2NNFA

Structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
SASKLDDAIAAKFGSLPIQESTAIQIKAPEIAENGAFVPVTVATSIPGATNISIFTPANFSPMVASFDVLPRMKPEVSLRMRMAKTENLVVVVQAGGKLYRAVREVKVTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfur covalently-binding protein
publication title X-ray crystallographic analysis of the sulfur carrier protein SoxY from Chlorobium limicola f. thiosulfatophilum reveals a tetrameric structure.
pubmed doi rcsb
source organism Chlorobium limicola
molecule tags Ligand binding protein
total genus 24
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13501 SoxY Sulfur oxidation protein SoxY
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2470 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2nnfA00
2OXGB 2OXHB 2NNCA 2OX5B 2NNFA 4UWQB
chains in the Genus database with same CATH superfamily
2RGSA 1J05B 3BCDA 3GI9H 1OARL 4J3WA 4L4VD 4O02A 4PVMA 4XZUB 2JLLA 1YEHH 3D7PA 1NGWB 3CWGA 2JQZA 1KV7A 4OZGA 3H3BC 4RAHA 4XPTH 5C0DB 2XVKA 1OGTA 5GGSY 3IEAA 4E36A 4F2MB 5FM5M 3VCLB 1A4CA 3F01A 3MLWL 5EN3A 1IBZA 2P1YA 3KYMA 4BUHA 4DP7X 2YD1A 5BW7C 3QK0A 4HJUA 4M5YH 1NCHA 3LV3A 5CD3B 2WMPB 2RH0A 4X0KB 5DS8B 2ORBL 5IJKC 2HFFA 4JKLA 4FQLH 2DBLL 1JWUB 3ZKMD 5GXBB 3GNML 3HLAA 2FBJL 1XO8A 1SXAA 4IIQB 3T0AA 1AZCA 4JQIH 3QDGB 5FYJU 3VGEA 2JE8A 1S7XB 5D1QC 4F7TA 1BGXL 5AG8A 4PJAF 4OZHB 4ANUA 1MVFA 1J8SA 2Z91B 4A2FA 3PXLA 1F97A 4NQCA 5D70L 4I0PB 5DEFB 3B9KA 1MCOL 1EFXB 1JTPA 2D31B 3OWEA 2YPLB 3BHBB 1SHWA 3DOSB 1G7QB 3LRMA 1N7MH 3ZX1A 2B3RA 1ZT4A 4PGZA 2NNAA 3UTQA 5GS0C 5KVMC 4ODXA 5KOMC 2ZX8A 3UPRA 4IYKA 1DBJH 4X4MA 1U8KA 3IDMB 3KD4A 3IMBA 2E27H 5E5RB 2V3EA 1ZXQA 1CLCA 3IFNH 2Y7QB 1BF8A 2ZX9A 4F15B 3MREB 3K72A 2Z1KA 5SX5H 4X9GA 1KTDA 1U8HB 4OKDA 4JKKA 4HEPG 1B6UA 3FU0A 3UAJD 3LXUX 4R8WH 4I3RH 1E4WH 4PRHA 5ANHA 1U95B 4WI2A 2A2QT 2CCWA 4F9LA 2WYIA 1GGBL 1DO5A 1AAJA 3HZKB 3G5XB 3IGAB 4P23B 3GKWL 3V5DB 5BOZG 5AW8B 5JPMC 4GKSA 2RQ8A 3GS7A 4YSDA 3Q5OA 1R3JB 1ZHNA 3MTRA 5HI3D 3ZIYA 3FSVA 5FKAA 2V7HA 4XPAH 3NJVA 3NRFA 1R5WB 4X6CE 1NLDL 3LTVA 3Q1SH 4TTDD 4V1DA 5LUMA 4F7EA 3NRQA 4HWNA 4RAVA 1OCRB 2AI0H 1P53A 1HXMB 2A38A 4Q9BA 2B1HL 3KG5A 2O6DA 5I1JL 1SJMA 4N8CH 3QRGL 4U0QB 4WHTA 4WUKL 5E1AA 4ANKA 1NMAL 5BS0D 1DJGA 2VR7A 3P4OA 4CJ1A 3TT1H 1E8WA 3TBYB 2YUXA 3DX8A 1QWNA 3MLUL 3S6CA 3F7KA 2DDQH 3I50L 3EADA 3Q2VA 5AD0A 1MFEL 5CCKH 2JH2A 3RKDC 2IPKA 3IETA 4K7PL 3BAYA 4KDTA 1RZ7L 4JFDB 5LXGH 1L0QA 2ZCHH 3BPCA 4FJZA 4TVUA 2Y2TA 1WS8A 4JB9H 1NWPA 2R1WA 4D0DB 1YZZA 1NSNL 2R0ZL 2YBRA 2HRHA 4NCC2 4Y19D 3ZK0A 1SDDA 1KLFB 3DX7B 3OXSA 3QFJE 3TJEH 2P80D 5DD5H 3VFRA 3O2DA 4ZAKA 5JXEC 2AVFA 4JANA 2AJXH 4U1GB 3M1BA 1MREH 4DKFH 1P69B 2GC4C 3QI9B 4M6MH 1RUMH 2E59A 2A9ML 1F18A 1QSED 1QTSA 3CLFH 1G9HA 2HFEA 1NJ9B 5JXAL 4LCUB 4JE4B 3UTZA 5EF2A 1BV8A 3L4XA 4FQPA 4NPYB 5C71A 1BPVA 2F8VA 4XNZC 4AE1A 2OW7A 1WISA 2AJUL 1A7QH 1ZA3A 1OE2A 4CL7A 1AY1H 5D2LA 4ZS7H 3ZHNA 2AQ3A 4UQEA 3W0WD 5J11C 2AZAA 3QDMB 1ZV9A 4K5LA 2FX9H 1Y7VA 4G5AA 1W72L 2J1KA 1X9QA 4PP1C 1HFUA 2AJSH 3OKEB 4DQOL 3VNZA 3IGLA 5F6HI 5F8QC 5EBWB 3P3SA 3MGOB 5JOFB 4K9EC 4QXTA 4KQ3L 3ZT6A 4WO4D 2G3XA 4G8AC 3STBA 3PLYA 4X6CB 4YNYA 1CDJA 3AROA 4ODTL 4JR9H 2Z35A 3QORA 3HR5B 1J87A 3MLPA 1F6AA 4MWFA 2X9YA 3BVNB 1KXTB 3D9AH 2W91A 3MFFA 3X13B 2CPUA 4AYGA 1EZVY 2NLJA 4MNQE 3IXTA 1AANA 1H9VA 2N3JA 4XCFL 4QIRA 2KZ1B 4UU9B 2CBTA 3VD3A 4FA7B 1E40A 2PCPB 5I28A 1NBYB 5DZJA 1UD3A 3EOBA 3OKOA 5T3XL 1KZYA 4G43B 1XGUB 2G2NA 1IZJA 1DQIA 1NGPH 2E7MA 1FYTE 5SWQA 1A25A 1TTGA 2D3VA 1IX2A 2WVTA 4K7PY 4JK0D 4KQ4L 1IAIH 1SY6A 3D52A 1NC2B 1UA6H 1VDGA 2ZUWA 3BSHA 3KNBB 5KTEL 5DJCA 2ODIA 5BXFB 3CSGA 3LKNA 4UM9D 4DGUA 3HE7D 3DETD 2RCSL 4X8JA 1ETZB 4QRRE 4TNWF 3L4UA 4L9LA 5K9KB 3QFJB 4L3EE 2QKIB 5E08L 3U7WL 1INDH 3ULUL 3DMMD 4YBHA 1BZ9B 4OB5L 3LSOB 2ZKMX 3U9UA 2OXHB 1AO7D 3HN5A 2CIIA 2Y6TE 3G6DL 3V0DA 4UIMB 4R3SA 1UWEL 4HJTA 1RZIA 5CP3A 1TDQA 2F54E 1VIWA 5EUOF 3ESUF 2A4ZA 1UT9A 2ITCA 1CGYA 1FIGL 1VENA 5E8NA 3ZZSA 1X5MA 5TH2B 4DK3A 3VA2C 2WK2A 2KMWA 1F00I 1GS7A 4KFZC 5DJ0B 1T03H 3VYPA 2IIJA 5EOCL 2IPTL 2WO2B 2UX6A 1B9ZA 3IJYA 3QUGA 3EXJA 3LKPA 4JJOA 2PO6A 3TM6A 1BLNA 3MJ7A 3CZJA 1AQMA 1GA2A 3EJPA 4M1CC 3F58H 2JCWA 2Y3NA 3FMGL 6CGTA 1NAMA 4UOQA 2EDRA 4H2AA 2YA2A 2LU4A 4ZW7A 2EXWD 5GGQL 2EACA 3BPLB 4KGJA 2H3NB 3FTSA 4W70A 4IBSA 5EZIH 4DEPB 4EIUA 2P8LB 1AS8A 3Q43A 3PWPD 4U2ZA 4G5ZH 3GS4A 4CSZA 5L0QC 1TOXA 2KYIA 5D7JC 4WK2B 2ZOUA 5E6IA 3SDCA 1I8LC 1KN2L 1XF3A 4PCKA 3CDFA 5FM4A 2JKJA 5HDQH 2K6YA 4S0HA 1FYTB 3V6OE 4QRSA 3CLWA 2G75A 3L3IB 1GGIH 1WIUA 2R0KH 2OQJA 4NZUL 2VTFA 1GJWA 1HNYA 1N4XL 1ES0B 5C0NC 4A63A 4N90D 2FEDC 5TDOB 4ZFZB 3X1NA 3UIYA 5ABZA 4UQ2B 3GMMB 4JG0L 1FVDA 3PAZA 2I7SA 1MAKA 4MJIB 2QR0B 2FHCA 1IARB 3NCXA 4JRYE 3UC0H 3GMOB 1L6ZA 2DJ4A 3O6KH 3GRWA 3HI6H 1OTSC 3MKGA 3VWJA 4JM2D 1BZDA 5DQDH 2DWEB 1FNEB 3TBWB 3DJ9A 2F54B 3ARQA 5I1DA 3HG2A 1KB9J 1FO0H 3T2LA 1U21A 2OR9L 1NPUA 4M7KH 3N04A 4Y16D 3P02A 2R9HD 4AJVA 5SWSD 3MCYA 1IKFH 4UOZA 1FZMB 3CDZA 3KPQB 3WY2A 2NXZD 4GMSH 2M8XA 4LHUB 1EJOL 5FPIA 3VE0A 1MWAH 3MRKA 5DRXA 3P11H 4LLAA 1T21B 4FG0A 1NCCL 4RWHA 