2NNUA

Crystal structure of the papillomavirus dna tethering complex e2:brd4
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
201
structure length
201
Chain Sequence
SMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDICNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Papillomavirus DNA-Tethering Complex E2:Brd4 and a Peptide that Ablates HPV Chromosomal Association.
pubmed doi rcsb
source organism Human papillomavirus type 16
molecule tags Transcription
molecule keywords Regulatory protein E2
total genus 66
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00508 PPV_E2_N E2 (early) protein, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.30 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2nnuA01
2.170.200.10 Mainly Beta Beta Complex Regulatory Protein E2; Chain: A; Domain 2 Regulatory Protein E2; Chain: A; Domain 2 2nnuA02
1R6NA 2JEXA 1QQHA 1R6KA 2JEUA 2NNUA 1DTOA 1TUEB
chains in the Genus database with same CATH superfamily
4AQYB 1GO3F 3DGEA 2DWEC 3EHBB 4MTGA 4UCRA 4B3SB 1WPXA 3N2KA 3JATA 2F43G 1L1FA 3OTOB 3F7YC 2AHYA 4ZI7B 2N05A 4LF6B 4OX9O 2IBZH 2PUSA 1XEQA 2OCCC 1NH2D 1H2GA 1P84F 1R6NA 4NTXA 3VQVA 4LFAO 4MTOA 3QG5A 4DR2O 3CYOA 1VQOV 5J9PC 3OR7C 5LMUB 2L6LA 1XBLA 3PN1A 5IYBO 5CA3A 4DR6O 4FM1A 1URFA 3KCXA 3O65A 2VQEO 5KUMA 3B09A 4X1IA 1JFFA 4TOIA 5A2QN 1R3IC 1N4CA 1WJZA 4FFBB 4DV1O 3ZMUA 3W7XA 2UXCB 4LC1A 1N34O 4P9PA 1PL0A 4HNAA 2CTWA 4MVOA 2BTQB 2FYUH 2Q8VA 2QWOB 4OX9B 1SERA 1L0NH 4FLZA 2XHBA 4DUYB 4JAUA 4RUFA 3FKSG 3OEHG 3B2EE 5B3SC 4GLXA 1IBMO 1SQVH 3LDDA 3THOA 1A32A 3ETEA 1D5AA 4H37A 4J10A 4TQFA 2JGUA 2HR3A 2Q7EA 1SKVA 3WFVA 5EBWC 4TQDA 4FLVA 3K59A 1FYJA 2ZDIC 4I7ZB 1I94O 2EBOA 2IW5A 2IU3A 1GN3A 3BFRA 4X8AA 2OTJV 4O4HA 1Y76B 3TK1A 1Y4MA 3N2KB 1AP5A 2ZKOA 4R6ZA 3ZRWB 4UV9A 4F6EA 4XDKA 4PA3A 5B1NA 3ZRXA 1M57B 2MW2B 5E79Z 3ABLB 3KG2A 2CTQA 3W7TA 1VQMV 1YVWA 3ZRVA 2CDYA 5JJJB 3LSUA 4HAMA 4JYCA 2OT5A 4I5SA 3K5MA 5J2UA 1PNMA 2P4VA 4BIOA 1NS1A 1AR4A 2Y69B 5BMVA 3CMEV 3JAWA 2LFRA 3T4ZA 1JVMA 3MHHC 4ZBMA 1IDSA 4X1IB 3ZMZA 1RM1C 3RYIB 2OIGA 3ABKC 1NKDA 1MA1A 4JF3A 4LFAB 1XILA 3OMNB 1BHAA 3ZEDA 2UU9B 2WLLB 3TGUH 3G4SV 3W7UA 4DR4B 4P2ZA 2X0LA 1AJPA 4AHCA 2CH7A 2XNDG 3CC7V 1VQLV 1K5SA 3OFNG 3ZHRA 1EBOA 4YHHO 3CRRA 5GONB 4AQYO 1VQ5V 3CEIA 3ETDA 4GT1A 5EBMC 4IIJB 4HZ3A 4YIOA 3E8HA 3ZN0A 2UUBO 4DR7B 4LF5B 4JI2B 4JI3B 3HKCB 3O9OA 1FFTB 2QR4A 2QM7A 2YXYA 3RVZA 2DYSC 1W59A 3L75H 1Z2GA 4K0KB 1Q7YW 3P3PA 1R3JC 2XAGA 3D36A 1MMMA 1PKXA 3OM3B 4MTXA 3QO7A 3CB2A 1NH2B 2A7WA 1IXBA 4DV6B 5EYPA 2DN9A 1SETA 2XTAA 1V55B 2JJ1G 3MHSC 1SQBH 5BZBA 2YDEA 1IBKB 1GAXA 2PTMA 4TUYB 1QHTA 3BA8A 4JI7B 2D2CB 1BT8A 3OW2U 3CSXA 3T1YB 3S3WA 3IC9A 4N23A 1IBLB 4B3MO 2Y48A 5LP6A 1H2KA 3SJAC 4MVUA 3BAAA 4FM0A 5TISZ 5LMNB 3JCUZ 1FFXA 3AG3B 3JAWB 2CK3G 4PELA 1FFXB 2Q73A 2CE4A 3FYIB 2HJFC 4IHJB 2ZINA 1WA8A 1SA0B 1YTFB 2ITCC 3OUFA 2W0FC 1Y6XA 2VS0A 5E1AC 2JK5C 4FZ1A 4X65B 2ZNIA 2P4KA 1P4RA 2A79B 3JD1A 3I56V 1KC8W 5H2FZ 2DW4A 4B7EA 4RQFA 4E2LA 3E89A 1FJGO 3MD0A 4L87A 1UFIA 1KB9F 3ZN1A 4B3TO 1OCZC 1E79G 3J81N 1BL8A 1ZWIC 1JJ2U 4IL6Z 4CS2A 1EN4A 1NZ6A 2UUCB 4E4EA 2YC0A 1XHZA 2R9IA 3HKEB 5IYZB 2QM4A 2YUAA 4ZKIA 2ZXWC 2RDCA 1FPOA 1H2MA 1KKCA 3MDSA 1KP2A 3AG2C 2CGOA 5FPRA 4JI3O 2Q0OC 2AXTZ 2B1GA 4OPAA 3RGBA 1J5EB 1H8HG 2GTAA 4Z1MG 1YHQV 4DV7B 3LSSA 2GHYA 4RO2A 4DR1B 1LR1A 2ZR2A 2ADQB 1M57C 1FS0G 3T4DA 3F5TA 1HR0B 4B3SO 2F4VO 3CCMV 2UXDO 5EYPB 1RFYA 1K8AW 1ZSPA 4R7CA 3OUSA 1Q8IA 1FJGB 4J7ZA 4LF5O 5K1XA 3ZBHA 1M9NA 2ZR3A 3E83A 1XMOB 4LF8O 3CXCU 1VP7A 1BE3H 1P7BA 3HB3B 2WLHA 1NQTA 2JJ2G 2OCCB 3K3WA 4DUYO 4J7JA 2QDOA 4NVPA 5IYDO 1QCEA 5EK0A 3K0DA 1DLBA 1XMQO 2PY5A 1H38A 2Q68A 1HNZO 2ZM6O 4MVZA 1Q6HA 5L3EA 3H1IH 3UQ8A 1TAEA 2BTOA 3GB7C 2QWNB 1QVGU 2BSKB 2HLDG 3E86A 3JYCA 3ZX6A 4H44B 3U11A 1U96A 4CH6A 3A0BZ 4GX2A 2Q7GA 2JVDA 5EC1C 2UUAO 4DW1A 4XDJA 1M90W 3EVKA 3KCYA 