2NNUA

Crystal structure of the papillomavirus dna tethering complex e2:brd4
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
201
structure length
201
Chain Sequence
b'SMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDICNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein E2
molecule tags Transcription
source organism Human papillomavirus type 16
publication title Structure of the Papillomavirus DNA-Tethering Complex E2:Brd4 and a Peptide that Ablates HPV Chromosomal Association.
pubmed doi rcsb
total genus 66
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2nnuA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 2nnuA02
2NNUA 2JEXA 1DTOA 1R6KA 1TUEB 1R6NA 1QQHA 2JEUA
chains in the Genus database with same CATH superfamily
3JAWA 1THZA 1SERA 3HKEA 3LSQA 4HBNA 3K57A 4J42A 1N33O 4JI6B 4RUEA 3B2EE 5KHJA 2EIKB 3L71H 4ZI7A 2YICA 3DC6A 5GONB 4MVOA 1H2KA 2QKSA 3CB2A 5JJEB 1FXKB 2EIKC 4X65B 1PM9A 3U0ZA 4XDKA 3UKMA 2DE0X 2IJIA 3ZIAG 2OTLV 4X1KB 1SA0A 2YIBD 1RM1B 3K0DA 4UCOA 1YZBA 2F4VO 3OAAG 1B06A 1XNRO 3D3IA 2L6LA 5CA1B 1CEZA 3A0BZ 3J80N 1JJOA 1XQ8A 1KKCA 1DLBA 5H2FZ 1YCIA 4EEQA 4X66B 1KBHA 2ZE7A 3CHXA 3JARB 1K34A 3RYIA 4UVCA 2AZ2A 2EIMB 2WA3A 4RWUA 1MZFA 2ODMA 3F5TA 4UCRA 3UQ8A 2B1IA 4JI7O 2Z0AA 3AG4B 4UCTA 2E3CA 3OR7C 3ML0A 2CTWA 2Y69B 2OIEA 3DC5A 2QM4A 4FZ0A 4Q6GA 3SPGA 1R6TA 1IBMO 1K3EA 2ZM6B 4FFBA 2H94A 3ZRXA 1VQ5V 3OD4A 4LFCB 3TCUA 3SYCA 1SETA 5KAFZ 3RYCB 1QLEC 2HEPA 3CRRA 5B1OA 3CYOA 4TUYA 1GH6A 4CZZA 2QKAA 1VQ4V 1NVPB 4FPPA 2E75B 1UFIA 2QGNA 2VWKA 3SYQA 1YITV 4NVPA 2UXCO 1R3JC 2N05A 3R65A 5L3BA 1GRJA 1VMGA 3CC7V 4U3JA 1FFTB 3C3TA 5DM6V 4DR1B 4FLWA 3JASA 4J10A 3ZX6A 4UCSA 2Q67A 2Q0OC 2YI8A 1AI7A 2X6BA 1RPRA 1LR1A 2YC0A 2Z3YA 3SJBC 4JI8B 5BY1A 3F5WC 3WG7B 2PI5A 2ZKOA 4DR4B 3SPHA 1EBOA 4DR7B 2BOBC 2YSUB 4UVAA 4DR3O 3PJSK 1W0KG 3SGIA 1W0JG 2RJZA 5LHIA 2ETNA 2P6JA 3G6EV 3N27A 3B09A 3CCRV 2YUAA 2KSDA 4JI6O 2VQEB 3EFFK 2BCCH 5J2UB 1JFFB 2VRZA 4DV3O 4FIPC 3LSSA 1E79G 3VQXA 3QG5A 1EN5A 2UXBO 3SJQC 5A2QN 1XHZA 3FB6C 3SJCC 1JX9A 2ARHA 4DR2O 3CCQV 4YY3B 4B7KA 1NR1A 1M57B 1V54B 3ETEA 4B3MB 1DF4A 4LF6B 3UT5A 2GDSA 4CH5A 2Q7HA 4X20B 4MTOA 3AK1A 1V9PA 5B5EZ 2P5OA 1Q6IA 1LNQA 2Q5ZA 3B8NA 2MK3A 4WFFA 1WNSA 2IU3A 3B8MA 3GVMA 4GYCB 4FK5C 2QTSA 3A2FA 4FJCC 4PA7A 2DYRB 2ZINA 5CA0B 5IJ0B 1Q6HA 3HKCB 1D2DA 4AILC 1Q90D 3HKEB 1O9HA 2ZDIA 3K9AA 3DTUB 3QNEA 1IBKO 1KB9F 1P7GA 5EZYA 3AG3B 1NJIW 2P7TC 2UXXA 1JVMA 1AVMA 4XBFA 3L73H 2QWNB 2WLMA 2XHBA 2F95B 1PNKA 3L74H 5B1AC 4LF5O 3KCYA 4HZ3A 5EYPB 2IH3C 4UFZA 1BCCH 4X1KA 1S77D 1HDJA 2JS3A 2XTAA 4JI2B 1BMFG 5KHHA 1ZSPA 2EINB 3APOA 5IYZA 4O4HB 3K08A 2JGUA 1YTFD 3CCLV 2PYJA 2LQTA 2JVDA 3IGAC 1F23A 1GKFA 3W7WA 4DR6O 2O57A 3D36A 1MSDA 1HR0B 3G80A 1K97A 4JV5O 3G6BA 5JCOA 1KP3A 3OMAB 3WB0A 1FJGB 4YJ2A 1N0JA 1J5EO 3IAYA 4J7KA 2X0LA 4JI3B 3ABKC 1NKDA 3EVKA 1K9MW 4KHPB 3ABLC 5TISZ 2K9PA 2UXBB 2P22C 1S5HC 3ZRWA 2YI9A 3ZMTA 3ABLB 3JAWB 1YDXA 1BHAA 4H44B 1YI2V 1VQ9V 4PA4A 2XAJA 4DR6B 1IDSA 3CXHF 1DTOA 4LNUB 3RYCA 1HNZO 4AHCA 1VF6C 3K03A 1M5IA 3T1HB 2JJ2G 5B1BC 2B1GA 3FAVA 1N36O 1JMKC 2JRIA 5IYBO 4UUJC 3OGCC 2BTOA 5B3SC 4ICGA 4JYYA 3E89A 4O2BB 1WN7A 2YEVB 1BHBA 1XUQA 4CC5A 4FM1A 2FTKA 5FPRA 3ZS8C 5D5QA 1ZX3A 2LP7A 2PI4A 4LH6A 3JALB 4PV1B 1IBMB 2AHZA 2DYSC 4W4LA 3OR6C 4JPRA 5HFLA 1EZVH 2QJ1A 4L87A 3DXRA 4Z1VA 4MVRA 3FFQA 1U97A 2Y4UA 1Y76A 3E22B 3IFXA 5H5NA 1AI6A 5JQGB 1HNZB 1EN4A 4KL1A 1I5XA 4I5SA 2GTSA 1ZLZA 4IYIA 1HR0O 1H2LA 1V55C 3LNMB 3L70H 4OX9B 4LFBB 1YXBA 1X59A 3QO7A 3HB3B 1SQXH 4O2AB 3VQVA 3QTCA 3QO5A 4RUFA 2BSKB 2Q9LA 2AZ0A 4BIZA 3K3WA 1SQGA 4FM0A 4JI2O 2ITDC 2QWOB 3SJAC 1Z2GA 5LYJA 4H33A 5B1NA 3OMIB 3KZIZ 1QQCA 2RDCA 4ASUG 2EIJC 2CH7A 2LFRA 1NQTA 3HKDA 1BGYH 3E35A 5EIBD 2R70A 1B6QA 3CMAV 4P30A 2GHYA 4X64O 3O65A 5IWAO 2ZD9A 1Y74A 2V1DA 3H1LH 4ZBMA 3HKCA 3M7MX 4P9OA 4DRXA 2RQ6A 1E1RG 5IY5C 1SC5B 3TXQA 2IJJA 1YEWA 1PL0A 3G71V 3Q4HB 5C8YA 4ABMA 1Q3EA 5KHGA 1H38A 1SESA 1GAXA 1SQQH 1XOUA 5LMNB 3JD3A 1URFA 3BHPA 4WFGA 1K4CC 4B08A 1JFFA 3B77A 4I9QA 4BAYA 4I4TA 5EYPA 4DXWA 2R9AA 3SPJA 2IM9A 3ABUA 4FLZA 1K5QA 5LL6Y 3RGBA 3CXCU 3S3WA 5IJ9A 3K79A 2W0FC 3K5OA 2HG5C 4JAUA 4YJ3B 1OCRC 1Q82W 1YHQV 1XNQO 4NXNB 4FLVA 1G4YB 1AP6A 3B4SA 2KKWA 2RNBA 1P84F 2AXTZ 3FB8C 3LDDA 3EXAA 4NTWA 3L9DA 4R7CA 1GM8A 4MTFA 1ZWIC 4G2KA 4DK1A 4MW8A 2Y4TA 1WA8B 1QLNA 2GTAA 2W6JG 4UB8Z 1I7FA 4WF9V 5FLXN 3RVYA 2Q8VA 4MT8A 4UCUA 4JI8O 4J9YB 4MSWC 1M90W 5GTIZ 1RPOA 4RAIA 3OT7A 3CMEV 2WLIB 3T1YB 1NT2B 1QR8A 1MG1A 1S5LZ 3K5LA 3R66A 2LGQA 2YS8A 4JAAA 3MAQA 1MA1A 2F4VB 3JD0A 4BW5A 5EK0A 4JI5O 4DW1A 4E2LA 3E8FA 4DV4B 4O2BA 4GT1A 3H1IH 3SYAA 1QCEA 3CC2V 3OGIB 2Y69C 1L1FA 5BZBA 3SYOA 4X89A 1FXKA 1PV0A 1GM9A 1H2SB 4DV1B 4UVBA 3WG7C 3CCJV 3CCMV 3NXSA 4NXMB 3CX5F 4GUNA 3U10A 4LP8A 1Q8IA 2AW9A 2UU9B 3BABA 3APQA 2UUAO 1XMQB 3ZRVA 5CA1A 5GTHZ 5L3DA 4NB5A 4K8XA 3ASOC 4JV5B 4X1IB 2N74A 4YHHB 4X62B 1NH2B 4DO2A 2CTPA 5LP6A 2EX3A 2FKXA 2Y48A 3QF7A 4J41A 3KKYA 1KKDA 2A0LA 1DK1A 4CS2A 2HHHO 3JAKA 2ZM6O 1IVSA 1F4MA 3E8GA 3VQWA 1FFXA 2ZE5A 1FS0G 3G67A 1XNRB 1S0VA 4GX1A 1Y66A 3OTOO 4DV7B 3BEHA 2UUCO 2XASA 1RFYA 4R6ZA 2ZR3A 1XEQA 2F1MA 4KXRA 3F7YC 4R50A 3T4DA 5E79Z 2Q73A 1JOYA 3AG1B 1VQPV 2YIDA 5GONA 4AQYO 3GWKC 