1H3UA 4WJKB 5AEAA 3SY6A 4DGIH 1MHPL 1P4BH 4EZMA 3MXWH 5I8CB 1ZGLB 4YO0A 4HBCL 4RWYL 5I1LB 1AR2A 2B8OT 3GGWA 1L3WA 4YDVB 4G83A 3N41B 4QRQA 1JNNH 3KPPB 4YXLL 2YPVH 5IKCA 5IQ7L 2ZOLA 1JYVA 4YHKH 2BIIA 2XVBA 1MCNA 3L54A 1F45A 1CICA 2CPCA 2G30A 2GJJA 1NCOA 4JLRB 4BK5C 1KXVA 4XWOD 1V7NL 3V4VH 3V0VB 4G82A 5C2BH 3PP4L 3QZWB 4WUUA 2B5IB 3TN0D 3WFDH 4GMTH 1LE5A 5HPMB 4K55A 3UBXI 2HKFH 5D5MB 1P7HL 2F9BT 2VISB 3OQ3B 1DQDH 3KEHA 3RVTC 5I19L 1SVZA 4UNUA 5BVJA 1N67A 1B0RA 1JUFB 1D6EA 3BLBA 3QIWB 4EKJA 2DWSA 4NNXA 1ACZA 4BFGA 4P59H 4N8VG 3RWJA 5GGSA 2BXYA 3OJDB 1DEEB 2H9GB 2VERA 4RIRA 5AOJA 5EC2A 5MI0B 3VSTA 2XOTA 2D0FA 3VI3A 1BF5A 3FYIB 4DTGH 1VERA 3CHXA 4EIZC 4LPVA 3MRNA 3CFCH 3V8OA 2DQDH 4JRYB 3E1F1 4YUEL 3UDWA 1E8YA 1QWUA 3US0A 1UD5A 2EEAA 4MJ5A 4EMZA 2WSPA 4RETB 2WCGA 2AMGA 4MX7B 2AC0A 5F0MB 1ZS8B 1MF2H 1OAYL 3B2PA 2AANA 1TQCB 2E7HA 2OMTB 3WMSA 3ZQXA 4BKLA 4P9HL 2HFTA 1FRGH 3RJOA 3PWVA 2QADD 1AXSA 1H6UA 3E8VA 4QWWC 4OGAD 1DZBA 3IKCB 1IEBA 1FIEA 4M4RA 4U05A 4HCFA 3ARXA 4Q7DA 1LO4H 4P4RA 5AVUB 4NM8L 2G4GA 5EEVA 3ROLB 4QHKJ 4FQ1L 3DSFH 4Y4FB 3HAEH 4R83A 4CN4A 2ED9A 3TYGL 4BZ2L 1T4KB 3RGVD 1T66D 3L45A 4XBMA 5H94A 2NZ9D 1UWYA 3HE6C 2VNCA 4N0RA 2WLIA 5AB1A 1DVFA 5IMLB 4OJYA 2XXGA 1JK9A 5F9AC 3V4PB 1J12A 1UZGA 2CA3A 1KDJA 4Y5XA 1WPCA 3PJSA 4CDGC 1MFCH 2Y1ZA 4FFZL 2GTZA 1AVAA 2NY4C 5CZVL 4LRIC 3WNNA 2VJXA 4R0LC 1PPIA 1S7UA 5D9SB 3CV5A 1NAKH 5ALBH 3T2NL 2RALA 4HPHA 5LWYL 3O9WD 1JXGA 4WFHE 4YSUA 4ZS6C 4H1LB 3SIKA 3L81A 3BD3A 3O11A 5AW4B 1XXDC 4MXWH 4E2OA 3QWQB 4TUJA 4B7LA 3N0PB 3OKKA 1FL3B 4HEPA 3AREA 4DGYL 3PDGA 5LCVA 2EUVA 1PQZB 4TVPD 4XMLL 1WZ1L 1BEYH 2GSGB 2OJEA 4L8CA 2CXGA 1T0MB 2EDQA 3CFKA 4X7EC 5E4EC 2XPYA 1UB6A 3CGTA 3HBQA 4ZPTB 4Z0BL 4DP8X 4X7TA 1F3JB 1JVKA 1J86A 2BZDA 1VADB 2R7EB 3GJEB 1VSCA 1MRCL 4Y4KD 2LLNA 3WE1A 3FO2A 1A8JH 2BP0A 3IN0A 4IKIA 4O2EA 1ZTXL 4PJ5A 1WCBA 3VXMD 3J7HA 3T1WA 4G7VL 1T2QH 3JSSA 4U6HB 3VFMB 2E6QA 1MCPL 1BQUA 1E9OB 3LRGA 3TASA 4X6FB 4B9YA 5C8JA 5JR1L 2QQKL 4UTBH 1M7DA 3PIQA 3QJUB 4N6RB 1TNMA 2F7IA 2X2JA 3S37H 4HUVB 1H9DA 2NY1C 1PU0A 1ZSDB 2F74B 4FNLL 2C4FU 5GZOA 3SGKC 3PL6D 5KBKA 5DRZA 1OZTG 3AVEA 2ZOTA 4WFEE 1JZ2A 5I76A 3KWWA 1KCRH 4QOKA 2W9EH 2XG5A 4PJXF 5E4IA 4LOUC 4XNXL 2ZUQB 4L1TA 4ISVA 1MCBA 1PF3A 5I18H 5FECB 3NIDE 3PGFL 1IKNA 3L16A 4GNKB 3IXAB 4XNAA 3SDXA 5BUGA 4FYTA 4Z8FH 4J2XA 3UGXA 1IQWL 3NDYE 1KIPA 1IC1A 4IBYA 3PAUA 2HMID 5HJ3B 3STLA 1JXDA 2ZUSA 4J4PD 3VXUE 2BK8A 4PGDA 2J5LB 1JF1B 2CSPA 4ONOA 2RB8A 3G9AB 4O2CB 1K5NB 3QUYC 2D0HA 5FO8A 5DWPA 5HVGB 1U36A 2VE6B 2WHVA 2ZWYA 3MLXH 1FORH 1MCCA 4OGZA 1CBVH 4N2HA 3M7OA 4MAYD 2J88L 4PJBA 5HD8C 4YMPA 3EOTH 3D2UD 5GGVH 3L4YA 1RVFH 3BVTA 5MEOB 3UABA 5C0IA 3SE9H 1BDYA 2OXGA 1LO2H 1B0WA 1U8IA 5D7IB 3T0EE 3G5VA 5DEGB 4HJJL 3FT4B 4H7VA 3ZDWA 4HUXB 2BHFA 3C8DA 4UQBA 3C8KA 1N6QL 4YWGH 4WO0A 5ETUB 3VMNA 4KJPD 4D0BA 3QIBB 4XVJL 1WZAA 2UVFA 4LLDA 4Y5YB 1DVQA 1V7MH 2XN9D 4HKZB 1HHIB 4G59C 4ZX6A 3RL2B 4JZOA 1UHVA 4NHCH 3F62A 2XRAL 3DJRA 4ODUA 2ZCLH 2HKHH 3QWOB 4KXDA 1EXUA 1IV8A 5KOVC 4EF3A 1PNCA 4Y2LA 4LCVA 1T5XA 3WO4B 1PX8A 1UUNA 2EVFA 1HCYA 4P5KA 4PJ9A 1DVSA 1I7RB 3P4NB 1E50A 1ZVYA 3O2VH 4OIBA 5EU4B 1I1YB 4Y89A 4A6YH 3UZQA 4E5XB 4CMMA 2VXSH 1YN7B 5CILL 4G6FB 4MVBD 3ABGA 3MUJA 5DJ8B 5EOTB 1KCKA 3ABZA 2YOCA 4OCYL 3TBTA 1MHEA 1NIBA 5FO7B 3MRIB 2FH6A 2R2EA 2ZP8A 1CE6A 2ADGB 4IRJC 4OJCA 5I0ZA 5FOBB 3RFZC 4UQ3B 3NIDB 4MGXA 3UJIH 5EEXA 2AS5M 3LYRA 3QHTC 3T0BA 1PG7H 1XEDA 3LNEA 5HHVH 1WK0A 4PWKA 3HVDA 2QGEA 4JN2A 4MS6A 2QSQA 1KTLA 3F85A 2XPGB 1I82A 3ET9F 2VYRE 3NFPB 4LF3A 5F44A 5L6YL 4A7GA 4OV5A 3VXUB 4G9FA 4KKNA 4Q14A 2JB5H 3RJQB 4E9RA 5T1MB 1JVLA 1XIWB 3C9NB 1HXYA 4QRFA 2P8PA 2BWDA 4G3YL 5F7EL 5E1HB 2KC0A 4X5WB 3D12B 4XAKD 3WTXA 4XH2B 4PJIA 2PPCA 2YUZA 3BIAX 3C6SB 1V55B 1EAOA 4IIZA 4XE5B 2KPWA 1W72A 1JZ6A 4DH2A 1SN2A 1KFAH 1WEJL 1RJZB 1A1OB 5B3JF 4P23D 3FTGB 3L1GA 3QJFA 3SO5A 1LO3H 1PZSA 3TH2T 1WBZA 3HMXL 4S10A 3UAFA 5KSUB 3RGBA 3HZVA 2H32H 1QG3A 2FD6H 3NCMA 3QGVA 1YEGL 2FO4A 4U1SB 3I6LE 3IM1A 1YMHB 1HILA 4QI3A 1Y07A 3AUVA 3A23A 2Z1PA 2BWQA 3ATEA 4HIQA 1T0PB 3SDDB 1DBBH 1A9EB 1WYJA 4CVXA 1GJIA 4R7NA 4NB7A 1M2OA 1KGCE 1HOCB 1YSOA 2R29H 4KVCL 4HU8A 1I53A 4YIQB 4J3TA 5JIHA 2HG5A 3PUUA 4A7GF 2CD0A 3BWUC 3QQ3B 4K07A 4JY5H 5T1LA 1F4XH 1Q9KB 5I2IB 5LGHL 4AQ1C 1QSFA 3CVBA 4PJ7E 1SM3H 1T6BX 1OKEA 1IBYA 5CJOL 5IROA 1R4XA 1I1CA 4L1HA 1TZGL 5EU6D 2H0FA 5AOIA 2H1PH 5DFWH 3LEYL 2OTUA 1WO2A 1TYJA 4R5XA 5BQDA 5DMGC 4ELMF 2PNDA 2ZWKA 3WSQH 1V3JA 3U9WA 5HHXL 1BMZA 1IC4H 2CGRL 2Z7ZA 1JHKL 5KVFH 2EE3A 4YDNA 3X3FL 1FJ1B 2MRYA 3NEOA 3MJWA 4LGRB 4K23H 3UZEA 1UB5B 5DEJA 3OPUA 3VFPA 3OSKA 3D1MC 5D1ZI 3PJLA 1DSFH 1BWWA 4NO0A 4KK6C 2ITEA 5CMAA 5EU5B 1YCSA 4PD4J 2CK0L 2Q87A 4NBYB 3PXJA 4N0FB 1T0NB 4HKBB 3WKML 3ARGB 1FFTB 2V17L 3MGTB 3VG9C 2NY3B 4KI5C 1D2OA 1ZKAA 5FGBC 5I1GH 3LZQA 5DHVA 4M9PA 2EO7A 2R23A 5E4AA 3ZTDC 1DQML 4IRSB 4LDEB 5BV7L 1XSJA 4RGNB 1AFVL 4M8QB 3TO4C 3QDMD 2WLNA 5BOJA 1DUZA 2A3TA 1BBDL 1GSMA 5IJVA 2XI9A 3IRZA 3I3EA 1DBAL 1JZGA 3JTTB 4G6AD 4N5EC 1KNOA 4X4YA 1N3NA 1E5YA 1P2CB 4QLRA 3LXAA 4UBDC 3NZ8B 4P3CL 1NCBL 2X0WA 