2NN6F

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
242
structure length
223
Chain Sequence
GTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 32
structure length 223
sequence length 242
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2nn6F00
1OYPA 2BR2A 5C0XA 2WP8B 2PO1A 5JEAB 5JEAE 2C37B 3U1KA 4BA1A 4AIMA 5JEAD 4AM3A 4OO1A 2PNZA 3L7ZB 2PO1B 2JEBA 1UDOA 4IFDF 1R6MA 4OO1F 2C38A 2PO2B 3B4TA 3GCMA 2PNZB 2NN6C 2WNRA 5K36B 5C0XC 1E3PA 2C38B 2PO0B 2NN6B 2NN6E 2JEAB 3KRNA 1UDNA 2BR2B 1R6LA 5C0XB 5C0XE 4IFDA 2NN6D 5JEAF 2JE6A 4BA1B 4BA2A 3M7ND 3M85D 3DD6A 5K36C 4OO1B 4OO1E 3HKMA 2JEBB 3CDJA 3H1CA 5K36E 4BA2B 2WP8A 5K36D 3M7NG 5JEAA 2C37A 3M85G 2WNRB 3GMEA 2BA0D 4IFDC 4OO1C 2BA1D 5C0XD 2NN6F 2C39A 3L7ZA 5C0XF 4IFDE 4IFDB 1OYSA 1OYRA 2JE6B 2PO2A 2BA0G 4IFDD 1UDSA 4OO1D 3CDIA 4NBQA 2C39B 2BA1G 3GLLA 1UDQA 5K36A 2PO0A 5JEAC 2NN6A 5K36F 4AIDA 2JEAA 1E3HA
chains in the Genus database with same CATH superfamily
1ZM9A 3WU6A 2O1TA 4JI6E 4LF4E 4DPWA 1Y4SA 2PO1A 5JEAB 4K0KI 4BA1A 4X66E 4DR5I 4NXNE 4PRXA 2GO4A 5JEAD 3T1HI 3L7ZB 4IFDF 4OO1F 3P3GA 4JI2E 4MU3A 4X65E 2PO2B 4HACB 1XNRE 3J7AM 3GCMA 2R42A 1XMQI 3T1YI 4OX9E 4B3RE 2Z5CA 5FLXC 4OZEA 4LCFA 4FW4A 3WU5A 2VQEI 1OJ4A 4LCGA 2UXCE 4LF9E 2UU9I 4WUCA 3J80Q 3PS2A 4LF6I 1Y4UA 2NN6E 5BR8I 1N0UA 4GQUA 3KRNA 4DPYA 1R6LA 4LFCE 5C0XE 2VF3A 1UEKA 3M6AA 5JEAF 4BA1B 1N33I 4BA2A 4DV5E 2ZM6I 3M85D 1B62A 4RPFA 4UTGA 1XMOE 4DV0E 1Z0EA 3V2UC 4DUZI 3P3CA 3HKMA 2F4VE 3H1CA 4DV1E 5K36E 1HNWI 2HHHI 5IT9C 1H7SA 1HR0I 2E5LI 2WP8A 1HNZI 4USKA 2AJ4A 4MYUA 3LTOA 3M7NG 3PYEA 2VESA 5DNXA 4K0KE 4DR5E 3P3EA 5C0XD 1Z0BA 1ZM2A 2F1DA 2PNMA 1RHYA 4IFDE 1N32I 1PVGA 1EI1A 4ISAA 3U1YA 4DXLA 1FKAE 1UDSA 4R1FA 4B3SI 3ZZ0A 2CZ9A 2C39B 1XMQE 3T1YE 2UUCI 4J3DA 1ZXNA 4JI3I 1RREA 4JV5E 2VQEE 1ELOA 4DU8A 5LMUI 2Z5EA 1IBLI 4DV4I 5BR8E 3J7AG 5L3JA 4GKKI 2BR2A 5IWAI 1FI4A 3P06A 2WP8B 3J81C 1Y60A 4HY1A 5JEAE 3NZKA 4DR3I 1N33E 1FWKA 2NPFA 1MU5A 4DV2I 1IBKI 2Q2EB 4DUZE 4JI4I 2GO3A 4NXMI 3PRYA 4LCHA 4U3DA 4LF7I 1HNWE 2HHHE 3B4TA 4KQVA 1KKHA 1HR0E 2E5LE 2JT2A 1HNZE 3PS3A 2A2DA 4FW9A 1DARA 4MYTA 4JI5I 3QT6A 3F0NA 4X62E 3HULA 1UDNA 2BR2B 2IOQA 