4PJ0Z 1ROPA 4AQYB 3SR2C 1Q86W 2KB1A 3AG1C 5EBWC 1Y74B 1YJWV 2PGGA 4IHJB 4PA6A 4PDLA 4CH6A 4IGGA 4DRXB 1QVFU 1COWG 4LFAO 2QKCA 3DXRB 4JI3O 2UUCB 2CDYA 1X4TA 2R9RB 3K59A 2VWJA 4DV6O 2EZPA 5CN0A 2X7RB 2XOKG 3OE7G 3E22A 3CS5A 5EC1C 3UCSC 1KC8W 3VQYA 4FLYA 3HPLC 3IC9A 1N8RW 1GN2A 2IJKA 4MTGA 3ZHQA 1IURA 1R73A 4JGSA 3IJ4A 1KD1W 2WPDG 3RW0A 3OMNB 1DGSA 4EB6A 1IBKB 5GW7A 5LBQA 4J7ZA 2ZR2A 2V4DA 3RYHA 2ZCEA 5CB4A 1FPOA 4I50A 4YJ3A 1PNMA 1MNGA 2GUZB 5L3CA 1WP8A 4LF7O 4K0KO 1GN4A 4GKJB 1OCOC 3FYIB 4DR5B 2UUBO 1YF2A 3CJHB 2HJFC 2QE7G 2D3OW 1M1KW 2CH7B 5LMNO 4RQFA 1M56C 2FMLA 1TAEA 3CCSV 3SYPA 3LNNA 4U7OA 1XL4A 3ZBHA 4QIWF 1FD9A 4DUYO 3CRCA 5JJJB 4UV8A 5LGNA 2EZOA 1NTZH 1JPXA 5L3GA 3WB2A 4JZ2A 1VP7A 4GX5A 1F7YA 4DYLA 3JASB 5K1XA 2XNDG 5C8YB 3M8AA 1MSWD 3H01A 3VOUA 3LDCA 1VF7A 1H8HG 1K92A 1R1BA 2QWQB 2EILB 4I4TB 3BVOA 5BMVB 2E5LO 4X88A 3N2KA 2Q69A 3BAAA 2W6IG 3OUFA 3OUSA 1IZ3A 4DV4O 4JI4O 5KUMA 4O4JB 4F6EA 4JF3A 3ZN0A 3OW2U 3DGEA 2JIZG 2Y0PA 4TQDA 3ZHRA 2QR4A 4I9WA 4LR3A 1Q7YW 1JA8A 3WB1A 1E1QG 1EN6A 3BY6A 1AJNA 3MDSA 2C2AA 2A06H 4TOIA 5E1AC 1FXKC 3UO3A 1AJQA 2HHHB 4FLXA 1OCZB 3H1HH 1Q5OA 4DR3B 3CSXA 1WJZA 3CPWU 5EBMC 4JYAB 2OCHA 1TUBA 4E4EA 1KP2A 1WA8A 3IC7A 4WFBV 4DUZB 4GCZA 3E8HA 1SZXA 1N0NA 5LA6B 3T4ZA 3K5MA 3ZMUA 5LP6B 1JR9A 2WA4A 1I0HA 5J2TA 2YXYA 1QU7A 2XAQA 3HKBA 1N33B 4J7JA 5FNVA 2FB5A 3JAKB 5CBHA 1VARA 3N2GB 3W7XA 1BL8A 4BR6A 4F6RA 1NI8A 1YSCA 4UCVA 5CA0A 3AG4C 4LF8O 4G28B 3ABMB 4DV2O 2DYSB 2V7QG 1R3LC 1AR1B 2WLLB 4D7TA 4JTDB 2ZNIA 4LNUA 5KX5B 4JI1B 3SDLA 3P3NA 1HNWB 1QHTA 1WB7A 4TWKA 3A0RA 4MS2A 1F4NA 4TV8A 4PDRA 4J80A 1Z5WA 3AK3A 2OT5A 2PTMA 1UJWB 3RT3C 3T1YO 1AR4A 3FD9A 2NNUA 1K33A 1CP9A 2IH1C 1NS1A 2CK3G 2JJ1G 4F4LA 3ZHSA 3RYFA 4BIUA 2B5UA 1J5EB 1OJHA 1SQVH 2A9HA 5KLVH 3CWBH 4DV3B 1ZUQA 5IYCO 4EFEA 3I55V 1K7DA 3E8BA 4FVMA 1VQ8V 3THOA 1BSMA 3RWRD 1G6UA 3BA9A 3ZRWB 5CB4B 4DR4O 1VQ6V 3D36C 1R3IC 3JATB 3PN1A 2JEUA 5JCOC 2N04A 3E86A 1HW7A 4I55A 1R6KA 1WB8A 4LF5B 4TV9B 1I94O 2B9ZA 4CH4A 3H1KH 3KG2A 1LUWA 3JCZA 5EIBC 1I5YA 1XHXA 4GX0A 4H37A 4IYHA 4UV9A 1K5SA 5LHGA 3I56V 2YEVA 1BS3A 4JI0O 2IJHA 3JD4A 4L8JA 5CMUA 3MHSC 1ZAUA 5L3FA 1BZKA 5CA3A 1P49A 4BWAA 3JSLA 2ITCC 4K8ZA 2DW4A 2EIMC 2WAMA 3D8CA 5DEDA 4LF9O 4X62O 4WCEV 3K04A 3FKSG 1PNLA 2CE4A 4OXSA 3CEIA 3QVNA 1Y76B 3ETDA 3Q4HA 3W7TA 4LH7A 3WU2Z 4I50B 2QM8A 4B3SB 4LFAB 1HP8A 1K73W 5H6RA 1WPXA 4KFMA 4ZHQA 1SRYA 4JI4B 4UXNA 4B3RB 1PL4A 2FL4A 4EFBA 1FJGO 4MVMA 1VQ7V 4EKWA 3P30A 3ZMSA 3RVZA 4KP4A 2UXDB 1YTFB 4LWSA 3CRAA 3ETGA 1TVKB 3RN4A 5JVDA 2ZE6A 3ZHVA 2A3QA 4MVZA 4CC6A 2P90A 2QM7A 2EINC 4YXWG 2DOSA 5LA6A 1D5NA 2UXCB 5EBLC 4B3SO 4B3TB 4G27B 4JASA 3VBBA 1XL6A 1QNMA 2HLDG 3HKDB 5ITZB 5BR8B 4X1YB 4HNAB 3AK2A 4NTYA 4C7UA 3L72H 4OGQB 4F6RB 2CAZC 1XI1A 4DV1O 2UUBB 5BMVA 2ATKC 1ORQC 1QVGU 4TSFG 2WLLA 2ADPA 5A9GA 2DQ0A 2WLIA 4N21A 1GO3F 2F66C 1JCHA 3T1CA 1HWYA 3BPZA 2P4KA 4ZI7B 3K0GA 5HFMA 3BRCA 4JZGA 4JI5B 2HP8A 1M9NA 2JGDB 4HYOA 4YIOA 2JK5C 3TGUH 4DR5O 3NR7A 4JTAB 3I5DA 4OPHA 4PA3A 1OZ0A 1U96A 5C93A 1AI5A 1AI4A 5IJ9B 1A32A 4LF4O 2OYQA 2VQFO 1AILA 3RYFB 5LXTB 3ETQA 2EJRA 1LUVA 4CS4A 3ASNB 4DV5O 4GZRB 2AGAA 3ASNC 5J2TB 3HKBB 1K8AW 2QSAA 3CE2A 5FNVB 1N4CA 2LW7A 4DUYB 2FYUH 4WFAV 2OCCB 3N2GA 1UPGA 1VEWA 1N34O 2WLKA 3T2MA 4CH3A 5IT9N 2Q7EA 2DWEC 2HFEC 4PDVA 5FL7G 5LGTA 4P9PA 1BE3H 5LOVA 2R72A 1BQ0A 2WLJA 2BTQB 1H2GA 1IX9A 3F7VC 4U7NA 2ZIMA 1P7BA 3O9OA 4GKKO 4DV7O 4JYCA 1TA8A 1WPBA 4JI0B 2EULA 1SQPH 3CRMA 5B1AB 4DV2B 5D5PA 1OV9A 4IIJA 4CS3A 4TV8B 5LHHA 2UXNA 2HVJC 4QGPA 4O4IA 3JD1A 4PDMA 4TT3G 1G8MA 1SA0B 1B3QA 4IT5A 3EHBB 4NXNO 1OCCB 4R8CA 3AG2C 4NYKA 4U3JB 1S72V 2E74B 3AG2B 4QPJA 1VQMV 3SPCA 1FXHA 2Q6AA 1SQFA 4LFBO 1N32O 1PKXA 3JCUZ 3CRQA 4IHJA 5IWAB 3ABKB 2XAHA 1WLEA 1YIJV 3UO2A 4MW3A 5KA6A 5H6QA 2M6YA 3DSQA 4K0KB 2QTOA 1AB3A 4PELA 2VS0A 4X1IA 2H3OA 4RO2A 1M56B 4LC1A 4IL6Z 1PPJH 4Q20A 5KHKA 3JATA 4JTCB 4FFBB 2ADQB 4GKKB 3QO8A 4GX2A 4DV5B 3P3PA 1ZL8B 5F2VO 4TV9A 4OPAA 4Z1MG 4EB6B 2H8PC 2IBZH 3BCCH 2IU0A 2HR3A 1FKAO 5B3SB 2CGNA 1FFXB 3LUTB 2RCVA 1L0NH 1FAFA 4I0XA 1VF5B 1NTKH 2ZQMA 2CGOA 2ZE8A 1NBMG 2EJ7A 4FFKA 4X20A 2GUZA 3TETA 2GSMB 1KU9A 1OCRB 3FX7A 5KHIA 1XMOO 3W7SA 4WBNA 4P2ZA 2AHYA 2BE3A 4AI8A 3CJHA 4B7EA 5CBFA 5IDJA 4O4LB 1KYOF 4HNAA 3CC4V 1S76D 4FLUA 3H9VA 3W7UA 2Y0IA 2UXDO 5IJ0A 2HKOA 2NN4A 5JH7B 4LFCO 4I7ZB 4QJFB 1HNWO 3STLC 1KECA 4FMTA 1QLEB 1QQHA 4DR7O 4NTXA 1MZEA 2Q0AA 5EZYB 2X6AA 1OCZC 3U11A 1RM1C 1SKVA 1HNXB 5KUKA 3J81N 2DJVA 4ZKIA 2A79B 3JYCA 3KCXA 1FXVA 2WLNA 2KG7B 1DF5A 3BFRA 1XILA 5IE9A 5J2UA 1QR9A 5J9PC 2YXLA 3C90A 2WWWA 2LJ2A 3CCVV 4WFEA 5LP6C 1VQKV 2ZNJA 4ZIBA 3AG7A 5IYZB 4O4JA 4X66O 1H8EG 1TVKA 4PHZA 1W59A 3JAMN 3L75H 3RYHB 5B66Z 4J9ZB 4PI0A 4XDJA 3SPIA 4QE7A 4YIPA 4D7SA 2D2CB 1Z5VA 5KA5A 3CCUV 5EC2C 4DV0B 1RSOB 1MOFA 1EFRG 2HVKC 3C3SA 4JI7B 2EIJB 2EBOA 4UB6Z 2M7WA 3OM3B 1R3KC 3CP1A 1CXZB 4YJ2B 1H2MA 4LBEC 4JYAO 1Y67A 4NXMO 1JJ2U 3D3QA 1SS3A 4QNHB 3GWOA 4K3AA 3ZEDA 1YVWA 3JD2A 2ZDIC 5IY5B 2JS5A 3ASOB 1N34B 5LOVB 1K4DC 3K5NA 1Q81W 3ZMVA 3JSNA 2DMXA 3H1JH 1JQ0A 1NZ6A 4FM2A 4ZOLB 2PZSA 1NU1H 2G38A 3ZRSA 3FAVB 4U3FH 5IYDO 1VF6A 2E5LB 1NTMH 1F51A 3A0HZ 2R9IA 4J11A 2WLHA 2ILMA 2VQEO 2OTJV 3N2KB 2DWDC 1R6NA 2L35A 4BIOA 2OIGA 1US6A 5KMGB 