1WW3A 3RARA 1OBHA 4IUYA 2LRHA 1WXIA 4RIGA 4I4TF 5F52A 5T67A 4UBOA 4GKKB 2XTJA 5IM5A 1TQ2A 1E1CA 3UWSA 1RBMA 1REQA 3PFIA 4LGCA 4I4IA 1ECCA 1KEUA 1LC3A 3I3OA 1I3KA 4S1TA 4EA6A 5F7XA 4PS0A 4ZARA 1ZMRA 2P3OA 2XQVA 3R3JA 4FYYA 1DBQA 1OLOA 2O6HA 4QYIA 5ALTA 3EVZA 4V1CI 4MNTA 2YBEA 2FZEA 2YDYA 2NO5A 4XYMA 2B37A 4REOA 4WASA 2EGGA 2W4MA 1RCUA 1ST2A 1KQGA 4L4RA 3AIOA 3QF7A 1HH4A 4R0MA 2VPTA 4KR0A 2SCUB 3QMWA 3CUTA 4DGQA 3WL5A 3ER9A 2ZROA 1I30A 4KL8S 1ORHA 2HBZA 1BWSA 3LRXA 4ZXPA 2W43A 3RIHA 3HJCA 4ZP1A 2YMQA 4ALNA 5JROA 1KY5A 3C1AA 4N48A 2H63A 2IOHA 2SKEA 2XOXA 5IDWA 3EHDA 3EGDB 5ALUA 4KZKA 1UZUA 1Y8ZA 2VHYA 1HLFA 4HB4A 1KJIA 3RS0A 2EZUA 1SUIA 1KKLA 3G2NA 2P69A 4K9LA 2I8AA 4ARUA 3K71B 3G0HA 2QRZA 3ISJA 4UOEA 1DTWA 3MWEA 5FTLA 2JGRA 3AKCA 5EKSA 3AETA 2J6BA 4JI5B 3W5DA 3IGFA 3PFNA 4HEJA 4NVRA 2FPOA 4FU0A 2IF2A 5JADA 2WKWA 2YC2C 2FPPB 4U8HA 1NXSA 3I5UA 3D0RA 3ABRB 4B3FX 4G1MB 3DP7A 3OLQA 3TB6A 1L7XA 1QO0D 2DH6A 3K5HA 821PA 3OIDA 4IJ6A 3LBHA 1WS6A 1MQ9A 1VMKA 4QARA 1YR9A 3QKTA 4DMUB 4IJMA 2VDQB 2JHPA 5CIWA 4BNTA 3A6EA 4UOZA 3JRXA 2J09A 4V0LA 3K2QA 1R0WA 4Y2XA 4BAZA 4DKXA 2J0EA 1PO7A 3OIYA 2RCYA 1F17A 3W05A 3HYRA 4MCAA 4A8JB 1KYQA 4FD2A 1TVCA 4TSRA 2YHBA 1BXRB 1GXSB 2NO6A 3L5OA 1XZBA 4BE9A 1TVKA 3R77A 3LY7A 4JGIA 1GUAA 2J7KA 4X8MA 1HDRA 1V39A 1YDHA 4W9NC 5SY6A 5IPFA 1DAMA 3L77A 5E9AA 4D98A 2DMRA 5BXYA 1E94E 4TL6A 4X7PA 1SQ0A 1AQJA 3PQEA 1DG9A 3ZU5A 2DCMA 3IEVA 2O2XA 2WAXA 3ERCA 3GH1A 4GZ3A 2IEIA 3AUUA 2I3BA 3WLNA 1QAQA 3K05A 4LV5B 4EO4A 5H16A 6GPBA 3UMRA 1G2OA 1U3UA 3QBVA 5BMOA 2CCJA 1USUA 2XMGA 1CQZA 4OXXA 4DLKA 4K9RA 4RIIA 1P5FA 3FVRA 3LX8A 2Z8YM 5IBQA 1U7DA 3TIFA 1SXPA 4MWEA 4AJ2A 2BEVA 4IX9A 1R88A 1BCRA 1WHSB 5HUHA 2P6RA 3UJ7A 3GFBA 3GMIA 2R5FA 5AW4A 4BMYA 2HDNB 5AK6A 3WHIA 3Q5DA 4RYLA 2JIQA 