2WW4A 4LFBI 1S16A 4LF5E 1N32E 4Z7YA 4QNJA 3UHMA 4B3SE 4DR1I 2AE8A 4PU9A 1EA6A 4LF8I 4YHHI 2CG9A 2UUCE 1XXEA 4JYAE 4JI3E 4B3MI 3ZKDA 4XTJA 1NHIA 4WUDA 4DV4E 1IBMI 2UUBI 4GKKE 4MU1A 2C37A 4DR2I 3M85G 2BM1A 4DUYI 2BA0D 4HXZA 4LOMA 1RR9A 2E1RA 3PS1A 2BA1D 5IT9Q 1KVKA 2LJPA 4DV2E 1XNQE 2C39A 3B82A 4B3TI 2V2ZA 4LPFA 5DRPA 1YHCA 5LMNI 3ZZUA 1Z0TA 5LL6R 2J7KA 4JI1I 2HFUA 4NXME 3CWVA 4LF7E 4JI7E 3CDIA 4NBQA 4URLA 1YH8A 3GLLA 4EMDA 3WU3A 5K36A 2OI2A 3B78A 3J80C 1ZXMA 2EFGA 3PYGA 4JI5E 4ED4A 5A2QQ 4AIDA 5FWKA 4ZVIA 4DR6I 1OYPA 2O3ZA 2V2QA 1U2RA 4U3BA 4AQYI 3T1HE 2O1VA 4LFBE 2C37B 3U1KA 3D4JA 3JAMQ 3V5RA 1N36I 1KIJA 3Q1QA 1ZM4A 4FW3A 1Y5YA 2DEIA 4LF4I 1MX0A 4AM3A 2UUAI 3LNUA 1Z0WA 2VQFI 4OO1A 1XHKA 1S4EA 4LF8E 2JEBA 1UDOA 4YHHE 1R6MA 4X64I 2O1UA 1N0VC 4KHPI 4IZJA 3K85A 2CGEA 4B3ME 2UU9E 1VI7A 4LF6E 4M1KA 2A2CA 1NHJA 2UUBE 3H4LA 1H74A 2PNZB 4I3HA 4DR2E 4DR7I 1Z0VA 5K36B 1XNRI 4WUBA 2C38B 5GMDA 5ELWA 1H73A 1WUUA 2ZM6E 4OX9I 4B3TE 1PIEA 2BM0A 5LMNE 1HNXI 3Q6NA 2JE6A 4IZKA 1J5EI 2XEXA 4UT4A 1Z59A 4DPXA 4JI8I 3DD6A 4PRVA 2UXBI 4OO1B 2J65A 1USUA 3ZM7A 3PYFA 2BV3A 2JEBB 4JI0I 4FWHA 3QT7A 4DV5I 4FW5A 4IZJB 1XMOI 4DR6E 4IZJD 4MU0A 2V2VA 3K1JA 5FLXQ 4FW6A 1N36E 4MQYA 3OTOI 1H7UA 2UUAE 2VQFE 4DV6I 4MDTA 1OYRA 2JE6B 5GMEA 4X64E 4IZKB 2CVEA 2BA0G 4P7AA 4KHPE 1I94I 1IBLE 5LMUE 3QT8A 3B8HA 4GKJI 2BA1G 5IWAE 3PYDA 4MU4A 2O1WA 5DRRA 1FNMA 4DR7E 2PO0A 2NN6A 4DR3E 1Z5CA 2JEAA 4P52A 5C0XA 1IBKE 2Z5BB 4LFAI 1P42A 4JV5I 1FJGI 4FN5A 1HNXE 1J5EE 4AIMA 4JI4E 2IESA 2GS8A 4DV3I 4JI8E 1PKPA 1Z0GA 2ZITA 4N3OA 2UXDI 2PNZA 2PO1B 2UXBE 4IS9A 2HK2A 2PNLA 4JI0E 1N34I 2C38A 4DR4I 1B63A 2NN6C 2X7IA 2WNRA 3LPSA 1K47A 4YY3I 1BKNA 1KTVA 1E3PA 5C0XC 2PO0B 4DV7I 2NN6B 4JI6I 4DPTA 3OTOE 2JEAB 4DR1E 5C0XB 4IFDA 2NN6D 2Z5CB 3K17A 4DV6E 3J81Q 4X66I 4NXNI 2ZBKB 1FWLA 4FW7A 1A6FA 2HFSA 4X62I 1H72C 3M7ND 4FWGA 3Q6MA 4FWDA 1I94E 5K36C 3ZKBA 4GKJE 1IBME 4OO1E 4LF5I 3CDJA 4JI2I 4DUYE 4X65I 3P76A 5A2QC 4BA2B 1Z0CA 1Z5BA 2HKJA 4JG4A 3WU4A 5K36D 1D6TA 4B3RI 5JEAA 1NHHA 4HYMA 4LFAE 1ZM3A 3JAMC 1Y6ZA 2WNRB 4JYAI 3GMEA 2V34A 2UXCI 4LF9I 2GQ0A 1FJGE 1HK7A 4OKGA 1NZ0A 4IFDC 4OO1C 5DNLA 4JI1E 4DV3E 2NN6F 2HK3A 5DROA 1Z5AA 3L7ZA 4LFCI 3ZZTA 2UXDE 4Z7CA 5C0XF 4DPUA 4IFDB 2X36A 1OYSA 1QZRA 2PO2A 4HACA 1N34E 5EL9A 4IFDD 4DR4E 2IOPA 2V8PA 1XNQI 4OO1D 4QNKA 2DEJA 5EKWA 2HKEA 4DV0I 2Z5BA 1MG7A 5DRQA 1UDQA 1USVA 4USMA 2IERA 4DU7A 1VISA 3HJCA 4AQYE 3QT5A 2F4VI 4DV1I 4YY3E 3GONA 2R3VA 4JI7I 5JEAC 5K36F 4DV7E 1E3HA