1S5JA 4X64O 2PI5A 1GN4A 5H6QA 4XDLA 1Q43A 2E3CA 2QTOA 2GSMB 3HKEA 4YJ2B 1Q82W 3JALB 4FIPC 4DR3O 1FXHA 2HHHB 1MSDA 5B1OA 4U7OA 2DOSA 1JA8A 5JH7A 1W2BU 4IYHA 1XDCA 1DGSA 4FK5C 4GX1A 1W0KG 2OCHA 5EC2C 4JAVA 4CBCA 1IBMB 4DV4B 2M6YA 3X2QB 3JAKB 3A2FA 4GKKB 4UUJC 2KB1A 2Q67A 4JGSA 3L9DA 2E74B 3H1JH 1VQNV 4MVQA 3ZS8C 3G6BA 2H8PC 4EFBA 2JEUA 2DQ3A 1S5HC 1GM8A 2KSDA 4JI5O 3ASNC 3S3XA 1NR1A 5ITZB 4WFAV 4DXWA 3E22A 2Q7HA 2BOCC 4LWSB 2YIBA 3ZRWA 3E22B 2VQFB 3SJBC 3BABA 4G2KA 2RN9A 4B7KA 2WLNA 3CCUV 1H2NA 4Q20A 3UCSC 3QO8A 5CB4B 2E75B 4LR3A 4K3AA 2KQXA 5CB4A 4DV0B 3KKYA 1GN6A 2AGAA 1VQ7V 3HKBA 2B1IA 4DR4O 1GK9A 2WPDG 2W6IG 4FLWA 3OGCC 4EKWA 3RYCA 1YXBA 4BW5A 1M1KW 1HNZB 1Z5WA 2YIDA 5BXZA 1GM9A 4IHJA 3DC6A 1N32O 1FXKA 2VRZA 4I50B 4JI5B 1SESA 2YIAA 5KHHA 4KFMA 3ABUA 2CUGA 4X64B 3KZIZ 2JS5A 4DV5O 3CC4V 2YSUB 4YY3O 3MAQA 1JX9A 2B9ZA 1XL6A 4CZZA 1VEWA 4JTAB 5KAFZ 4GCZA 5IJ0A 5LGTA 5C8YA 1HNXO 3WG7C 5JH7B 3AG4B 3RVYA 5IY5B 1Q5OA 3VQXA 1WP8A 4DV6O 4DV2O 5IY5C 2IH3C 2XAFA 4J7KA 3SJCC 2HHHO 3A0RA 1AI7A 3HKCA 2XAJA 3K08A 3SYOA 1XNQB 3LDEA 1QLEC 1DTOA 3VQYA 2GDSA 1OCRB 1G6UA 4CH5A 5J2TB 1YZBA 4UXNA 3QVNA 3U10A 5LBQA 1KUQA 3M8AA 1Y67A 1I08A 4KUMA 5IWAO 5L3BA 1S0VA 1S76D 4TUYA 4RAIA 3T1HB 4MT8A 3TXQA 5KHJA 5LYJB 3FAVB 2O57A 1R1BA 1VQ8V 1J95A 3SR2C 3CMAV 2P06A 1AVMA 4CC6A 4LF6O 1R73A 4BWAA 5JWPA 1XMQB 4CH3A 1CXZB 3SPIA 4MW3A 4WCEV 1HW7A 4DRXA 1PNLA 1N32B 2X7RB 2HP8A 5LP6B 2HVKC 4WBNB 4U3JB 2GUZA 3ZMVA 1H2SB 3C3TA 5KLVH 3E8BA 4PA7A 4U3JA 2M7WA 4H0LB 4FLTA 1NVPD 4LBEC 1BMFG 1TGOA 1TVKA 2IJJA 4ZI7A 4GKKO 3L73H 4F6RB 2F93B 4O2AB 4ICGA 1GH6A 1OCOC 1NBMG 4DV3B 1R6KA 5LGUA 3D8CA 1US6A 4DR2B 1JPXA 5C93A 1R3LC 4JI0O 2P90A 4KL1A 5B1AC 5IE9A 5L3GA 3RW0A 4JI8B 1EZVH 1DF5A 4P30A 2Q4PA 3NR7A 3CRAA 4NXNO 1WB7A 1L8DA 2OIEA 1TUBB 4TV8A 5GTHZ 4NXMO 5B1BB 4HNAB 1AJNA 1FXVA 3U0ZA 5IYZA 1WPBA 2JGDB 2BTQA 3D3QA 5CA1A 3EFFK 1CP9A 5LGNA 1FKAO 1OCCB 1IBLO 2UUBB 4JYYA 2YEVB 3CCQV 5JQGB 4J41A 3APQA 2A3QA 3L72H 4NKGB 2P6JA 3F7VC 2ZIOA 3JARB 3RYHA 1VMGA 5B5EZ 2PF4E 2B5UA 1LUVA 2LFSA 4WF9V 1VF6A 3T1HO 1I5YA 5KX5B 3APOA 5FLXN 4X88A 2P22C 4DV7O 2ODMA 4FZ0A 1OJHA 3UKMA 2RMKB 1N36B 5K1PA 4EB6A 2DJVA 1OCZB 2YXHA 2QWQB 4GKJO 4ZOLA 1YI2V 1NTKH 2QWRB 3ZHVA 1ENVA 4J9YB 1QLEB 1HNXB 3ZHQA 3FD9A 2GUZB 4Q6GA 3JSNA 2YS8A 5EIBD 2F1MA 4OGQB 1M5IA 1WNSA 1L0LH 1MOFA 4NYKA 1NU1H 3D3IA 2WLJA 1ZUQA 3K5OA 2WLIB 1PL4A 2QWPB 4PJ0Z 4G27B 3AG1C 3FB6C 2DWDC 2PYJA 3T2MA 1FD9A 3CRCA 3E8FA 2QKSA 4JI1B 1GKFA 1MSWD 1ROPA 4L8JA 2Z0AA 2K9PA 5LP6C 1F23A 4UB8Z 5AG2A 5CBGA 5BMVB 5BR8O 2NR5A 4RQEA 3I55V 4I9WA 4I55B 1IBKO 2LW1A 4J9ZB 5JVDB 2AHZA 3K04A 4LF7O 3CCSV 3ICXA 4NXMB 1XL4A 4NB5A 1JMKC 3BEHA 2JDIG 2EIKC 2QM8A 4MVMA 1TUBA 3K5NA 3ETGA 1XUQA 3J7AU 4DUZO 5EBLC 1BS3A 2CH7B 4B08A 1KD1W 4YJ2A 2JGDA 2WLLA 4X66B 1ZL8B 5LMUO 1GN2A 1F4MA 3CWBH 4DV0O 3DXRB 4O4LA 3CCRV 4DR6B 3CC2V 4K35A 4TV9B 2KG7B 4LNUB 1IURA 4IIJA 4ASUG 3OR6C 4FFKA 3TCUA 1IZ3A 5GONA 2WLMA 1O9HA 3JAKA 1K92A 1ZLZA 3HPLC 1Q86W 1GTOA 1WLEA 1RPRA 4UVCA 5EZYA 1N8RW 4ABMA 5ITZA 1QR8A 5LXTB 3AK1A 1VARA 1XHXA 4JASA 3WB0A 4EB6B 4DV4O 1PPJH 4O4JB 5LXTA 4LP8A 1XQ8A 3FB5C 4X62B 1V55C 4O4JA 4I4TB 1VQ9V 4DW0A 1SRYA 4O4HB 3B4SA 5LHGA 2Y4TA 3BVOA 2CTPA 4PA4A 4NTYA 4JYAO 1EZJA 4DR5O 1B04A 1SQPH 3B8MA 3UO2A 1EN6A 1TA8A 4PI2A 4QPJA 4O2BB 4BIUA 1JJOA 4TWKA 3RYCB 1J5EO 1HDJA 4PDVA 2LW7A 2IM9A 3QF7A 1KECA 2MK3A 3CX5F 4D7SA 5KHGA 4R8CA 3CJHA 3N27A 4B3MB 2ZNJA 5IDJA 2FKXA 4GKJB 1R6TA 1S72V 1WA8B 3P32A 4U7NA 4JAAA 3CCJV 4EFEA 5CA0B 3SPJA 4O2AA 3SYQA 3D36C 3LNNA 3ASOC 4BIZA 1KP3A 1M56C 3ABTA 4CS4A 1YITV 3W7WA 2ILMA 5LA6A 3JD3A 3FB8C 3CD6V 1ZL8A 3CPWU 2H3OA 4YY3B 2ZDIA 1IVSA 5LHIA 2OYQA 2XAQA 1Y74B 4EEQA 5LOVA 4LNUA 1Y74A 2X6AA 4TV8B 2AZ2A 4LH7A 1B06A 3K9SA 3L71H 4LF9B 1AROP 1EN5A 1VF6C 2L35A 1YEWA 4DV3O 3OTFA 4JV5B 2W6JG 1N0JA 3OGIB 1WN7A 3ZCCA 3AG7A 5HFMA 1QNMA 2GV9A 4H33A 4X1KB 4ZHQA 