4AIEA 4BH7B 5E5UB 1T1ZB 2AJ3A 2WXNA 1CIDA 1KPUA 2EXSA 1J1PL 5DK2A 4GKLA 1GGCL 1TCRB 3KLHD 3F7PC 4NQXB 4LKCA 4IS6A 4YPGB 5KSVB 1BD2E 3MRCA 4K3DH 1RJCA 1E28B 1OM3L 2FT7A 3PGDA 2WOYA 4YHNB 3MAWA 5K9OB 1W0YT 4K2UH 5FYKD 4GUCA 4GKOA 4N26A 1KXQE 4MDIB 1P4UA 1UWGL 5DQJA 1JSYA 1J88A 4PJ7B 5DK0A 1N59A 3CSFA 3N55A 1JHTB 4J1UB 4AW4A 3DK2A 1RZ8A 2Z7YA 3ZHLA 5DJ2B 4GP8B 4UTAH 2YN5A 4XCYB 3RIKA 2UUDK 4DN3L 2QPSA 2J2ZB 5K9QI 3D2TA 2ROYA 1N8ZA 3ARSA 3GIVB 3IE4A 4ZMOA 3HKFA 2CUIA 1GAFL 2SODB 2C3WA 3LQZA 2ZG2A 4C4UA 4N8VA 4DVRH 3I3BA 4D94A 2BVYA 1E6JL 2R1XB 2EIKB 2NYYD 4X42A 3HNSL 1RQ5A 4Z7QE 5AAWA 1A7RL 5KVEH 2Z31C 3UX9B 4NZJA 1JG9A 1U3HA 3ATDA 1JYWA 4OZIA 3FU5A 5I0VA 2WXPA 4WGWB 1M1XA 4QXUH 3WN5C 1LWRA 1QKZL 2VR3A 2P5ED 2ATAA 1K2DB 1CFVH 4DN4H 3RL1A 2ZKHL 3VD5A 3THML 4NKIH 5B1JC 3TIDA 3X1BA 3NCJH 1W16A 1U3JA 2XG4A 2FJFA 3EF4A 4ZYKB 3PPSA 3QO1B 1U8OB 4I1RA 2ZSVB 2KZKA 4ONFH 4PLKC 4FZ8H 3GS0A 2D2CC 5E5MA 5MERA 3VSVA 4M5TA 3LZLA 3OLGA 5DJYA 4IOIA 3KPLB 2YPKA 4K9EL 1CG9B 4QTHA 4YZFF 1EJFA 3I9AA 3MLYH 1BBJB 2C4XA 5CXPA 2DL9A 2APBA 2NSQA 4BQ9A 4XX1G 1Y6NR 3BO8A 1ET8A 5DR5H 4H8PA 3SJVE 3WTWA 3OPZL 2W0FA 5EEUA 2RHEA 3ZTNL 3WHXB 5E99L 4U3HA 1RUKL 2NNCA 2Y36H 4PJ8A 4JGMA 4FYSA 4HCRA 1GMEA 3PABB 2Y22A 1E4XH 1JV5B 5FCSH 5L7XL 1UCTA 3W38A 25C8H 3NCWA 4H0LC 2GSIA 4M29A 4PV8A 3UL4A 4MBRA 5I82A 1E7VA 2JJUA 4KHXL 1CD9B 2GFBB 2Q7YB 4CC4A 4CMHC 1X9LA 4JJHA 2VDMH 4YH6A 3GHEH 3ZBMA 1MG3C 2DS4A 4AQAB 1GXEA 3BAEL 4FN0A 3UTSD 1DN2A 3HHRB 3UTTB 4C54A 3FPXA 1DJYA 4QTIL 3E2HB 4WKZB 5B22A 3RX7A 2DQEL 3LQMA 4UT7H 4KY2A 1FLRL 2LQRA 3NPSC 3FT1A 2BVQA 3F6LA 4MJID 1BG1A 5BRPA 3GXPA 4XB3A 1DLFH 2M1KA 2RD0A 5DD6B 5ICYB 3ISYA 5D1QD 2AVGA 4PRDB 2CRYA 4PI0A 4U6XA 1WT5C 3TFKD 1E27A 3MLVH 1CD1B 4XMWA 4N24A 2UWEA 3RBSA 4R7DB 5F21B 3FCTB 4KUCF 1V05A 2PWFA 1RIUH 3EBIA 3AG1B 3PDDA 4MJ6A 4LLQA 3KXFE 1COBA 3ZRSA 2MH4A 1IFRA 3N1MC 3QZNA 2G0LA 4I48A 1LEIA 3TWCL 3FB8A 1K6QL 5GS0D 1MFAH 1I9IH 4BZ2A 4EJ1C 5L4IA 4NQQA 3N91A 4KHTH 4WNSA 4XGZA 5IHHA 4I88A 3MX0A 2VXQH 1DDTA 4KNTA 4NP4L 2VDKH 3QXVA 3ZZQA 4L37B 4K8RL 2I9TA 4NP9A 4PRIE 1UOLA 5K69A 4HKJA 3ZVVA 2WANA 2DMBA 4FFZA 4DCQA 3V5HA 4HZLB 5EO1B 3CFJB 3E6HA 4FQQB 5AAMC 3Q7JA 4PJHF 4HX1A 1NGZA 5B8CC 1F02I 1CFSA 3PWNA 3RWDB 3KW8A 1S7VB 1E5UI 3D05A 4EI5A 4MQTB 3QFDB 2E9IA 2GK0A 1J5HA 4W9LC 1NCAL 5I6XB 4M93B 4MAZA 3BXNB 3RY6A 1QLEH 3OTTA 3SOBL 3HNTL 2Y25A 1TQBB 3WYRA 3EW3B 4KJYB 1G6RH 4CSPA 3F2LA 6FABL 4MXVF 5FW6A 3MRQA 4HIEA 2OX5B 5AB0A 1FL6B 3HZYA 3STZA 4JG1H 6PCYA 3TCLB 5SX4H 3Q9QA 2P4AB 4MA1B 2VLJE 4QRUA 1JGDB 1OGPA 1U2CA 4YDIH 1PZ3A 2VLRD 4D9LL 2AP2A 2ZWNA 3A47A 4PR5B 2AQNA 2SEBB 1K5WA 4JPVL 5DWUH 4NN5C 2BVEA 3ARBA 4NQCE 4NKOA 2Z0BA 3ZDZF 5DZOA 2PR4H 3MRLA 4YOKA 3KLQA 3QJRB 1BEXA 3IFOA 1IUZA 1OB1B 5B1AB 4EBQH 1E3FA 2AJZB 5JOPD 1S8DA 2R4SL 3S35L 3LNIA 3LAFA 2DQCL 5CP7B 5I26A 2X4OB 2BOCB 3MRFB 4JDZB 4Y2DB 5KAQG 2R8SH 5JW4Q 1RIHL 4X5PA 2COVD 4X4ME 1HZKA 4AIZA 1SYSA 2FGZA 5FFGA 2G60L 4PB0H 4L3CA 2EYRB 1MW3A 2OMZB 5IHUL 2WGXA 3KXFB 4WVRA 2H26A 4ZFQA 3RIFK 2WQ8A 4JE0A 4X7CC 4I18A 2ZAHA 3M7FB 2Z8RA 4PJAB 2YN3A 4JKNA 3SYPA 4QUOA 1MJ8L 2X38A 3BUTA 4XNQB 2CLZB 1YQVH 5G4NA 4CSSA 4NQDA 4PRIB 3KL0A 1LD9A 1FG2A 3DVNA 3QWRA 4G6JL 2R69H 3GMQB 1EGJH 2DKMA 4YXKL 3RWFB 1VPOH 4OM1L 3MJ8A 4U1NA 4FOMA 4V1DE 3MHZA 3B4NA 3ECUA 2CLRA 2J43A 3CMOH 4PP1D 3MRPB 3FT3B 4LRNL 2P24B 3NJIA 3B2DC 2QZQA 2F5BL 2X4RA 3P69A 4Y1AB 4R97C 2AQTA 3LS5H 1PKQE 3AACA 3KBHE 3ZUNC 4X83A 3OKLB 3PP3H 1P5VA 4LVOC 4Y4HC 1TTRA 3AB0B 3SKOB 3X1FA 4ZO7A 2J1XA 2DIBA 4TSCH 3FQWB 1NOAA 2AV1A 1K4DB 4JFHD 4Q8BA 3C2AH 1SMOA 2VZUA 4AY0A 2VLJB 2BRRL 1PVHA 1MRFL 1E67A 3CFBB 4WRLA 2VLLA 3D34A 1CYXA 1R5VB 1BM3L 4NX0A 3VXOB 3FQUA 3DTUB 1LEGB 4XMPH 4F7KA 12E8L 1KF9B 3OHXB 1ZDQA 2YA0A 4NNPL 3CQQA 4A67A 1KYOJ 4QNPF 3EGSA 5J8OA 2JKLA 2NZIA 5IIEB 2OL3B 4NZTH 3S34H 4P2OB 3EG9B 4IKLA 2PP8A 2Y5TB 3CFQA 1UURA 2UY6B 1JZ7A 4S0SD 5F7UA 1KB5L 4QYOA 4DPCX 4TQHA 5IHWA 3S0PA 1BQKA 4R5TA 4UB0H 2C1PA 3I75A 5ICXA 3CX5K 4FHJA 3BH8B 3RZCA 1B4JH 4DW2H 2V37A 2YAHA 3BT2L 3VW3L 2LFEA 3DIFB 3FRPG 1SOXA 4YR6B 3PPEA 4AM0Q 2YAMA 1MCEA 5FUZL 1JV2A 1MWOA 4FQ2L 3HMWH 3GYRA 1E4HA 4P3DA 3FTVA 1WZKA 1MLBB 2VDOH 1RERA 3F00A 1NKRA 4K71B 1D5IL 3T3MF 1G9MH 5C9JA 2ZX5A 3CUPA 3M17B 4X6BA 1TU2A 1A9BA 1QFWI 1USQA 3PHOA 4WHTB 5F1NB 1NIDA 1PKQB 4R90L 4WFGD 5EUOE 3Q05A 2B9BA 3ZRFC 2BSRB 5ANMA 5CLYA 2EICA 3HMXA 5BVPL 3U7YH 5DCCA 5ECGA 3TVMB 2YAFA 1HI6B 4E9YA 3FCSB 3GTNA 2R27A 2HVJA 4W1TA 2ZZUT 1A7PL 1MJUH 3FU9A 3I6GB 3QIBD 4HC1L 4HXBH 3E8UH 3ZPDA 1Y0LA 3HG1A 1N19A 1Z9NA 1UXLA 3BGMA 3FOMB 2Z64C 1MOEA 2ZCKH 2CJUH 4G7QB 1SOKA 2DTML 2GJ6D 4GT0A 1A6AB 1SOQA 3ZTJG 2IXQA 4LL4A 4PVLA 3BYYA 3SQBA 4DP1X 1HJBC 1J8HE 3TPKA 1IGTA 1WRFA 4CNIA 2O6CA 4U0RC 2FJSA 1CDYA 2EH8H 2YARA 4PBDA 1VZGA 3TH4T 1Q38A 2JI2A 1M7UA 3B83A 4NJ9H 2B2XH 3B43A 5C0ND 2VRQA 4B0MM 2MMXA 4F7MB 3NIFF 3B8YA 1I3RB 1MCWW 1KEGH 5FDWB 4UT6H 2JIXB 3NIGF 5KVGL 4NKMA 1DJIA 2ICEB 3TZVB 1UGKA 3NCFB 2AEPL 3CSPA 1VACB 5C9KA 4I5BB 1AS6A 1WFIA 4KO9A 1JIBA 5FFOA 1XL6A 4YNYB 4XN1A 4HPYH 1OAQH 3C6LB 1REIA 5JHLL 5A2BA 2MNWA 4DEPC 5JHDD 3K2UH 1N64L 