chains in the Genus database with same CATH topology
1OYPA 2BR2A 5C0XA 2WP8B 2PO1A 5JEAB 5JEAE 2C37B 3U1KA 4BA1A 4AIMA 5JEAD 4AM3A 4OO1A 2PNZA 3L7ZB 2PO1B 2JEBA 1UDOA 4IFDF 1R6MA 4OO1F 2C38A 2PO2B 3B4TA 3GCMA 2PNZB 2NN6C 2WNRA 5K36B 5C0XC 1E3PA 2C38B 2PO0B 2NN6B 2NN6E 2JEAB 3KRNA 1UDNA 2BR2B 1R6LA 5C0XB 5C0XE 4IFDA 2NN6D 5JEAF 2JE6A 4BA1B 4BA2A 3M7ND 3M85D 3DD6A 5K36C 4OO1B 4OO1E 3HKMA 2JEBB 3CDJA 3H1CA 5K36E 4BA2B 2WP8A 5K36D 3M7NG 5JEAA 2C37A 3M85G 2WNRB 3GMEA 2BA0D 4IFDC 4OO1C 2BA1D 5C0XD 2NN6F 2C39A 3L7ZA 5C0XF 4IFDE 4IFDB 1OYSA 1OYRA 2JE6B 2PO2A 2BA0G 4IFDD 1UDSA 4OO1D 3CDIA 4NBQA 2C39B 2BA1G 3GLLA 1UDQA 5K36A 2PO0A 5JEAC 2NN6A 5K36F 4AIDA 2JEAA 1E3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYP A;  2BR2 A;  5C0X A;  2WP8 B;  2PO1 A;  5JEA B;  5JEA E;  2C37 B;  3U1K A;  4BA1 A;  4AIM A;  5JEA D;  4AM3 A;  4OO1 A;  2PNZ A;  3L7Z B;  2PO1 B;  2JEB A;  1UDO A;  4IFD F;  1R6M A;  4OO1 F;  2C38 A;  2PO2 B;  3B4T A;  3GCM A;  2PNZ B;  2NN6 C;  2WNR A;  5K36 B;  5C0X C;  1E3P A;  2C38 B;  2PO0 B;  2NN6 B;  2NN6 E;  2JEA B;  3KRN A;  1UDN A;  2BR2 B;  1R6L A;  5C0X B;  5C0X E;  4IFD A;  2NN6 D;  5JEA F;  2JE6 A;  4BA1 B;  4BA2 A;  3M7N D;  3M85 D;  3DD6 A;  5K36 C;  4OO1 B;  4OO1 E;  3HKM A;  2JEB B;  3CDJ A;  3H1C A;  5K36 E;  4BA2 B;  2WP8 A;  5K36 D;  3M7N G;  5JEA A;  2C37 A;  3M85 G;  2WNR B;  3GME A;  2BA0 D;  4IFD C;  4OO1 C;  2BA1 D;  5C0X D;  2NN6 F;  2C39 A;  3L7Z A;  5C0X F;  4IFD E;  4IFD B;  1OYS A;  1OYR A;  2JE6 B;  2PO2 A;  2BA0 G;  4IFD D;  1UDS A;  4OO1 D;  3CDI A;  4NBQ A;  2C39 B;  2BA1 G;  3GLL A;  1UDQ A;  5K36 A;  2PO0 A;  5JEA C;  2NN6 A;  5K36 F;  4AID A;  2JEA A;  1E3H A; 
#chains in the Genus database with same CATH topology