4AI8A 1BHBA 2Q69A 3AG2B 2ZE6A 3ABMB 4YHHB 4DR1O 3RYFA 2EINC 3LNMB 4NTWA 2OTLV 3VQWA 2P7TC 1RPOA 3E8GA 2UU9O 2YI8A 2LP7A 3AEIA 3OAAG 5LL6Y 3SPCA 3JASB 3T1CA 5H5NA 3CHXA 5FNVB 2JIZG 1OCCC 1AI4A 1K4DC 1JOYA 4JI2O 4I9QA 4DRXB 1K5QA 4JI8O 5JCOC 2EINB 1PNKA 2UXNA 3P30A 3JATB 3BCCH 1HNWO 2EILB 4MVSA 4JYBA 5KHIA 5CA0A 2EIMB 2BSKA 1K4CC 2A0LA 4UVAA 4F6RA 2VWJA 2NLJC 3K0GA 1LNQA 3CS5A 3N2GB 5KA5A 3N2GA 1QBZA 1B6QA 2ZE7A 1OCOB 4FVMA 4PDRA 5F2VO 4MSWC 3ZMSA 1QU7A 1PM9A 4NR1A 4UV8A 4BR6A 4MS2A 1NT2B 2E76B 5KMGB 4IYIA 2XOKG 1JCHA 4UCVA 4PA6A 1SQGA 2N74A 4OXSA 1N33O 1SQXH 2ITDC 3IFXA 3ML0A 5JCOA 1GMGA 5DECA 2UXBO 2FMLA 3ASOB 4UB6Z 1Q90D 2YICA 3JSLA 1BSMA 4JI7O 4O4LB 3L70H 3OD4A 1AI6A 3RYHB 2CTRA 1XNQO 5L3DA 2KG7A 2C2AA 4X1KA 4ZHQB 3H1KH 3B40A 4UCUA 2RQ6A 4LCUC 1NVPB 4TSFG 3QNEA 3JARA 2QKCA 3VOUA 5KX5A 4DO2A 4GX5A 3UO3A 4W4KA 2Z3YA 2BE3A 2F23A 2WA3A 1N36O 3TJTA 4WFEA 2EJ7A 1YDXA 1HNWB 3SGIA 3LUTB 3Q4HA 3T1YO 3IJ4A 2Q9LA 4MVRA 4DV1B 2LJ2A 3H1LH 4FJCC 3ZHSA 3ABLC 4MW8A 4ZOLB 1KBHA 4JPRA 2RCVA 3J80N 2Z5UA 1H8EG 4FLYA 4X66O 4LF4O 4J80A 1QQCA 4J11A 4F4LA 2OWOA 4LWSA 5L3FA 2QSAA 4GYCB 3SYAA 4AILC 3WB1A 3ABMC 1VQKV 2F4VB 4DYLA 2WLIA 2EJRA 3OE7G 3C90A 4LFCB 4QNHB 1RP3B 1KQSU 2ZE5A 4GX0A 1AI5A 3OTOO 2HFEC 1NJIW 4LFBB 3STZC 4G28B 4HYOA 1RSOB 1GM7A 1WB8A 3JD0A 5B66Z 3K79A 1RSOA 1V54C 3CRMA 3L74H 4JZGA 3K58A 1SA0A 2EIMC 4I50A 3GWOA 1DF4A 4KHPO 3W7SA 1RM1B 2QTSA 4X65O 4DK1A 3UT5A 4QE9A 5LA6B 1THZA 3G6EV 2EZOA 1T5EA 4LF7B 3AG4C 2ZXWB 1HR0O 5FPOA 1E1RG 1K3EA 1TUEB 2PZSA 4QIWF 2UXXA 4FMTA 2XUMA 4BW9A 4JZ2A 3AK3A 2EULA 2P67A 3CRQA 2WSSG 3G80A 2EIJC 3F5WC 3QO5A 2DYSB 1K33A 1K9MW 2ZT9B 2LGWA 4K8XA 2IH1C 3OEEG 3WB2A 1ZX3A 4OPHA 2QGNA 2Q5ZA 2UUAB 4JYAB 4JI0B 3BPZA 1MZFA 5J2TA 4O4IA 3ZMTA 3CXHF 1ORQC 1O9GA 5KAIZ 4KP4A 1AR5A 4QGPA 1WP7A 3LDCA 3RYFB 4PV1B 1HWYA 3WG7B 3K9AA 4LF4B 4LH6A 3IC7A 1Q6UA 1P49A 4D7TA 4I4TA 1B3QA 5LYJA 2Y0PA 2QJ1A 1N0NA 2IJIA 1Z5VA 3K57A 2HJDA 4FPPA 1UPGA 3FAVA 2WAMA 1XNRO 4R50A 2QA4V 2FB5A 3QTCA 5CBHA 2Y0IA 1NI8A 3EXAA 4DR5B 1COWG 2XAHA 1HP8A 2RNBA 4TT3G 4IGGA 3M99B 1W0JG 1M56B 1AJQA 2G38A 1TVKB 3FB7C 4J42A 4JI4B 2A9HA 1QR9A 1NR7A 1XI1A 1Q3EA 2FTKA 1CPYA 1LUWA 2DYRC 1F51A 2VQFO 1MG1A 3ETQA 4NXNB 4DV5B 5IYCO 4C7UA 5H9CA 4YXWG 4DR3B 1NTMH 2JRIA 2E5LB 3JAMN 2GBOA 4RUEA 4U3FH 1YIJV 2HEPA 4X1YA 5IT9N 2W0XA 3SDLA 4YJ3B 5C8YB 3DTUB 4X1YB 4X89A 3ZIAG 1NTZH 4P9OA 3GVMA 4B3TB 5BY1A 3ASNB 4X9QA 3RWRD 2ZD9A 4PDLA 3P3NA 2EIKB 2R70A 4FFBA 3BA9A 5LOVB 4PI0A 3RN4A 2EIJB 4UCTA 1YJ9V 4Z2WA 1QQHA 1EFRG 2ATKC 3BRCA 1KU9A 2AW9A 1JR9A 2R9AA 2V7QG 4CC5A 2QEXV 1YJWV 5B3SB 4O4IB 4FLUA 4YIPA 1PD3A 2V1DA 5JQGA 4DUZB 1VQPV 2CGNA 4W4LA 4DK0A 1OZ0A 1EM1A 2EX3A 2ARHA 1SF9A 2YEVA 1E1QG 3CCVV 1X59A 1AR1B 1F7YA 2ZE8A 1AP6A 5CN0A 3K5LA 1I94B 4XBFA 3CCEV 1YSCA 1Q6IA 1KKDA 1SQQH 1R3KC 2Q0AA 3G67A 4PD4F 1MABG 3JD2A 3K06A 5LHHA 2DE0X 3Q4HB 5DM6V 2FL4A 2ETNA 2Q6AA 3JASA 4WFGA 1VF5B 2EZPA 1SC5B 2N04A 2R9RB 2UUCO 1K34A 2KKWA 2EILC 1MZEA 3ZHTA 2GTSA 4IT5A 3OMAB 2HVJC 4WBNA 2HG5C 5DEDA 1WAZA 3STLC 1VF7A 3CP1A 1Y76A 1XNRB 5FL7G 4HBNA 3A0HZ 3AG3C 2XT9A 3B77A 1Y66A 3FYEB 3E2EA 1M93A 3HKBB 3IGAC 3HKDA 4PA9A 3DC5A 4WFBV 3ZRSA 3SYPA 5JJNB 2XASA 1MNGA 3B8NA 4I0XA 1VIBA 2LGQA 4YJ3A 2ZIMA 5JVDA 4CS3A 1N33B 3ZJZA 4QPKA 3TXSA 3A8TA 3H9VA 5JJEB 1YJNV 4KXRA 3SYCA 3H01A 1YF2A 1JFFB 4D6TH 1SZTA 1YTFD 3CE2A 3JALA 2F95B 5KMGA 1AILA 2QE7G 1PP9H 1BCCH 3DSQA 3SJQC 4CH4A 1IXMA 5L3CA 1K7DA 2X6CA 5KA6A 3H1HH 4X20A 3R65A 5CA1B 4QJFB 3PJSK 2UXCO 1PV0A 1ZAUA 4TV9A 1M4UA 2IJKA 1Q81W 5H6RA 1I0HA 2E5LO 3DXRA 1SZXA 2DQ0A 4QE7A 4DR7O 1G1XB 4ZIBA 4JTDB 1V9PA 3I5DA 2LO1A 4BAYA 5KHKA 2F66C 4K8ZA 1XOUA 2YIBD 2H94A 2IJHA 1K97A 3HR0A 1QVFU 1G4YB 1D2DA 1XMOO 4LF8B 4FLXA 3RBZA 5IJ9A 1K73W 1IX9A 4KHPB 3SPGA 3LSQA 4JI6O 2AZ0A 3FFQA 2R72A 1F4NA 3JD4A 2CAZC 1FAFA 1I5XA 1CEZA 4UVBA 2ZCEA 1XREA 2ZM6B 4GZRB 2BOBC 4RWUA 4X62O 4JTCB 4JV5O 