4PRZA 3L8DA 3KYDA 2VHVA 3ROXA 4F2WA 5JMOA 4PPYA 3QVGB 3DHVA 4K9MA 5EKDA 4F9TA 1XTJA 4Z8XA 1A7JA 3KJFA 3EA5A 4ZOBA 1W9HA 3BBLA 4RZ3A 2Z3WA 3A06A 3EZ9A 1W85A 3L04A 4E30A 3LH5A 2QVYX 1XI2A 1M34B 1YZ3A 4Y6OA 1TW3A 3ELWA 3UHFA 2QZJA 2DRIA 3VR5H 2PMCA 1JQBA 2DWCA 1VHDA 1V16A 1D1PA 2VOEA 3FPKA 4RKWA 3TD2A 1CZRA 1P6UA 2CLSA 4XJSA 3UT5A 3AVTA 4B87A 2YTZA 1EB9A 3KTAA 1U1CA 3TXYA 3AFIA 3TW8B 1D9XA 3RSGA 2YWHA 1E5QA 3ESBA 1XWFA 2P2LA 1ADJA 1N2IA 3EQZA 4J0FA 1QJ4A 3ETCA 4NYMR 4PC7A 2O2GA 4RY8A 5TARA 5EIBD 4DA8A 4NXNB 3THOA 2XA9A 4H4DA 3FB4A 3SOZA 2I54A 1OV6A 2QWXA 3TEJA 4D0RA 5ELXA 4AIRA 1MG5A 1UZAA 1SQ6A 1SQ5A 2C58A 3UF0A 2E9SA 3Q9SA 3BB4A 2CUZA 5TS2A 1Q1BA 3EAQA 4R2IA 1TU3A 3MAGA 4ETWA 1RCFA 4PYRA 1EFLA 3Q3JB 2CXPA 4RADA 4NRDA 4JJ4A 3TEFA 4RTJA 4LFAB 2PMWB 1AMOA 4ZWNA 2WSSA 1TTQB 1MIOA 2HQOA 3HWWA 4POOA 3T5TA 5KYYA 5KQGA 2Z2KA 5BN1A 3Q2OA 1P73A 4EG7A 2VYVA 4U02A 1XJ5A 1TKBA 3B9QA 3DUFA 1R16A 4HKTA 1L8AA 5I3CA 2F3QA 4RW0A 3GBSA 2OFPA 5H80A 5ALVA 3AXSA 5JY6A 5IT0A 1NBME 3DKVA 3KL4A 2HD4A 4WOCA 2ATEA 1RZ3A 1HFKA 2R8YA 3EFEA 1QU3A 3HKCB 2HREA 4D0GA 1XVTA 3EXG2 3IOYA 2GJSA 2RONA 1JXQA 4UDYX 3T7IA 3UYLA 4WOBA 2P8SA 2XBLA 3GRKA 3MJEA 4KMRA 4L5JA 2B9EA 4U5QA 3WLOA 1Z3IX 5CA1F 2GBIA 2FP4B 2AJCA 4EHFA 3I9FA 3CLKA 1GQYA 2VNKA 2G0TA 1KQNA 4QD3A 4HHEA 2HYIC 1X38A 1XQVA 1YL5A 3WWEA 3RQIA 3DMNA 2BGWA 3A26A 1FFWA 2XYHA 3AEQA 3BGOS 3EIHA 4FZ5A 1MJNA 4IHAA 3VNBA 1J09A 1MV8A 4ZAGA 4QZVA 2XNSA 4LZPA 4EJSB 5MN5A 1JR4A 2J0VA 3G0IA 4I55F 5A5VA 3DGEC 4R84A 1XKTA 2WDZA 2Z58A 1Y9AA 2B34A 3A58B 1EGAA 2ZIAA 3IVGA 3PDJA 4WCFB 1B6SA 3PUWA 2JGDB 4WY2A 2QMHA 2Y77A 1BW9A 3MN1A 1P7CA 1NX9A 1SB8A 1MBZA 3H5IA 3N87A 1MAVA 4UNNA 1INLA 5TIIA 4BLUA 2GD1O 2O05A 3TLCA 5JOQA 5JH7B 1G1MA 4M0UA 1FIUA 4OJQA 3E9EA 2EX0A 2CYBA 3X1YA 