1NM4A 1IE5A 2Q7AA 5KYYA 3CZLA 1KT2A 2W8CA 3WTUA 4HOZA 1P6WA 4GG6B 2NQDA 4WW2A 5IHZA 5IQ9A 1U2HA 5D7HA 5EUOB 3WKQA 2VXUL 2E0PA 4GW1B 4K15A 4ZQTA 4N86A 2PYFB 1OB0A 5B4MD 4NQVA 4IDJL 1VFBA 3U36A 5IQNA 3RTQA 1O75A 4TNWK 3MNZB 3P9LB 4B3VA 3ULSB 2VABA 1UYWH 2XKNB 3HHSA 4U1HA 3L7FB 3SDDD 2YEQA 3LKNB 3GSVA 4B9ZA 5C09A 1Q9LB 2QHRH 3L2NA 4RFEB 4XPGL 4FA8A 4GQ9H 4DGVH 4Z23A 2OJ1A 1YEKH 3QZPA 2FECL 3UYPA 3BT0A 1J8HB 4BV1A 2I7OA 1BMGA 3DUSB 3RVTD 2H4EA 2ZXAA 1CLOH 1EMTH 1FAIH 2W5PA 3FRUA 1K8IA 4X7DC 2VLME 3SODB 4WWNA 4ANXA 5FA3B 3PQYE 3MBWA 4NC2B 4G1EB 4YDJA 2X40A 1G0DA 4PW3A 1W0WA 1AZUA 3SBWC 1L7IH 4H25B 3CC5A 4IQHA 3B7TA 3HC3L 4WW2F 3U1SH 3GK8H 2KZWA 1F8TH 1MSPA 3HIZA 2X4QA 5HGDA 2W0LA 1MCQA 5F1IA 1TZHB 5KBDA 2QEJA 4KTEL 2A74C 5AVTB 5HY9A 4M56A 3ULVL 4LBEB 1ZEAL 2HJFA 1Y1DA 2C34A 2ITDA 2TRYA 2WV3A 4GO9A 1RD6A 1I1AA 1M3JA 2LHAA 3VXRA 5FEBA 5KYWB 5GZNA 3ILPB 2GCYB 1A21A 1G9MC 1IGML 2ZG3A 3INUL 1G7IA 4GG8B 1OP3K 3RU8L 3QRFM 1HHKB 3SZ6A 1IGCL 2YR3A 3A67L 3HEIB 1AG0A 1RMFL 4L2LA 4PY8I 2Y69B 2LGNA 5CIPH 3OZLA 3AAZB 2YUWA 3K4ZA 5HDBF 5DT1H 3AGWA 3JWDH 4X99A 2VT0A 2WLYA 1U3YA 4OIIH 4RGND 5CBAB 5TE6L 2WQRA 4JAMB 4HGWA 5KJ4A 3TEUA 1CF8L 4RAUB 3BE1H 5EB9A 5KJRH 3VGHA 1KB3A 1A0QL 4WUUE 3V6OC 5IESH 2JELL 5KZCB 2VDLH 2NY4D 1MNUL 4N22A 2DYPA 2N56A 5DFAA 5AYUL 5E51A 3G6JA 2DLEA 4JPQA 1MEXH 3VG0H 1IAKA 4P07A 5J6HB 2HKAA 3L5WA 4ZS6D 3HS0C 4BZ1L 5LLIC 1ZJBA 1BMWA 1DEDA 2OP4L 4QRPD 2UZIH 1ZWIB 4U3SB 4F7CB 2V4LA 2BNUB 1JPSH 1O7DC 2XV6B 3MV9A 3WIIH 3WXVL 2NMSA 1YMMD 3GI8H 1CF1A 1VCBC 1YNKL 1ZAGA 2N59A 1JZEA 3APFA 4IOSD 4MCYA 3PQYB 3MRGA 7TAAA 4KZDL 3JVGC 2KZBA 1T0OA 4O9HL 4P46C 3ZTEA 4FXGA 5BZWB 1UOWA 3QAZB 2XTJE 4PGEA 1CZ8H 4MDRA 4QHPA 1ITBB 1WQVT 3VFWB 4ZUWB 4OCXH 5DU7A 4X4XA 3V4UL 3ZRCC 2GVYA 2WN3A 4AV5A 2EVJA 3BUYA 3BZ4B 3SKNA 1S9KC 3AGVA 4W4NA 1DVYA 1G1OA 2NUPB 1KCUH 3Q1EA 3EDFA 5FYLL 2QELA 4N9GA 5AB2A 3EFDL 2GUOA 4ZW5A 1NOFA 4NENA 1A3ZA 4K5MA 2W94A 1SLXA 4EOWL 1NFIB 1H3GA 2OTPA 5BCAA 3GJFH 1G7PB 3W2DL 3H6JA 3D09A 4QRQB 1WFOA 1V3LA 2DI8A 1I85A 3DPBA 4U6YA 5DS2A 1R33A 5EZJB 4HF5H 5EG6C 1MUJB 1NEZB 4CVZB 1U3NA 2YAEA 3VFTB 4PJCB 4DAGH 1NCDH 4J39A 1KELL 3KVDD 2Q1EA 4NNYA 1ZK9A 5F3BA 3ML9A 5JHAA 5JW3L 1IGYA 1RUAH 1DQLL 5J1TC 3RFRA 2ZQKA 5LG1A 3F8UB 4CKQA 1DLHB 4PJXE 4WUUB 1BZEA 4NN7C 1S9YB 1QEXA 2GYSA 3QIUC 5CSGA 4M62L 1AD9B 3LZRA 4HLZH 3QEQD 2OYPA 4G8FA 2J7LA 4NWUH 4YK4B 4YSQA 3QUYD 4FA6A 1QASA 4ICXA 5D6CB 1X6NA 1M05A 2X1WL 4Z7VF 4EI6A 4NNXB 2NNFA 4FI7A 1XGYH 4EQ2A 1H8OA 1G4RA 1MFDH 4E42B 3BUQA 5DHXB 4PJ5E 3VXQB 3KYOA 4U6TA 1DP0A 4DOHE 2D7TH 2C4FT 3WDIA 3FTYA 4XP9H 2XQYG 3BQUB 1GYAA 3MRBA 4NWTH 5CZKA 3TYFA 4NFDA 4P5TA 4QO1A 3D85D 3HFFA 2IH3B 1Q9WB 2X4UA 4AWJC 1PEWA 2RFXB 5DD1H 2FATH 1HINL 5DUBA 3BSGA 1A4BA 3B6SA 4X0NA 4U7MA 1HJCA 5E2UL 4MSWA 1GW0A 4DNLA 5KN5A 4XMTA 3MV7B 2K45A 4P8QA 4Y5VB 4KZEL 2X10A 1ONQA 4V2BA 15C8H 2KHAA 3U2JA 1J8KA 1TTCA 4KPHH 4XO9A 3UTTD 1RK1A 1R5IA 3AT0A 1IJ9A 2KDYA 4XVTL 1AHWC 3JWDC 3HPJB 1DJHA 1EO7A 5INCB 3SDXE 3WFCL 5ESVB 3W3BA 2JTDA 2D7NA 3OGCA 4KV5F 2ZP0T 2VKXA 1PX4A 5EZLA 1T5WB 1FFNB 2EDWA 3SKMA 3TEYA 4IRJD 4MCNA 1S7UB 2E6PA 2A9CA 1IGIL 1LP9F 1QWHA 4S1QH 1U8JB 4LBAA 5C70A 4KUZH 3QQ4A 4GIAA 5I75B 2IOMA 4PJXB 4PJBE 3E0GA 1KJ2A 5L88L 2HTLC 1XH3A 3ZE2F 2QSTA 4G6MH 5F7YC 1OOAA 3WL9B 4POYA 3FO9A 1OAXL 4GT7A 2P43B 1YPZF 2BWIA 4J3OH 3VXSA 3GXTA 2BCMA 1LQSR 3FL7A 1AD0B 2Y7SA 3S4SB 3FRPA 4BSVA 5H35A 3IJEB 4JHUA 5F6IB 4JO1L 1ZHKB 1F0LA 4G1MB 3T4AC 3WJJA 5D4JA 1G5AA 5DEZA 4JQXA 4O51A 2WWMC 1JGLL 2O26U 4WTZG 3KVQA 1F90H 3ARZA 3BIKB 4DOHB 3HPLA 1FNFA 1BIIB 3LB6C 3UFIA 3IJ8A 2WYHA 1QW8A 3KW7A 3T0WA 5J57B 1XX9C 3OAYH 5D1XA 1NTDA 4XOAA 3NDZE 2F53D 1DN0B 3ZE0F 4NC0B 5CBEB 1NKOA 3LZFL 4IKKA 3OKNB 1R3KA 5B3JE 4LOFA 2NY2B 1RULH 1BXXA 3QA3B 3L2MA 1R3IH 1L0PA 3CLEH 3ZUCA 1IE4A 5KSBF 3WTSA 3T71A 2YRZA 3FB5B 2Z0UA 3M1OA 4APXA 4XX5A 1OD9A 2WBKA 5CR8A 4B9PA 3GLDA 5E6SB 4AUUA 3BKJH 4PPTA 3RVWC 2PXYC 2EYSB 1AR1B 4MMXC 4ZSOE 1F4WH 3ES6B 5EU7E 4TQPA 4P5MA 5F9OL 4GBXA 1XCTA 3SPIA 1S78C 4A38A 3STLB 2YJQA 1FNLA 2E74C 2YXFA 1ESOA 1NCGA 3APMA 4UMGA 2IMMA 2DIJA 4QR7A 5DMGD 4JM0A 5MP6L 5EWIH 1EHNA 5KVDE 4LCCB 2GI0A 2WXMA 2VAAB 5F7DB 3N50A 4BXVA 5L2KD 2ESVD 3Q9PA 5DA4A 5F71A 3RWHA 2JCCA 1KTCA 1KB5A 5CGBA 5IM7B 4XN7A 3QG6A 1EHLH 4L4JA 4ODSH 4JFZH 3OC8A 2OMVB 2Y7MA 4KK6D 3L3OC 1A3QA 4YGAB 4OKVB 3T0EC 2Z8SA 5KEZA 3BZ5A 2MHAB 2BCKA 5IQLA 4OV6F 4EDXA 4ELME 4F3FA 3MXVL 3ETBF 1IKOP 3SE4C 4L0YA 5CNHA 1D9KC 5I66B 4KRMB 1NCWH 3KPRA 1I31A 1U41A 4KI5D 3HE6A 2GBTA 1F58H 4P3WA 2JI3A 2VDPB 1KJ3H 1UACH 1UM4L 3D69B 4YHIA 3X14B 1HDMB 3RBGA 4LVNC 5I1KL 4D3CL 3TO4D 3PNRB 5DHDA 2C7FA 2WBJB 2D9CA 3L4ZA 4HH9A 4JFOA 4M6OL 4N5ED 4ACPA 3V79C 3SDYL 1NC4B 2ED8A 4OF3A 2BNQA 4MS8C 4P5RA 5BS0A 1O7VA 2QVTA 1PD1A 1I9JL 1FH5L 3IPEA 5IV2A 4WCYL 4L8BA 4XP5H 1H19A 4GAAA 1QSFE 4WTQA 2YKLH 5EZOH 3MZGB 2JCCF 3O0RL 1A64A 3HBPA 4PWIA 1GL4B 4Y2OB 1TKWB 2ATKA 3SHSA 3WTYA 4WY7L 4DQAA 1INEL 3D4CA 1LXMA 4OU3A 3EFFB 1MHEB 1A1MB 4GRMB 5DC2A 4Z7WA 1V10A 8FABB 1J5OH 3GTTA 3MYJA 2BY3A 2O5XH 4YEEA 3CXDL 1P4IL 2B1OA 3V52L 4K7FA 3LH2H 4NUGH 1I9RH 