4H13B 4YY3O 4CBCA 5KAIZ 5LXTA 3ZMZA 2XAFA 3AEIA 1T5EA 1EM1A 3JALA 4W4KA 3ZHTA 3CD6V 4PD4F 1AP5A 4DK0A 2XAGA 4DV0O 1H2NA 4MVQA 3CCEV 4TQFA 1MABG 1SQBH 2F43G 3OFNG 3BA8A 2UU9O 3FB7C 1P4RA 1TUBB 2QWPB 2BOCC 4X64B 1YJNV 1TUEB 2QWRB 2K1EA 1M57C 1V54C 4LF7B 5JQGA 1I94B 4MVSA 3LSUA 2ZIOA 2BTQA 4Z2WA 1W2BU 4BW9A 4B3MO 1ZL8A 1YJ9V 4JYBA 4QPKA 2JDIG 2UUAB 4B3TO 1EZJA 1L8DA 1G1XB 1SF9A 4IIJB 5BXZA 2DN9A 2OWOA 1GK9A 1AJPA 1BT8A 4D6TH 4I0XB 3E2EA 2GBOA 4O4IB 1GN6A 3K9SA 2DYRC 1L0LH 4MVUA 4I55B 3LDEA 5LYJB 2P67A 4JAVA 4DV6B 5KX5A 1GN3A 1OCOB 3AG3C 2ZT9B 4NKGB 4TUYB 3OEHG 4DUZO 2XUMA 1S3JA 1S5JA 1XMOB 3RBZA 2F23A 3OTOB 3T1HO 1KQSU 1ENVA 1PP9H 2CTQA 3B40A 2GV9A 1CPYA 2KQXA 3STZC 5JH7A 2PUSA 2RMKB 4XDLA 5CBGA 1GTOA 2YDEA 1VQOV 3UM7A 2QA4V 1Q43A 1GMGA 3MHHC 4H0LB 2PF4E 4KHPO 2KG7A 3JARA 3RYIB 2QEXV 3GB7C 1RP3B 4LF4B 4X8AA 1SZTA 3ABTA 4O2AA 2ZXWB 3TJTA 1XMQO 2NR5A 2F93B 1B04A 2BSKA 2IW5A 2ZXWC 1N36B 5FPOA 2WSSG 1M93A 1VQNV 1Q6UA 4DR1O 1M4UA 5JJNB 4PI2A 3ZJZA 1J95A 4FZ1A 3ZN1A 1XNQB 2Z5UA 2X6CA 3X2QB 1RSOA 2JEXA 1AR5A 4X65O 3G4SV 5LMUO 1QBZA 2YXHA 4WBNB 3X2QC 3TK1A 2PYLA 2QDOA 4LWSB 4O4LA 1GM7A 1O9GA 1D5AA 3E83A 5L3EA 1HNXO 4LF9B 3RFRA 4RQEA 1XBLA 2NLJC 4LCUC 4KUMA 3J7AU 3UT5B 5B1BB 2RN9A 3FB5C 3HR0A 5JWPA 5K1PA 3M99B 4PA9A 2P4VA 2MW2B 1KUQA 3ZCCA 3K58A 1PD3A 3FYEB 3ICXA 1IXMA 5BR8O 3K06A 1N32B 1VQLV 5LGUA 1WP7A 2Q68A 4X1YA 1IBLB 2YIAA 1ZTEA 1Y4MA 3S3XA 1NVPD 1NR7A 1XREA 4NR1A 2Q7GA 1OCCC 2Q4PA 1I08A 2LFSA 3ABMC 3MD0A 3TXSA 1AROP 5KMGA 3OTFA 2OCCC 2XT9A 2DQ3A 1Y6XA 1MMMA 1XDCA 2CTRA 4A5UB 1NH2D 4B3RO 4ZHQB 4DR2B 2A7WA 2JGDA 2LW1A 5AG2A 2P06A 1TGOA 4MTXA 3ZHUA 1V55B 2VQFB 2YIBA 5H9CA 3WFVA 4O4HA 4GLXA 5JVDB 2LGWA 5DECA 4OX9O 2E76B 1FYJA 3P32A 3OEEG 1WAZA 2CUGA 2W0XA 4QE9A 4N23A 1OHHG 4GKJO 1VIBA 2PY5A 4JI1O 4X9QA 2LO1A 4YHHO 4K35A 1IXBA 1IBLO 3A8TA 5ITZA 4HAMA 4ZOLA 5DN6G 4FLTA 4LF6O 2EILC 2HJDA 4DW0A 5LMUB 4LF8B 1KMIZ 1BQZA 4WFHA
chains in the Genus database with same CATH topology
4G28B 4ASUG 3ABMB 2EIJC 1THZA 1SERA 5IDJA 5CBFA 2LFRA 1NQTA 3E35A 2DYSB 3CC4V 3LSQA 2V7QG 1B6QA 1S76D 3CMAV 1R3LC 3OMIB 1AR1B 4P30A 2WLLB 2GHYA 4JTDB 3W7UA 2ZD9A 2V1DA 2HKOA 4ZBMA 4P9OA 4RUEA 2EIKB 1E1RG 4MVOA 5IY5C 4QJFB 3STLC 1KECA 4TWKA 2QKSA 3A0RA 1QLEB 1FXKB 2IJJA 4FMTA 1F4NA 2EIKC 4MS2A 1PL0A 1QQHA 4PDRA 2X6AA 1OCZC 1RM1C 3G71V 4XDKA 3UKMA 2IJIA 3ZIAG 2OT5A 2OTLV 1H38A 1SESA 1UJWB 5KUKA 1RM1B 3K0DA 3JD3A 4ZKIA 2A79B 1CP9A 1K33A 2IH1C 1FXVA 2NNUA 1K4CC 2WLNA 3JYCA 3OAAG 3D3IA 4WFGA 1DF5A 1CEZA 2CK3G 2JJ1G 1QR9A 4F4LA 3B77A 5J9PC 2WWWA 4BIUA 4BAYA 4DXWA 3CCVV 2B5UA 4WFEA 1DLBA 1VQKV 3SPJA 3ABUA 2A9HA 1K5QA 1H8EG 1K34A 3CXCU 4UVCA 3K79A 5IYCO 2W0FC 2HG5C 4JAUA 4J9ZB 1OCRC 2EIMB 3I55V 1K7DA 3E8BA 4XDJA 1Q82W 3SPIA 1YHQV 4QE7A 1VQ8V 2B1IA 1G4YB 5KA5A 3CCUV 3AG4B 5EC2C 3OR7C 1MOFA 1EFRG 2HVKC 3ML0A 2EIJB 2Y69B 3FB8C 2EBOA 2M7WA 3OM3B 3LDDA 1R3KC 3ZRWB 4R7CA 3CP1A 3SPGA 1VQ6V 1GM8A 1R3IC 4MTFA 1K3EA 4LBEC 1ZWIC 2JEUA 4G2KA 4MW8A 2H94A 3E86A 1JJ2U 1QLNA 3ZRXA 1R6KA 4QNHB 2W6JG 1VQ5V 3GWOA 3TCUA 3SYCA 4WF9V 1SETA 3JD2A 3RVYA 2ZDIC 5IY5B 4MT8A 1QLEC 3ASOB 4J9YB 4MSWC 5B1OA 3CYOA 1M90W 1RPOA 1K4DC 3KG2A 4RAIA 4CZZA 3JCZA 1VQ4V 1Q81W 1NVPB 3ZMVA 4FPPA 3CMEV 1I5YA 4H37A 4GX0A 4UV9A 5B1NA 1K5SA 2WLIB 3SYQA 1YITV 1QR8A 1MG1A 1JQ0A 1R3JC 5LHGA 3R65A 5L3BA 3CC7V 3ZRSA 5IYDO 3I56V 1FFTB 2YEVA 5DM6V 1F51A 2IJHA 3JD4A 2R9IA 3JD0A 2WLHA 4BW5A 5CMUA 3MHSC 2OTJV 5EK0A 5L3FA 2DWDC 4E2LA 1R6NA 3E8FA 5CA3A 2ITCC 2DW4A 2Q67A 4GT1A 2EIMC 1AI7A 2WAMA 3SYAA 2X6BA 1RPRA 4CBCA 1QCEA 2Z3YA 3F5WC 3CC2V 3WG7B 3ZMZA 2XAFA 2PI5A 2Y69C 3AEIA 1L1FA 5BZBA 4WCEV 3K04A 3SPHA 3FKSG 1PNLA 3SYOA 1EBOA 4X89A 2BOBC 1FXKA 2YSUB 4OXSA 4WFHA 1GM9A 4UVAA 3CD6V 4UVBA 3WG7C 3PJSK 2XAGA 3NXSA 3ETDA 3CCJV 1W0KG 3CCMV 3W7TA 4MVQA 1W0JG 5LHIA 3CCEV 4LP8A 1MABG 2QM8A 2P6JA 3G6EV 2F43G 3CCRV 3OFNG 3EFFK 3FB7C 1K73W 1P4RA 5H6RA 3ZRVA 1WPXA 4KFMA 1SRYA 2BOCC 4UXNA 1YJNV 4FIPC 3LSSA 5L3DA 1TUEB 1E79G 3ASOC 4MVMA 1VQ7V 3SJQC 4EKWA 3P30A 3ZMSA 2K1EA 3RVZA 1M57C 1V54C 3FB6C 4KP4A 1NH2B 1JX9A 4DO2A 1YTFB 4MVSA 3ETGA 3CCQV 1NR1A 1M57B 1V54B 2Y48A 3ETEA 4MVZA 1W2BU 1DF4A 2P90A 1KKDA 2A0LA 2EINC 2QM7A 1YJ9V 4JYBA 4YXWG 4QPKA 1F4MA 4MTOA 2JDIG 5EBLC 3E8GA 1EZJA 4G27B 1LNQA 1FS0G 4JASA 3VBBA 1GK9A 1AJPA 1S0VA 4GX1A 1XL6A 1Y66A 2MK3A 3B8NA 2HLDG 4WFFA 3E2EA 2IU3A 3B8MA 3BEHA 2XASA 2DYRC 4FK5C 4MVUA 4R6ZA 3LDEA 4FJCC 2ZR3A 4PA7A 2P67A 3F7YC 4R50A 2DYRB 3T4DA 4JAVA 1OCOB 1JOYA 2ATKC 3AG1B 3AG3C 1VQPV 1ORQC 2ZDIA 3OEHG 3K9AA 1QVGU 1ROPA 4TSFG 3DTUB 3QNEA 1S3JA 2WLLA 1Q86W 2KB1A 3AG1C 2DQ0A 3AG3B 3RBZA 5EBWC 2WLIA 1YJWV 1NJIW 4N21A 2P7TC 4PA6A 1GO3F 4PDLA 2UXXA 1KQSU 1JVMA 1ENVA 1JCHA 3T1CA 4XBFA 1HWYA 1CPYA 1QVFU 3STZC 3K0GA 5HFMA 4XDLA 1COWG 2WLMA 5CBGA 1PNKA 1M9NA 1GTOA 5B1AC 2R9RB 4HYOA 2EZPA 5CN0A 4HZ3A 2X7RB 2XOKG 1VQOV 3OE7G 5EC1C 2IH3C 2JK5C 3UM7A 2QA4V 1S77D 1KC8W 4JTAB 3HPLC 1N8RW 4PA3A 1GMGA 1OZ0A 3MHHC 1BMFG 2IJKA 2EINB 5C93A 4MTGA 1AI5A 1AI4A 1R73A 4JGSA 3K08A 2QEXV 1YTFD 3GB7C 3CCLV 4X8AA 1KD1W 2WPDG 3IGAC 1SZTA 2EJRA 3RW0A 3ABTA 3OMNB 1F23A 2ZXWB 3ASNB 1GKFA 5GW7A 3W7WA 5LBQA 2ZR2A 3D36A 2IW5A 2ZXWC 3ASNC 1K97A 2WSSG 1VQNV 1KP3A 3OMAB 1K8AW 3ZJZA 1PNMA 1J95A 4WFAV 2X0LA 2OCCB 