2CNDA 3KTOA 3I92A 3K35A 3QKWA 4AJNA 1KQPA 2HK7A 3L0PA 4OJKA 3U60B 2XDWA 4B47A 5L40A 5M04A 2ETXA 1E3TA 2QGFA 3KJGA 4Q9DA 5EUCA 5FADA 4QOIA 2CFTA 3O1JC 3OF5A 1SZCA 2Y1EA 1KORA 2CNBA 2OV8A 2Q6KA 3OX2A 1VHWA 4O0MA 1P61B 1H2XA 1U8AA 3N59A 4NJOA 1HA3A 1SRRA 8MHTA 1EBUA 1QVVA 2VJQA 3SN6A 2DPGA 2RGYA 4I9NA 3FTFA 1KP3A 3DOEA 1LW6E 1T91A 3EASA 4F6RA 2EFGA 2F17A 3T35A 5B6PA 4DB2A 4JJIA 1M2GA 1T13A 1T5IA 3WR5A 4BNHA 1XYVA 3P20A 3LVFO 1PWZA 1MEOA 3KT0A 4TUYA 4A6DA 1FYVA 2RHTA 3TOXA 3HDQA 4NYJR 5HF9A 5E6RA 1NSYA 2JI9A 3ROQA 1DXOA 1S2LA 1SUWA 4S05A 4M83A 3TGWA 1QQ7A 2Y0CA 4WLFA 4MW4A 4ZC1A 4Q3AA 1FS4A 1UEIA 1FP6A 4XXHA 2FPIB 3VNAA 2JAQA 3GGPA 3UAZA 1M2FA 2JCYA 3LKZA 4UASA 2J4CA 2GD6A 4KO1S 5SZJA 2A5JA 4YXFA 2O0HA 3ONFA 2YV2A 3TQIA 2H9AA 4QOJA 4LHYA 4KLAA 3WGYA 1RQXA 1Q12A 3CN7A 1FFXB 3I4LA 4NHEA 3B20A 5EESA 4OXQA 4JC5A 4C04A 2JFZA 1LV8A 1ZGGA 1K2WA 1IXYA 1ZCZA 3FKQA 4FHFA 1U3TA 2YMMA 4ZN6A 5L3SB 4JQYA 4IKPA 1DARA 1VIAA 2CXRA 3E70C 3WZ2A 3DF9A 4BP8A 5LIRA 4ZHQB 4TL8A 4KYIB 2PUGA 4D9IA 3WKBA 1WV0A 1QOZA 2A67A 2PPLA 2V9ZA 3HXOA 2VK2A 5I9LA 4J0JA 4QUGA 3ZCRA 4DBZA 1ODFA 1BCSB 2G06A 3BB1A 4YJFA 2D1FA 1HMYA 2FWRA 3HEMA 2V4ZA 1X0XA 2UYGA 2O7RA 3KAQA 3P9QA 3BMOB 3QKSA 3DS8A 1MT3A 1YR7A 3KEQA 2RHGB 4WZBB 3TE7A 1NRJB 3DVAA 3MT0A 4IL5A 4K6FA 3FNFA 3RSQA 4G5QA 4U2FA 1JIXA 5EHZA 4PO3X 5FDFA 1E1LA 4A0SA 1EVYA 3VO1A 4EX6A 3TJMA 1WZCA 3QXSA 4P3YA 4MVYA 1FVOA 3W1EA 1HEUA 2QU8A 3AVQA 1C9YA 2IU3A 3BIXA 4P86A 1GTZA 1E0KA 2VRCA 5COAA 1KMHB 1YC5A 4EO7A 1F8YA 2LDBA 4U2DA 3H2YA 4C89A 2PJUA 1JG3A 2QX9A 3CLTC 3LHFA 1J1IA 4HDSB 4UTXA 4D9MA 1RC8A 1KU6A 2IVZA 3H4TA 3AK4A 3KBBA 2A7XA 2R86A 2BGIA 2XKBA 4N8DA 4PCUA 1MG0A 5TC4A 2BP7B 3SP1A 4HYEA 1PL8A 3HU1A 4KYTA 1PJQA 4NAUA 2OBLA 3KZKA 2ZIFA 5BSHA 1WUIS 3PIRA 1UC5B 3FE2A 2FQ1A 