 1ZM9 A;  3WU6 A;  2O1T A;  4JI6 E;  4LF4 E;  4DPW A;  1Y4S A;  2PO1 A;  5JEA B;  4K0K I;  4BA1 A;  4X66 E;  4DR5 I;  4NXN E;  4PRX A;  2GO4 A;  5JEA D;  3T1H I;  3L7Z B;  4IFD F;  4OO1 F;  3P3G A;  4JI2 E;  4MU3 A;  4X65 E;  2PO2 B;  4HAC B;  1XNR E;  3J7A M;  3GCM A;  2R42 A;  1XMQ I;  3T1Y I;  4OX9 E;  4B3R E;  2Z5C A;  5FLX C;  4OZE A;  4LCF A;  4FW4 A;  3WU5 A;  2VQE I;  1OJ4 A;  4LCG A;  2UXC E;  4LF9 E;  2UU9 I;  4WUC A;  3J80 Q;  3PS2 A;  4LF6 I;  1Y4U A;  2NN6 E;  5BR8 I;  1N0U A;  4GQU A;  3KRN A;  4DPY A;  1R6L A;  4LFC E;  5C0X E;  2VF3 A;  1UEK A;  3M6A A;  5JEA F;  4BA1 B;  1N33 I;  4BA2 A;  4DV5 E;  2ZM6 I;  3M85 D;  1B62 A;  4RPF A;  4UTG A;  1XMO E;  4DV0 E;  1Z0E A;  3V2U C;  4DUZ I;  3P3C A;  3HKM A;  2F4V E;  3H1C A;  4DV1 E;  5K36 E;  1HNW I;  2HHH I;  5IT9 C;  1H7S A;  1HR0 I;  2E5L I;  2WP8 A;  1HNZ I;  4USK A;  2AJ4 A;  4MYU A;  3LTO A;  3M7N G;  3PYE A;  2VES A;  5DNX A;  4K0K E;  4DR5 E;  3P3E A;  5C0X D;  1Z0B A;  1ZM2 A;  2F1D A;  2PNM A;  1RHY A;  4IFD E;  1N32 I;  1PVG A;  1EI1 A;  4ISA A;  3U1Y A;  4DXL A;  1FKA E;  1UDS A;  4R1F A;  4B3S I;  3ZZ0 A;  2CZ9 A;  2C39 B;  1XMQ E;  3T1Y E;  2UUC I;  4J3D A;  1ZXN A;  4JI3 I;  1RRE A;  4JV5 E;  2VQE E;  1ELO A;  4DU8 A;  5LMU I;  2Z5E A;  1IBL I;  4DV4 I;  5BR8 E;  3J7A G;  5L3J A;  4GKK I;  2BR2 A;  5IWA I;  1FI4 A;  3P06 A;  2WP8 B;  3J81 C;  1Y60 A;  4HY1 A;  5JEA E;  3NZK A;  4DR3 I;  1N33 E;  1FWK A;  2NPF A;  1MU5 A;  4DV2 I;  1IBK I;  2Q2E B;  4DUZ E;  4JI4 I;  2GO3 A;  4NXM I;  3PRY A;  4LCH A;  4U3D A;  4LF7 I;  1HNW E;  2HHH E;  3B4T A;  4KQV A;  1KKH A;  1HR0 E;  2E5L E;  2JT2 A;  1HNZ E;  3PS3 A;  2A2D A;  4FW9 A;  1DAR A;  4MYT A;  4JI5 I;  3QT6 A;  3F0N A;  4X62 E;  3HUL A;  1UDN A;  2BR2 B;  2IOQ A;  2WW4 A;  4LFB I;  1S16 A;  4LF5 E;  1N32 E;  4Z7Y A;  4QNJ A;  3UHM A;  4B3S E;  4DR1 I;  2AE8 A;  4PU9 A;  1EA6 A;  4LF8 I;  4YHH I;  2CG9 A;  2UUC E;  1XXE A;  4JYA E;  4JI3 E;  4B3M I;  3ZKD A;  4XTJ A;  1NHI A;  4WUD A;  4DV4 E;  1IBM I;  2UUB I;  4GKK E;  4MU1 A;  2C37 A;  4DR2 I;  3M85 G;  2BM1 A;  4DUY I;  2BA0 D;  4HXZ A;  4LOM A;  1RR9 A;  2E1R A;  3PS1 A;  2BA1 D;  5IT9 Q;  1KVK A;  2LJP A;  4DV2 E;  1XNQ E;  2C39 A;  3B82 