2NN6F

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
242
structure length
223
Chain Sequence
b'GTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 32
structure length 223
sequence length 242
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2nn6F00
5C0XC 4OO1C 5JEAB 3M85D 4BA2B 1UDSA 3CDIA 4IFDA 2C39B 4BA1B 5C0XD 2JEAB 3M7ND 2PNZA 3U1KA 2WP8B 2NN6E 2NN6C 5C0XB 4AIMA 5JEAF 5K36E 1UDOA 5K36C 3M85G 4OO1E 5JEAA 3DD6A 2NN6D 4BA2A 4AM3A 3M7NG 2C39A 2BA0G 4BA1A 5K36D 2JEAA 5C0XF 4OO1D 3HKMA 4OO1F 2NN6B 3CDJA 2WP8A 2PO0B 5K36B 1E3HA 5C0XA 2C38B 4OO1B 3L7ZB 3B4TA 4NBQA 1UDNA 3GMEA 3KRNA 4AIDA 2NN6F 1R6MA 1E3PA 2BA1D 4IFDE 2PO2B 1R6LA 5K36F 4IFDC 2NN6A 3H1CA 2PO0A 2BR2B 5K36A 2C38A 4OO1A 2JE6B 3L7ZA 2WNRB 2JEBB 4IFDD 2PO1A 4IFDF 2PO1B 1OYRA 2BA1G 5JEAE 5JEAC 4IFDB 2PO2A 2BA0D 2PNZB 5C0XE 1OYSA 3GCMA 2BR2A 5JEAD 1UDQA 2C37A 2C37B 1OYPA 3GLLA 2JE6A 2WNRA 2JEBA
chains in the Genus database with same CATH superfamily
5DNLA 4X65E 4DV6I 2X7IA 1Z59A 4JI1E 4QNKA 4JI7I 3Q6MA 4JI5I 1NHHA 3ZKDA 2C39B 4DXLA 3UHMA 3J80C 1HNZI 4GKJI 2ZBKB 2CZ9A 4U3BA 4PRVA 2PNZA 3Q1QA 4HYMA 5LMNI 1N32I 4FW7A 4KQVA 5DNXA 4AIMA 1YH8A 5K36E 5GMEA 4JI0E 2AJ4A 4JI6E 2VQFI 4X62E 3JAMQ 1IBLI 3PYGA 1PVGA 1ZXMA 4DR2E 4WUCA 4LF6I 4DV7I 2NN6D 4AM3A 1FI4A 3M7NG 2C39A 4K0KE 4FN5A 3PS2A 4ISAA 5IT9Q 3HKMA 3CWVA 2NN6B 3P3GA 2R42A 4GQUA 2UXDE 2PNMA 4X64I 4DV4E 1N33I 3GONA 1B63A 2C38B 4U3DA 5LMUI 1N0UA 2Z5BB 2PNLA 2O1WA 2VQEE 3KRNA 4LFCI 4X66I 3ZM7A 1E3PA 4EMDA 1IBME 1H74A 1ZM3A 4IFDE 1NHJA 4MU0A 3PRYA 4IS9A 2NN6A 3H1CA 2A2CA 4DR5E 2BR2B 1VISA 1XMQE 4LOMA 1HNXI 4LF7I 3V2UC 5IWAI 2C38A 4AQYI 5BR8I 2JE6B 4JV5E 2PO1B 4DV2E 1XMOE 1WUUA 2F1DA 2HK3A 2HHHI 4DU7A 2Z5CB 3PS1A 4I3HA 4P52A 1YHCA 4JI2E 1N36I 3B8HA 1FJGE 2CGEA 3K1JA 1ZM2A 2OI2A 3F0NA 2BR2A 1UEKA 5JEAD 4IZKB 1PIEA 4DV0E 4DV5E 4PU9A 2C37B 1KKHA 1OYPA 2UXCE 2JE6A 1R6LA 5EKWA 4OX9E 2HK2A 4JI4I 1FWKA 5JEAB 3ZZTA 1RREA 4DPXA 4JI8I 4DUYI 2GO4A 1FWLA 3J80Q 1XNRI 2HFSA 1UDSA 2Z5CA 3P3EA 3H4LA 4JI3E 4JYAE 4MYUA 2IOQA 4LFBI 5C0XD 3OTOI 1XNQE 1MU5A 2UUCI 3K85A 4DPYA 3M7ND 4YY3I 4LFAE 2WP8B 1QZRA 2UUBI 2Q2EB 2IOPA 2NN6C 4IZKA 5C0XB 1HNWE 