2NN6F

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
242
structure length
223
Chain Sequence
GTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
molecule keywords Polymyositis/scleroderma autoantigen 1
total genus 32
structure length 223
sequence length 242
ec nomenclature
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2nn6F00
2PNZB 1R6LA 4BA1B 4OO1C 1UDNA 2C38A 3CDJA 2JEBA 2BA1D 2WP8B 3M85D 2NN6F 2BR2B 5C0XF 5C0XC 3GCMA 5C0XA 2PO1A 2NN6A 4IFDD 1R6MA 1UDQA 5JEAC 5JEAF 5JEAD 4BA1A 2PO0A 2C39A 2C37A 3B4TA 2BA1G 3GLLA 4IFDA 5K36F 4AM3A 3M85G 5K36E 4OO1A 5JEAB 5K36D 3L7ZA 2JE6B 2PNZA 3HKMA 2PO2A 4OO1D 4NBQA 2JEBB 5JEAE 1E3HA 2C39B 5K36B 4AIMA 3GMEA 2BR2A 1OYSA 4OO1B 3H1CA 5C0XB 4BA2A 2JE6A 5C0XD 2NN6B 5K36C 2NN6D 2NN6C 2BA0G 2C38B 3M7NG 2PO0B 1E3PA 4IFDF 2JEAB 3U1KA 2WNRA 4AIDA 1UDOA 2PO1B 5JEAA 1OYRA 4IFDC 3L7ZB 3CDIA 2PO2B 1UDSA 2WP8A 3KRNA 2BA0D 2C37B 2NN6E 3M7ND 4OO1F 5C0XE 4OO1E 5K36A 4IFDB 4IFDE 2JEAA 2WNRB 4BA2B 1OYPA 3DD6A
chains in the Genus database with same CATH superfamily
3K1JA 4FW5A 4DV0I 4ZVIA 3D4JA 4OO1C 1RR9A 4JI6I 2C38A 4UTGA 4GKJI 1RHYA 2BA1D 1H74A 4MU3A 4JI3I 4LF6I 1B62A 2ZITA 2NN6F 2V8PA 2UXDE 2E5LI 4FW6A 4KQVA 5C0XC 4JI3E 3GCMA 3HJCA 3K85A 1XNQE 1S16A 3B82A 3T1HI 2XEXA 1OJ4A 4HXZA 4ISAA 5JEAF 5JEAD 1N33E 4XTJA 2C37A 1HNXI 2VF3A 1QZRA 4R1FA 4KHPI 4LF8E 4AM3A 2HFSA 4ED4A 1H7SA 1FJGE 5K36E 2Z5EA 2HFUA 5IT9C 4JI8I 2R42A 5K36D 4RPFA 1I94I 1IBMI 1USUA 4LOMA 4DXLA 1XMOE 5IWAI 1EI1A 3H4LA 5JEAE 3Q1QA 1E3HA 4X62E 4YY3I 5GMEA 1MG7A 4AIMA 4QNKA 5DRQA 4LF8I 3GMEA 4OO1B 5BR8E 5C0XB 1FKAE 2CVEA 3J81Q 4DR1E 5K36C 1NHHA 2NN6D 1Y4UA 1Y60A 4JV5I 2C38B 1KKHA 5GMDA 3P3CA 3J80Q 2GO3A 1E3PA 4JG4A 3LNUA 5FLXQ 1UDOA 4X64E 4DR3I 4LF6E 3L7ZB 1S4EA 4JI5E 1Z0BA 3WU6A 3QT5A 4DPWA 5LMNE 2ZM6E 4DPTA 4JI0I 4FW3A 4QNJA 4OO1E 4JI2E 2Z5BB 1YHCA 1DARA 4LFBE 2O1UA 4PRXA 3V2UC 2WNRB 4YY3E 3NZKA 3LTOA 4JI7I 4BA2B 1N36I 1Y5YA 5A2QQ 1Z59A 4EMDA 1XMOI 4GKJE 2UXCE 4JI8E 4OX9I 5DNLA 1H7UA 1MX0A 1P42A 1ZM3A 2OI2A 1ZM2A 1N36E 5EKWA 2JT2A 4LCGA 4DV3I 4JI1E 1IBLI 3JAMC 2F1DA 4KHPE 4LF4I 5LMUE 3CWVA 4DUZE 2IOQA 3PYDA 5LL6R 4X66I 4AQYI 2V34A 2NN6A 4IZJB 2V2QA 1R6MA 