2XWDA 2GY7B 1CLZH 2NTSP 1C5DA 1R24A 4NGHH 1RUQL 4NT6A 4JNXA 2KDGA 2P3YA 4OZFH 4GAGH 4TULL 1F4HA 4Y19A 3W56A 4ZSOB 3FN0H 3FB6A 4YSAA 1BVLB 1UD6A 3VVVA 2YZ1A 1SN5A 1XGPB 1Q72H 3AY4C 3IMUA 2EECA 3BPOB 1XGTA 1OP5K 1E9PA 4OLEA 4AYBA 3TBVB 4OI8A 3NAAH 5ILTH 1QSEA 1L5GA 4LGPB 3WEMA 4J3OC 4JO3L 1IEAB 4TPRL 2XYBA 1HNGA 2OSLB 4YHLH 1ZLUK 4YHYC 2JFCA 4NUQA 3CHOA 4JDEB 3QCUH 3IDGB 4IKJA 4KX7A 1TQSA 1GC1H 4UILL 2I60L 2Z31D 5IW6B 4ELMB 3EDDA 4YAQB 1BG9A 2BS9A 2XA8L 2G9HA 1FNGA 1EAQA 2WKOA 2O6EA 4Z7WF 2OFQA 4AL8C 1AH1A 4UQDA 3TH3T 1I8IB 4XMKL 1QBAA 1CXIA 4LSVL 4R7VA 3UAEA 7PCYA 3VYOA 4B9FA 4JFXB 4LCIH 4FE9A 3I9GL 5HGBB 1TZIB 2AXFA 3P30L 4F5CA 2B08A 3BW9A 3DDGA 2VR8A 4X7SL 4KJQC 3RDTA 1CGXA 2OZ4L 3IU3A 4UM8B 3OV6A 3DIDA 1QRNB 4PLKD 1MCDA 3T6WA 3DUUB 2ISDA 4XPFH 5EU3A 2Q0ZX 3QYNA 5E8OB 3LRSA 3O2WH 1DQQA 3MODH 4XNYL 1QNIA 2ZPKH 3BJ91 5DO8A 2XX0A 4PRPE 1E9QB 3LD8B 2ZYHA 4Y8AA 1FVEA 3NA9L 1NBZB 5B38B 2FZ3B 4OAWB 3PFQA 3PAYA 2MJWA 2IC2A 1KIRB 1RZJC 4PB9L 4YDKL 4UM9A 3HE7A 3G08A 3O6FC 2E7DA 4GRLC 1RZGB 1CJYA 2GY5A 2RR3A 3FDWA 4K3JL 4YZFE 5E7BA 4HZAA 4Z3GA 1UJ3A 1H0DB 4TQEL 3OG4B 3B8SA 4AEIL 1W2KT 3FH5A 5HVFB 4XCCH 3D39E 2VZTA 2P7TA 3CMGA 4RISH 3TWYA 4N2CA 1Q4NX 3EYSH 1YVLA 2F2HA 2PYEA 4N1CA 4OCRL 3B1TA 3KPSE 4PM1A 1ASQA 4OSUL 2Q10A 4LSPH 4U1LA 5CN2A 3ZKXC 3DROB 3D3VA 1MW1A 2WLKA 1PZBA 1HYSC 1PG7W 2OJZL 2IALA 4HJGA 4JY6A 2C9UA 1XR9B 4JJ5A 3EIFA 3GC3A 4H26A 5SV3A 3IRCA 4PGCA 2F0CA 5LDSA 2VC2H 3U0TA 4OZ4A 4U4BA 3L5IA 2BZCA 3UMTA 2XBTA 4ZZFA 1O5PA 4KAQL 3QPXL 7FABL 3KM2A 3P0VH 4K9JA 4ODVL 1K85A 1T20B 3EFOA 4GW4B 2L7UA 2IAMC 2J8OA 3GBEA 3ZGHA 3IFPA 2EKSB 1KY7A 2VDLB 2ZUUA 4GAYB 4EDWL 3IB4A 3IMSA 5DXWA 5GS1C 43CAB 3GMRA 2CCVA 3QUZB 4NCDA 1AIZA 3C6LD 5C7XH 3DX6B 5JA8B 1XQ4A 1GCFA 1UGNA 2YOAA 3TNNA 5J13C 2OMWB 5TQ0L 4GEJA 4B9GA 1TO4A 3Q6GL 4PYHA 4A2MA 1NDGB 3REVB 1A47A 1GKEA 2PMZA 3J8F7 4PUBH 3S2AA 2XBZA 1CDCA 5DQJB 4PRPB 5ID0A 3ZR6A 3G5YB 2NSMA 3TV3L 5MHSE 1ZY9A 4AH2B 1FNHA 3E6FB 4H20L 3NFNB 2DJMA 4ZUTB 2HH0H 5JPNB 1BQ5A 1GGTA 3VFUB 2EIMB 5IB2B 4ZQKB 3HR6A 5HYJD 1Z1WA 2V7NB 4FHBD 4NXKA 1H15A 4JZJC 1MIEL 3BH9B 2XQBH 3DRTB 4LKXA 5IB4A 5I6LA 3NSCA 2ZCZA 2WYZA 5HHQB 2HN7B 1CQKA 4YSEA 3D39B 2WLHA 5L4FA 4PJHE 4KXAA 1R3HA 3U25A 3KPSB 2YMXL 4ZNEA 1GC1C 4EVNA 1C5CH 1JF6A 4JM2A 3PGCA 1JK8B 2GT9B 4OD3L 4N0UE 1CR9H 4ORGA 1JD7A 3T1FA 2H2PC 4QJ4B 3CVHB 3LMJH 3MV01 3Q8AA 4MXVE 1Z9SB 4UOJA 1U6AH 2YRBA 5HJGA 1D7FA 2IGTA 2VXTH 3NFSL 4Q6IB 1UM5H 2BINA 3QUXC 4F92B 4UDUA 2HFGL 4GSXA 4UV4L 3LEXB 2BIHA 3BEWA 3C5XA 3T5WA 2YJLA 4XXDA 2HA1A 4CBPA 4WJ5B 3N06B 1UM6H 4JS7A 4LEEA 2F58H 3H9SD 3L9RA 3BMVA 4TNFA 3ZDZE 2O4EA 3TF4A 3UOAB 3TL5A 3V7AE 1HH6B 5DD0H 4I4WA 5FXCH 2G5RA 2HPOA 1O6SA 4HWBH 4LCWE 4OJEH 4I7ZC 4XNMA 4ZXBB 5HGHA 5C08D 1A5FH 3WD5L 3S88H 3Q06A 4JFEE 1CFBA 2DLTA 1KB9K 2AEWA 1F3DJ 4M93C 4BQBA 3FUIA 3FC8A 4XNUL 5IMOA 4ZMZA 2WNKA 4J23A 4NYLB 4JM2F 4EN3B 2GAZA 5LBSL 1BIHA 3TN0A 1UWFA 5C07D 4BM7A 1GPOL 3OJ2C 1S7TA 4EN2A 4Q9QL 4OCWL 1WGVA 3DK0A 5KZCD 3BZEB 3NJNA 4YFEA 1D2PA 5E0FA 1ZGLM 3TF7C 2BVPA 1EXGA 1MHCA 3G6AA 1P5UC 4XP6H 3O6MH 4WWOA 5IBLC 1AP2B 4FFWC 4LCYA 4YX2L 3SDAD 3RI5F 2IWFA 2EDHA 4HKXA 2F1EA 1ACXA 3UBXB 4LSUH 5FUOL 2EH7L 3PNWB 2W60B 1AOZA 2BXZA 1AGEB 5FFLA 4L4TB 2ZJSH 4TTGA 2H47C 2BY0A 4I0KA 5I23A 5D6DC 2WKLA 4PJHB 4ZFGL 3AU1A 4WTZA 3LRHA 4J8RA 4BFJA 5IGXL 3TV8A 4MNHB 4JM4L 3MBXL 3OR7B 3KBEA 4HFUL 1AKJA 4P2RA 4AQZA 2AV7B 4WI0B 3SBQA 4MHHG 2J57A 1R0AL 4PREB 2IBZY 3IPBA 3CFEA 4KI1A 4R9HA 4N0UB 3GSRA 3S5LB 4MXQC 3CK0L 2A83A 4HWZA 4X8XA 3VYNA 2QSCL 2C3VA 1OY3B 4GO6B 4KNSA 4G9DA 5E6UB 1GW6A 4FQXA 2FBOJ 4MMYB 3O2DH 3EZ8A 5D1ZC 3GSWB 4XCEB 3C60C 2I07B 2X89D 3H7BB 2FWSA 2BHZA 4J12A 1ORSB 2B59A 5DRWB 3FO1B 5DVPA 3TBSA 1ZVNA 3P0GB 1IC7L 1MH5B 5A16A 2CK2A 3ZDZB 4KVNH 3O45A 1BZOA 4X9HA 3CG8A 5TPWL 1T80A 1BFVL 5IB5B 4LCWB 2J56A 5DHYA 2N7SA 2P5WE 3GMNB 2MQGA 4G72B 1A7BA 2ADIA 2YC1A 4JO4L 4OLZH 5J0BA 4JFEB 4IGBB 2QSVA 3LVTA 3O9WA 4MFHA 4KDVA 2W80C 4QNPE 3V0WL 3KYKL 2A1WH 2EINB 4MJ2A 2AEQL 4FQJL 4KDWA 5HHOA 4F20A 4P2CG 1QI4A 5D96C 1S9XB 3PF2A 3KJ4C 3OZKA 3VJ6A 3MA7A 3V6ZA 3I2CH 2XWBA 4PWHA 4GLRI 3SKJH 3LN5B 5C0AE 3NUKA 4Y4KA 5CINH 1K3IA 5J9PB 5LGJB 3G5ZB 3PHAA 1FDLL 3B9KC 3K80A 2VLKA 1A4KA 1KBGL 2ZOKA 3EHBB 3WIHL 4A2LA 3O3BA 1SJVA 2W9DH 2WYTA 2XWJB 4GXUN 1L9SA 4HPOH 3BQUD 5ICZA 4CW1B 1JPTL 2VSMB 3EO1B 1SY6H 3DTXA 4YBLC 2NW3A 3MROB 4ESKA 1HSBB 3NN8A 3T3ME 3IJSA 4KKRA 4UZUA 3FQYA 1PIGA 1HE8A 1IEHA 4ZX5A 2APWA 2FX7L 2J21A 3F83A 3JV4B 3CZFA 4GI6A 1CI3M 1MFVA 1NMCC 2A73A 5AZUA 2IO5A 1A2YA 2IDUA 5LXVA 3QO0A 4XBEL 4LHUG 3BGFC 4JRXB 3MV7D 3B7UX 4LLMA 3SYQA 4DUXA 5T1KB 1KPVA 1CDBA 4LXFA 4BXSV 3DRQB 4F9LC 2NT0A 1M6OA 2BFVL 2XFGB 4I18B 3VRJA 1SNRA 5CSZB 3SD2A 4OD1H 1J11A 4IRZL 4WEMB 5CP3H 1JXFA 3MLSL 3N42F 5G4OA 2HUEA 5IF0B 1UATA 3GQFA 5EORL 4MA8L 4V33A 3V4PL 2C1OA 3C5SB 1I1FA 4ABWA 3J07A 3W37A 4MMZA 4F7PB 2P5WB 1NLBH 3RB7A 1UXMA 3VGAC 4G70B 1U58B 4BJLA 3V0IA 5C3LD 4K71C 4U1KB 3DNKA 3TT3L 3VD9A 1A7OL 4XN9A 1W9XA 5GJSH 4TSAH 4JPKH 1CFMA 1XXFC 3IU4L 3QZWG 3ARDB 3O4LD 4G11A 2ZIDA 1JWSA 3GO1H 5D55A 1L0YA 3NIFE 5ESAB 5GRXG 