A;  4B3T I;  2V2Z A;  4LPF A;  5DRP A;  1YHC A;  5LMN I;  3ZZU A;  1Z0T A;  5LL6 R;  2J7K A;  4JI1 I;  2HFU A;  4NXM E;  3CWV A;  4LF7 E;  4JI7 E;  3CDI A;  4NBQ A;  4URL A;  1YH8 A;  3GLL A;  4EMD A;  3WU3 A;  5K36 A;  2OI2 A;  3B78 A;  3J80 C;  1ZXM A;  2EFG A;  3PYG A;  4JI5 E;  4ED4 A;  5A2Q Q;  4AID A;  5FWK A;  4ZVI A;  4DR6 I;  1OYP A;  2O3Z A;  2V2Q A;  1U2R A;  4U3B A;  4AQY I;  3T1H E;  2O1V A;  4LFB E;  2C37 B;  3U1K A;  3D4J A;  3JAM Q;  3V5R A;  1N36 I;  1KIJ A;  3Q1Q A;  1ZM4 A;  4FW3 A;  1Y5Y A;  2DEI A;  4LF4 I;  1MX0 A;  4AM3 A;  2UUA I;  3LNU A;  1Z0W A;  2VQF I;  4OO1 A;  1XHK A;  1S4E A;  4LF8 E;  2JEB A;  1UDO A;  4YHH E;  1R6M A;  4X64 I;  2O1U A;  1N0V C;  4KHP I;  4IZJ A;  3K85 A;  2CGE A;  4B3M E;  2UU9 E;  1VI7 A;  4LF6 E;  4M1K A;  2A2C A;  1NHJ A;  2UUB E;  3H4L A;  1H74 A;  2PNZ B;  4I3H A;  4DR2 E;  4DR7 I;  1Z0V A;  5K36 B;  1XNR I;  4WUB A;  2C38 B;  5GMD A;  5ELW A;  1H73 A;  1WUU A;  2ZM6 E;  4OX9 I;  4B3T E;  1PIE A;  2BM0 A;  5LMN E;  1HNX I;  3Q6N A;  2JE6 A;  4IZK A;  1J5E I;  2XEX A;  4UT4 A;  1Z59 A;  4DPX A;  4JI8 I;  3DD6 A;  4PRV A;  2UXB I;  4OO1 B;  2J65 A;  1USU A;  3ZM7 A;  3PYF A;  2BV3 A;  2JEB B;  4JI0 I;  4FWH A;  3QT7 A;  4DV5 I;  4FW5 A;  4IZJ B;  1XMO I;  4DR6 E;  4IZJ D;  4MU0 A;  2V2V A;  3K1J A;  5FLX Q;  4FW6 A;  1N36 E;  4MQY A;  3OTO I;  1H7U A;  2UUA E;  2VQF E;  4DV6 I;  4MDT A;  1OYR A;  2JE6 B;  5GME A;  4X64 E;  4IZK B;  2CVE A;  2BA0 G;  4P7A A;  4KHP E;  1I94 I;  1IBL E;  5LMU E;  3QT8 A;  3B8H A;  4GKJ I;  2BA1 G;  5IWA E;  3PYD A;  4MU4 A;  2O1W A;  5DRR A;  1FNM A;  4DR7 E;  2PO0 A;  2NN6 A;  4DR3 E;  1Z5C A;  2JEA A;  4P52 A;  5C0X A;  1IBK E;  2Z5B B;  4LFA I;  1P42 A;  4JV5 I;  1FJG I;  4FN5 A;  1HNX E;  1J5E E;  4AIM A;  4JI4 E;  2IES A;  2GS8 A;  4DV3 I;  4JI8 E;  1PKP A;  1Z0G A;  2ZIT A;  4N3O A;  2UXD I;  2PNZ A;  2PO1 B;  2UXB E;  4IS9 A;  2HK2 A;  2PNL A;  4JI0 E;  1N34 I;  2C38 A;  4DR4 I;  1B63 A;  2NN6 C;  2X7I A;  2WNR A;  3LPS A;  1K47 A;  4YY3 I;  1BKN A;  1KTV A;  1E3P A;  5C0X C;  2PO0 B;  4DV7 I;  2NN6 B;  4JI6 I;  4DPT A;  3OTO E;  2JEA B;  4DR1 E;  