4Z7YA 4DPYA 4NXMI 4BA1A 3T1HE 4DR7I 2C39A 2VQEI 1UEKA 4JI1I 3GLLA 2UXDI 4B3RE 5K36F 2PNMA 2CG9A 4MDTA 4URLA 2NPFA 5JEAB 4WUDA 4DV6I 2JE6B 1H73A 4FW9A 5ELWA 4I3HA 2PO2A 1ZXMA 4JV5E 1HNWI 2JEBB 1XMQE 2HHHI 1XXEA 4DUZI 2R3VA 1HNZI 2C39B 4JI2I 1FWKA 5K36B 1XNQI 2GO4A 4LF5I 1XNRI 4MU1A 5BR8I 2F4VE 1J5EI 2DEJA 4JI0E 2E5LE 4LFAE 1IBLE 4BA2A 4P7AA 1Z5AA 5C0XD 2NN6B 4J3DA 1KIJA 4JI5I 4FWDA 4DV7I 3WU4A 2VQFI 1N32I 5IWAE 4FN5A 1HR0I 3PS3A 1PVGA 3V5RA 4P52A 4DV0E 2CZ9A 4IFDF 2BV3A 1Y6ZA 4FWGA 4B3TE 4DUYI 4MU0A 3B78A 4AIDA 4GKKI 4DV2E 1KTVA 4IS9A 1OYRA 1N34E 5LMNI 4DV3E 2ZM6I 1N33I 1YH8A 4DV6E 1UDSA 2O3ZA 2WW4A 4Z7CA 1NZ0A 4OX9E 1D6TA 2CGEA 1BKNA 3M7ND 1FI4A 4OO1F 3T1YE 4B3SE 3Q6MA 4JI4E 3OTOE 4IFDE 1NHJA 3ZKBA 4JI7E 1N0VC 2VQEE 1Z0GA 3QT7A 4JI4I 4U3DA 2BM1A 4IZJA 4DR5E 3ZZTA 3WU5A 1R6LA 1A6FA 4FW4A 1XHKA 1Y4SA 1EA6A 2JEBA 4HACB 2Q2EB 2WP8B 4LF7I 4USKA 4UT4A 2GS8A 4PRVA 4B3MI 4MYTA 4JYAI 4LCFA 2LJPA 2BR2B 1Z0TA 5C0XA 4MU4A 2PO1A 2UXBI 4X62I 1Z0WA 1UDQA 5EL9A 1IBME 2EFGA 4OZEA 4FWHA 1PKPA 4DPUA 5A2QC 4DV7E 3B4TA 1KVKA 1FJGI 2BA1G 4DR6E 1RREA 2E1RA 1N0UA 4IFDA 2F4VI 1FNMA 4OO1A 4DR4E 4LFAI 2HK3A 3L7ZA 4WUBA 4LFCI 1XMQI 2HHHE 4AQYE 4DR5I 4NBQA 3WU3A 4X66E 2ZBKB 4LFCE 5FLXC 3P3GA 1Z0CA 2UUBI 2VESA 2DEIA 1HK7A 4DR4I 2Z5CB 2HK2A 1OYSA 3H1CA 3PS2A 3U1YA 3PS1A 1ELOA 3HULA 3JAMQ 5IT9Q 4DV5E 2BA0G 1ZM4A 2HKJA 2PO0B 3J7AG 5DRRA 4GKKE 2JEAB 2WNRA 4DUYE 4NXNE 4M1KA 2PO1B 1B63A 1K47A 5JEAA 4IFDC 4DV5I 2J7KA 2GQ0A 3CDIA 2PO2B 4HACA 4JI6E 3ZKDA 2WP8A 3UHMA 2A2DA 2UXCI 2UUCE 2BA0D 2C37B 2AJ4A 4B3RI 5C0XE 4DV4I 5K36A 1Z5BA 2A2CA 2UUBE 4NXNI 2JEAA 2X36A 3OTOI 3T1YI 4B3SI 4LF9I 3PYEA 2JE6A 1HNWE 4LF7E 2IOPA 2PNZB 3P06A 4BA1B 1UDNA 3CDJA 3J81C 1N34I 4IZJD 4LF4E 2UU9I 4DV2I 4DR2E 4DR6I 3M85D 2V2VA 3QT6A 5DRPA 4DPXA 1FWLA 5C0XF 2HKEA 3ZZ0A 3PYGA 4DR7E 5DROA 2J65A 4DV1I 4IFDD 4OKGA 1HR0E 3PYFA 4K0KE 4IZKA 5JEAC 4YHHE 2UXBE 2PO0A 4HY1A 2PNLA 5FWKA 4B3ME 2AE8A 2IESA 5LMUI 2Z5CA 1ZXNA 2UUAE 5L3JA 4JYAE 4WUCA 1J5EE 1ZM9A 3M85G 1XNRE 1HNXE 1WUUA 2O1TA 4YHHI 2PNZA 3HKMA 1IBKI 4LF9E 1USVA 4DU8A 4OO1D 3QT8A 2VQFE 1I94E 1IBKE 4DV1E 3P76A 2Z5BA 4LFBI 1PIEA 2BM0A 4N3OA 4LPFA 2UUCI 2UU9E 2BR2A 2IERA 