5IQMA 3D2UA 5KBLA 35C8H 1NAMH 1HAUA 4TL4A 3RG1C 3OJMB 1HWGB 1M9WA 1JOIA 2A6IB 1J05A 4LEXH 4M6NH 4XZUA 5E6YA 5C0AB 4MB5A 3T6XA 1NGWA 2VWEC 4KDTC 1F4AA 2IQAB 3WAJA 5C0DA 3DO7B 2NY6B 5I6OA 4Z7UB 3QEUB 5HVHB 4QYAA 4F2MA 3VCLA 4P4KB 1ZLSH 1NL0L 4Q4EA 4BRVA 5J89A 2KI6A 4HQQH 1UA7A 3BWZA 1PDKB 5A1AA 5CD3A 2WMPA 4FI6A 4Q58C 2Q20A 3HTLX 4X0KA 5DS8A 5E95B 3VFVA 3A0OA 3ZZ1A 5B39B 1XB3A 5CHNB 5DJDB 3T3MB 1BVNT 1TTFA 1JWUA 3NOIA 4G7YL 1RK0B 3S37X 3B5GA 3ATFA 4QRRD 5F7NC 4IIQA 2FEEL 3QDGA 3K2MC 1BFOB 4JO2H 1S7XA 2FBRA 3CVIL 2RBLA 2R0LH 1QBLL 3AQXA 4ZX4A 3CPLB 4MQXC 2NQCA 5FKPB 2EVIA 2MTPA 5FCUH 4OZHA 5C97A 3IDUA 4I77H 2DIEA 3L13A 5DZAA 2Z91A 1S46A 2BIQA 3ZT7A 3GRWH 4I0PA 3S5YA 5JOEA 5DEFA 2A4CA 2LVEA 3HZ3A 1EFXA 5I6KA 1WC7B 4DGWC 5AW0B 1MI5D 2H0PA 1UH4A 2YPLA 3BHBA 5F3FA 4UNTA 3DOSA 1G7QA 3ML8A 3BAKA 1YY8B 4ZO6A 3KL3A 2OMUB 2B0SL 1C8PA 2FGWH 3IDMA 4BUQA 3WFHB 3QORC 1G7LB 1XH2A 1A3LL 1PSKH 2I5YL 1P7QB 2YGVA 4L5FH 1EEQA 2Y7QA 4FTVE 4H1LG 1SRDA 2FVNA 3O3UN 5AZ2H 2OS7A 3MREA 2J8UB 1U8HA 2CBQA 1Z5LB 3VM7A 1CK0H 1SLUA 3KGUA 1U95A 4KROC 1I9EA 1KCVH 4DSYA 4OQTL 3T8VA 3HZKA 4NM4H 3IGAA 5C0RH 2ERJC 4P23A 3V5DA 3W39B 1IGJB 5IG7B 1VGEH 3RY5A 1IT9H 3NIGB 1FPTL 2MKWA 5AW1B 3S96B 4APQB 1R3JA 2FT6A 2IV9A 4OZHF 2Z65C 1R5WA 2BNRD 1CIUA 4M43L 4XP4L 4WI8A 2HLEB 4FQIL 1XSOA 4NDMB 1S3KL 5DJ6B 4NQED 1T89A 3C09B 4PS7A 1YO4A 4GRWH 4L9LC 2OZ4A 1HXMA 2XHNA 2AXJA 4ZFOB 5C09E 1QD0A 3PV6B 1XBRA 5D2NA 4S1RL 2Q86B 1NC4D 1AJ7L 3KBPA 1U8MB 4KKQA 3MBEB 5T3ZE 5HDBE 1UKTA 2UZYB 5GJTH 3QISA 5ADPL 3GWJA 5MEND 3TBYA 5F7AA 1T1YB 2JXMB 3QPQD 1QFWH 2NNXA 2G5BB 5C0FB 4B9KC 5TDNB 4LLWB 1UT1A 5CUSL 3VI4B 2WJ7A 5T1JA 5E1QA 4ZFFB 1TJHH 4YHMH 1ZV5A 4ALAH 3ZLQC 4JFDA 5C92A 1PMYA 3MZTA 2C7UB 3JQOB 4KWUA 1ZXKA 4OLUH 4B97A 3ZKNC 2FAUA 5CSBA 4D0DA 4LL9A 4NO2B 1KLFA 3DX7A 5E5LA 1PG7X 2VDQB 2PO6C 4XOBA 3GXMA 4WQOA 4KO6A 4YSCA 2MEJB 4XPHL 1OSYA 5CJXA 4IU2B 1QPXA 3IF1B 4FFYL 5MEPB 5LB1A 5IFHH 3QI9A 4FTVB 1GYWA 1CXLA 1OT1A 2DQFB 3DX9A 4MD0B 1NJ9A 1QUNB 4LCUA 5EMYA 5LN8A 3IJHB 4NPYA 2VL5B 5FA4B 1DBMH 1JJUA 5E6IC 4U7SA 1I1RA 3LHPH 1SLWA 3QDMA 4PTUB 3SDCC 3K91A 3X17A 1XL4A 3BESR 3OKEA 3TONA 3P77B 2F68X 5EBWA 5JOFA 3MGOA 5I8KH 5IT2L 1OZUA 4GAJH 5CU9A 1QP1A 4JKPL 4BGLA 4YQXL 2HAZA 3HRZB 4PD4K 1LDPL 4N2AA 4UV7H 5LCVH 3HR5A 3BVNA 3X13A 1KXTA 2DQHH 2C9SA 2HXAA 2VDNB 5ALCL 1OARH 2ZWLT 4RDQF 2YBGA 4H4NA 3MV9E 3QIUD 4UU9A 4X2UA 1OW0A 3MI6A 4IBZA 5HDBB 3EH2A 3QDJD 1OCCB 3VWKB 3RX8A 3VWJC 1AYOA 3I6KB 4GQZA 1NBYA 3AM8C 1VF5C 2Z7WA 3MLWH 2ZKWA 4KK8C 2QZ5A 4G43A 1XGUA 1QOKA 1R3LB 2ZUTA 1C16B 2YLHA 4L9DA 1OO2A 5DHEA 1E5ZA 3U46B 1NC2A 3KNBA 2ORBH 3FTZA 3ZYOA 4DP4X 1QA9B 3GB7B 2DBLH 5BXFA 3TA3B 2AQRA 4B3EA 5EBLB 3GNMH 2FBJH 2XN0A 4F8NA 1ETZA 2N01B 4ORZC 4YDLB 5HXMA 3IPFA 4Z7VE 4M4PA 3RWCB 5K9KA 1OIOA 3QFJA 4TUUA 5KSAB 2QKIA 3AJ7A 4EZKA 1Z7JA 3LSOA 1IBDA 2KPNA 4ZBJA 2AQPA 3UGEA 4WFFD 1KZQA 2OXHA 4KO7A 3HC0B 4MJJA 5D70H 3U9PL 3MR9B 4UIMA 1MCOH 4NAJA 1JDAA 2YAPA 3SCMB 4UDTB 4MAUL 1X5FA 4TUOB 1KXVC 4BDVB 4WK0B 3N85L 5C6PB 1F1GA 2P49B 4XTRC 5TH2A 2F7OA 4OFPA 1M71B 5DJ0A 3LKQB 3TJHC 1BAGA 4AYDC 3E3QE 3ISWA 1EO5A 4F9PA 2E7CA 1R1CA 1KG0B 3F12B 1QSZA 5JQIB 3EH5B 2N0KA 2CO3A 1WBXB 5ISZB 4X9IA 4WI7A 5I6NA 4PJGB 1GSKA 2PF6A 4AL8L 1GGBH 4LP4A 3SKUD 2A99A 4DF9A 5D72L 3GKWH 3LH9A 4KV5E 4N3UA 5B21A 2H3NA 2C5DC 1PX3A 5CGTA 3UG4A 3NEEA 1CTMA 1CLYL 2HTLD 3UDWC 4PMFA 3C5ZB 4PN6A 2J55A 4ALAC 1NLDH 4LVEA 1LP9E 5LBSA 2Y06L 2H7WA 2NTFB 4WI5A 1C1EL 3GM8A 4J7RA 5LGKA 3JBG7 3BN3B 1QZNA 2WQVA 2XTJC 1XH1A 3RVVC 2A77L 2B1HH 5I8EB 2R2CA 4CU7A 1FYTA 5I1JH 2HPTA 3ZSSA 5IWLA 4IHOB 1S9VB 2WWMD 3L3IA 9CGTA 3ZE2E 3QRGH 1BF2A 4WUKH 1KGYE 1NMAH 4U3CA 1YPZE 1ES0A 2YGOA 4FKKA 3LY6A 4PAZA 3LB6D 5TDOA 2D0GA 4JMXA 4ZFZA 3MLUH 4Z7VB 4PW9A 4UQ2A 3GMMA 1M7XA 1RZJL 3AADB 4C83B 3I50H 4ZDHB 5K39B 1MFEH 2FUTA 1DVFC 3GMLB 4MJIA 2QR0A 4K7PH 2JJWA 4Y5XC 3GMOA 1RZ7H 5AAPA 2DPKA 2PW2B 1CD8A 3CD4A 4RMSA 2JQAA 3RNQB 1FVCB 1FNEA 5DLML 3TBWA 4A37A 1NSNH 2R0ZH 2F54A 1SF5A 4H0HB 2FB4L 1A4AA 5DRNB 2YGNA 3BUDA 4JG9A 5DGRA 4DO4A 2HB0A 1T5KA 4X4ZA 3ZE0E 1HK6A 1FZMA 1PY0A 3JWNG 3KPQA 2PXYD 4FKHA 4H0IA 1JP5A 3RVWD 3AREC 3NJJA 5BPPA 4LHUA 3QP3A 3MACL 2A9MH 1T21A 2QPFA 1D5RA 4OJFL 3DXAD 5JXAH 1QFUL 1F5WA 4DETA 5KSBE 2Y24A 2CBMA 4N25A 2B9AA 5IVOA 5I8CA 3Q8CA 1ZGLA 2AJUH 5I1LA 5TDPB 3JWOC 4OCMC 4YDVA 3CZGA 4G71B 4L4VE 5DYFA 1HCVA 4Q9CA 4YJZL 3BPNB 1K3ZA 3KPPA 4NO5B 2EE2A 1SEBB 1W72H 3IJ7A 2CHWA 1JGVL 4DQOH 3OZ9L 3ARFB 1A22B 1JN6B 3BKML 5LAPA 4KQ3H 3ZE1B 3V2AR 1M3IA 4JLRA 3CCHB 2F18A 1FCGA 5GGUB 4ODTH 1LP9B 1D9KD 3V0VA 2X2HA 1I3GL 4EN3D 3MNDA 3MRMB 3QZWA 3T08A 5GZOC 1GOFA 4R5VA 1Z66A 2FECI 2YQGA 1IU1A 5HPMA 5D5MA 4IU3B 3H0TB 1TLMA 2R2HB 3ZE2B 2ATPB 4ETQB 3FQTB 3QIWA 2GHZA 1YPZB 3T6QC 1QRKA 1OV8A 1DCEA 5T3XH 4HOXA 3OJDA 1DEEA 2H9GA 1IKNC 1YEEL 4MS8D 5IJDC 5JNYB 1OP9A 3WIHA 2PWDA 3QJHB 4L4TD 3EBGA 3H3PL 5KW9L 4KQ4H 1M4KA 3SO3C 3WHE0 4AM0B 5KTEH 3DECA 4LSRL 2JF1A 4MX7A 4JHWL 3QNFA 4KKAC 3GXNA 2OMTA 2RCSH 3OMZA 5B7FA 2G4EA 3L8QA 3QUHA 5AVZB 4H13C 5E08H 3LEVL 3U7WH 4PJDF 3ULUH 1QNZL 4AIXA 4OB5H 3IKCA 3ZE0B 4EI0A 4LPXA 