3ZN1A 3ABKC 1NKDA 2Z5UA 1K9MW 2X6CA 5L3CA 3X2QB 3ABLC 2WLKA 3T2MA 2JEXA 1OCOC 3G4SV 3FYIB 1QBZA 1S5HC 3ZRWA 3X2QC 3ZMTA 2DWEC 3ABLB 3TK1A 2HFEC 4PDVA 2HJFC 2QE7G 2D3OW 1M1KW 1BHAA 5FL7G 5LGTA 4P9PA 1GM7A 4RQFA 1M56C 3E83A 1YI2V 5L3EA 1VQ9V 2WLJA 1H2GA 4PA4A 4RQEA 3CCSV 3F7VC 4U7NA 3SYPA 2XAJA 2NLJC 4LCUC 4U7OA 1P7BA 1XL4A 4KUMA 4QIWF 5B1BB 3FB5C 1DTOA 4JYCA 3M99B 4PA9A 3K03A 2JJ2G 5B1AB 3ZCCA 4UV8A 5LGNA 2EZOA 5B1BC 2B1GA 1PD3A 3FYEB 1IXMA 1JPXA 5L3GA 3K06A 4GX5A 5IYBO 4UUJC 3OGCC 5B3SC 5LHHA 2UXNA 2XNDG 2HVJC 1VQLV 3JD1A 5LGUA 4PDMA 1MSWD 4TT3G 1G8MA 2Q68A 3H01A 3VOUA 3EHBB 3LDCA 1OCCB 4R8CA 1Y4MA 3AG2C 1H8HG 1K92A 3E89A 1NVPD 1NR7A 2YEVB 1BHBA 2EILB 1S72V 1OCCC 2FTKA 3AG2B 4QPJA 1VQMV 4X88A 3SPCA 2Q69A 1FXHA 2LFSA 2LP7A 2Q6AA 2W6IG 3OUFA 2PI4A 3OUSA 3ABMC 3MD0A 1AROP 2AHZA 5KUMA 2DYSC 4JF3A 1PKXA 3OR6C 3ZN0A 2OCCC 3ABKB 3OW2U 2XAHA 2DQ3A 4JPRA 1WLEA 3DGEA 2JIZG 5HFLA 1YIJV 4MW3A 4I9WA 1NH2D 4L87A 1Q7YW 5KA6A 4MVRA 5H6QA 2QTOA 1E1QG 3BY6A 1AJNA 4PELA 2C2AA 4MTXA 4RO2A 1M56B 1FXKC 5E1AC 1AJQA 4LC1A 1OCZB 4Q20A 3IFXA 4JTCB 1AI6A 1V55B 3CPWU 5EBMC 3QO8A 5H9CA 3WFVA 1I5XA 4WFBV 1KP2A 4I5SA 3IC7A 4GX2A 3P32A 1V55C 4GCZA 3OEEG 3LNMB 3E8HA 4QE9A 3QO7A 3HB3B 4Z1MG 3T4ZA 3QO5A 2H8PC 4RUFA 3ZMUA 2IU0A 2HR3A 4N23A 5B3SB 1OHHG 3LUTB 4BIZA 3K3WA 2XAQA 2ITDC 2ZQMA 5CBHA 1NBMG 4HAMA 5DN6G 3TETA 3W7XA 1BL8A 2GSMB 2EILC 1OCRB 1YSCA 3W7SA 4H33A 4P2ZA 2AHYA 3AG4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NNU A;  2JEX A;  1DTO A;  1R6K A;  1TUE B;  1R6N A;  1QQH A;  2JEU A; 
#chains in the Genus database with same CATH topology
 3JAW A;  1THZ A;  1SER A;  3HKE A;  3LSQ A;  4HBN A;  3K57 A;  4J42 A;  1N33 O;  4JI6 B;  4RUE A;  3B2E E;  5KHJ A;  2EIK B;  3L71 H;  4ZI7 A;  2YIC A;  3DC6 A;  5GON B;  4MVO A;  1H2K A;  2QKS A;  3CB2 A;  5JJE B;  1FXK B;  2EIK C;  4X65 B;  1PM9 A;  3U0Z A;  4XDK A;  3UKM A;  2DE0 X;  2IJI A;  3ZIA G;  2OTL V;  4X1K B;  1SA0 A;  2YIB D;  1RM1 B;  3K0D A;  4UCO A;  1YZB A;  2F4V O;  3OAA G;  1B06 A;  1XNR O;  3D3I A;  2L6L A;  5CA1 B;  1CEZ A;  3A0B Z;  3J80 N;  1JJO A;  1XQ8 A;  1KKC A;  1DLB A;  5H2F Z;  1YCI A;  4EEQ A;  4X66 B;  1KBH A;  2ZE7 A;  3CHX A;  3JAR B;  1K34 A;  3RYI A;  4UVC A;  2AZ2 A;  2EIM B;  2WA3 A;  4RWU A;  1MZF A;  2ODM A;  3F5T A;  4UCR A;  3UQ8 A;  2B1I A;  4JI7 O;  2Z0A A;  3AG4 B;  4UCT A;  2E3C A;  3OR7 C;  3ML0 A;  2CTW A;  2Y69 B;  2OIE A;  3DC5 A;  2QM4 A;  4FZ0 A;  4Q6G A;  3SPG A;  1R6T A;  1IBM O;  1K3E A;  2ZM6 B;  4FFB A;  2H94 A;  3ZRX A;  1VQ5 V;  3OD4 A;  4LFC B;  3TCU A;  3SYC A;  1SET A;  5KAF Z;  3RYC B;  1QLE C;  2HEP A;  3CRR A;  5B1O A;  3CYO A;  4TUY A;  1GH6 A;  4CZZ A;  2QKA A;  1VQ4 V;  1NVP B;  4FPP A;  2E75 B;  1UFI A;  2QGN A;  2VWK A;  3SYQ A;  1YIT V;  4NVP A;  2UXC O;  1R3J C;  2N05 A;  3R65 A;  5L3B A;  1GRJ A;  1VMG A;  3CC7 V;  4U3J A;  1FFT B;  3C3T A;  5DM6 V;  4DR1 B;  4FLW A;  3JAS A;  4J10 A;  3ZX6 A;  4UCS A;  2Q67 A;  2Q0O C;  2YI8 A;  1AI7 A;  2X6B A;  1RPR A;  1LR1 A;  2YC0 A;  2Z3Y A;  3SJB C;  4JI8 B;  5BY1 A;  3F5W C;  3WG7 B;  2PI5 A;  2ZKO A;  4DR4 B;  3SPH A;  1EBO A;  4DR7 B;  2BOB C;  2YSU B;  4UVA A;  4DR3 O;  3PJS K;  1W0K G;  3SGI A;  1W0J G;  2RJZ A;  5LHI A;  2ETN A;  2P6J A;  3G6E V;  3N27 A;  3B09 A;  3CCR V;  2YUA A;  2KSD A;  4JI6 O;  2VQE B;  3EFF K;  2BCC H;  5J2U B;  1JFF B;  2VRZ A;  4DV3 O;  4FIP C;  3LSS A;  1E79 G;  3VQX A;  3QG5 A;  1EN5 A;  2UXB O;  3SJQ C;  5A2Q N;  1XHZ A;  3FB6 C;  3SJC C;  1JX9 A;  2ARH A;  4DR2 O;  3CCQ V;  4YY3 B;  4B7K A;  1NR1 A;  1M57 B;  1V54 B;  3ETE A;  4B3M B;  1DF4 A;  4LF6 B;  3UT5 A;  2GDS A;  4CH5 A;  2Q7H A;  4X20 B;  4MTO A;  3AK1 A;  1V9P A;  5B5E Z;  2P5O A;  1Q6I A;  1LNQ A;  2Q5Z A;  3B8N A;  2MK3 A;  4WFF A;  1WNS A;  2IU3 A;  3B8M A;  3GVM A;  4GYC B;  4FK5 C;  2QTS A;  3A2F A;  4FJC C;  4PA7 A;  2DYR B;  2ZIN A;  5CA0 B;  5IJ0 B;  1Q6H A;  3HKC B;  1D2D A;  4AIL C;  1Q90 D;  3HKE B;  1O9H A;  2ZDI A;  3K9A A;  3DTU B;  3QNE A;  1IBK O;  1KB9 F;  1P7G A;  5EZY A;  3AG3 B;  1NJI W;  2P7T C;  2UXX A;  1JVM A;  1AVM A;  4XBF A;  3L73 H;  2QWN B;  2WLM A;  2XHB A;  2F95 B;  1PNK A;  3L74 H;  5B1A C;  4LF5 O;  3KCY A;  4HZ3 A;  5EYP B;  2IH3 C;  4UFZ A;  1BCC H;  4X1K A;  1S77 D;  1HDJ A;  2JS3 A;  2XTA A;  4JI2 B;  1BMF G;  5KHH A;  1ZSP A;  2EIN B;  3APO A;  5IYZ A;  4O4H B;  3K08 A;  2JGU A;  1YTF D;  3CCL V;  2PYJ A;  2LQT A;  2JVD A;  3IGA C;  1F23 A;  1GKF A;  3W7W A;  4DR6 O;  2O57 A;  3D36 A;  1MSD A;  1HR0 B;  3G80 A;  1K97 A;  4JV5 O;  3G6B A;  5JCO A;  1KP3 A;  3OMA B;  3WB0 A;  1FJG B;  4YJ2 A;  1N0J A;  1J5E O;  3IAY A;  4J7K A;  2X0L A;  4JI3 B;  3ABK C;  1NKD A;  3EVK A;  1K9M W;  4KHP B;  3ABL C;  5TIS Z;  2K9P A;  2UXB B;  2P22 C;  1S5H C;  3ZRW A;  2YI9 A;  3ZMT A;  3ABL B;  3JAW B;  1YDX A;  1BHA A;  4H44 B;  1YI2 V;  1VQ9 V;  4PA4 A;  2XAJ A;  4DR6 B;  1IDS A;  3CXH F;  1DTO A;  4LNU B;  3RYC A;  1HNZ O;  4AHC A;  1VF6 C;  3K03 A;  1M5I A;  3T1H B;  2JJ2 G;  5B1B C;  2B1G A;  3FAV A;  1N36 O;  1JMK C;  2JRI A;  5IYB O;  4UUJ C;  3OGC C;  2BTO A;  5B3S C;  4ICG A;  4JYY A;  3E89 A;  4O2B B;  1WN7 A;  2YEV B;  1BHB A;  