3UAGA 1Z0FA 3MUOA 3BDVA 3E1GA 2OV4A 4TMTA 3WDMA 5JDIC 4B3GA 5F77A 4LY9A 4ALKA 2I91A 1X1DA 3H3JA 5IBPA 1E7SA 3TQCA 4UHJA 1GPDG 3SJBA 2ILTA 1WPRA 1FYFA 4HNGA 4S0ZA 1YVEI 2LE0A 2BCJQ 3H42B 2YZ7A 1V6SA 3NPMA 1KYTA 4A2QA 2PLWA 4WERA 3WNCA 3DV9A 4I81A 4QO7A 3QNUA 3KRTA 4A8HA 4O3FA 2AFRA 1C4OA 5HSGA 2B78A 3E8XA 3IKJA 3ONNA 4GG1A 1PTJA 3A25A 1YFKA 4P33A 5LZ5A 4MP3A 5J23A 1C9MA 2HNKA 4R81A 4W63A 2BTQA 2CCKA 2Q8QA 4KQ1A 2W4IA 1RMTA 5KSOA 2G67A 1R5JA 2X13A 2QRLA 3DW3X 2IIBA 4MZDA 4RJIA 2EBHX 5BOVA 1DQPA 4CHTA 4WGFA 1X70A 4OKNA 5I6DA 1ZD5A 4D9HA 4XB6B 4RDIA 3IL2A 2IHBA 3WNZA 2AUNA 3O0DA 4ZEXA 4JBGA 1P0QA 1QG2A 1P39A 3LWDA 2WT8A 4ZJPA 1VCNA 1GLVA 4G85A 4BKMA 5A03A 3LFUA 2ANCA 4ONEA 2MHCA 4B73A 2ID7A 3K0FA 1FZTA 1W5SA 3K9LA 1G7SA 3KHKA 3R3WA 2VDWB 4QU8A 4H7JA 4URWR 3TO5A 4D4HA 1I1HA 4BO4A 5HS6A 3SHFA 4DQ0A 1JNXX 2WU0A 3QEMA 1E3JA 1X9GA 4CN9A 4C4AA 3ZGNA 4WK6A 2F8TA 1T9GS 1EFVA 2B2CA 1WUYA 2EV9A 2P4SA 3AUTA 3MTGA 3FLAA 2RKBA 4O4LB 1CCWA 5GGXA 2C7OA 5KYKA 1H4QA 7REQA 1QGED 2IEAA 4ZDKA 3DMTA 1QGAA 1S1MA 3SIPA 4L73A 1HT3A 2OCXA 1E79A 1J90A 4KPUB 3GAMA 1E7MA 4MV7A 5IK2D 5LXTB 3PLAE 3AO0B 1VSTA 2FPGA 4YAKA 4IZ6A 5I5GA 3PC8A 2XBMA 1GLNA 2ODPA 3K32A 4EYSA 1JLHA 4JJ6A 2ATIA 5HPYB 1ONNA 2QW8A 4R2MA 1VE3A 1NQTA 2I7VA 4TMZA 1E77A 1IEXA 1IATA 3D5TA 3MM4A 4GZMA 2WM8A 4K6GA 1YBMA 4IPTA 1FRVA 4B9EA 3BXPA 4OHUA 4HRAA 3OIUA 1JPUA 4Z6KA 1SU8A 5EP4A 2GCOB 5I7EA 4QWMA 1XTRA 2KQUA 1TF7A 4WESB 5B7GA 2WJJA 3LA8A 3QX7A 5CD9A 1ISJA 4MR7A 1JN0A 1A9QA 1RQGA 3NETA 3R0ZA 4URFA 5HE8A 4HNUA 1LRLA 5KHOC 1IN1A 1N6NA 3FGNA 4LOJA 2JVIA 1XQWA 2JJYA 5F5NA 1I1NA 2G25A 1U8ZA 3UGJA 2DB3A 4INZA 4MYRA 3HBAA 3R2JA 3ROMA 3U80A 3PNYA 2XSZA 2PAFA 1SCQA 1XX6A 2H4ZA 1LPPA 1CY0A 1T8PA 3BCHA 4NULA 4P5PA 3RIEA 5DOZA 3CPSA 4BVHA 5IVHA 1FP1D 1OAAA 