5C0X B;  4IFD A;  2NN6 D;  2Z5C B;  3K17 A;  4DV6 E;  3J81 Q;  4X66 I;  4NXN I;  2ZBK B;  1FWL A;  4FW7 A;  1A6F A;  2HFS A;  4X62 I;  1H72 C;  3M7N D;  4FWG A;  3Q6M A;  4FWD A;  1I94 E;  5K36 C;  3ZKB A;  4GKJ E;  1IBM E;  4OO1 E;  4LF5 I;  3CDJ A;  4JI2 I;  4DUY E;  4X65 I;  3P76 A;  5A2Q C;  4BA2 B;  1Z0C A;  1Z5B A;  2HKJ A;  4JG4 A;  3WU4 A;  5K36 D;  1D6T A;  4B3R I;  5JEA A;  1NHH A;  4HYM A;  4LFA E;  1ZM3 A;  3JAM C;  1Y6Z A;  2WNR B;  4JYA I;  3GME A;  2V34 A;  2UXC I;  4LF9 I;  2GQ0 A;  1FJG E;  1HK7 A;  4OKG A;  1NZ0 A;  4IFD C;  4OO1 C;  5DNL A;  4JI1 E;  4DV3 E;  2NN6 F;  2HK3 A;  5DRO A;  1Z5A A;  3L7Z A;  4LFC I;  3ZZT A;  2UXD E;  4Z7C A;  5C0X F;  4DPU A;  4IFD B;  2X36 A;  1OYS A;  1QZR A;  2PO2 A;  4HAC A;  1N34 E;  5EL9 A;  4IFD D;  4DR4 E;  2IOP A;  2V8P A;  1XNQ I;  4OO1 D;  4QNK A;  2DEJ A;  5EKW A;  2HKE A;  4DV0 I;  2Z5B A;  1MG7 A;  5DRQ A;  1UDQ A;  1USV A;  4USM A;  2IER A;  4DU7 A;  1VIS A;  3HJC A;  4AQY E;  3QT5 A;  2F4V I;  4DV1 I;  4YY3 E;  3GON A;  2R3V A;  4JI7 I;  5JEA C;  5K36 F;  4DV7 E;  1E3H A; 
#chains in the Genus database with same CATH homology
 1OYP A;  2BR2 A;  5C0X A;  2WP8 B;  2PO1 A;  5JEA B;  5JEA E;  2C37 B;  3U1K A;  4BA1 A;  4AIM A;  5JEA D;  4AM3 A;  4OO1 A;  2PNZ A;  3L7Z B;  2PO1 B;  2JEB A;  1UDO A;  4IFD F;  1R6M A;  4OO1 F;  2C38 A;  2PO2 B;  3B4T A;  3GCM A;  2PNZ B;  2NN6 C;  2WNR A;  5K36 B;  5C0X C;  1E3P A;  2C38 B;  2PO0 B;  2NN6 B;  2NN6 E;  2JEA B;  3KRN A;  1UDN A;  2BR2 B;  1R6L A;  5C0X B;  5C0X E;  4IFD A;  2NN6 D;  5JEA F;  2JE6 A;  4BA1 B;  4BA2 A;  3M7N D;  3M85 D;  3DD6 A;  5K36 C;  4OO1 B;  4OO1 E;  3HKM A;  2JEB B;  3CDJ A;  3H1C A;  5K36 E;  4BA2 B;  2WP8 A;  5K36 D;  3M7N G;  5JEA A;  2C37 A;  3M85 G;  2WNR B;  3GME A;  2BA0 D;  4IFD C;  4OO1 C;  2BA1 D;  5C0X D;  2NN6 F;  2C39 A;  3L7Z A;  5C0X F;  4IFD E;  4IFD B;  1OYS A;  1OYR A;  2JE6 B;  2PO2 A;  2BA0 G;  4IFD D;  1UDS A;  4OO1 D;  3CDI A;  4NBQ A;  2C39 B;  2BA1 G;  3GLL A;  1UDQ A;  5K36 A;  2PO0 A;  5JEA C;  2NN6 A;  5K36 F;  4AID A;  2JEA A;  1E3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...