2JCCE 3R7RA 2G3MA 2HX7A 3SGJA 3G6DH 3AWGA 3ROLA 1JFHA 1ETB1 3LKOB 4Y4FA 3L4CA 1UWEH 2APXA 4ZT1A 4FXKB 4XP1L 1KYUA 1MJ7L 4WHCA 1KJ2B 1T4KA 2W0PA 4XWGL 3S8GB 2CKNA 5KSBB 4GOSA 2Q8AL 2J73A 5IMLA 3V4PA 1YN6B 1NFDB 3FQXB 2ZWSA 4HIHB 4J3OD 1FIGH 4HHAB 4L4VB 5EO0B 5C0EB 3OXRB 1JNLL 1OQOA 2P42B 1S7WB 3US1A 3FOLB 3CC1A 4IGBD 5D9SA 3Q13A 5EOCH 1RZQA 2IPTH 4JFFD 4UZGA 4XOCA 1U8QB 1RUPL 4JVUA 4HS8L 2C26A 4H1LA 4LFHD 2XWXA 4TL5A 1ZLVH 3TC9A 4RH4A 4PJ9C 3FFCB 3FMGH 1FL3A 1OCWL 2RTTA 3CZNA 1PQZA 4H2CA 3TA4D 5GGQH 5BS0E 2C9QA 4WWKD 1UXWB 3WNOA 2PN5A 1T0MA 3WUWB 3EGDB 2R2BB 4ZPTA 1SXZA 5LBGA 1TPXB 1F3JA 2AK4B 4B9CA 3D0AA 5T1DL 2R7EA 1VADA 3U0WL 3GJEA 5B1BB 1T04B 3S48A 3T0VA 2ICWJ 1CGSL 1E0OB 5IVXF 1KN2H 4Z7WE 3RA7L 3WNIA 1WWBX 2DICA 4U6HA 5ES4B 2IDFA 3QR1A 2CKBB 1Y6MR 5EU7C 2F61A 4HK0B 4UQ9A 1E9OA 4X6FA 3Q2LA 1JYNA 1JNHB 1QBML 1HHHB 3H9YA 4Y19E 1WTGT 2XNAB 4N6RA 4NZUH 1N4XH 4HUVA 3EYOB 2AGJL 2EDTA 2F74A 1ZSDA 5K33A 2A6DB 2PP9A 1AI1L 3WEXA 2X4TB 2GPZA 2IG2L 3QS3A 5H2BB 1UWXK 4JG0H 5F0LB 4UYQA 1NBVL 3VXPB 4ELKB 4HH8A 4GRLD 1QSEE 4NHUB 1PY4A 4Y0GA 4JRXD 4LEOB 4O00A 5C0BD 5EDSA 3X1EA 5HHNB 5E2VL 5FECA 1J9TA 1D5ZB 1RZKL 3CH8A 5BRZD 3W0WE 5A2KH 3TJPA 5BO1L 3UYOD 3IXAA 5E8DL 3U79A 1GMIA 1Q1JL 2OR9H 1MN4A 3CU1A 1PZDA 3RURA 5HJ3A 1HYSD 4O02L 5HP5A 3NRPA 5FDYA 1TITA 2W92A 1EJOH 3S3CB 3N43B 4XN5A 1KYOK 1AGDB 2XN1A 5A7EA 4LE8A 1GZQB 1JF1A 3BP6B 1NCCH 3Q6FB 4UZSA 2WNGA 4J8QA 1K5NA 5KYXB 1MHPH 3VFSB 1H8NA 2VE6A 2UZXB 4HBCH 4RWYH 2XTSA 3EJYC 1W8EA 4I3SL 4AC4A 5EF3A 3ARDD 1BQHB 2IAMD 5AWNH 3N5AA 4YXLH 5G2NA 5B3NA 4OQTA 5CN1A 4QLWA 3JT0A 5IQ7H 3ELAT 4HCGA 5MEOA 3CVCA 5IROC 4J3UA 1BD2D 3EH4B 5D7IA 5DEGA 1TQVA 3FT4A 1PEZA 4HUXA 5DMIL 4AGLA 1V7NH 4JDTL 5ETUA 3PP4H 3QIBA 4Y5YA 2X7LB 4M8RA 1KGJA 1QLRB 1QQDB 4MA3B 2ZTBA 4HKZA 2L7JA 3MCLL 1HHIA 2FLRT 4RGMB 3OR6B 3RL2A 3UZEC 5AUMB 5I19H 1F41A 2IJ0C 3QWOA 1N70A 2X12A 2IAND 4Y19B 3QJOA 4QHNB 1I7RA 3P4NA 3ROOB 2LU7A 3H54A 5EU4A 1I1YA 3P4MB 5DFTA 4E5XA 2F6AA 4BFIB 1S7RB 1AO7E 2KQNA 3DVFA 4PEEA 1YN7A 1ROWA 3JV5A 4OCNC 2N4IA 1FQ9C 2OL3L 1JPFB 5DJ8A 3GHBL 3WXWL 1B4RA 4YUEH 4LMQE 5FO7A 3F7YB 3MRIA 4YGVB 3UROR 4CADB 2ADGA 5FOBA 4UQ3A 2VCOA 4GIOA 3S3JA 1OAYH 3W0WB 2CDFB 4GI9A 4UQCA 3ZQ9A 1C12B 5D7IF 4P9HH 2V2XB 2Y0SA 1URZA 4D8OA 1TVDA 4B7IA 3TTYA 1DSYA 1A6TB 2XZCL 3T2PA 3R1GL 2BS71 3EGXB 5DVNA 1PJWA 2XPGA 3IDYC 4KMQA 4WO4B 5CLTA 3NFPA 5E9DD 1WITA 1BX2B 3A4DA 4NM8H 1BQLL 3VXUA 2H2PD 4FFYA 1HVXA 1QABA 5L2JB 4FQ1H 5T1MA 1T4WA 1XIWA 3G5WA 3C9NA 1OPGL 3H7LA 3TYGH 1GYVA 3QUXD 4PS4L 4X5WA 4XBGB 3RNKB 2AQ2A 1RP9A 2DEYX 2FYVA 1TJIL 3CDYA 3LNGA 3VAEA 2A5UA 4XH2A 2HT3C 3C6SA 3PWPE 4FFZH 2WVUA 5FGCE 5CZVH 3LRSB 2I9LB 1FFOB 1RJZA 3TIEB 1A1OA 3W9EB 3T2NH 1TCMA 3D08A 3FTGA 5LWYH 1NQBA 1DQVA 5KSUA 4APQD 3KCWA 4OT1L 1VJSA 4U1SA 1TFHA 5C0CD 1YMHA 4DGYH 5D7SL 3UP6A 4HISA 4XMLH 1WZ1H 2XVLA 1DE4B 3SDDA 1A9EA 4OGXL 2EVHA 3QHFL 1HCFX 4N90E 2WWKO 4UAHA 4Z0BH 2P28B 1HOCA 2JKRM 3LS4L 3N3EA 4YIQA 3U6XA 5AAWC 2IDTA 4DVBB 2F8IA 4FNUA 4DUVA 3QQ3A 4IJ3B 1MRCH 3MBED 4ABUA 1AQDA 2HT4D 1OXYA 1Q9KA 5I2IA 1U3HC 4BKTC 3D25B 3DMMB 1KACB 3VFVB 1Z3GL 1I8MB 2HT2D 5IBLD 3WJMB 4FFWD 1XBDA 1AO7B 1EEZB 1QUPA 1ZTXH 2GTWB 2F1BA 4ZNEE 4G7VH 5F0PB 4OIFA 5I5RA 1MCPH 3GSUB 4GJTB 1OEZW 3BRGC 4PU2A 4DPBX 4YHZL 5JR1H 2K6ZA 2QQKH 1LLAA 1IM9B 3U2IA 1JBJA 4Y9CA 3O8XB 5IFAL 4FNRA 4ODBD 4FJ6A 3QJQB 3EJSA 4O2FB 1OALA 3L3DB 4FNLH 5GISL 5SWSE 4H5SB 2W0KA 3ZKQD 2Y7NA 1FJ1A 3JUZA 5JYLA 3K6FA 4LO9A 1UB5A 4NERA 3LRKA 3WIFB 1BP3B 1ZLDA 1OTUD 4P57B 4MXQD 5A6MA 4M61B 1MPAL 4RX4D 4XNXH 1BVOA 3VACA 2CG9X 5EU5A 3UG5A 3FH8A 2WJ5A 1WUNT 4N0FA 3D0VB 1T0NA 3PGFH 1OT2A 4HKBA 3ARGA 3MGTA 4XAWL 5D1ZD 3C60D 2V9QA 4JPWL 4ZO8A 5C7ZA 2YIHA 3ZGIA 1IQWH 3QUKB 3LJ3A 4EEEA 4ZZKA 4PJ8C 4IRSA 3HS9A 3PWPB 3WMPA 3NCEB 4UNVA 4M8QA 4DT2A 3B3IB 3L3JB 1QEWB 4GXFA 5EEZA 3B5TA 1JXJA 4YVNA 2ALAA 4IOFC 4CA4A 5ID0B 4GFTB 1P2CA 4ABVA 3NZ8A 4CC4C 1FFQA 4TNVF 5EO9B 1K8DB 4BH7A 4BKSC 4NKDB 1TEGA 4FMKA 2J88H 3P3RA 1T1ZA 2VMCA 2YD9A 4W6YB 1TCRA 4ONGL 4NQXA 3K46A 4YPGA 3DSNB 5KSVA 4L8DB 4W9GC 3TBCA 1E28A 1DDHB 4HJJH 4ONHB 4NSKB 4FABL 2DWYA 4YHNA 5K9OA 3R06B 3HHMA 1GZHA 4LLVB 2XZQL 4I9XA 1XZ0B 1N6QH 1HHJB 3VWKD 4MDIA 3WS3B 4XVJH 3SE8L 4IOSA 4PJ7A 2VN5A 1D6VL 4RBPH 3TEWA 4P9HC 1JHTA 4JGJA 5MEQB 2XRAH 4J1UA 3B9KD 4AYID 1PFCA 2EDDA 4XCYA 2EEDA 2J2ZA 5KUKA 4DKEL 4Y16B 3NGBB 1W8NA 1MAML 3GIVA 3HZMB 5SWSB 1ILUA 1X9UA 3HB3C 3NTCL 4YVUA 4EXPX 3BQVA 2NXZB 4MNGE 4N8PA 5CILH 4L29B 2R1XA 2VR4A 1BVZA 4UDUB 1MWAA 1TTUA 1NGQL 1L4IA 3P73B 3PWJB 4OCYH 5IW3A 2OBGA 1CYWA 4IHBA 1EJ8A 4GSQA 5I0XA 2R0WL 2CUAA 5CLZA 3HNVL 1TT6A 2WXLA 1X5JA 3OQRA 4QKXB 2WLJA 3BYTA 4I4WB 4PRHD 4TS6A 3FN3A 4YPJA 3UXFA 3WEAA 2F08A 3RAJL 3SCMD 2YPVA 3FULA 4OIAA 1I75A 4ZTEA 1C5BL 1H3WM 1K2DA 4DPAX 4FKEA 4EI5C 5H4ZA 2R51A 1RI8A 3AFLA 3FTUA 5L6YH 2IWEA 3RY6C 2ZYSA 4PWEA 1KYFA 3CFUA 3T4YB 5I74B 2EEFA 1KBBA 3QO1A 4ZYKA 1U8OA 4LQFL 3RI5K 1FL5B 2ZSVA 4G3YH 2CMRL 5F7EH 5PAZA 2J25A 2QTVA 1V27A 4TVPE 3MLZL 4OTXL 1C7SA 4LARL 1CMOA 4PJFF 4AJ0A 5ISZD 1CG9A 4AMKL 1OSEA 2WZAA 5H37G 1BBJA 2A9BA 3MRRB 1TZOA 2EABA 1WEJH 