1VI7A 1Z5CA 2O1WA 1Z0VA 2NN6C 3GONA 4DR1I 3P3EA 3M7NG 1Z0EA 3B8HA 4K0KI 1VISA 3J80C 4X64I 4DR3E 4FW7A 2O1VA 3Q6NA 3U1KA 4DV4E 4B3TI 3K17A 1H72C 4LCHA 4X65I 2V2ZA 3J7AM 3ZZUA 4PU9A 4DU7A 4MQYA 4DR2I 1N32E 1MU5A 3M6AA 4IZKB 4HYMA 4NXME 1U2RA 3KRNA 3LPSA 4X65E 2NN6E 3ZM7A 4U3BA 2UUAI 3F0NA 1HNZE 4IFDB 4USMA 1NHIA 4LF5E 2X7IA 5DNXA 3PRYA 1OYPA 4MYUA 4GQUA 3DD6A
chains in the Genus database with same CATH topology
2PNZB 1R6LA 4BA1B 4OO1C 1UDNA 2C38A 3CDJA 2JEBA 2BA1D 2WP8B 3M85D 2NN6F 2BR2B 5C0XF 5C0XC 3GCMA 5C0XA 2PO1A 2NN6A 4IFDD 1R6MA 1UDQA 5JEAC 5JEAF 5JEAD 4BA1A 2PO0A 2C39A 2C37A 3B4TA 2BA1G 3GLLA 4IFDA 5K36F 4AM3A 3M85G 5K36E 4OO1A 5JEAB 5K36D 3L7ZA 2JE6B 2PNZA 3HKMA 2PO2A 4OO1D 4NBQA 2JEBB 5JEAE 1E3HA 2C39B 5K36B 4AIMA 3GMEA 2BR2A 1OYSA 4OO1B 3H1CA 5C0XB 4BA2A 2JE6A 5C0XD 2NN6B 5K36C 2NN6D 2NN6C 2BA0G 2C38B 3M7NG 2PO0B 1E3PA 4IFDF 2JEAB 3U1KA 2WNRA 4AIDA 1UDOA 2PO1B 5JEAA 1OYRA 4IFDC 3L7ZB 3CDIA 2PO2B 1UDSA 2WP8A 3KRNA 2BA0D 2C37B 2NN6E 3M7ND 4OO1F 5C0XE 4OO1E 5K36A 4IFDB 4IFDE 2JEAA 2WNRB 4BA2B 1OYPA 3DD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNZ B;  1R6L A;  4BA1 B;  4OO1 C;  1UDN A;  2C38 A;  3CDJ A;  2JEB A;  2BA1 D;  2WP8 B;  3M85 D;  2NN6 F;  2BR2 B;  5C0X F;  5C0X C;  3GCM A;  5C0X A;  2PO1 A;  2NN6 A;  4IFD D;  1R6M A;  1UDQ A;  5JEA C;  5JEA F;  5JEA D;  4BA1 A;  2PO0 A;  2C39 A;  2C37 A;  3B4T A;  2BA1 G;  3GLL A;  4IFD A;  5K36 F;  4AM3 A;  3M85 G;  5K36 E;  4OO1 A;  5JEA B;  5K36 D;  3L7Z A;  2JE6 B;  2PNZ A;  3HKM A;  2PO2 A;  4OO1 D;  4NBQ A;  2JEB B;  5JEA E;  1E3H A;  2C39 B;  5K36 B;  4AIM A;  3GME A;  2BR2 A;  1OYS A;  4OO1 B;  3H1C A;  5C0X B;  4BA2 A;  2JE6 A;  5C0X D;  2NN6 B;  5K36 C;  2NN6 D;  2NN6 C;  2BA0 G;  2C38 B;  3M7N G;  2PO0 B;  1E3P A;  4IFD F;  2JEA B;  3U1K A;  2WNR A;  4AID A;  1UDO A;  2PO1 B;  5JEA A;  1OYR A;  4IFD C;  3L7Z B;  3CDI A;  2PO2 B;  1UDS A;  2WP8 A;  3KRN A;  2BA0 D;  2C37 B;  2NN6 E;  3M7N D;  4OO1 F;  5C0X E;  4OO1 E;  5K36 A;  4IFD B;  4IFD E;  2JEA A;  2WNR B;  4BA2 B;  1OYP A;  3DD6 A; 
#chains in the Genus database with same CATH topology