5B1BC 1SQFA 1GRJA 5KUKA 4LFBO 4GUNA 1JQ0A 3UM7A 4FM2A 4LFCO 1X4TA 1S5LZ 5LMNO 1V54B 3VBBA 4B3RB 3M7MX 3CCLV 4PDMA 5GTIZ 1P7GA 3HKDB 5B1AB 4O2BA 4JI4O 5HFLA 4Z1VA 3C3SA 2YXLA 5J2UB 4I0XB 2JEXA 3OT7A 5CBFA 4WFFA 2NNUA 2BCCH 2WWWA 5D5PA 4I55A 3R66A 3CJHB 3FX7A 3ZHUA 3NXSA 5IWAB 2DMXA 2ADPA 2QKAA 4UCOA 5A9GA 3WU2Z 1FXKB 3K03A 3RYIA 5EIBC 3TETA 3AG1B 1D5NA 2PGGA 1AB3A 1DK1A 5IJ0B 1FXKC 3JCZA 3UT5B 1U97A 2K1EA 2V4DA 4K0KO 1VQ6V 5BR8B 4MTFA 3AK2A 4X20B 2WLKA 4A5UB 1KMIZ 2HKOA 3RT3C 3OMIB 5GW7A 2UXBB 1BQZA 4DV2B 2RJZA 1S3JA 2D3OW 2IU0A 5DN6G 2PI4A 3IAYA 2P5OA 1UJWB 1SS3A 4JI1O 1VQ4V 4UFZA 5D5QA 1G8MA 1H2LA 2PYLA 3RFRA 1BGYH 4WFHA 3G71V 5IJ9B 5EZYB 1I7FA 4UCSA 2ZQMA 1ZTEA 5CMUA 1OHHG 1BQ0A 4LF9O 2A06H 2DYRB 2NN4A 1OCRC 1KYOF 1OV9A 2Y4UA 1S77D 1N34B 3E35A 3BY6A 1BZKA 2JS3A 4PHZA 3X2QC 1QLNA 4N21A 2VQEB 2VWKA 2YI9A 5FNVA 3ABKB 2WA4A 3SPHA 2X6BA 2UXDB 4JI6B 3BHPA 1YCIA 2LQTA 4B3RO 3GWKC 4H13B 2Y69C
chains in the Genus database with same CATH topology
4KP4A 1GO3F 3DGEA 3CCRV 4GX2A 2DWEC 3LDCA 3EHBB 3CC2V 1HWYA 3WG7B 4MTGA 5EC1C 1WPXA 3K9AA 3IC7A 2F43G 4ASUG 3OR6C 3TCUA 1L1FA 4XDJA 1M90W 2WLMA 3F7YC 2AHYA 2PI5A 1K92A 5H6QA 4XDLA 3HPLC 2IJIA 1Q86W 1GTOA 2OCCC 1NH2D 1H2GA 1WLEA 1RPRA 1R6NA 4FPPA 4UVCA 2QTOA 2GSMB 1Q82W 1N8RW 4MTOA 4FIPC 2WAMA 1FXHA 4R50A 2QA4V 3CYOA 1QR8A 1VQOV 5J9PC 5B1OA 3OR7C 4U7OA 5CBHA 4JASA 1W2BU 4LP8A 1COWG 5IYBO 2XAHA 3FB5C 4FK5C 4GX1A 5CA3A 1W0KG 5EC2C 4JAVA 1V55C 5KUMA 4CBCA 4TT3G 1VQ9V 1SRYA 3M99B 3X2QB 1W0JG 1M56B 4UUJC 5LHGA 1AJQA 1R3IC 3FB7C 4PA4A 2A9HA 2KB1A 3ZMUA 1QR9A 1NR7A 2Q67A 4JGSA 1EZJA 2FTKA 1CPYA 2DYRC 3B8MA 1F51A 3W7XA 1MG1A 1VQNV 4MVQA 4LC1A 4QPJA 5IYCO 2H8PC 5H9CA 4P9PA 4YXWG 1PL0A 2JEUA 4BIUA 2DQ3A 1S5HC 4TWKA 1GM8A 4RUEA 1YIJV 4MVOA 3ASNC 4PDVA 1SERA 1NR1A 3DTUB 1KECA 2MK3A 4DXWA 4WFAV 4X89A 4R8CA 3ZIAG 2BOCC 4JAUA 4P9OA 4RUFA 3ASNB 5IDJA 3FKSG 3ZRWA 2ZD9A 4PDLA 2EIKB 1S72V 3OEHG 5B3SC 3P32A 4G2KA 4U7NA 3LDDA 3CCJV 2WLNA 3ETEA 3CCUV 2EIJB 1YJ9V 4Q20A 4H37A 3SPJA 3QO8A 1QQHA 1EFRG 3SYQA 2ATKC 3ASOC 4BIZA 2HR3A 1KP3A 1M56C 3ABTA 1YITV 2V7QG 3W7WA 3WFVA 5EBWC 2QEXV 1YJWV 5B3SB 3JD3A 1PD3A 2V1DA 1VQ7V 2B1IA 3FB8C 3CD6V 1GK9A 2WPDG 2W6IG 2ZDIC 1VQPV 3CPWU 1OZ0A 3OGCC 4EKWA 2EBOA 2ZDIA 2IW5A 4BW5A 1M1KW 5LHIA 2IU3A 2YEVA 1E1QG 3CCVV 4X8AA 2XAQA 1AR1B 1GM9A 2OTJV 3TK1A 1Y4MA 5CN0A 1FXKA 4XBFA 3CCEV 2X6AA 1YSCA 4R6ZA 1SESA 3ZRWB 1KKDA 4UV9A 4KFMA 4XDKA 3ABUA 4PA3A 1R3KC 5B1NA 1AROP 3ZRXA 3CC4V 2YSUB 1JX9A 1MABG 1M57B 3JD2A 3K06A 5LHHA 3ABLB 5DM6V 2W6JG 3KG2A 1XL6A 2Q6AA 4CZZA 3W7TA 4WFGA 4JTAB 1VQMV 2EZPA 4GCZA 3ZRVA 4HAMA 5LGTA 4JYCA 2OT5A 4I5SA 3ZCCA 2R9RB 3WG7C 1PNMA 5HFMA 1K34A 3AG4B 3RVYA 4H33A 2EILC 1BHBA 2Q69A 5IY5B 3AG2B 2Y69B 3OMAB 3ABMB 3CMEV 2EINC 2LFRA 3T4ZA 2HVJC 2HG5C 1JVMA 3LNMB 2OTLV 3MHHC 4ZBMA 3ZMZA 2P7TC 1RM1C 1RPOA 3E8GA 3ABKC 3STLC 5IY5C 1NKDA 3CP1A 2IH3C 2XAFA 2LP7A 5FL7G 4JF3A 3A0RA 1AI7A 3AEIA 3OAAG 3OMNB 3SPCA 2XAJA 1BHAA 3K08A 3AG3C 3SYOA 3B77A 2WLLB 3T1CA 1Y66A 3FYEB 3G4SV 3LDEA 1QLEC 1DTOA 3W7UA 3E2EA 4P2ZA 1OCRB 2X0LA 1AJPA 3IGAC 2XNDG 4PA9A 4UXNA 3ZRSA 4WFBV 3CC7V 2JIZG 1VQLV 1OCCC 3SYPA 5LBQA 2XASA 3B8NA 1AI4A 1K4DC 1JOYA 1K5SA 3OFNG 1EBOA 4KUMA 1K5QA 3ZJZA 4QPKA 5L3BA 1S0VA 1YJNV 1VQ5V 3SYCA 1S76D 2EINB 3ETDA 4GT1A 4RAIA 1PNKA 3H01A 5EBMC 2UXNA 3P30A 1SZTA 4MT8A 1YTFD 2EILB 4MVSA 4HZ3A 4JYBA 3E8HA 3ZN0A 2EIMB 2QE7G 1K4CC 1VQ8V 1J95A 3CMAV 3SJQC 1FFTB 2A0LA 1IXMA 4UVAA 1R73A 1K7DA 2QM7A 5L3CA 3RVZA 2DYSC 2NLJC 3K0GA 2X6CA 1LNQA 5KA6A 1Q7YW 1R3JC 2XAGA 3D36A 3R65A 1PKXA 3OM3B 4MW3A 4MTXA 3SPIA 3PJSK 4QJFB 4WCEV 1PNLA 5KA5A 3QO7A 1QBZA 2X7RB 1B6QA 1NH2B 2IJKA 1Q81W 2HVKC 5H6RA 1OCOB 4QE7A 2DQ0A 4PDRA 3ZMVA 4MSWC 1SETA 4JTDB 3ZMSA 1V55B 3E8BA 4PA7A 4BAYA 2M7WA 2JJ1G 3MHSC 4UV8A 5BZBA 4MS2A 4LBEC 1NVPD 2H94A 1BMFG 2IJHA 1K97A 1QVFU 1G4YB 2XOKG 1JCHA 2IJJA 4PA6A 3RBZA 4OXSA 1K73W 2ITDC 