4NXME 2O1UA 2XEXA 1Y4UA 3M85G 4LF9I 4OO1E 1KTVA 5JEAA 2JT2A 2Z5EA 4DR7E 5EL9A 1A6FA 4B3ME 2UU9I 2UXBI 5K36D 1KIJA 3J7AM 2E1RA 4DPTA 1N0VC 2WP8A 2PO0B 4JI6I 5K36B 1H7UA 5C0XA 2E5LI 3WU5A 2LJPA 4NBQA 3J81C 4LF4I 4GKKE 4DPUA 4K0KI 4AIDA 1PKPA 4P7AA 1ZM4A 2R3VA 2O3ZA 3PYDA 2IERA 4JI7E 1Z5BA 4B3SE 2CVEA 1USVA 2VF3A 3WU3A 2UXDI 4URLA 1HNZE 3K17A 1EI1A 2DEJA 2PO0A 5A2QC 1HR0I 5K36A 1Z0VA 5LMNE 1N32E 1J5EI 3LTOA 4LF5I 2WNRB 4IFDD 2V2ZA 2AE8A 2BA1G 1BKNA 1DARA 1Y60A 4YHHE 5JEAC 2ZM6E 1I94I 4IFDB 3LNUA 4MDTA 4NXNE 2CG9A 4UTGA 1H7SA 4FW5A 3Q6NA 1FKAE 4LF8I 4DV3I 4B3RE 1N33E 5L3JA 2WNRA 3LPSA 5C0XC 1XMOI 1VI7A 4OO1C 2BM0A 5LMUE 1S4EA 2GQ0A 2V2QA 4ZVIA 3M85D 4RPFA 4LCFA 4BA2B 4XTJA 3CDIA 4IFDA 4DUZE 4X66E 4LFCE 2UUAE 1FJGI 2O1TA 4KHPI 1Z0EA 1IBKI 4DR3E 5DROA 1Y6ZA 2JEAB 3WU4A 1N34E 3HULA 4DV0I 2V8PA 4OX9I 4ED4A 5K36C 5BR8E 1Z0WA 3T1YE 4JI3I 2ZITA 4BA2A 4QNJA 4DR1I 4MU3A 3T1HE 4LFAI 2NPFA 2HHHE 4FW4A 3PS3A 4WUDA 2JEAA 4DR4I 5FLXC 2X36A 4OO1D 3CDJA 2J7KA 1N36E 1HNWI 1U2RA 3ZZ0A 3J81Q 4DR6I 1E3HA 2DEIA 1H73A 4OO1B 3L7ZB 4X65I 4J3DA 1UDNA 3QT5A 4B3MI 1Z0TA 4JI1I 1Y4SA 4MQYA 4HACB 1Z0BA 3GMEA 4DV1E 4DR6E 4HY1A 4N3OA 4DUYE 1XNRE 2NN6F 1R6MA 2HFUA 2BA1D 5A2QQ 3J7AG 4FWDA 2PO2B 4IFDC 4Z7YA 3OTOE 1ZXNA 2O1VA 4JI0I 3PYEA 3PYFA 2UUBE 4FWGA 3WU6A 4OO1A 1Z0CA 1FNMA 4USKA 3L7ZA 4X62I 4B3TE 2F4VE 2JEBB 4IFDF 4DR2I 4HACA 4MU1A 4LF9E 4UT4A 4B3SI 5ELWA 1EA6A 4DV6E 2HKEA 2UU9E 2UXBE 1RHYA 2PO2A 2BA0D 4JI5E 1Y5YA 5GMDA 4DV4I 4GKJE 3B82A 3QT7A 3V5RA 4R1FA 1NHIA 1UDQA 1B62A 2GS8A 2VQEI 3NZKA 3D4JA 2JEBA 5LL6R 2E5LE 4JG4A 1S16A 1Z0GA 4YHHI 2ZM6I 1ZM9A 2VQFE 4LF4E 4NXNI 1IBMI 1IBLE 4MYTA 4BA1B 1RR9A 4LF6E 4DV7E 4IZJD 4OZEA 4DPWA 4DR5I 2BV3A 1XMQI 2VESA 3U1KA 4B3RI 2NN6E 4M1KA 2EFGA 4IZJB 1Z5AA 5JEAF 1Z5CA 1HR0E 4JV5I 4X64E 1UDOA 4HXZA 4FW9A 4DV2I 1J5EE 2WW4A 4USMA 4LF5E 3DD6A 5DRQA 4DUZI 2UUAI 1ELOA 2GO3A 4DR3I 3ZKBA 4JI2I 3JAMC 3U1YA 1K47A 5FLXQ 1N34I 2BA0G 4BA1A 1KVKA 1MX0A 4WUBA 2IESA 1I94E 3QT6A 2BM1A 2V34A 5C0XF 2HKJA 4OO1F 4DV5I 3P06A 2UXCI 5IT9C 1XHKA 4IZJA 1MG7A 5FWKA 2Z5BA 3B4TA 3T1YI 4FWHA 1HNXE 4LF7E 4LF8E 4DV3E 5IWAE 4AQYE 4LPFA 3T1HI 4MU4A 4JYAI 1D6TA 1NZ0A 1XNQI 1OJ4A 3P3CA 3B78A 4OKGA 5DRPA 2V2VA 3ZZUA 5K36F 4Z7CA 4KHPE 1IBKE 2J65A 4LCGA 4FW6A 3HJCA 4NXMI 4DV1I 2PO1A 4DR7I 1XXEA 1OYRA 4DU8A 3M6AA 5JEAE 3P76A 4JI4E 1H72C 4JI8E 5DRRA 4DR1E 3QT8A 2A2DA 2PNZB 4PRXA 1OYSA 4LFBE 4FW3A 1USUA 3GCMA 4DR4E 2UUCE 4B3TI 2F4VI 4LCHA 1P42A 4YY3E 2C37A 1HK7A 3GLLA 5C0XE 4GKKI