 3K1J A;  4FW5 A;  4DV0 I;  4ZVI A;  3D4J A;  4OO1 C;  1RR9 A;  4JI6 I;  2C38 A;  4UTG A;  4GKJ I;  1RHY A;  2BA1 D;  1H74 A;  4MU3 A;  4JI3 I;  4LF6 I;  1B62 A;  2ZIT A;  2NN6 F;  2V8P A;  2UXD E;  2E5L I;  4FW6 A;  4KQV A;  5C0X C;  4JI3 E;  3GCM A;  3HJC A;  3K85 A;  1XNQ E;  1S16 A;  3B82 A;  3T1H I;  2XEX A;  1OJ4 A;  4HXZ A;  4ISA A;  5JEA F;  5JEA D;  1N33 E;  4XTJ A;  2C37 A;  1HNX I;  2VF3 A;  1QZR A;  4R1F A;  4KHP I;  4LF8 E;  4AM3 A;  2HFS A;  4ED4 A;  1H7S A;  1FJG E;  5K36 E;  2Z5E A;  2HFU A;  5IT9 C;  4JI8 I;  2R42 A;  5K36 D;  4RPF A;  1I94 I;  1IBM I;  1USU A;  4LOM A;  4DXL A;  1XMO E;  5IWA I;  1EI1 A;  3H4L A;  5JEA E;  3Q1Q A;  1E3H A;  4X62 E;  4YY3 I;  5GME A;  1MG7 A;  4AIM A;  4QNK A;  5DRQ A;  4LF8 I;  3GME A;  4OO1 B;  5BR8 E;  5C0X B;  1FKA E;  2CVE A;  3J81 Q;  4DR1 E;  5K36 C;  1NHH A;  2NN6 D;  1Y4U A;  1Y60 A;  4JV5 I;  2C38 B;  1KKH A;  5GMD A;  3P3C A;  3J80 Q;  2GO3 A;  1E3P A;  4JG4 A;  3LNU A;  5FLX Q;  1UDO A;  4X64 E;  4DR3 I;  4LF6 E;  3L7Z B;  1S4E A;  4JI5 E;  1Z0B A;  3WU6 A;  3QT5 A;  4DPW A;  5LMN E;  2ZM6 E;  4DPT A;  4JI0 I;  4FW3 A;  4QNJ A;  4OO1 E;  4JI2 E;  2Z5B B;  1YHC A;  1DAR A;  4LFB E;  2O1U A;  4PRX A;  3V2U C;  2WNR B;  4YY3 E;  3NZK A;  3LTO A;  4JI7 I;  4BA2 B;  1N36 I;  1Y5Y A;  5A2Q Q;  1Z59 A;  4EMD A;  1XMO I;  4GKJ E;  2UXC E;  4JI8 E;  4OX9 I;  5DNL A;  1H7U A;  1MX0 A;  1P42 A;  1ZM3 A;  2OI2 A;  1ZM2 A;  1N36 E;  5EKW A;  2JT2 A;  4LCG A;  4DV3 I;  4JI1 E;  1IBL I;  3JAM C;  2F1D A;  4KHP E;  4LF4 I;  5LMU E;  3CWV A;  4DUZ E;  2IOQ A;  3PYD A;  5LL6 R;  4X66 I;  4AQY I;  2V34 A;  2NN6 A;  4IZJ B;  2V2Q A;  1R6M A;  4Z7Y A;  4DPY A;  4NXM I;  4BA1 A;  3T1H E;  4DR7 I;  2C39 A;  2VQE I;  1UEK A;  4JI1 I;  3GLL A;  2UXD I;  4B3R E;  5K36 F;  2PNM A;  2CG9 A;  4MDT A;  4URL A;  2NPF A;  5JEA B;  4WUD A;  4DV6 I;  2JE6 B;  1H73 A;  4FW9 A;  5ELW A;  4I3H A;  2PO2 A;  1ZXM A;  4JV5 E;  1HNW I;  2JEB B;  1XMQ E;  2HHH I;  1XXE A;  4DUZ I;  2R3V A;  1HNZ I;  2C39 B;  4JI2 I;  1FWK A;  5K36 B;  1XNQ I;  2GO4 A;  4LF5 I;  1XNR I;  4MU1 A;  5BR8 I;  2F4V E;  1J5E I;  2DEJ A;  4JI0 E;  2E5L E;  4LFA E;  1IBL E;  4BA2 A;  4P7A A;  1Z5A