1XUQ A;  4CC5 A;  4FM1 A;  2FTK A;  5FPR A;  3ZS8 C;  5D5Q A;  1ZX3 A;  2LP7 A;  2PI4 A;  4LH6 A;  3JAL B;  4PV1 B;  1IBM B;  2AHZ A;  2DYS C;  4W4L A;  3OR6 C;  4JPR A;  5HFL A;  1EZV H;  2QJ1 A;  4L87 A;  3DXR A;  4Z1V A;  4MVR A;  3FFQ A;  1U97 A;  2Y4U A;  1Y76 A;  3E22 B;  3IFX A;  5H5N A;  1AI6 A;  5JQG B;  1HNZ B;  1EN4 A;  4KL1 A;  1I5X A;  4I5S A;  2GTS A;  1ZLZ A;  4IYI A;  1HR0 O;  1H2L A;  1V55 C;  3LNM B;  3L70 H;  4OX9 B;  4LFB B;  1YXB A;  1X59 A;  3QO7 A;  3HB3 B;  1SQX H;  4O2A B;  3VQV A;  3QTC A;  3QO5 A;  4RUF A;  2BSK B;  2Q9L A;  2AZ0 A;  4BIZ A;  3K3W A;  1SQG A;  4FM0 A;  4JI2 O;  2ITD C;  2QWO B;  3SJA C;  1Z2G A;  5LYJ A;  4H33 A;  5B1N A;  3OMI B;  3KZI Z;  1QQC A;  2RDC A;  4ASU G;  2EIJ C;  2CH7 A;  2LFR A;  1NQT A;  3HKD A;  1BGY H;  3E35 A;  5EIB D;  2R70 A;  1B6Q A;  3CMA V;  4P30 A;  2GHY A;  4X64 O;  3O65 A;  5IWA O;  2ZD9 A;  1Y74 A;  2V1D A;  3H1L H;  4ZBM A;  3HKC A;  3M7M X;  4P9O A;  4DRX A;  2RQ6 A;  1E1R G;  5IY5 C;  1SC5 B;  3TXQ A;  2IJJ A;  1YEW A;  1PL0 A;  3G71 V;  3Q4H B;  5C8Y A;  4ABM A;  1Q3E A;  5KHG A;  1H38 A;  1SES A;  1GAX A;  1SQQ H;  1XOU A;  5LMN B;  3JD3 A;  1URF A;  3BHP A;  4WFG A;  1K4C C;  4B08 A;  1JFF A;  3B77 A;  4I9Q A;  4BAY A;  4I4T A;  5EYP A;  4DXW A;  2R9A A;  3SPJ A;  2IM9 A;  3ABU A;  4FLZ A;  1K5Q A;  5LL6 Y;  3RGB A;  3CXC U;  3S3W A;  5IJ9 A;  3K79 A;  2W0F C;  3K5O A;  2HG5 C;  4JAU A;  4YJ3 B;  1OCR C;  1Q82 W;  1YHQ V;  1XNQ O;  4NXN B;  4FLV A;  1G4Y B;  1AP6 A;  3B4S A;  2KKW A;  2RNB A;  1P84 F;  2AXT Z;  3FB8 C;  3LDD A;  3EXA A;  4NTW A;  3L9D A;  4R7C A;  1GM8 A;  4MTF A;  1ZWI C;  4G2K A;  4DK1 A;  4MW8 A;  2Y4T A;  1WA8 B;  1QLN A;  2GTA A;  2W6J G;  4UB8 Z;  1I7F A;  4WF9 V;  5FLX N;  3RVY A;  2Q8V A;  4MT8 A;  4UCU A;  4JI8 O;  4J9Y B;  4MSW C;  1M90 W;  5GTI Z;  1RPO A;  4RAI A;  3OT7 A;  3CME V;  2WLI B;  3T1Y B;  1NT2 B;  1QR8 A;  1MG1 A;  1S5L Z;  3K5L A;  3R66 A;  2LGQ A;  2YS8 A;  4JAA A;  3MAQ A;  1MA1 A;  2F4V B;  3JD0 A;  4BW5 A;  5EK0 A;  4JI5 O;  4DW1 A;  4E2L A;  3E8F A;  4DV4 B;  4O2B A;  4GT1 A;  3H1I H;  3SYA A;  1QCE A;  3CC2 V;  3OGI B;  2Y69 C;  1L1F A;  5BZB A;  3SYO A;  4X89 A;  1FXK A;  1PV0 A;  1GM9 A;  1H2S B;  4DV1 B;  4UVB A;  3WG7 C;  3CCJ V;  3CCM V;  3NXS A;  4NXM B;  3CX5 F;  4GUN A;  3U10 A;  4LP8 A;  1Q8I A;  2AW9 A;  2UU9 B;  3BAB A;  3APQ A;  2UUA O;  1XMQ B;  3ZRV A;  5CA1 A;  5GTH Z;  5L3D A;  4NB5 A;  4K8X A;  3ASO C;  4JV5 B;  4X1I B;  2N74 A;  4YHH B;  4X62 B;  1NH2 B;  4DO2 A;  2CTP A;  5LP6 A;  2EX3 A;  2FKX A;  2Y48 A;  3QF7 A;  4J41 A;  3KKY A;  1KKD A;  2A0L A;  1DK1 A;  4CS2 A;  2HHH O;  3JAK A;  2ZM6 O;  1IVS A;  1F4M A;  3E8G A;  3VQW A;  1FFX A;  2ZE5 A;  1FS0 G;  3G67 A;  1XNR B;  1S0V A;  4GX1 A;  1Y66 A;  3OTO O;  4DV7 B;  3BEH A;  2UUC O;  2XAS A;  1RFY A;  4R6Z A;  2ZR3 A;  1XEQ A;  2F1M A;  4KXR A;  3F7Y C;  4R50 A;  3T4D A;  5E79 Z;  2Q73 A;  1JOY A;  3AG1 B;  1VQP V;  2YID A;  5GON A;  4AQY O;  3GWK C;  4PJ0 Z;  1ROP A;  4AQY B;  3SR2 C;  1Q86 W;  2KB1 A;  3AG1 C;  5EBW C;  1Y74 B;  1YJW V;  2PGG A;  4IHJ B;  4PA6 A;  4PDL A;  4CH6 A;  4IGG A;  4DRX B;  1QVF U;  1COW G;  4LFA O;  2QKC A;  3DXR B;  4JI3 O;  2UUC B;  2CDY A;  1X4T A;  2R9R B;  3K59 A;  2VWJ A;  4DV6 O;  2EZP A;  5CN0 A;  2X7R B;  2XOK G;  3OE7 G;  3E22 A;  3CS5 A;  5EC1 C;  3UCS C;  1KC8 W;  3VQY A;  4FLY A;  3HPL C;  3IC9 A;  1N8R W;  1GN2 A;  2IJK A;  4MTG A;  3ZHQ A;  1IUR A;  1R73 A;  4JGS A;  3IJ4 A;  1KD1 W;  2WPD G;  3RW0 A;  3OMN B;  1DGS A;  4EB6 A;  1IBK B;  5GW7 A;  5LBQ A;  4J7Z A;  2ZR2 A;  2V4D A;  3RYH A;  2ZCE A;  5CB4 A;  1FPO A;  4I50 A;  4YJ3 A;  1PNM A;  1MNG A;  2GUZ B;  5L3C A;  1WP8 A;  4LF7 O;  4K0K O;  1GN4 A;  4GKJ B;  1OCO C;  3FYI B;  4DR5 B;  2UUB O;  1YF2 A;  3CJH B;  2HJF C;  2QE7 G;  2D3O W;  1M1K W;  2CH7 B;  5LMN O;  4RQF A;  1M56 C;  2FML A;  1TAE A;  3CCS V;  3SYP A;  3LNN A;  4U7O A;  1XL4 A;  3ZBH A;  4QIW F;  1FD9 A;  4DUY O;  3CRC A;  5JJJ B;  4UV8 A;  5LGN A;  2EZO A;  1NTZ H;  1JPX A;  5L3G A;  3WB2 A;  4JZ2 A;  1VP7 A;  4GX5 A;  1F7Y A;  4DYL A;  3JAS B;  5K1X A;  2XND G;  5C8Y B;  3M8A A;  1MSW D;  3H01 A;  3VOU A;  3LDC A;  1VF7 A;  1H8H G;  1K92 A;  1R1B A;  2QWQ B;  2EIL B;  4I4T B;  3BVO A;  5BMV B;  2E5L O;  4X88 A;  3N2K A;  2Q69 A;  3BAA A;  2W6I G;  3OUF A;  3OUS A;  1IZ3 A;  4DV4 O;  4JI4 O;  5KUM A;  4O4J B;  4F6E A;  4JF3 A;  3ZN0 A;  3OW2 U;  3DGE A;  2JIZ G;  2Y0P A;  4TQD A;  3ZHR A;  2QR4 A;  4I9W A;  4LR3 A;  1Q7Y W;  1JA8 A;  3WB1 A;  1E1Q G;  1EN6 A;  3BY6 A;  1AJN A;  3MDS A;  2C2A A;  2A06 H;  4TOI A;  5E1A C;  1FXK C;  3UO3 A;  1AJQ A;  2HHH B;  4FLX A;  1OCZ B;  3H1H H;  1Q5O A;  4DR3 B;  3CSX A;  1WJZ A;  3CPW U;  5EBM C;  4JYA B;  2OCH A;  1TUB A;  4E4E A;  1KP2 A;  1WA8 A;  3IC7 A;  4WFB V;  4DUZ B;  4GCZ A;  3E8H A;  1SZX A;  1N0N A;  5LA6 B;  3T4Z A;  3K5M A;  3ZMU A;  5LP6 B;  1JR9 A;  2WA4 A;  1I0H A;  5J2T A;  2YXY A;  1QU7 A;  2XAQ A;  3HKB A;  1N33 B;  4J7J A;  5FNV A;  2FB5 A;  3JAK B;  5CBH A;  1VAR A;  3N2G B;  3W7X A;  1BL8 A;  4BR6 A;  4F6R A;  1NI8 A;  1YSC A;  4UCV A;  5CA0 A;  3AG4 C;  4LF8 