chains in the Genus database with same CATH topology
5C0XC 4OO1C 5JEAB 3M85D 4BA2B 1UDSA 3CDIA 4IFDA 2C39B 4BA1B 5C0XD 2JEAB 3M7ND 2PNZA 3U1KA 2WP8B 2NN6E 2NN6C 5C0XB 4AIMA 5JEAF 5K36E 1UDOA 5K36C 3M85G 4OO1E 5JEAA 3DD6A 2NN6D 4BA2A 4AM3A 3M7NG 2C39A 2BA0G 4BA1A 5K36D 2JEAA 5C0XF 4OO1D 3HKMA 4OO1F 2NN6B 3CDJA 2WP8A 2PO0B 5K36B 1E3HA 5C0XA 2C38B 4OO1B 3L7ZB 3B4TA 4NBQA 1UDNA 3GMEA 3KRNA 4AIDA 2NN6F 1R6MA 1E3PA 2BA1D 4IFDE 2PO2B 1R6LA 5K36F 4IFDC 2NN6A 3H1CA 2PO0A 2BR2B 5K36A 2C38A 4OO1A 2JE6B 3L7ZA 2WNRB 2JEBB 4IFDD 2PO1A 4IFDF 2PO1B 1OYRA 2BA1G 5JEAE 5JEAC 4IFDB 2PO2A 2BA0D 2PNZB 5C0XE 1OYSA 3GCMA 2BR2A 5JEAD 1UDQA 2C37A 2C37B 1OYPA 3GLLA 2JE6A 2WNRA 2JEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X C;  4OO1 C;  5JEA B;  3M85 D;  4BA2 B;  1UDS A;  3CDI A;  4IFD A;  2C39 B;  4BA1 B;  5C0X D;  2JEA B;  3M7N D;  2PNZ A;  3U1K A;  2WP8 B;  2NN6 E;  2NN6 C;  5C0X B;  4AIM A;  5JEA F;  5K36 E;  1UDO A;  5K36 C;  3M85 G;  4OO1 E;  5JEA A;  3DD6 A;  2NN6 D;  4BA2 A;  4AM3 A;  3M7N G;  2C39 A;  2BA0 G;  4BA1 A;  5K36 D;  2JEA A;  5C0X F;  4OO1 D;  3HKM A;  4OO1 F;  2NN6 B;  3CDJ A;  2WP8 A;  2PO0 B;  5K36 B;  1E3H A;  5C0X A;  2C38 B;  4OO1 B;  3L7Z B;  3B4T A;  4NBQ A;  1UDN A;  3GME A;  3KRN A;  4AID A;  2NN6 F;  1R6M A;  1E3P A;  2BA1 D;  4IFD E;  2PO2 B;  1R6L A;  5K36 F;  4IFD C;  2NN6 A;  3H1C A;  2PO0 A;  2BR2 B;  5K36 A;  2C38 A;  4OO1 A;  2JE6 B;  3L7Z A;  2WNR B;  2JEB B;  4IFD D;  2PO1 A;  4IFD F;  2PO1 B;  1OYR A;  2BA1 G;  5JEA E;  5JEA C;  4IFD B;  2PO2 A;  2BA0 D;  2PNZ B;  5C0X E;  1OYS A;  3GCM A;  2BR2 A;  5JEA D;  1UDQ A;  2C37 A;  2C37 B;  1OYP A;  3GLL A;  2JE6 A;  2WNR A;  2JEB A; 
#chains in the Genus database with same CATH topology