A;  5C0X D;  2NN6 B;  4J3D A;  1KIJ A;  4JI5 I;  4FWD A;  4DV7 I;  3WU4 A;  2VQF I;  1N32 I;  5IWA E;  4FN5 A;  1HR0 I;  3PS3 A;  1PVG A;  3V5R A;  4P52 A;  4DV0 E;  2CZ9 A;  4IFD F;  2BV3 A;  1Y6Z A;  4FWG A;  4B3T E;  4DUY I;  4MU0 A;  3B78 A;  4AID A;  4GKK I;  4DV2 E;  1KTV A;  4IS9 A;  1OYR A;  1N34 E;  5LMN I;  4DV3 E;  2ZM6 I;  1N33 I;  1YH8 A;  4DV6 E;  1UDS A;  2O3Z A;  2WW4 A;  4Z7C A;  1NZ0 A;  4OX9 E;  1D6T A;  2CGE A;  1BKN A;  3M7N D;  1FI4 A;  4OO1 F;  3T1Y E;  4B3S E;  3Q6M A;  4JI4 E;  3OTO E;  4IFD E;  1NHJ A;  3ZKB A;  4JI7 E;  1N0V C;  2VQE E;  1Z0G A;  3QT7 A;  4JI4 I;  4U3D A;  2BM1 A;  4IZJ A;  4DR5 E;  3ZZT A;  3WU5 A;  1R6L A;  1A6F A;  4FW4 A;  1XHK A;  1Y4S A;  1EA6 A;  2JEB A;  4HAC B;  2Q2E B;  2WP8 B;  4LF7 I;  4USK A;  4UT4 A;  2GS8 A;  4PRV A;  4B3M I;  4MYT A;  4JYA I;  4LCF A;  2LJP A;  2BR2 B;  1Z0T A;  5C0X A;  4MU4 A;  2PO1 A;  2UXB I;  4X62 I;  1Z0W A;  1UDQ A;  5EL9 A;  1IBM E;  2EFG A;  4OZE A;  4FWH A;  1PKP A;  4DPU A;  5A2Q C;  4DV7 E;  3B4T A;  1KVK A;  1FJG I;  2BA1 G;  4DR6 E;  1RRE A;  2E1R A;  1N0U A;  4IFD A;  2F4V I;  1FNM A;  4OO1 A;  4DR4 E;  4LFA I;  2HK3 A;  3L7Z A;  4WUB A;  4LFC I;  1XMQ I;  2HHH E;  4AQY E;  4DR5 I;  4NBQ A;  3WU3 A;  4X66 E;  2ZBK B;  4LFC E;  5FLX C;  3P3G A;  1Z0C A;  2UUB I;  2VES A;  2DEI A;  1HK7 A;  4DR4 I;  2Z5C B;  2HK2 A;  1OYS A;  3H1C A;  3PS2 A;  3U1Y A;  3PS1 A;  1ELO A;  3HUL A;  3JAM Q;  5IT9 Q;  4DV5 E;  2BA0 G;  1ZM4 A;  2HKJ A;  2PO0 B;  3J7A G;  5DRR A;  4GKK E;  2JEA B;  2WNR A;  4DUY E;  4NXN E;  4M1K A;  2PO1 B;  1B63 A;  1K47 A;  5JEA A;  4IFD C;  4DV5 I;  2J7K A;  2GQ0 A;  3CDI A;  2PO2 B;  4HAC A;  4JI6 E;  3ZKD A;  2WP8 A;  3UHM A;  2A2D A;  2UXC I;  2UUC E;  2BA0 D;  2C37 B;  2AJ4 A;  4B3R I;  5C0X E;  4DV4 I;  5K36 A;  1Z5B A;  2A2C A;  2UUB E;  4NXN I;  2JEA A;  2X36 A;  3OTO I;  3T1Y I;  4B3S I;  4LF9 I;  3PYE A;  2JE6 A;  1HNW E;  4LF7 E;  2IOP A;  2PNZ B;  3P06 A;  4BA1 B;  1UDN A;  3CDJ A;  3J81 C;  1N34 I;  4IZJ D;  4LF4 E;  2UU9 I;  4DV2 I;  4DR2 E;  4DR6 I;  3M85 D;  2V2V A;  3QT6 A;  5DRP A;  4DPX A;  1FWL A;  5C0X F;  2HKE A;  3ZZ0 A;  3PYG