1HE8B 3HSYA 1D6NA 1NXTA 4O4HB 1MPTA 1D2NA 2GPAA 2WZDA 4F71A 3UICA 1Y3DE 2R66A 2IV3A 2ADFA 2D3WA 5JTTA 4NYIQ 4OYHA 3NRBA 4LDZA 2OR3A 2CMGA 3KEGA 5E7MA 2AFHE 2NZVG 1RYHA 3KR0A 5I7WA 1R0ZA 2OHIA 3CSSA 3AEKA 1YIOA 3L1HA 3PQFA 1S3SA 1YA4A 2HFKA 4G1VA 2WYVA 4IG4A 3CEPB 4HVAA 1DAFA 2AXNA 2ZU0C 2BONA 4PV7A 4JXKA 2XXAB 1Z0SA 1P2GA 1GZHB 4GIBA 4NOLA 4C1NA 1YK1A 2YMLA 3GLHA 3SVTA 5DU2A 3NBUA 1FVFA 4HWGA 5F21A 2H17A 4QTUB 3URKA 1GG9A 2PV7A 2VBIA 1Q2UA 2Z5LA 4UUNA 4DJTA 3LLUA 5K6RA 1LI5A 4LJSA 4DY4A 5AVQA 3DD1A 3NOQA 3IAM1 1WB6A 3G2OA 4YC7A 4LW8A 3Q3CA 3BIOA 1X7XA 1ZCFA 3P52A 1OW3B 4NBSA 1UF9A 4UVDA 2PCJA 3I9MA 5K8CA 4B3IA 1JSLA 3ROZA 4JITA 4KW7A 3TXXA 4ZU3A 3H3FA 1KI4A 1MB2A 1SOUA 2CXNA 4WACA 4X9XA 5ABPA 1DX4A 1ORRA 2A9FA 4BO5A 1MVLA 3B1JA 3FIJA 3MCAA 2YWBA 4Z7QB 5BOSB 1RYFA 3E2IA 3VGJA 1NVTA 1KOGA 4RHTA 4K9OA 1PLKA 3DHEA 3VU9B 4ZVUA 3GAZA 4BXOB 3CQ9A 1Z08A 4GOOD 4B7XA 2PDAA 1CJKC 4YRKA 2D5LA 3O8OB 1TKRA 4P1ZA 3WMWA 3SF8B 3ZDQA 1FSGA 2XJ9A 5K01A 3RS9A 4ZI3A 4EHLA 1Z7GA 4JLUA 2V65A 3C6XA 3I6IA 4D99A 4OMDA 2Q1WA 3B12A 3DBVO 4HEHA 2XWQA 3G7NA 2QN6A 3B53X 1EE9A 3NEYA 1O5OA 3N8HA 1EX9A 5JO9A 3FLBA 3RO7A 3K7EA 3RW9A 3VOBA 4TMYA 1PJ4A 2C96A 2IC5A 4JSTA 2ZIWB 4QLOA 4BRWA 2WZCA 2Z3ZA 4PCLA 4DJEC 1ZJ6A 4XR4A 2AV6A 1SM4A 5DM4A 4OUDA 1O6BA 1K6IA 3ZK7A 5K0CA 3GLGE 1M1NA 1NF3A 4AKEA 1DG3A 2Q28A 3V00A 2XJ4A 5LQCA 2QRQA 4MRMB 5PNTA 1TCAA 1HSZA 1VL2A 3B6ZA 4HADA 4QVIA 4KXQA 4WXEA 2LW7A 1W36D 1U7HA 4E5NA 2ZWPA 1ENZA 3SKVA 4OSEA 2B7BA 5ALEA 4RD6A 2XNJA 1JVNA 4NZMA 1U3VA 4H31A 1UINA 1QF6A 3DCYA 4OL9A 4B3MB 1DZIA 1VLVA 3BXXA 4WXMA 1LD3A 1W59A 1GU1A 3CT4A 4RA9A 3URMA 4BC0A 3SBDA 2PXXA 3UA4A 1OAOC 4I99A 3GFPA 2O2JA 4X00A 2B7CA 4JMPA 3HJNA 4MRSA 1USIA 4YRNA 4Z7JA 5KEIA 1VRWA 4G86A 4OQQA 3AUFA 1I2DA 4NC9A 1AKUA 1UXKA 