 5DNL A;  4X65 E;  4DV6 I;  2X7I A;  1Z59 A;  4JI1 E;  4QNK A;  4JI7 I;  3Q6M A;  4JI5 I;  1NHH A;  3ZKD A;  2C39 B;  4DXL A;  3UHM A;  3J80 C;  1HNZ I;  4GKJ I;  2ZBK B;  2CZ9 A;  4U3B A;  4PRV A;  2PNZ A;  3Q1Q A;  4HYM A;  5LMN I;  1N32 I;  4FW7 A;  4KQV A;  5DNX A;  4AIM A;  1YH8 A;  5K36 E;  5GME A;  4JI0 E;  2AJ4 A;  4JI6 E;  2VQF I;  4X62 E;  3JAM Q;  1IBL I;  3PYG A;  1PVG A;  1ZXM A;  4DR2 E;  4WUC A;  4LF6 I;  4DV7 I;  2NN6 D;  4AM3 A;  1FI4 A;  3M7N G;  2C39 A;  4K0K E;  4FN5 A;  3PS2 A;  4ISA A;  5IT9 Q;  3HKM A;  3CWV A;  2NN6 B;  3P3G A;  2R42 A;  4GQU A;  2UXD E;  2PNM A;  4X64 I;  4DV4 E;  1N33 I;  3GON A;  1B63 A;  2C38 B;  4U3D A;  5LMU I;  1N0U A;  2Z5B B;  2PNL A;  2O1W A;  2VQE E;  3KRN A;  4LFC I;  4X66 I;  3ZM7 A;  1E3P A;  4EMD A;  1IBM E;  1H74 A;  1ZM3 A;  4IFD E;  1NHJ A;  4MU0 A;  3PRY A;  4IS9 A;  2NN6 A;  3H1C A;  2A2C A;  4DR5 E;  2BR2 B;  1VIS A;  1XMQ E;  4LOM A;  1HNX I;  4LF7 I;  3V2U C;  5IWA I;  2C38 A;  4AQY I;  5BR8 I;  2JE6 B;  4JV5 E;  2PO1 B;  4DV2 E;  1XMO E;  1WUU A;  2F1D A;  2HK3 A;  2HHH I;  4DU7 A;  2Z5C B;  3PS1 A;  4I3H A;  4P52 A;  1YHC A;  4JI2 E;  1N36 I;  3B8H A;  1FJG E;  2CGE A;  3K1J A;  1ZM2 A;  2OI2 A;  3F0N A;  2BR2 A;  1UEK A;  5JEA D;  4IZK B;  1PIE A;  4DV0 E;  4DV5 E;  4PU9 A;  2C37 B;  1KKH A;  1OYP A;  2UXC E;  2JE6 A;  1R6L A;  5EKW A;  4OX9 E;  2HK2 A;  4JI4 I;  1FWK A;  5JEA B;  3ZZT A;  1RRE A;  4DPX A;  4JI8 I;  4DUY I;  2GO4 A;  1FWL A;  3J80 Q;  1XNR I;  2HFS A;  1UDS A;  2Z5C A;  3P3E A;  3H4L A;  4JI3 E;  4JYA E;  4MYU A;  2IOQ A;  4LFB I;  5C0X D;  3OTO I;  1XNQ E;  1MU5 A;  2UUC I;  3K85 A;  4DPY A;  3M7N D;  4YY3 I;  4LFA E;  2WP8 B;  1QZR A;  2UUB I;  2Q2E B;  2IOP A;  2NN6 C;  4IZK A;  5C0X B;  1HNW E;  4NXM E;  2O1U A;  2XEX A;  1Y4U A;  3M85 G;  4LF9 I;  4OO1 E;  1KTV A;  5JEA A;  2JT2 A;  2Z5E A;  4DR7 E;  5EL9 A;  1A6F A;  4B3M E;  2UU9 I;  2UXB I;  5K36 D;  1KIJ A;  3J7A M;  2E1R A;  4DPT A;  1N0V C;  2WP8 A;  2PO0 B;  4JI6 I;  5K36 B;  1H7U A;  5C0X A;  2E5L I;  3WU5 A;  2LJP A;  4NBQ A;  3J81 C;  4LF4 I;  4GKK E;  4DPU A;  4K0K I;  4AID A;  1PKP A;  4P7A A;  1ZM4 A;  2R3V A;  2O3Z A;  3PYD A;  2IER A;  4JI7 E;  1Z5B A;  4B3S E;  2CVE