A;  4DR7 E;  5DRO A;  2J65 A;  4DV1 I;  4IFD D;  4OKG A;  1HR0 E;  3PYF A;  4K0K E;  4IZK A;  5JEA C;  4YHH E;  2UXB E;  2PO0 A;  4HY1 A;  2PNL A;  5FWK A;  4B3M E;  2AE8 A;  2IES A;  5LMU I;  2Z5C A;  1ZXN A;  2UUA E;  5L3J A;  4JYA E;  4WUC A;  1J5E E;  1ZM9 A;  3M85 G;  1XNR E;  1HNX E;  1WUU A;  2O1T A;  4YHH I;  2PNZ A;  3HKM A;  1IBK I;  4LF9 E;  1USV A;  4DU8 A;  4OO1 D;  3QT8 A;  2VQF E;  1I94 E;  1IBK E;  4DV1 E;  3P76 A;  2Z5B A;  4LFB I;  1PIE A;  2BM0 A;  4N3O A;  4LPF A;  2UUC I;  2UU9 E;  2BR2 A;  2IER A;  1VI7 A;  1Z5C A;  2O1W A;  1Z0V A;  2NN6 C;  3GON A;  4DR1 I;  3P3E A;  3M7N G;  1Z0E A;  3B8H A;  4K0K I;  1VIS A;  3J80 C;  4X64 I;  4DR3 E;  4FW7 A;  2O1V A;  3Q6N A;  3U1K A;  4DV4 E;  4B3T I;  3K17 A;  1H72 C;  4LCH A;  4X65 I;  2V2Z A;  3J7A M;  3ZZU A;  4PU9 A;  4DU7 A;  4MQY A;  4DR2 I;  1N32 E;  1MU5 A;  3M6A A;  4IZK B;  4HYM A;  4NXM E;  1U2R A;  3KRN A;  3LPS A;  4X65 E;  2NN6 E;  3ZM7 A;  4U3B A;  2UUA I;  3F0N A;  1HNZ E;  4IFD B;  4USM A;  1NHI A;  4LF5 E;  2X7I A;  5DNX A;  3PRY A;  1OYP A;  4MYU A;  4GQU A;  3DD6 A; 
#chains in the Genus database with same CATH homology
 2PNZ B;  1R6L A;  4BA1 B;  4OO1 C;  1UDN A;  2C38 A;  3CDJ A;  2JEB A;  2BA1 D;  2WP8 B;  3M85 D;  2NN6 F;  2BR2 B;  5C0X F;  5C0X C;  3GCM A;  5C0X A;  2PO1 A;  2NN6 A;  4IFD D;  1R6M A;  1UDQ A;  5JEA C;  5JEA F;  5JEA D;  4BA1 A;  2PO0 A;  2C39 A;  2C37 A;  3B4T A;  2BA1 G;  3GLL A;  4IFD A;  5K36 F;  4AM3 A;  3M85 G;  5K36 E;  4OO1 A;  5JEA B;  5K36 D;  3L7Z A;  2JE6 B;  2PNZ A;  3HKM A;  2PO2 A;  4OO1 D;  4NBQ A;  2JEB B;  5JEA E;  1E3H A;  2C39 B;  5K36 B;  4AIM A;  3GME A;  2BR2 A;  1OYS A;  4OO1 B;  3H1C A;  5C0X B;  4BA2 A;  2JE6 A;  5C0X D;  2NN6 B;  5K36 C;  2NN6 D;  2NN6 C;  2BA0 G;  2C38 B;  3M7N G;  2PO0 B;  1E3P A;  4IFD F;  2JEA B;  3U1K A;  2WNR A;  4AID A;  1UDO A;  2PO1 B;  5JEA A;  1OYR A;  4IFD C;  3L7Z B;  3CDI A;  2PO2 B;  1UDS A;  2WP8 A;  3KRN A;  2BA0 D;  2C37 B;  2NN6 E;  3M7N D;  4OO1 F;  5C0X E;  4OO1 E;  5K36 A;  4IFD B;  4IFD E;  2JEA A;  2WNR B;  4BA2 B;  1OYP A;  3DD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...