3IFXA 1OCOC 1NBMG 3ML0A 3OW2U 3SPGA 1GMGA 1R6KA 3LSQA 3ASOB 5LGUA 4N23A 1JPXA 5C93A 2Y48A 1F4NA 1R3LC 3JD4A 1AI6A 1I5XA 2P90A 4MVUA 1CEZA 4UVBA 5L3DA 2C2AA 5B1AC 5L3GA 3RW0A 3AG3B 1DF5A 2BOBC 4LCUC 1NVPB 4TSFG 4P30A 2CK3G 3QNEA 4PELA 4JTCB 3FYIB 3VOUA 2HJFC 4DO2A 4GX5A 5B1BC 2Z3YA 1YTFB 2ITCC 3OUFA 5KUKA 2W0FC 1JQ0A 5E1AC 2JK5C 4WFEA 5B1BB 3UM7A 1AJNA 1FXVA 1V54B 3LUTB 3VBBA 1P4RA 2A79B 3JD1A 3I56V 1KC8W 4MVRA 3CCLV 3EFFK 4PDMA 1CP9A 5LGNA 2DW4A 1OCCB 4FJCC 5B1AB 2YEVB 3CCQV 5HFLA 4RQFA 3ABLC 4MW8A 4E2LA 3E89A 4JPRA 2Z5UA 1H8EG 3MD0A 2JEXA 2P6JA 5CBFA 4WFFA 3F7VC 2NNUA 2WWWA 4L87A 3ZN1A 4F4LA 5L3FA 1OCZC 1E79G 1BL8A 1ZWIC 1JJ2U 3NXSA 2B5UA 3SYAA 2LFSA 4WF9V 1FXKB 3K03A 1I5YA 3TETA 3AG1B 4X88A 3ABMC 2R9IA 1VQKV 4ZKIA 2ZXWC 1FXKC 3UKMA 2WLIA 3JCZA 1KP2A 3AG2C 2EJRA 3OE7G 1OCZB 2K1EA 2B1GA 4QNHB 1H8HG 4Z1MG 1KQSU 1YHQV 1YI2V 3LSSA 2GHYA 4GX0A 4RO2A 1VQ6V 1AI5A 4MTFA 1NJIW 2HFEC 2WLKA 2ZR2A 3STZC 4G28B 2HKOA 1M57C 3OMIB 1ENVA 4J9YB 1FS0G 5GW7A 4HYOA 3T4DA 1QLEB 1GM7A 1S3JA 3JD0A 3CCMV 2D3OW 2IU0A 5DN6G 2PI4A 3K79A 1V54C 1K8AW 1UJWB 2EIMC 1MOFA 4R7CA 3GWOA 1DF4A 3D3IA 3OUSA 1VQ4V 2WLJA 3W7SA 1G8MA 1RM1B 2WLIB 4QE9A 4G27B 3AG1C 4WFHA 3G71V 3FB6C 2DWDC 1THZA 3E83A 1M9NA 2EZOA 2ZR3A 3T2MA 3AG4C 3G6EV 3CXCU 3E8FA 2ZQMA 2QKSA 2ZXWB 1GKFA 1P7BA 1E1RG 3HB3B 1K3EA 2WLHA 5CMUA 1MSWD 1ROPA 1TUEB 1NQTA 2JJ2G 1OHHG 2OCCB 2UXXA 4FMTA 1F23A 3K3WA 4QIWF 5CBGA 4RQEA 3I55V 2P67A 2DYRB 4I9WA 5IYDO 2WSSG 1QCEA 5EK0A 4J9ZB 3K0DA 2EIJC 3F5WC 3QO5A 2DYSB 1OCRC 2AHZA 1DLBA 1K33A 3K04A 3CCSV 1K9MW 1XL4A 2IH1C 2Q68A 1H38A 1S77D 3E35A 3OEEG 3BY6A 4MVZA 3BEHA 2JDIG 2EIKC 5L3EA 2QM8A 4MVMA 3ETGA 3X2QC 1QLNA 3GB7C 4N21A 5EBLC 3ABKB 1QVGU 3SPHA 1KD1W 2X6BA 2HLDG 3ZMTA 2WLLA 3E86A 3JYCA 1ORQC 2Y69C 1F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6N A;  2JEX A;  1QQH A;  1R6K A;  2JEU A;  2NNU A;  1DTO A;  1TUE B; 
#chains in the Genus database with same CATH topology
 4AQY B;  1GO3 F;  3DGE A;  2DWE C;  3EHB B;  4MTG A;  4UCR A;  4B3S B;  1WPX A;  3N2K A;  3JAT A;  2F43 G;  1L1F A;  3OTO B;  3F7Y C;  2AHY A;  4ZI7 B;  2N05 A;  4LF6 B;  4OX9 O;  2IBZ H;  2PUS A;  1XEQ A;  2OCC C;  1NH2 D;  1H2G A;  1P84 F;  1R6N A;  4NTX A;  3VQV A;  4LFA O;  4MTO A;  3QG5 A;  4DR2 O;  3CYO A;  1VQO V;  5J9P C;  3OR7 C;  5LMU B;  2L6L A;  1XBL A;  3PN1 A;  5IYB O;  5CA3 A;  4DR6 O;  4FM1 A;  1URF A;  3KCX A;  3O65 A;  2VQE O;  5KUM A;  3B09 A;  4X1I A;  1JFF A;  4TOI A;  5A2Q N;  1R3I C;  1N4C A;  1WJZ A;  4FFB B;  4DV1 O;  3ZMU A;  3W7X A;  2UXC B;  4LC1 A;  1N34 O;  4P9P A;  1PL0 A;  4HNA A;  2CTW A;  4MVO A;  2BTQ B;  2FYU H;  2Q8V A;  2QWO B;  4OX9 B;  1SER A;  1L0N H;  4FLZ A;  2XHB A;  4DUY B;  4JAU A;  4RUF A;  3FKS G;  3OEH G;  3B2E E;  5B3S C;  4GLX A;  1IBM O;  1SQV H;  3LDD A;  3THO A;  1A32 A;  3ETE A;  1D5A A;  4H37 A;  4J10 A;  4TQF A;  2JGU A;  2HR3 A;  2Q7E A;  1SKV A;  3WFV A;  5EBW C;  4TQD A;  4FLV A;  3K59 A;  1FYJ A;  2ZDI C;  4I7Z B;  1I94 O;  2EBO A;  2IW5 A;  2IU3 A;  1GN3 A;  3BFR A;  4X8A A;  2OTJ V;  4O4H A;  1Y76 B;  3TK1 A;  1Y4M A;  3N2K B;  1AP5 A;  2ZKO A;  4R6Z A;  3ZRW B;  4UV9 A;  4F6E A;  4XDK A;  4PA3 A;  5B1N A;  3ZRX A;  1M57 B;  2MW2 B;  5E79 Z;  3ABL B;  3KG2 A;  2CTQ A;  3W7T A;  1VQM V;  1YVW A;  3ZRV A;  2CDY A;  5JJJ B;  3LSU A;  4HAM A;  4JYC A;  2OT5 A;  4I5S A;  3K5M A;  5J2U A;  1PNM A;  2P4V A;  4BIO A;  1NS1 A;  1AR4 A;  2Y69 B;  5BMV A;  3CME V;  3JAW A;  2LFR A;  3T4Z A;  1JVM A;  3MHH C;  4ZBM A;  1IDS A;  4X1I B;  3ZMZ A;  1RM1 C;  3RYI B;  2OIG A;  3ABK C;  1NKD A;  1MA1 A;  4JF3 A;  4LFA B;  1XIL A;  3OMN B;  1BHA A;  3ZED A;  2UU9 B;  2WLL B;  3TGU H;  3G4S V;  3W7U A;  4DR4 B;  4P2Z A;  2X0L A;  1AJP A;  4AHC A;  2CH7 A;  2XND G;  3CC7 V;  1VQL V;  1K5S A;  3OFN G;  3ZHR A;  1EBO A;  4YHH O;  3CRR A;  5GON B;  4AQY O;  