A;  1USV A;  2VF3 A;  3WU3 A;  2UXD I;  4URL A;  1HNZ E;  3K17 A;  1EI1 A;  2DEJ A;  2PO0 A;  5A2Q C;  1HR0 I;  5K36 A;  1Z0V A;  5LMN E;  1N32 E;  1J5E I;  3LTO A;  4LF5 I;  2WNR B;  4IFD D;  2V2Z A;  2AE8 A;  2BA1 G;  1BKN A;  1DAR A;  1Y60 A;  4YHH E;  5JEA C;  2ZM6 E;  1I94 I;  4IFD B;  3LNU A;  4MDT A;  4NXN E;  2CG9 A;  4UTG A;  1H7S A;  4FW5 A;  3Q6N A;  1FKA E;  4LF8 I;  4DV3 I;  4B3R E;  1N33 E;  5L3J A;  2WNR A;  3LPS A;  5C0X C;  1XMO I;  1VI7 A;  4OO1 C;  2BM0 A;  5LMU E;  1S4E A;  2GQ0 A;  2V2Q A;  4ZVI A;  3M85 D;  4RPF A;  4LCF A;  4BA2 B;  4XTJ A;  3CDI A;  4IFD A;  4DUZ E;  4X66 E;  4LFC E;  2UUA E;  1FJG I;  2O1T A;  4KHP I;  1Z0E A;  1IBK I;  4DR3 E;  5DRO A;  1Y6Z A;  2JEA B;  3WU4 A;  1N34 E;  3HUL A;  4DV0 I;  2V8P A;  4OX9 I;  4ED4 A;  5K36 C;  5BR8 E;  1Z0W A;  3T1Y E;  4JI3 I;  2ZIT A;  4BA2 A;  4QNJ A;  4DR1 I;  4MU3 A;  3T1H E;  4LFA I;  2NPF A;  2HHH E;  4FW4 A;  3PS3 A;  4WUD A;  2JEA A;  4DR4 I;  5FLX C;  2X36 A;  4OO1 D;  3CDJ A;  2J7K A;  1N36 E;  1HNW I;  1U2R A;  3ZZ0 A;  3J81 Q;  4DR6 I;  1E3H A;  2DEI A;  1H73 A;  4OO1 B;  3L7Z B;  4X65 I;  4J3D A;  1UDN A;  3QT5 A;  4B3M I;  1Z0T A;  4JI1 I;  1Y4S A;  4MQY A;  4HAC B;  1Z0B A;  3GME A;  4DV1 E;  4DR6 E;  4HY1 A;  4N3O A;  4DUY E;  1XNR E;  2NN6 F;  1R6M A;  2HFU A;  2BA1 D;  5A2Q Q;  3J7A G;  4FWD A;  2PO2 B;  4IFD C;  4Z7Y A;  3OTO E;  1ZXN A;  2O1V A;  4JI0 I;  3PYE A;  3PYF A;  2UUB E;  4FWG A;  3WU6 A;  4OO1 A;  1Z0C A;  1FNM A;  4USK A;  3L7Z A;  4X62 I;  4B3T E;  2F4V E;  2JEB B;  4IFD F;  4DR2 I;  4HAC A;  4MU1 A;  4LF9 E;  4UT4 A;  4B3S I;  5ELW A;  1EA6 A;  4DV6 E;  2HKE A;  2UU9 E;  2UXB E;  1RHY A;  2PO2 A;  2BA0 D;  4JI5 E;  1Y5Y A;  5GMD A;  4DV4 I;  4GKJ E;  3B82 A;  3QT7 A;  3V5R A;  4R1F A;  1NHI A;  1UDQ A;  1B62 A;  2GS8 A;  2VQE I;  3NZK A;  3D4J A;  2JEB A;  5LL6 R;  2E5L E;  4JG4 A;  1S16 A;  1Z0G A;  4YHH I;  2ZM6 I;  1ZM9 A;  2VQF E;  4LF4 E;  4NXN I;  1IBM I;  1IBL E;  4MYT A;  4BA1 B;  1RR9 A;  4LF6 E;  4DV7 E;  4IZJ D;  4OZE A;  4DPW A;  4DR5 I;  2BV3 A;  1XMQ I;  2VES A;  3U1K A;  4B3R I;  2NN6 E;  4M1K A;  2EFG A;  4IZJ B;  