O;  4G28 B;  3ABM B;  4DV2 O;  2DYS B;  2V7Q G;  1R3L C;  1AR1 B;  2WLL B;  4D7T A;  4JTD B;  2ZNI A;  4LNU A;  5KX5 B;  4JI1 B;  3SDL A;  3P3N A;  1HNW B;  1QHT A;  1WB7 A;  4TWK A;  3A0R A;  4MS2 A;  1F4N A;  4TV8 A;  4PDR A;  4J80 A;  1Z5W A;  3AK3 A;  2OT5 A;  2PTM A;  1UJW B;  3RT3 C;  3T1Y O;  1AR4 A;  3FD9 A;  2NNU A;  1K33 A;  1CP9 A;  2IH1 C;  1NS1 A;  2CK3 G;  2JJ1 G;  4F4L A;  3ZHS A;  3RYF A;  4BIU A;  2B5U A;  1J5E B;  1OJH A;  1SQV H;  2A9H A;  5KLV H;  3CWB H;  4DV3 B;  1ZUQ A;  5IYC O;  4EFE A;  3I55 V;  1K7D A;  3E8B A;  4FVM A;  1VQ8 V;  3THO A;  1BSM A;  3RWR D;  1G6U A;  3BA9 A;  3ZRW B;  5CB4 B;  4DR4 O;  1VQ6 V;  3D36 C;  1R3I C;  3JAT B;  3PN1 A;  2JEU A;  5JCO C;  2N04 A;  3E86 A;  1HW7 A;  4I55 A;  1R6K A;  1WB8 A;  4LF5 B;  4TV9 B;  1I94 O;  2B9Z A;  4CH4 A;  3H1K H;  3KG2 A;  1LUW A;  3JCZ A;  5EIB C;  1I5Y A;  1XHX A;  4GX0 A;  4H37 A;  4IYH A;  4UV9 A;  1K5S A;  5LHG A;  3I56 V;  2YEV A;  1BS3 A;  4JI0 O;  2IJH A;  3JD4 A;  4L8J A;  5CMU A;  3MHS C;  1ZAU A;  5L3F A;  1BZK A;  5CA3 A;  1P49 A;  4BWA A;  3JSL A;  2ITC C;  4K8Z A;  2DW4 A;  2EIM C;  2WAM A;  3D8C A;  5DED A;  4LF9 O;  4X62 O;  4WCE V;  3K04 A;  3FKS G;  1PNL A;  2CE4 A;  4OXS A;  3CEI A;  3QVN A;  1Y76 B;  3ETD A;  3Q4H A;  3W7T A;  4LH7 A;  3WU2 Z;  4I50 B;  2QM8 A;  4B3S B;  4LFA B;  1HP8 A;  1K73 W;  5H6R A;  1WPX A;  4KFM A;  4ZHQ A;  1SRY A;  4JI4 B;  4UXN A;  4B3R B;  1PL4 A;  2FL4 A;  4EFB A;  1FJG O;  4MVM A;  1VQ7 V;  4EKW A;  3P30 A;  3ZMS A;  3RVZ A;  4KP4 A;  2UXD B;  1YTF B;  4LWS A;  3CRA A;  3ETG A;  1TVK B;  3RN4 A;  5JVD A;  2ZE6 A;  3ZHV A;  2A3Q A;  4MVZ A;  4CC6 A;  2P90 A;  2QM7 A;  2EIN C;  4YXW G;  2DOS A;  5LA6 A;  1D5N A;  2UXC B;  5EBL C;  4B3S O;  4B3T B;  4G27 B;  4JAS A;  3VBB A;  1XL6 A;  1QNM A;  2HLD G;  3HKD B;  5ITZ B;  5BR8 B;  4X1Y B;  4HNA B;  3AK2 A;  4NTY A;  4C7U A;  3L72 H;  4OGQ B;  4F6R B;  2CAZ C;  1XI1 A;  4DV1 O;  2UUB B;  5BMV A;  2ATK C;  1ORQ C;  1QVG U;  4TSF G;  2WLL A;  2ADP A;  5A9G A;  2DQ0 A;  2WLI A;  4N21 A;  1GO3 F;  2F66 C;  1JCH A;  3T1C A;  1HWY A;  3BPZ A;  2P4K A;  4ZI7 B;  3K0G A;  5HFM A;  3BRC A;  4JZG A;  4JI5 B;  2HP8 A;  1M9N A;  2JGD B;  4HYO A;  4YIO A;  2JK5 C;  3TGU H;  4DR5 O;  3NR7 A;  4JTA B;  3I5D A;  4OPH A;  4PA3 A;  1OZ0 A;  1U96 A;  5C93 A;  1AI5 A;  1AI4 A;  5IJ9 B;  1A32 A;  4LF4 O;  2OYQ A;  2VQF O;  1AIL A;  3RYF B;  5LXT B;  3ETQ A;  2EJR A;  1LUV A;  4CS4 A;  3ASN B;  4DV5 O;  4GZR B;  2AGA A;  3ASN C;  5J2T B;  3HKB B;  1K8A W;  2QSA A;  3CE2 A;  5FNV B;  1N4C A;  2LW7 A;  4DUY B;  2FYU H;  4WFA V;  2OCC B;  3N2G A;  1UPG A;  1VEW A;  1N34 O;  2WLK A;  3T2M A;  4CH3 A;  5IT9 N;  2Q7E A;  2DWE C;  2HFE C;  4PDV A;  5FL7 G;  5LGT A;  4P9P A;  1BE3 H;  5LOV A;  2R72 A;  1BQ0 A;  2WLJ A;  2BTQ B;  1H2G A;  1IX9 A;  3F7V C;  4U7N A;  2ZIM A;  1P7B A;  3O9O A;  4GKK O;  4DV7 O;  4JYC A;  1TA8 A;  1WPB A;  4JI0 B;  2EUL A;  1SQP H;  3CRM A;  5B1A B;  4DV2 B;  5D5P A;  1OV9 A;  4IIJ A;  4CS3 A;  4TV8 B;  5LHH A;  2UXN A;  2HVJ C;  4QGP A;  4O4I A;  3JD1 A;  4PDM A;  4TT3 G;  1G8M A;  1SA0 B;  1B3Q A;  4IT5 A;  3EHB B;  4NXN O;  1OCC B;  4R8C A;  3AG2 C;  4NYK A;  4U3J B;  1S72 V;  2E74 B;  3AG2 B;  4QPJ A;  1VQM V;  3SPC A;  1FXH A;  2Q6A A;  1SQF A;  4LFB O;  1N32 O;  1PKX A;  3JCU Z;  3CRQ A;  4IHJ A;  5IWA B;  3ABK B;  2XAH A;  1WLE A;  1YIJ V;  3UO2 A;  4MW3 A;  5KA6 A;  5H6Q A;  2M6Y A;  3DSQ A;  4K0K B;  2QTO A;  1AB3 A;  4PEL A;  2VS0 A;  4X1I A;  2H3O A;  4RO2 A;  1M56 B;  4LC1 A;  4IL6 Z;  1PPJ H;  4Q20 A;  5KHK A;  3JAT A;  4JTC B;  4FFB B;  2ADQ B;  4GKK B;  3QO8 A;  4GX2 A;  4DV5 B;  3P3P A;  1ZL8 B;  5F2V O;  4TV9 A;  4OPA A;  4Z1M G;  4EB6 B;  2H8P C;  2IBZ H;  3BCC H;  2IU0 A;  2HR3 A;  1FKA O;  5B3S B;  2CGN A;  1FFX B;  3LUT B;  2RCV A;  1L0N H;  1FAF A;  4I0X A;  1VF5 B;  1NTK H;  2ZQM A;  2CGO A;  2ZE8 A;  1NBM G;  2EJ7 A;  4FFK A;  4X20 A;  2GUZ A;  3TET A;  2GSM B;  1KU9 A;  1OCR B;  3FX7 A;  5KHI A;  1XMO O;  3W7S A;  4WBN A;  4P2Z A;  2AHY A;  2BE3 A;  4AI8 A;  3CJH A;  4B7E A;  5CBF A;  5IDJ A;  4O4L B;  1KYO F;  4HNA A;  3CC4 V;  1S76 D;  4FLU A;  3H9V A;  3W7U A;  2Y0I A;  2UXD O;  5IJ0 A;  2HKO A;  2NN4 A;  5JH7 B;  4LFC O;  4I7Z B;  4QJF B;  1HNW O;  3STL C;  1KEC A;  4FMT A;  1QLE B;  1QQH A;  4DR7 O;  4NTX A;  1MZE A;  2Q0A A;  5EZY B;  2X6A A;  1OCZ C;  3U11 A;  1RM1 C;  1SKV A;  1HNX B;  5KUK A;  3J81 N;  2DJV A;  4ZKI A;  2A79 B;  3JYC A;  3KCX A;  1FXV A;  2WLN A;  2KG7 B;  1DF5 A;  3BFR A;  1XIL A;  5IE9 A;  5J2U A;  1QR9 A;  5J9P C;  2YXL A;  3C90 A;  2WWW A;  2LJ2 A;  3CCV V;  4WFE A;  5LP6 C;  1VQK V;  2ZNJ A;  4ZIB A;  3AG7 A;  5IYZ B;  4O4J A;  4X66 O;  1H8E G;  1TVK A;  4PHZ A;  1W59 A;  3JAM N;  3L75 H;  3RYH B;  5B66 Z;  4J9Z B;  4PI0 A;  4XDJ A;  3SPI A;  4QE7 A;  4YIP A;  4D7S A;  2D2C B;  1Z5V A;  5KA5 A;  3CCU V;  5EC2 C;  4DV0 B;  1RSO B;  1MOF A;  1EFR G;  2HVK C;  3C3S A;  4JI7 B;  2EIJ B;  2EBO A;  4UB6 Z;  2M7W A;  3OM3 B;  1R3K C;  3CP1 A;  1CXZ B;  4YJ2 B;  1H2M A;  4LBE C;  4JYA O;  1Y67 A;  4NXM O;  1JJ2 U;  3D3Q A;  1SS3 A;  4QNH B;  3GWO A;  4K3A A;  3ZED