1VQ5 V;  3CEI A;  3ETD A;  4GT1 A;  5EBM C;  4IIJ B;  4HZ3 A;  4YIO A;  3E8H A;  3ZN0 A;  2UUB O;  4DR7 B;  4LF5 B;  4JI2 B;  4JI3 B;  3HKC B;  3O9O A;  1FFT B;  2QR4 A;  2QM7 A;  2YXY A;  3RVZ A;  2DYS C;  1W59 A;  3L75 H;  1Z2G A;  4K0K B;  1Q7Y W;  3P3P A;  1R3J C;  2XAG A;  3D36 A;  1MMM A;  1PKX A;  3OM3 B;  4MTX A;  3QO7 A;  3CB2 A;  1NH2 B;  2A7W A;  1IXB A;  4DV6 B;  5EYP A;  2DN9 A;  1SET A;  2XTA A;  1V55 B;  2JJ1 G;  3MHS C;  1SQB H;  5BZB A;  2YDE A;  1IBK B;  1GAX A;  2PTM A;  4TUY B;  1QHT A;  3BA8 A;  4JI7 B;  2D2C B;  1BT8 A;  3OW2 U;  3CSX A;  3T1Y B;  3S3W A;  3IC9 A;  4N23 A;  1IBL B;  4B3M O;  2Y48 A;  5LP6 A;  1H2K A;  3SJA C;  4MVU A;  3BAA A;  4FM0 A;  5TIS Z;  5LMN B;  3JCU Z;  1FFX A;  3AG3 B;  3JAW B;  2CK3 G;  4PEL A;  1FFX B;  2Q73 A;  2CE4 A;  3FYI B;  2HJF C;  4IHJ B;  2ZIN A;  1WA8 A;  1SA0 B;  1YTF B;  2ITC C;  3OUF A;  2W0F C;  1Y6X A;  2VS0 A;  5E1A C;  2JK5 C;  4FZ1 A;  4X65 B;  2ZNI A;  2P4K A;  1P4R A;  2A79 B;  3JD1 A;  3I56 V;  1KC8 W;  5H2F Z;  2DW4 A;  4B7E A;  4RQF A;  4E2L A;  3E89 A;  1FJG O;  3MD0 A;  4L87 A;  1UFI A;  1KB9 F;  3ZN1 A;  4B3T O;  1OCZ C;  1E79 G;  3J81 N;  1BL8 A;  1ZWI C;  1JJ2 U;  4IL6 Z;  4CS2 A;  1EN4 A;  1NZ6 A;  2UUC B;  4E4E A;  2YC0 A;  1XHZ A;  2R9I A;  3HKE B;  5IYZ B;  2QM4 A;  2YUA A;  4ZKI A;  2ZXW C;  2RDC A;  1FPO A;  1H2M A;  1KKC A;  3MDS A;  1KP2 A;  3AG2 C;  2CGO A;  5FPR A;  4JI3 O;  2Q0O C;  2AXT Z;  2B1G A;  4OPA A;  3RGB A;  1J5E B;  1H8H G;  2GTA A;  4Z1M G;  1YHQ V;  4DV7 B;  3LSS A;  2GHY A;  4RO2 A;  4DR1 B;  1LR1 A;  2ZR2 A;  2ADQ B;  1M57 C;  1FS0 G;  3T4D A;  3F5T A;  1HR0 B;  4B3S O;  2F4V O;  3CCM V;  2UXD O;  5EYP B;  1RFY A;  1K8A W;  1ZSP A;  4R7C A;  3OUS A;  1Q8I A;  1FJG B;  4J7Z A;  4LF5 O;  5K1X A;  3ZBH A;  1M9N A;  2ZR3 A;  3E83 A;  1XMO B;  4LF8 O;  3CXC U;  1VP7 A;  1BE3 H;  1P7B A;  3HB3 B;  2WLH A;  1NQT A;  2JJ2 G;  2OCC B;  3K3W A;  4DUY O;  4J7J A;  2QDO A;  4NVP A;  5IYD O;  1QCE A;  5EK0 A;  3K0D A;  1DLB A;  1XMQ O;  2PY5 A;  1H38 A;  2Q68 A;  1HNZ O;  2ZM6 O;  4MVZ A;  1Q6H A;  5L3E A;  3H1I H;  3UQ8 A;  1TAE A;  2BTO A;  3GB7 C;  2QWN B;  1QVG U;  2BSK B;  2HLD G;  3E86 A;  3JYC A;  3ZX6 A;  4H44 B;  3U11 A;  1U96 A;  4CH6 A;  3A0B Z;  4GX2 A;  2Q7G A;  2JVD A;  5EC1 C;  2UUA O;  4DW1 A;  4XDJ A;  1M90 W;  3EVK A;  3KCY A;  1S5J A;  4X64 O;  2PI5 A;  1GN4 A;  5H6Q A;  4XDL A;  1Q43 A;  2E3C A;  2QTO A;  2GSM B;  3HKE A;  4YJ2 B;  1Q82 W;  3JAL B;  4FIP C;  4DR3 O;  1FXH A;  2HHH B;  1MSD A;  5B1O A;  4U7O A;  2DOS A;  1JA8 A;  5JH7 A;  1W2B U;  4IYH A;  1XDC A;  1DGS A;  4FK5 C;  4GX1 A;  1W0K G;  2OCH A;  5EC2 C;  4JAV A;  4CBC A;  1IBM B;  4DV4 B;  2M6Y A;  3X2Q B;  3JAK B;  3A2F A;  4GKK B;  4UUJ C;  2KB1 A;  2Q67 A;  4JGS A;  3L9D A;  2E74 B;  3H1J H;  1VQN V;  4MVQ A;  3ZS8 C;  3G6B A;  2H8P C;  4EFB A;  2JEU A;  2DQ3 A;  1S5H C;  1GM8 A;  2KSD A;  4JI5 O;  3ASN C;  3S3X A;  1NR1 A;  5ITZ B;  4WFA V;  4DXW A;  3E22 A;  2Q7H A;  2BOC C;  4LWS B;  2YIB A;  3ZRW A;  3E22 B;  2VQF B;  3SJB C;  3BAB A;  4G2K A;  2RN9 A;  4B7K A;  2WLN A;  3CCU V;  1H2N A;  4Q20 A;  3UCS C;  3QO8 A;  5CB4 B;  2E75 B;  4LR3 A;  4K3A A;  2KQX A;  5CB4 A;  4DV0 B;  3KKY A;  1GN6 A;  2AGA A;  1VQ7 V;  3HKB A;  2B1I A;  4DR4 O;  1GK9 A;  2WPD G;  2W6I G;  4FLW A;  3OGC C;  4EKW A;  3RYC A;  1YXB A;  4BW5 A;  1M1K W;  1HNZ B;  1Z5W A;  2YID A;  5BXZ A;  1GM9 A;  4IHJ A;  3DC6 A;  1N32 O;  1FXK A;  2VRZ A;  4I50 B;  4JI5 B;  1SES A;  2YIA A;  5KHH A;  4KFM A;  3ABU A;  2CUG A;  4X64 B;  3KZI Z;  2JS5 A;  4DV5 O;  3CC4 V;  2YSU B;  4YY3 O;  3MAQ A;  1JX9 A;  2B9Z A;  1XL6 A;  4CZZ A;  1VEW A;  4JTA B;  5KAF Z;  4GCZ A;  5IJ0 A;  5LGT A;  5C8Y A;  1HNX O;  3WG7 C;  5JH7 B;  3AG4 B;  3RVY A;  5IY5 B;  1Q5O A;  3VQX A;  1WP8 A;  4DV6 O;  4DV2 O;  5IY5 