3QE9Y 3LQ4A 4FSXA 4MIOA 3B6JA 2NU7B 1AE1A 1A04A 4IOKA 3WWOA 2R9VA 4LFCB 2FMTA 3BERA 1G21E 3ZQ6A 4TL9A 2OZKA 4L4YA 2BE9A 2WU3A 5K8TA 2VTDA 3IEPA 5DBOA 2B7LA 1QHNA 1G63A 3G9ZA 1X8LA 1M6NA 1PHRA 2H48A 2W11A 3PCTA 5I4BA 1GAXA 3LK6A 4TZKA 2Q8PA 4X3OA 1HY3A 1OXVA 2V7GA 3I8OA 2YVUA 4K8RB 3VZPA 2X42A 3RRFA 1O94A 1TAGA 5EE3A 1T1SA 2QMUA 1I6LA 2HMVA 2WVAA 3AY3A 2FVYA 3LC0A 4TLBA 3V8BA 4DM4A 3M34A 3U37A 2RGWA 1I3OA 3L7OA 5HKAA 5HBRA 3REOA 1UXGA 1SG6A 2BFMA 4JEIA 5B57C 1XZLA 1QIEA 4IQGA 3LK7A 4TKUA 2PS3A 4IIEA 2DH5A 2EX4A 2D5AA 5BMVA 1LTHR 3FNHA 4BFWA 2W8ZA 3INRA 2FV8A 2OYSA 4EEZA 1KQFA 1UAYA 4ERXA 1JG7A 4JELA 1XA0A 5IFLA 2WYWA 2BEUB 4MWTA 1L7DA 1ZLYA 2FSIA 1FU7A 3BEDA 4IF4A 3EVAA 1PIWA 3F7OA 3JQAD 3PC2A 2C2WA 1NQXA 1OBVA 4BDSA 5JWHA 2ODBA 1MB3A 1ZYUA 2HJVA 4HRXA 3GLIE 2REQB 1YZQA 4KQJA 4UUPA 5FR1A 2OQVA 4CCYA 1M7HA 2HJ9A 1X74A 3NNNA 4HP8A 2PQ6A 2J07A 3UGTA 5EZ6B 3V8RA 2EJBA 2Z2ZA 1GKKA 5LP1A 4U3JB 4YV0A 1LRJA 4NATA 2I03A 4MQFB 1LLFA 4BQQA 1QVRA 3D6FA 3DFZA 3NVDA 4DC9A 5BNTA 3KQKA 2QBYB 2IHZA 1GPYA 3M6FA 5ARDA 4JLAA 4WMLA 3WJ2A 1GYPA 4US1R 3WMEA 1S7CA 4YAFA 1JHZA 4BQFA 3TVTA 4BNVA 4P7JA 1U0HC 1NVUQ 4DC0A 1W0KA 3QHQA 4MUNA 4TQAA 4HVLA 5IJ0A 2GPTA 3ESXA 1GL3A 2J3QA 4TXMA 1XWIA 4DCSA 2I87A 3EBPA 3NJ8A 4EJFA 4INOA 2NYVA 4GECA 4A36A 2OZVA 4H7EA 1JA1A 2P62A 4IGIA 1MVOA 5I7OA 2RH4A 4YAWA 3SNKA 1H2AS 2JHGA 1U1DA 1QF7A 4J1TA 4MS1B 1OXSC 1Q0PA 1NIJA 3AZQA 1II8A 1PL7A 3OBIA 4PCAA 5FI3A 4A03A 4ZI7F 4YP1A 4LRUA 5FTWA 1NI3A 1QBGA 1JJFA 1FDIA 3OHPA 3EEQA 5LPNA 4BNKA 2D5BA 3LD9A 4MYTA 4EA9A 1JJ7A 3FR8A 4NEHB 4PZZA 2HA4A 2VEOA 1IEWA 1Z26A 2YMPA 2QY9A 3BQ9A 2B4YA 2QV7A 2CLMB 5K0BA 5F7ZA 5LP6A 2JLWA 4FYWA 1KO8A 1NJ1A 1LY1A 2VP4A 2XB8A 3QPAA 2IZ5A 3U13A 5KKNB 2EDAA 1WSBA 3U3RA 3EDYA 2QT9A 4GBJA 5ENVA 2BM9A 