4E9SA 5IK3B 3ARBC 1S5HB 3M46A 3HMXH 5IEHB 3IAQA 1M2VB 3VXME 1FA4A 5BJTB 1YEGH 1ADQL 1MDTA 3WHXA 3U6RB 1KXQA 1ZD6A 1A7NL 1ZTMA 1MCKA 2NUTB 4JPIB 4RMBA 2WW8A 3PABA 3ZXAC 1JV5A 5JW4R 3AUWB 3X2QB 5FX3A 3GBDA 5ACMA 4C57C 2O1AA 4PP2B 4KVCH 4NOBA 2GFBA 2Q7YA 3NABL 1SVBA 5INDB 1KULA 2AJYL 1TVBB 5D7KD 2VN7A 4FHKA 5IOPB 4I18C 5BZXA 5LGHH 4JFYB 2HYMA 2H6PB 2WAQA 4ZAKD 4AQAA 5JORB 2APTA 4MNGB 5CJOH 3UTTA 4WKZA 2NW2A 1AG6A 1ZE3C 3VH8B 2PTTB 3RGVB 3LEYH 4YC2C 5GSVB 2I85A 1LEKB 5DD6A 1AC0A 1AYRA 3D18B 4OF6A 4AT6B 2WUBL 3LKRB 4ETYA 5ICYA 3OX8B 2CRMA 5HHXH 2CGRH 3BP4B 2JKNA 1JHKH 2IDSA 4PRDA 3X3FH 2WWKT 2D73A 4OGYL 2X6MA 1CD1A 2YC1B 1BXVA 3FB7B 4R7DA 1NZRA 3FCTA 2VAJA 4ZNCD 4MYWB 3B1UA 4PS8A 4A2EA 2WBXA 1VLXA 1YNLL 3CH1B 2CK0H 4E9VA 4NCC1 5I71C 3EYQC 1HKFA 3WKMH 3Q8FA 1Z5HA 2DM2A 4QGTA 2V17H 5LKNA 5FO9B 1D5BB 3N0AA 2VIRB 2CHDA 3S36L 3QORD 1JTOA 1X4XA 2NY0C 5DJAB 2EDMA 2NR6C 5ERWB 2WY3B 1SPDA 1DQMH 4L37A 4U6VL 5DZ9A 3O4OC 2WB1A 5BV7H 1UVQB 1AFVH 1NEPA 3N42B 2CLVB 2X4SB 1I7UB 1JVOA 2MOQA 4HZLA 4P4KC 1BBDH 5EO1A 1BOYA 3CFJA 4I9WE 4FQQA 2WZ5A 1DBAH 1WWAX 4LDOB 4KROD 3UTOA 1CC3A 2VKWA 3OGOE 1YYLL 3RWDA 3VXMB 1S7VA 2XN9E 4Z77B 4D7BA 4P3CH 5DF0A 1NCBH 3QFDA 4WV1B 3I02B 3BXNA 1M56B 3HJEA 4UTBA 3PYCA 1J1PH 3U7AA 1IFHL 1GGCH 2DD8L 4H40A 2K70A 4KJYA 2BVOB 3A6CL 1J18A 3PL6B 1JGEB 1OM3H 4F58L 2G2RB 2OX5A 1FL6A 2AF2A 1MW2A 1S9WB 3TCLA 1WAAA 5FWRA 3M8OL 3B9VA 4CU8A 1HEJC 5CGMA 3ESMA 4U3XA 3G9VA 1JGDA 1UWGH 2WXJA 4MHHI 5M94B 4OZHE 4GLRH 4J6RL 4PIBA 4PR5A 2SEBA 4OFQA 2JB6B 3RZCC 1OB1A 4DN3H 2OR7A 2AJZA 2DQTL 3IDIB 1VKXB 4L3AA 1G87A 1JRHL 5CP7A 1N0LB 3PU7A 2X4OA 2BOCA 3MRFA 1GAFH 4JDZA 4M9OA 4Y2DA 1AS7A 5LO7A 3UTPD 3EO9L 3BKYL 4G8IB 1NEZG 3NT0A 3GLAA 1E6JH 1TQTA 2NCEA 3GRGA 2H2SC 4HULB 4EPSA 3Q5YA 3HNSH 4UAOC 2EYRA 3L7EB 5E8EB 2OMZA 3KXFA 1A7RH 3MJ6A 1T22B 3KYNB 3K5RA 1IC0A 4MAYB 4XAKE 4Y7MA 3FHAA 4RRPM 4PJAA 4WGKA 3P2DA 1VZIA 1QKZH 5DK3A 4N28A 1ET5A 4XNQA 4PJEB 1VFUA 2CLZA 2FUQA 2ZKHH 5DZNA 1WAAF 3THMH 4L48A 5I0DA 3VD4A 4FNSA 4BFKA 1Y6KR 5BUAA 3BCFA 4PRIA 1KFGA 5I0WA 4G2AA 2CIKA 3GMQA 3RWFA 3K4DA 4M7ZC 3JWOL 3V0JA 3KAAA 4MD4B 1H3TA 4RSYA 3SDCD 2XN9B 2KL6A 4Z7OF 3DYOA 3PFUA 3FU7B 3MRPA 5H4YA 1C7TA 1EAJA 1S7SB 3FT3A 2P24A 3D4YA 4K9EH 1H6FA 5D2NE 3FFCD 4KGLA 4WU5B 5ITBL 4Y1AA 2ENYA 4TF4A 5I24A 4XZ4A 3B9AA 3NP4A 3ZT5A 2X44D 1HL5A 2IGLA 3OKLA 2KKQA 3G7TA 3LZOA 3VRIB 1ILSA 3SKOA 1N18A 3OPZH 5DTFB 1YJDL 2B16A 2D9QB 3ALWA 4L8SB 5I73B 3FQWA 3FPYA 3PRZA 3ZTNH 2AK4D 5E99H 1K4DA 1RUKH 5EU6E 3DWTA 4FXTA 2VLJA 2H3XC 2Y07L 5L7XH 3CFBA 4YSRA 2VZVA 3KWXA 1R5VA 1OAUL 4JFDE 1MCIA 3VXOA 1D7CA 3VWJD 1V5JA 3ZHFA 4KHXH 3GUTB 1EXHA 2R4RH 4KI5F 1LEGA 1ZHLB 4KK8D 1QVOB 4EIBA 1IC5L 4RVBA 3OHXA 1LNUB 4HK3N 1G1KA 4HJ0C 3BAEH 1ULVA 3QEHB 1J0IA 3U4BL 4QTIH 5IIEA 2DQEH 2OL3A 4WLCA 5HI4C 4PCTA 5GHWL 1FLRH 3ESOA 3AQZA 4OI9A 4AV0A 4P2OA 3EG9A 5BV7C 2Y5TA 4WW2C 1KN4L 2XXFA 4CVUA 4IBVA 2UY6A 1AE6L 4L0PB 3MLTB 1XMWA 4PRAB 2MWCA 4AYFB 3QDME 1RURL 1UZ8B 3BH8A 3MJ9L 1VEOA 2N1TE 1LK3L 3HC2A 3VM5A 3DIFA 3S4SG 3TCTA 4XR8C 5IR1B 3RTQC 3OSVA 1A65A 4YR6A 1CICD 2PCYA 3OG6B 3AG4B 3OHMB 3TWCH 2VDPL 1K6QH 5J12B 3DUHA 4XMXA 3QZLA 1E3XA 4PQXA 2OK0L 2O72A 3P9MB 4NP4H 3H9ZA 3POCA 3RUGB 2OMNA 4OF0A 3UMNA 1MLBA 4AMXA 1IL1B 3O0LA 3ALXA 2HTKD 4K8RH 4M7LL 3L5XL 4YDMA 2D2OA 3M17A 2BOBB 3NQKA 3PY9A 5D2NB 5F7LB 5FLUA 5M95B 5FYKE 5F1NA 1PKQA 1AGBB 2Z4QB 2BSRA 5A40E 4DKAA 5JTWA 3D48R 2E8ZA 5J1SC 3UEZA 1IIIA 1L9NA 3TVMA 1HI6A 1YY9C 3FCSA 5EU6B 4N0YL 1ZHBB 1NCAH 4RRPG 4WHYG 1KV3A 1R34A 1U30A 1WBYB 3I6GA 3SOBH 3HNTH 1T6WA 3FOMA 2OI9B 3FAXA 1I1AC 5TTRA 3VU1A 6FABH 4EZLA 3HN8A 1A6AA 4LP8A 4JDVA 5GZNC 1EBAA 3QE5A 2EKJA 4G42B 3EJUA 3GPEA 2HWZL 4GSRA 1FAKT 2XTJD 3MNVB 1A4JB 4FFVD 4R4NC 2XFXB 3RVVD 2R56L 2PCFB 4JL2A 3DVGB 2WTRB 2O30A 3EJQA 3RVXD 3WEBA 4D9LH 3TO2B 3NZSA 3WN6A 5JIPA 4J5VA 2FYYB 4WWID 3W1ZA 5KVDL 2DM7A 5D93C 4F7MA 3DX9B 5F7MC 2K4AA 4L1LA 4NZDA 2P5EE 2R4SH 1I3RA 3S35H 1PZ5B 2DQCH 4XN4A 5CZXC 5FDWA 1DVFD 5A2LH 2MNJB 3AXIA 4IM8A 2JIXA 1RIHH 3UO8B 2ICEA 5C6WH 4JRWA 3TZVA 3L3KB 4OLWL 5HVWA 1CYGA 2G60H 2X4PB 1Q8MA 2DYSB 4HAKA 3KR3L 4F1SA 4BINA 1VACA 4WZ9A 3ATAA 3WLBB 1MLCB 4I5BA 4GW5B 4AV4A 2K4WA 3K4AA 5B3SB 3T04D 3C6LA 1UASA 3JTSB 4UWQB 1ZK5A 2X6BA 5F6HJ 1MJ8H 3ARED 3ULAB 2EIZB 1T2XA 3ISRA 4GG6A 3DA0A 4G6JH 2MCAA 3RWEB 2OA9A 2VN6A 3G3LA 4YXKH 5EUOA 4X8GA 4OM1H 5FK9B 2TSBA 1M7IB 2VMEA 4ICWA 1P4LB 3OMAB 4GW1A 4FXGC 3GSNB 2DF3A 2PYFA 2WLZA 1BXAA 4W4OA 4WSKA 4LRNH 1KJVB 2FJUB 2GIYA 4HGKC 2YSSB 3F64A 1MQKL 1N6UA 2F5BH 3MNZA 3P9LA 4LZKA 4UTAA 3ULSA 2FEEI 2VN4A 2XKNA 2F8XC 3L7FA 5H37A 1Q9LA 4RFEA 3LXCA 5GZOD 5TK2A 3QCVL 1JAEA 4WU7B 3QJZA 1JI2A 4KRPC 1RHHB 1J8HA 2VM4A 2YK1L 3DUSA 2BRRH 4HMDA 1MRFH 1FFRA 5FM5O 4MJIE 2Z8WC 1WUZA 4QOKD 1MRDL 4PV9B 5FA3A 1I85C 4G1EA 1BM3H 1I3UA 5D1QE 1FBIL 1N6VA 4X6DF 4H25A 5D7LB 4GG6F 3M45A 2P5EB 3HCVB 3OB0H 1IM9D 12E8H 3K6NA 5EHFA 5ABAA 3O8XD 3ZTJH 1YLBB 1TZHA 2NY7L 3WDHA 3GPSA 4L1BA 3MOAL 4NNPH 3LDBB 2ICCA 4GSDL 4ZOAA 1AZBA 4E41B 3L2LA 2BLFA 2OZNA 1XTLA 3R0NA 1P6AB 4LBEA 5DA0B 2OCFD 5T8IA 2YMTA 1OSPL 5KYWA 2WO4A 4XC3L 4HU2A