A;  1YVW A;  3JD2 A;  2ZDI C;  5IY5 B;  2JS5 A;  3ASO B;  1N34 B;  5LOV B;  1K4D C;  3K5N A;  1Q81 W;  3ZMV A;  3JSN A;  2DMX A;  3H1J H;  1JQ0 A;  1NZ6 A;  4FM2 A;  4ZOL B;  2PZS A;  1NU1 H;  2G38 A;  3ZRS A;  3FAV B;  4U3F H;  5IYD O;  1VF6 A;  2E5L B;  1NTM H;  1F51 A;  3A0H Z;  2R9I A;  4J11 A;  2WLH A;  2ILM A;  2VQE O;  2OTJ V;  3N2K B;  2DWD C;  1R6N A;  2L35 A;  4BIO A;  2OIG A;  1US6 A;  5KMG B;  4H13 B;  4YY3 O;  4CBC A;  5KAI Z;  5LXT A;  3ZMZ A;  2XAF A;  3AEI A;  1T5E A;  1EM1 A;  3JAL A;  4W4K A;  3ZHT A;  3CD6 V;  4PD4 F;  1AP5 A;  4DK0 A;  2XAG A;  4DV0 O;  1H2N A;  4MVQ A;  3CCE V;  4TQF A;  1MAB G;  1SQB H;  2F43 G;  3OFN G;  3BA8 A;  2UU9 O;  3FB7 C;  1P4R A;  1TUB B;  2QWP B;  2BOC C;  4X64 B;  1YJN V;  1TUE B;  2QWR B;  2K1E A;  1M57 C;  1V54 C;  4LF7 B;  5JQG A;  1I94 B;  4MVS A;  3LSU A;  2ZIO A;  2BTQ A;  4Z2W A;  1W2B U;  4BW9 A;  4B3M O;  1ZL8 A;  1YJ9 V;  4JYB A;  4QPK A;  2JDI G;  2UUA B;  4B3T O;  1EZJ A;  1L8D A;  1G1X B;  1SF9 A;  4IIJ B;  5BXZ A;  2DN9 A;  2OWO A;  1GK9 A;  1AJP A;  1BT8 A;  4D6T H;  4I0X B;  3E2E A;  2GBO A;  4O4I B;  1GN6 A;  3K9S A;  2DYR C;  1L0L H;  4MVU A;  4I55 B;  3LDE A;  5LYJ B;  2P67 A;  4JAV A;  4DV6 B;  5KX5 A;  1GN3 A;  1OCO B;  3AG3 C;  2ZT9 B;  4NKG B;  4TUY B;  3OEH G;  4DUZ O;  2XUM A;  1S3J A;  1S5J A;  1XMO B;  3RBZ A;  2F23 A;  3OTO B;  3T1H O;  1KQS U;  1ENV A;  1PP9 H;  2CTQ A;  3B40 A;  2GV9 A;  1CPY A;  2KQX A;  3STZ C;  5JH7 A;  2PUS A;  2RMK B;  4XDL A;  5CBG A;  1GTO A;  2YDE A;  1VQO V;  3UM7 A;  2QA4 V;  1Q43 A;  1GMG A;  3MHH C;  4H0L B;  2PF4 E;  4KHP O;  2KG7 A;  3JAR A;  3RYI B;  2QEX V;  3GB7 C;  1RP3 B;  4LF4 B;  4X8A A;  1SZT A;  3ABT A;  4O2A A;  2ZXW B;  3TJT A;  1XMQ O;  2NR5 A;  2F93 B;  1B04 A;  2BSK A;  2IW5 A;  2ZXW C;  1N36 B;  5FPO A;  2WSS G;  1M93 A;  1VQN V;  1Q6U A;  4DR1 O;  1M4U A;  5JJN B;  4PI2 A;  3ZJZ A;  1J95 A;  4FZ1 A;  3ZN1 A;  1XNQ B;  2Z5U A;  2X6C A;  3X2Q B;  1RSO A;  2JEX A;  1AR5 A;  4X65 O;  3G4S V;  5LMU O;  1QBZ A;  2YXH A;  4WBN B;  3X2Q C;  3TK1 A;  2PYL A;  2QDO A;  4LWS B;  4O4L A;  1GM7 A;  1O9G A;  1D5A A;  3E83 A;  5L3E A;  1HNX O;  4LF9 B;  3RFR A;  4RQE A;  1XBL A;  2NLJ C;  4LCU C;  4KUM A;  3J7A U;  3UT5 B;  5B1B B;  2RN9 A;  3FB5 C;  3HR0 A;  5JWP A;  5K1P A;  3M99 B;  4PA9 A;  2P4V A;  2MW2 B;  1KUQ A;  3ZCC A;  3K58 A;  1PD3 A;  3FYE B;  3ICX A;  1IXM A;  5BR8 O;  3K06 A;  1N32 B;  1VQL V;  5LGU A;  1WP7 A;  2Q68 A;  4X1Y A;  1IBL B;  2YIA A;  1ZTE A;  1Y4M A;  3S3X A;  1NVP D;  1NR7 A;  1XRE A;  4NR1 A;  2Q7G A;  1OCC C;  2Q4P A;  1I08 A;  2LFS A;  3ABM C;  3MD0 A;  3TXS A;  1ARO P;  5KMG A;  3OTF A;  2OCC C;  2XT9 A;  2DQ3 A;  1Y6X A;  1MMM A;  1XDC A;  2CTR A;  4A5U B;  1NH2 D;  4B3R O;  4ZHQ B;  4DR2 B;  2A7W A;  2JGD A;  2LW1 A;  5AG2 A;  2P06 A;  1TGO A;  4MTX A;  3ZHU A;  1V55 B;  2VQF B;  2YIB A;  5H9C A;  3WFV A;  4O4H A;  4GLX A;  5JVD B;  2LGW A;  5DEC A;  4OX9 O;  2E76 B;  1FYJ A;  3P32 A;  3OEE G;  1WAZ A;  2CUG A;  2W0X A;  4QE9 A;  4N23 A;  1OHH G;  4GKJ O;  1VIB A;  2PY5 A;  4JI1 O;  4X9Q A;  2LO1 A;  4YHH O;  4K35 A;  1IXB A;  1IBL O;  3A8T A;  5ITZ A;  4HAM A;  4ZOL A;  5DN6 G;  4FLT A;  4LF6 O;  2EIL C;  2HJD A;  4DW0 A;  5LMU B;  4LF8 B;  1KMI Z;  1BQZ A;  4WFH A; 
#chains in the Genus database with same CATH homology
 4G28 B;  4ASU G;  3ABM B;  2EIJ C;  1THZ A;  1SER A;  5IDJ A;  5CBF A;  2LFR A;  1NQT A;  3E35 A;  2DYS B;  3CC4 V;  3LSQ A;  2V7Q G;  1B6Q A;  1S76 D;  3CMA V;  1R3L C;  3OMI B;  1AR1 B;  4P30 A;  2WLL B;  2GHY A;  4JTD B;  3W7U A;  2ZD9 A;  2V1D A;  2HKO A;  4ZBM A;  4P9O A;  4RUE A;  2EIK B;  1E1R G;  4MVO A;  5IY5 C;  4QJF B;  3STL C;  1KEC A;  4TWK A;  2QKS A;  3A0R A;  1QLE B;  1FXK B;  2IJJ A;  4FMT A;  1F4N A;  2EIK C;  4MS2 A;  1PL0 A;  1QQH A;  4PDR A;  2X6A A;  1OCZ C;  1RM1 C;  3G71 V;  4XDK A;  3UKM A;  2IJI A;  3ZIA G;  2OT5 A;  2OTL V;  1H38 A;  1SES A;  1UJW B;  5KUK A;  1RM1 B;  3K0D A;  3JD3 A;  4ZKI A;  2A79 B;  1CP9 A;  1K33 A;  2IH1 C;  1FXV A;  2NNU A;  1K4C C;  2WLN A;  3JYC A;  3OAA G;  3D3I A;  4WFG A;  1DF5 A;  1CEZ A;  2CK3 G;  2JJ1 G;  1QR9 A;  4F4L A;  3B77 A;  5J9P C;  2WWW A;  4BIU A;  4BAY A;  4DXW A;  3CCV V;  2B5U A;  4WFE A;  1DLB A;  1VQK V;  3SPJ A;  3ABU A;  2A9H A;  1K5Q A;  1H8E G;  1K34 A;  3CXC U;  4UVC A;  3K79 A;  5IYC O;  2W0F C;  2HG5 C;  4JAU A;  4J9Z B;  1OCR C;  2EIM B;  3I55 V;  1K7D A;  3E8B A;  4XDJ A;  1Q82 W;  3SPI A;  1YHQ V;  4QE7 A;  1VQ8 V;  2B1I A;  1G4Y B;  5KA5 A;  3CCU V;  3AG4 B;  5EC2 C;  3OR7 C;  1MOF A;  1EFR G;  2HVK C;  3ML0 A;  2EIJ B;  2Y69 B;  3FB8 C;  2EBO A;  2M7W A;  3OM3 B;  3LDD A;  1R3K C;  3ZRW B;  4R7C A;  3CP1 A;  3SPG A;  1VQ6 V;  1GM8 A;  1R3I C;  4MTF A;  1K3E A;  4LBE C;  1ZWI C;  2JEU A;  4G2K A;  4MW8 A;  2H94 A;  3E86 A;  1JJ2 U;  1QLN A;  3ZRX A;  1R6K A;  4QNH B;  2W6J G;  1VQ5 V;  3GWO A;  3TCU A;  3SYC A;  4WF9 V;  1SET A;  3JD2 A;  3RVY A;  2ZDI C;  5IY5 B;  4MT8 A;  1QLE C;  3ASO B;  4J9Y B;  4MSW C;  5B1O A;  3CYO A;  1M90 W;  1RPO A;  1K4D C;  3KG2 A;  4RAI A;  4CZZ A;  3JCZ A;  1VQ4 V;  1Q81 W;  1NVP B;  3ZMV A;  4FPP A;  