C;  2IH3 C;  2XAF A;  4J7K A;  3SJC C;  2HHH O;  3A0R A;  1AI7 A;  3HKC A;  2XAJ A;  3K08 A;  3SYO A;  1XNQ B;  3LDE A;  1QLE C;  1DTO A;  3VQY A;  2GDS A;  1OCR B;  1G6U A;  4CH5 A;  5J2T B;  1YZB A;  4UXN A;  3QVN A;  3U10 A;  5LBQ A;  1KUQ A;  3M8A A;  1Y67 A;  1I08 A;  4KUM A;  5IWA O;  5L3B A;  1S0V A;  1S76 D;  4TUY A;  4RAI A;  3T1H B;  4MT8 A;  3TXQ A;  5KHJ A;  5LYJ B;  3FAV B;  2O57 A;  1R1B A;  1VQ8 V;  1J95 A;  3SR2 C;  3CMA V;  2P06 A;  1AVM A;  4CC6 A;  4LF6 O;  1R73 A;  4BWA A;  5JWP A;  1XMQ B;  4CH3 A;  1CXZ B;  3SPI A;  4MW3 A;  4WCE V;  1HW7 A;  4DRX A;  1PNL A;  1N32 B;  2X7R B;  2HP8 A;  5LP6 B;  2HVK C;  4WBN B;  4U3J B;  2GUZ A;  3ZMV A;  1H2S B;  3C3T A;  5KLV H;  3E8B A;  4PA7 A;  4U3J A;  2M7W A;  4H0L B;  4FLT A;  1NVP D;  4LBE C;  1BMF G;  1TGO A;  1TVK A;  2IJJ A;  4ZI7 A;  4GKK O;  3L73 H;  4F6R B;  2F93 B;  4O2A B;  4ICG A;  1GH6 A;  1OCO C;  1NBM G;  4DV3 B;  1R6K A;  5LGU A;  3D8C A;  1US6 A;  4DR2 B;  1JPX A;  5C93 A;  1R3L C;  4JI0 O;  2P90 A;  4KL1 A;  5B1A C;  5IE9 A;  5L3G A;  3RW0 A;  4JI8 B;  1EZV H;  1DF5 A;  4P30 A;  2Q4P A;  3NR7 A;  3CRA A;  4NXN O;  1WB7 A;  1L8D A;  2OIE A;  1TUB B;  4TV8 A;  5GTH Z;  4NXM O;  5B1B B;  4HNA B;  1AJN A;  1FXV A;  3U0Z A;  5IYZ A;  1WPB A;  2JGD B;  2BTQ A;  3D3Q A;  5CA1 A;  3EFF K;  1CP9 A;  5LGN A;  1FKA O;  1OCC B;  1IBL O;  2UUB B;  4JYY A;  2YEV B;  3CCQ V;  5JQG B;  4J41 A;  3APQ A;  2A3Q A;  3L72 H;  4NKG B;  2P6J A;  3F7V C;  2ZIO A;  3JAR B;  3RYH A;  1VMG A;  5B5E Z;  2PF4 E;  2B5U A;  1LUV A;  2LFS A;  4WF9 V;  1VF6 A;  3T1H O;  1I5Y A;  5KX5 B;  3APO A;  5FLX N;  4X88 A;  2P22 C;  4DV7 O;  2ODM A;  4FZ0 A;  1OJH A;  3UKM A;  2RMK B;  1N36 B;  5K1P A;  4EB6 A;  2DJV A;  1OCZ B;  2YXH A;  2QWQ B;  4GKJ O;  4ZOL A;  1YI2 V;  1NTK H;  2QWR B;  3ZHV A;  1ENV A;  4J9Y B;  1QLE B;  1HNX B;  3ZHQ A;  3FD9 A;  2GUZ B;  4Q6G A;  3JSN A;  2YS8 A;  5EIB D;  2F1M A;  4OGQ B;  1M5I A;  1WNS A;  1L0L H;  1MOF A;  4NYK A;  1NU1 H;  3D3I A;  2WLJ A;  1ZUQ A;  3K5O A;  2WLI B;  1PL4 A;  2QWP B;  4PJ0 Z;  4G27 B;  3AG1 C;  3FB6 C;  2DWD C;  2PYJ A;  3T2M A;  1FD9 A;  3CRC A;  3E8F A;  2QKS A;  4JI1 B;  1GKF A;  1MSW D;  1ROP A;  4L8J A;  2Z0A A;  2K9P A;  5LP6 C;  1F23 A;  4UB8 Z;  5AG2 A;  5CBG A;  5BMV B;  5BR8 O;  2NR5 A;  4RQE A;  3I55 V;  4I9W A;  4I55 B;  1IBK O;  2LW1 A;  4J9Z B;  5JVD B;  2AHZ A;  3K04 A;  4LF7 O;  3CCS V;  3ICX A;  4NXM B;  1XL4 A;  4NB5 A;  1JMK C;  3BEH A;  2JDI G;  2EIK C;  2QM8 A;  4MVM A;  1TUB A;  3K5N A;  3ETG A;  1XUQ A;  3J7A U;  4DUZ O;  5EBL C;  1BS3 A;  2CH7 B;  4B08 A;  1KD1 W;  4YJ2 A;  2JGD A;  2WLL A;  4X66 B;  1ZL8 B;  5LMU O;  1GN2 A;  1F4M A;  3CWB H;  4DV0 O;  3DXR B;  4O4L A;  3CCR V;  4DR6 B;  3CC2 V;  4K35 A;  4TV9 B;  2KG7 B;  4LNU B;  1IUR A;  4IIJ A;  4ASU G;  3OR6 C;  4FFK A;  3TCU A;  1IZ3 A;  5GON A;  2WLM A;  1O9H A;  3JAK A;  1K92 A;  1ZLZ A;  3HPL C;  1Q86 W;  1GTO A;  1WLE A;  1RPR A;  4UVC A;  5EZY A;  1N8R W;  4ABM A;  5ITZ A;  1QR8 A;  5LXT B;  3AK1 A;  1VAR A;  1XHX A;  4JAS A;  3WB0 A;  4EB6 B;  4DV4 O;  1PPJ H;  4O4J B;  5LXT A;  4LP8 A;  1XQ8 A;  3FB5 C;  4X62 B;  1V55 C;  4O4J A;  4I4T B;  1VQ9 V;  4DW0 A;  1SRY A;  4O4H B;  3B4S A;  5LHG A;  2Y4T A;  3BVO A;  2CTP A;  4PA4 A;  4NTY A;  4JYA O;  1EZJ A;  4DR5 O;  1B04 A;  1SQP H;  3B8M A;  3UO2 A;  1EN6 A;  1TA8 A;  4PI2 A;  4QPJ A;  4O2B B;  4BIU A;  1JJO A;  4TWK A;  3RYC B;  1J5E O;  1HDJ A;  4PDV A;  2LW7 A;  2IM9 A;  3QF7 A;  1KEC A;  2MK3 A;  3CX5 F;  4D7S A;  5KHG A;  4R8C A;  3CJH A;  3N27 A;  4B3M B;  2ZNJ A;  5IDJ A;  2FKX A;  4GKJ B;  1R6T A;  1S72 V;  1WA8 B;  3P32 A;  4U7N A;  4JAA A;  3CCJ V;  4EFE A;  5CA0 B;  3SPJ A;  4O2A A;  3SYQ A;  3D36 C;  3LNN A;  3ASO C;  4BIZ A;  1KP3 A;  1M56 C;  3ABT A;  4CS4 A;  1YIT V;  3W7W A;  2ILM