3OPYI 3PXDA 4FR0A 4LPSA 2JEYA 4C7XA 4FFVA 4B8YA 2CNKA 3WICA 4K6HA 1ZWKA 2BOVA 3DLPX 3F49S 1BMDA 4JB3A 5CP8A 1EIWA 3RYTC 2PKQO 2HMWA 5HMLA 2IE8A 4PYQA 3VPHA 1I80A 4EY6A 2W2NA 1RKVA 4JY7A 2WHQA 4H3KB 3D7KA 4WD3A 1G2PA 1II9A 1S3GA 1Z7EA 2C78A 3EZ7A 3FRHA 3HP1A 1A2QA 3IV9A 4LQ4A 5FPKA 2H18A 4F8JA 5NULA 2E4VA 1V8BA 4HLQB 1UDBA 3A9SA 1XRNA 3N5CA 2E4YA 3KOXA 2TYSB 4ZT6A 2QNIA 3EGWA 5ALJA 2ZAOA 1A9OA 3H3XA 4PANA 3UMSA 1JYFA 2BKVA 3JWJA 3D59A 3AB8A 4RE5A 3DL0A 1S4MA 4JC8A 4QWWA 4QUJA 2JLUA 3G2LA 2QVLA 4EP1A 1C1HA 2VIIA 3HWRA 3OQVA 5AUQA 4M8IA 2H2FA 2P30A 2R60A 3MVEA 4MB2A 1EVEA 5LC1A 3OFND 1Y9JA 1LI4A 3NTUA 1XAJA 1RRCA 4JH0A 4NNOA 4PQGA 4DJAA 4K7JA 2G9QA 1APBA 4UAVA 1U9IC 2GI4A 4U9HS 3QTLA 1UJ2A 4W82A 3S1AB 4EMBA 3WG9A 2HA3A 4HAVA 2GBLA 4TKMA 3V1TC 2C5LA 4QRHA 5AKZA 1O96B 5E38A 4NENA 4PAQA 4D97A 2WOOA 3TNLA 1RAGA 1GNSA 1E2HA 3ND6A 5IF3A 4KTVE 1OB5A 5AI4A 5JHGB 4F2HA 3EBLA 2WF5A 3TEMA 5AHRA 5LYJF 3OE5A 1XRSB 3RFUA 3IUBA 1J8DA 1PGPA 5JDCC 5EJGA 3L6CA 3ZHTA 4DTCA 3OOJA 3IRUA 1YR2A 2JIOA 5ECDA 5KNCH 2W9XA 2O19A 2QW0X 1VZ3A 1OHHD 3HSKA 3LQQA 4CNQA 3ZJ5A 3AVOA 4KXXA 2VF4X 2E89A 5HS4A 4J0KA 5DSZA 1Y3IA 4JAVC 4PTZA 4LVUA 4HH0A 4EATA 5LKAA 1NONA 1DIGA 1W52X 3ZHYA 3LWZA 3G2QA 3GMDA 2PLNA 3DW1X 3F4KA 3ZGXA 3KVRA 4HPXB 2G77B 2ZXEA 1CQPA 1ESDA 1L4UA 1L4HA 4C3UA 2VS1A 2NAPA 2QOEA 3HJBA 1UDAA 4B3TB 1G20E 2J08A 2X4DA 2CHFA 5T3YA 1BXRA 1K3FA 1OU4A 1SVLA 1SU4A 2CK3D 2OHXA 2WU4A 2RGAA 3IJEB 5E2AA 5B6JA 1G8HA 3EQ6A 4W7SA 5CBKA 1QQBA 4GKVA 3T7TA 2C54A 2X0NA 1UJBA 3DDWA 4TVKA 4CKEA 1YVDA 1JZTA 1K9SA 1KMCA 1Z88A 4O02B 4J94A 4W1PA 4UBMA 1KVQA 1PAUA 2Z6VA 1O58A 3H6GA 1WCXA 3WB1A 2R25B 4B09A 1MABB 3IPLA 3TI7A 5DTQA 4W1SA 4COKA 4YJGB 4D92A 3T3OA 3BOSA 1IOLA 2JS7A 4JJ7A 1NW3A 4E7OA 4MR9A 1JFRA 1NI5A 1XF9A 2QV0A 1NF2A 