3CME V;  1I5Y A;  4H37 A;  4GX0 A;  4UV9 A;  5B1N A;  1K5S A;  2WLI B;  3SYQ A;  1YIT V;  1QR8 A;  1MG1 A;  1JQ0 A;  1R3J C;  5LHG A;  3R65 A;  5L3B A;  3CC7 V;  3ZRS A;  5IYD O;  3I56 V;  1FFT B;  2YEV A;  5DM6 V;  1F51 A;  2IJH A;  3JD4 A;  2R9I A;  3JD0 A;  2WLH A;  4BW5 A;  5CMU A;  3MHS C;  2OTJ V;  5EK0 A;  5L3F A;  2DWD C;  4E2L A;  1R6N A;  3E8F A;  5CA3 A;  2ITC C;  2DW4 A;  2Q67 A;  4GT1 A;  2EIM C;  1AI7 A;  2WAM A;  3SYA A;  2X6B A;  1RPR A;  4CBC A;  1QCE A;  2Z3Y A;  3F5W C;  3CC2 V;  3WG7 B;  3ZMZ A;  2XAF A;  2PI5 A;  2Y69 C;  3AEI A;  1L1F A;  5BZB A;  4WCE V;  3K04 A;  3SPH A;  3FKS G;  1PNL A;  3SYO A;  1EBO A;  4X89 A;  2BOB C;  1FXK A;  2YSU B;  4OXS A;  4WFH A;  1GM9 A;  4UVA A;  3CD6 V;  4UVB A;  3WG7 C;  3PJS K;  2XAG A;  3NXS A;  3ETD A;  3CCJ V;  1W0K G;  3CCM V;  3W7T A;  4MVQ A;  1W0J G;  5LHI A;  3CCE V;  4LP8 A;  1MAB G;  2QM8 A;  2P6J A;  3G6E V;  2F43 G;  3CCR V;  3OFN G;  3EFF K;  3FB7 C;  1K73 W;  1P4R A;  5H6R A;  3ZRV A;  1WPX A;  4KFM A;  1SRY A;  2BOC C;  4UXN A;  1YJN V;  4FIP C;  3LSS A;  5L3D A;  1TUE B;  1E79 G;  3ASO C;  4MVM A;  1VQ7 V;  3SJQ C;  4EKW A;  3P30 A;  3ZMS A;  2K1E A;  3RVZ A;  1M57 C;  1V54 C;  3FB6 C;  4KP4 A;  1NH2 B;  1JX9 A;  4DO2 A;  1YTF B;  4MVS A;  3ETG A;  3CCQ V;  1NR1 A;  1M57 B;  1V54 B;  2Y48 A;  3ETE A;  4MVZ A;  1W2B U;  1DF4 A;  2P90 A;  1KKD A;  2A0L A;  2EIN C;  2QM7 A;  1YJ9 V;  4JYB A;  4YXW G;  4QPK A;  1F4M A;  4MTO A;  2JDI G;  5EBL C;  3E8G A;  1EZJ A;  4G27 B;  1LNQ A;  1FS0 G;  4JAS A;  3VBB A;  1GK9 A;  1AJP A;  1S0V A;  4GX1 A;  1XL6 A;  1Y66 A;  2MK3 A;  3B8N A;  2HLD G;  4WFF A;  3E2E A;  2IU3 A;  3B8M A;  3BEH A;  2XAS A;  2DYR C;  4FK5 C;  4MVU A;  4R6Z A;  3LDE A;  4FJC C;  2ZR3 A;  4PA7 A;  2P67 A;  3F7Y C;  4R50 A;  2DYR B;  3T4D A;  4JAV A;  1OCO B;  1JOY A;  2ATK C;  3AG1 B;  3AG3 C;  1VQP V;  1ORQ C;  2ZDI A;  3OEH G;  3K9A A;  1QVG U;  1ROP A;  4TSF G;  3DTU B;  3QNE A;  1S3J A;  2WLL A;  1Q86 W;  2KB1 A;  3AG1 C;  2DQ0 A;  3AG3 B;  3RBZ A;  5EBW C;  2WLI A;  1YJW V;  1NJI W;  4N21 A;  2P7T C;  4PA6 A;  1GO3 F;  4PDL A;  2UXX A;  1KQS U;  1JVM A;  1ENV A;  1JCH A;  3T1C A;  4XBF A;  1HWY A;  1CPY A;  1QVF U;  3STZ C;  3K0G A;  5HFM A;  4XDL A;  1COW G;  2WLM A;  5CBG A;  1PNK A;  1M9N A;  1GTO A;  5B1A C;  2R9R B;  4HYO A;  2EZP A;  5CN0 A;  4HZ3 A;  2X7R B;  2XOK G;  1VQO V;  3OE7 G;  5EC1 C;  2IH3 C;  2JK5 C;  3UM7 A;  2QA4 V;  1S77 D;  1KC8 W;  4JTA B;  3HPL C;  1N8R W;  4PA3 A;  1GMG A;  1OZ0 A;  3MHH C;  1BMF G;  2IJK A;  2EIN B;  5C93 A;  4MTG A;  1AI5 A;  1AI4 A;  1R73 A;  4JGS A;  3K08 A;  2QEX V;  1YTF D;  3GB7 C;  3CCL V;  4X8A A;  1KD1 W;  2WPD G;  3IGA C;  1SZT A;  2EJR A;  3RW0 A;  3ABT A;  3OMN B;  1F23 A;  2ZXW B;  3ASN B;  1GKF A;  5GW7 A;  3W7W A;  5LBQ A;  2ZR2 A;  3D36 A;  2IW5 A;  2ZXW C;  3ASN C;  1K97 A;  2WSS G;  1VQN V;  1KP3 A;  3OMA B;  1K8A W;  3ZJZ A;  1PNM A;  1J95 A;  4WFA V;  2X0L A;  2OCC B;  3ZN1 A;  3ABK C;  1NKD A;  2Z5U A;  1K9M W;  2X6C A;  5L3C A;  3X2Q B;  3ABL C;  2WLK A;  3T2M A;  2JEX A;  1OCO C;  3G4S V;  3FYI B;  1QBZ A;  1S5H C;  3ZRW A;  3X2Q C;  3ZMT A;  2DWE C;  3ABL B;  3TK1 A;  2HFE C;  4PDV A;  2HJF C;  2QE7 G;  2D3O W;  1M1K W;  1BHA A;  5FL7 G;  5LGT A;  4P9P A;  1GM7 A;  4RQF A;  1M56 C;  3E83 A;  1YI2 V;  5L3E A;  1VQ9 V;  2WLJ A;  1H2G A;  4PA4 A;  4RQE A;  3CCS V;  3F7V C;  4U7N A;  3SYP A;  2XAJ A;  2NLJ C;  4LCU C;  4U7O A;  1P7B A;  1XL4 A;  4KUM A;  4QIW F;  5B1B B;  3FB5 C;  1DTO A;  4JYC A;  3M99 B;  4PA9 A;  3K03 A;  2JJ2 G;  5B1A B;  3ZCC A;  4UV8 A;  5LGN A;  2EZO A;  5B1B C;  2B1G A;  1PD3 A;  3FYE B;  1IXM A;  1JPX A;  5L3G A;  3K06 A;  4GX5 A;  5IYB O;  4UUJ C;  3OGC C;  5B3S C;  5LHH A;  2UXN A;  2XND G;  2HVJ C;  1VQL V;  3JD1 A;  5LGU A;  4PDM A;  1MSW D;  4TT3 G;  1G8M A;  2Q68 A;  3H01 A;  3VOU A;  3EHB B;  3LDC A;  1OCC B;  4R8C A;  1Y4M A;  3AG2 C;  1H8H G;  1K92 A;  3E89 A;  1NVP D;  1NR7 A;  2YEV B;  1BHB A;  2EIL B;  1S72 V;  1OCC C;  2FTK A;  3AG2 B;  4QPJ A;  1VQM V;  4X88 A;  3SPC A;  2Q69 A;  1FXH A;  2LFS A;  2LP7 A;  2Q6A A;  2W6I G;  3OUF A;  2PI4 A;  3OUS A;  3ABM C;  3MD0 A;  1ARO P;  2AHZ A;  5KUM A;  2DYS C;  4JF3 A;  1PKX A;  3OR6 C;  3ZN0 A;  2OCC C;  3ABK B;  3OW2 U;  2XAH A;  2DQ3 A;  4JPR A;  1WLE A;  3DGE A;  2JIZ G;  5HFL A;  1YIJ V;  4MW3 A;  4I9W A;  1NH2 D;  4L87 A;  1Q7Y W;  5KA6 A;  4MVR A;  5H6Q A;  2QTO A;  1E1Q G;  3BY6 A;  1AJN A;  4PEL A;  2C2A A;  4MTX A;  4RO2 A;  1M56 B;  1FXK C;  5E1A C;  1AJQ A;  4LC1 A;  1OCZ B;  4Q20 A;  3IFX A;  4JTC B;  1AI6 A;  1V55 B;  3CPW U;  5EBM C;  3QO8 A;  5H9C A;  3WFV A;  1I5X A;  4WFB V;  1KP2 A;  4I5S A;  3IC7 A;  4GX2 A;  3P32 A;  1V55 C;  4GCZ A;  3OEE G;  3LNM B;  3E8H A;  4QE9 A;  3QO7 A;  3HB3 B;  4Z1M G;  3T4Z A;  3QO5 A;  2H8P C;  4RUF A;  3ZMU A;  2IU0 A;  2HR3 A;  4N23 A;  5B3S B;  1OHH G;  3LUT B;  4BIZ A;  3K3W A;  2XAQ A;  2ITD C;  2ZQM A;  5CBH A;  1NBM G;  4HAM A;  5DN6 G;  3TET A;  3W7X A;  1BL8 A;  2GSM B;  2EIL C;  1OCR B;  1YSC A;  3W7S A;  4H33 A;  4P2Z A;  2AHY A;  3AG4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...