1Z5A A;  5JEA F;  1Z5C A;  1HR0 E;  4JV5 I;  4X64 E;  1UDO A;  4HXZ A;  4FW9 A;  4DV2 I;  1J5E E;  2WW4 A;  4USM A;  4LF5 E;  3DD6 A;  5DRQ A;  4DUZ I;  2UUA I;  1ELO A;  2GO3 A;  4DR3 I;  3ZKB A;  4JI2 I;  3JAM C;  3U1Y A;  1K47 A;  5FLX Q;  1N34 I;  2BA0 G;  4BA1 A;  1KVK A;  1MX0 A;  4WUB A;  2IES A;  1I94 E;  3QT6 A;  2BM1 A;  2V34 A;  5C0X F;  2HKJ A;  4OO1 F;  4DV5 I;  3P06 A;  2UXC I;  5IT9 C;  1XHK A;  4IZJ A;  1MG7 A;  5FWK A;  2Z5B A;  3B4T A;  3T1Y I;  4FWH A;  1HNX E;  4LF7 E;  4LF8 E;  4DV3 E;  5IWA E;  4AQY E;  4LPF A;  3T1H I;  4MU4 A;  4JYA I;  1D6T A;  1NZ0 A;  1XNQ I;  1OJ4 A;  3P3C A;  3B78 A;  4OKG A;  5DRP A;  2V2V A;  3ZZU A;  5K36 F;  4Z7C A;  4KHP E;  1IBK E;  2J65 A;  4LCG A;  4FW6 A;  3HJC A;  4NXM I;  4DV1 I;  2PO1 A;  4DR7 I;  1XXE A;  1OYR A;  4DU8 A;  3M6A A;  5JEA E;  3P76 A;  4JI4 E;  1H72 C;  4JI8 E;  5DRR A;  4DR1 E;  3QT8 A;  2A2D A;  2PNZ B;  4PRX A;  1OYS A;  4LFB E;  4FW3 A;  1USU A;  3GCM A;  4DR4 E;  2UUC E;  4B3T I;  2F4V I;  4LCH A;  1P42 A;  4YY3 E;  2C37 A;  1HK7 A;  3GLL A;  5C0X E;  4GKK I; 
#chains in the Genus database with same CATH homology
 5C0X C;  4OO1 C;  5JEA B;  3M85 D;  4BA2 B;  1UDS A;  3CDI A;  4IFD A;  2C39 B;  4BA1 B;  5C0X D;  2JEA B;  3M7N D;  2PNZ A;  3U1K A;  2WP8 B;  2NN6 E;  2NN6 C;  5C0X B;  4AIM A;  5JEA F;  5K36 E;  1UDO A;  5K36 C;  3M85 G;  4OO1 E;  5JEA A;  3DD6 A;  2NN6 D;  4BA2 A;  4AM3 A;  3M7N G;  2C39 A;  2BA0 G;  4BA1 A;  5K36 D;  2JEA A;  5C0X F;  4OO1 D;  3HKM A;  4OO1 F;  2NN6 B;  3CDJ A;  2WP8 A;  2PO0 B;  5K36 B;  1E3H A;  5C0X A;  2C38 B;  4OO1 B;  3L7Z B;  3B4T A;  4NBQ A;  1UDN A;  3GME A;  3KRN A;  4AID A;  2NN6 F;  1R6M A;  1E3P A;  2BA1 D;  4IFD E;  2PO2 B;  1R6L A;  5K36 F;  4IFD C;  2NN6 A;  3H1C A;  2PO0 A;  2BR2 B;  5K36 A;  2C38 A;  4OO1 A;  2JE6 B;  3L7Z A;  2WNR B;  2JEB B;  4IFD D;  2PO1 A;  4IFD F;  2PO1 B;  1OYR A;  2BA1 G;  5JEA E;  5JEA C;  4IFD B;  2PO2 A;  2BA0 D;  2PNZ B;  5C0X E;  1OYS A;  3GCM A;  2BR2 A;  5JEA D;  1UDQ A;  2C37 A;  2C37 B;  1OYP A;  3GLL A;  2JE6 A;  2WNR A;  2JEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...