3GEDA 1X1RA 4UTVA 2FJPA 4YJ2A 1JDUA 1N5KA 2YXBA 1ZITA 2BZSA 1ZJZA 3W34A 4CMEC 2YV1A 1NJ6A 3V4LA 2VDKB 1XCPA 5EJFA 4RPLA 4C1BA 1DL5A 1NBAA 2VHWA 2AI3A 3K8QA 4LYJA 3KQMA 3VPFA 3NDRA 1BFKA 1EA7A 3MFQA 2AR7A 4RPKA 3Q41A 1Z82A 5BY2A 3BJIC 3KZXA 1IIRA 2W98A 1XDGA 3HPQA 3ILHA 4JCOA 1ACMA 5AHXA 1VSVA 2JKVA 1EM6A 4GMKA 4NR0A 2M98A 1CY4A 4OI1A 1Z4OA 3JATB 3BSFA 1JI3A 1AKQA 3C5WP 4B82A 1E8NA 2G83A 3S7TA 4EMSA 3E6AA 5A1TA 1VKOA 4E12A 3WLKX 5EN4A 1QFJA 4MVJM 4X24A 1D0VA 4ZODA 3IQHX 3R76A 1S1CA 2I1WA 3EFBA 4RZXA 2RC5A 2VHXA 1ZA1A 3BIFA 3AV3A 3I0ZA 4S35A 3GT3A 2FRDA 3ZX4A 4Q5IA 3MRSA 2WJGA 3R40A 4E33A 3O5AA 1YS4A 3D7LA 4GVXA 1IBSA 1QO0A 5LDGA 1Z3CA 4KR2A 3DEYX 1VC2A 2Q8NA 3LGXA 3C8MA 3H2SA 1M83A 2N75A 3BWCA 1FK8A 4Z3OA 2VSFA 2ZRHA 4D8TA 4JLVA 3UJPA 1G0OA 2QQ0A 3SX4A 1MJ5A 2YV4A 1PTKA 3CH5A 1QX3A 1KBOA 5HJ5A 4DBVO 4JBLA 5KSWB 1EAMA 1RDFA 1Y6QA 5LJIA 3WGKA 1BXZA 2IUEA 2R5WA 1M5UA 2BKAA 1BNCA 3G13A 4L50A 4IBOA 4BB0A 5CB0A 5CA0B 1N2XA 1A50B 4FDTA 1NVWQ 2G6TA 4G24A 3GJYA 3ZJTA 4GLFA 4XTCS 1RWQA 3ZWPA 5A7GA 2X40A 5ITVA 2A1UA 3I3SR 5KQPA 2W00A 5FWYB 4Y30A 1EYZA 3EG5A 2ZJOA 5DHQA 5A04A 3NHBA 1BMTA 2ZIEA 4XH9B 3G02A 1F12A 2HIAA 3VV3A 2RB4A 2KBEA 1RWBA 1XN1A 3RSSA 5TJ9A 1PR4A 3OOHA 3T1QA 3REQA 5H3LA 1KJWA 2J32A 2PZAA 3D81A 1HURA 2PPVA 2QTBA 1QV6A 3H2BA 3M4XA 1B16A 4MVJI 4X90A 5EJ6A 1WNTA 2ODEA 5B37A 3F5FA 4NXMB 1B0ZA 1CU1A 2FZVA 4FDLA 2XY4A 3S28A 4UHKA 1VBNA 3KETA 1IBMB 1Z2PX 3L1KA 3SDBA 3LYLA 5A0VA 2D5IA 3ADKA 4FEYA 4QYSA 4HWSA 5AOBA 1RQRA 3SPXA 2QQFA 2OO5A 3LDHA 3PXUA 1ECBA 2BW0A 3VNVA 3PI6A 2Q21A 2IXAA 2V3VA 1ZMTA 2ERXA 4FDVA 4EBBA 2JLVA 1KGDA 4IDOA 3X1XA 5JNTA 4ND1A 2ZRCA 1QYIA 4CEIB 4WCFA 1ZD1A 4K0KB 4MRAA 4LWQA 4BKRA 2XUAA 3W1WA 2JIDA 2RJNA 1WF6A 4TRNA 4D26A 1NZJA 2D8AA 2HMAA 2IODA 5AVSA 2BF7A 1QVWA