A;  5LA6 A;  3JD3 A;  3FB8 C;  3CD6 V;  1ZL8 A;  3CPW U;  2H3O A;  4YY3 B;  2ZDI A;  1IVS A;  5LHI A;  2OYQ A;  2XAQ A;  1Y74 B;  4EEQ A;  5LOV A;  4LNU A;  1Y74 A;  2X6A A;  4TV8 B;  2AZ2 A;  4LH7 A;  1B06 A;  3K9S A;  3L71 H;  4LF9 B;  1ARO P;  1EN5 A;  1VF6 C;  2L35 A;  1YEW A;  4DV3 O;  3OTF A;  4JV5 B;  2W6J G;  1N0J A;  3OGI B;  1WN7 A;  3ZCC A;  3AG7 A;  5HFM A;  1QNM A;  2GV9 A;  4H33 A;  4X1K B;  4ZHQ A;  4AI8 A;  1BHB A;  2Q69 A;  3AG2 B;  2ZE6 A;  3ABM B;  4YHH B;  4DR1 O;  3RYF A;  2EIN C;  3LNM B;  4NTW A;  2OTL V;  3VQW A;  2P7T C;  1RPO A;  3E8G A;  2UU9 O;  2YI8 A;  2LP7 A;  3AEI A;  3OAA G;  5LL6 Y;  3SPC A;  3JAS B;  3T1C A;  5H5N A;  3CHX A;  5FNV B;  2JIZ G;  1OCC C;  1AI4 A;  1K4D C;  1JOY A;  4JI2 O;  4I9Q A;  4DRX B;  1K5Q A;  4JI8 O;  5JCO C;  2EIN B;  1PNK A;  2UXN A;  3P30 A;  3JAT B;  3BCC H;  1HNW O;  2EIL B;  4MVS A;  4JYB A;  5KHI A;  5CA0 A;  2EIM B;  2BSK A;  1K4C C;  2A0L A;  4UVA A;  4F6R A;  2VWJ A;  2NLJ C;  3K0G A;  1LNQ A;  3CS5 A;  3N2G B;  5KA5 A;  3N2G A;  1QBZ A;  1B6Q A;  2ZE7 A;  1OCO B;  4FVM A;  4PDR A;  5F2V O;  4MSW C;  3ZMS A;  1QU7 A;  1PM9 A;  4NR1 A;  4UV8 A;  4BR6 A;  4MS2 A;  1NT2 B;  2E76 B;  5KMG B;  4IYI A;  2XOK G;  1JCH A;  4UCV A;  4PA6 A;  1SQG A;  2N74 A;  4OXS A;  1N33 O;  1SQX H;  2ITD C;  3IFX A;  3ML0 A;  5JCO A;  1GMG A;  5DEC A;  2UXB O;  2FML A;  3ASO B;  4UB6 Z;  1Q90 D;  2YIC A;  3JSL A;  1BSM A;  4JI7 O;  4O4L B;  3L70 H;  3OD4 A;  1AI6 A;  3RYH B;  2CTR A;  1XNQ O;  5L3D A;  2KG7 A;  2C2A A;  4X1K A;  4ZHQ B;  3H1K H;  3B40 A;  4UCU A;  2RQ6 A;  4LCU C;  1NVP B;  4TSF G;  3QNE A;  3JAR A;  2QKC A;  3VOU A;  5KX5 A;  4DO2 A;  4GX5 A;  3UO3 A;  4W4K A;  2Z3Y A;  2BE3 A;  2F23 A;  2WA3 A;  1N36 O;  3TJT A;  4WFE A;  2EJ7 A;  1YDX A;  1HNW B;  3SGI A;  3LUT B;  3Q4H A;  3T1Y O;  3IJ4 A;  2Q9L A;  4MVR A;  4DV1 B;  2LJ2 A;  3H1L H;  4FJC C;  3ZHS A;  3ABL C;  4MW8 A;  4ZOL B;  1KBH A;  4JPR A;  2RCV A;  3J80 N;  2Z5U A;  1H8E G;  4FLY A;  4X66 O;  4LF4 O;  4J80 A;  1QQC A;  4J11 A;  4F4L A;  2OWO A;  4LWS A;  5L3F A;  2QSA A;  4GYC B;  3SYA A;  4AIL C;  3WB1 A;  3ABM C;  1VQK V;  2F4V B;  4DYL A;  2WLI A;  2EJR A;  3OE7 G;  3C90 A;  4LFC B;  4QNH B;  1RP3 B;  1KQS U;  2ZE5 A;  4GX0 A;  1AI5 A;  3OTO O;  2HFE C;  1NJI W;  4LFB B;  3STZ C;  4G28 B;  4HYO A;  1RSO B;  1GM7 A;  1WB8 A;  3JD0 A;  5B66 Z;  3K79 A;  1RSO A;  1V54 C;  3CRM A;  3L74 H;  4JZG A;  3K58 A;  1SA0 A;  2EIM C;  4I50 A;  3GWO A;  1DF4 A;  4KHP O;  3W7S A;  1RM1 B;  2QTS A;  4X65 O;  4DK1 A;  3UT5 A;  4QE9 A;  5LA6 B;  1THZ A;  3G6E V;  2EZO A;  1T5E A;  4LF7 B;  3AG4 C;  2ZXW B;  1HR0 O;  5FPO A;  1E1R G;  1K3E A;  1TUE B;  2PZS A;  4QIW F;  2UXX A;  4FMT A;  2XUM A;  4BW9 A;  4JZ2 A;  3AK3 A;  2EUL A;  2P67 A;  3CRQ A;  2WSS G;  3G80 A;  2EIJ C;  3F5W C;  3QO5 A;  2DYS B;  1K33 A;  1K9M W;  2ZT9 B;  2LGW A;  4K8X A;  2IH1 C;  3OEE G;  3WB2 A;  1ZX3 A;  4OPH A;  2QGN A;  2Q5Z A;  2UUA B;  4JYA B;  4JI0 B;  3BPZ A;  1MZF A;  5J2T A;  4O4I A;  3ZMT A;  3CXH F;  1ORQ C;  1O9G A;  5KAI Z;  4KP4 A;  1AR5 A;  4QGP A;  1WP7 A;  3LDC A;  3RYF B;  4PV1 B;  1HWY A;  3WG7 B;  3K9A A;  4LF4 B;  4LH6 A;  3IC7 A;  1Q6U A;  1P49 A;  4D7T A;  4I4T A;  1B3Q A;  5LYJ A;  2Y0P A;  2QJ1 A;  1N0N A;  2IJI A;  1Z5V A;  3K57 A;  2HJD A;  4FPP A;  1UPG A;  3FAV A;  2WAM A;  1XNR O;  4R50 A;  2QA4 V;  2FB5 A;  3QTC A;  5CBH A;  2Y0I A;  1NI8 A;  3EXA A;  4DR5 B;  1COW G;  2XAH A;  1HP8 A;  2RNB A;  4TT3 G;  4IGG A;  3M99 B;  1W0J G;  1M56 B;  1AJQ A;  2G38 A;  1TVK B;  3FB7 C;  4J42 A;  4JI4 B;  2A9H A;  1QR9 A;  1NR7 A;  1XI1 A;  1Q3E A;  2FTK A;  1CPY A;  1LUW A;  2DYR C;  1F51 A;  2VQF O;  1MG1 A;  3ETQ A;  4NXN B;  4DV5 B;  5IYC O;  4C7U A;  5H9C A;  4YXW G;  4DR3 B;  1NTM H;  2JRI A;  2E5L B;  3JAM N;  2GBO A;  4RUE A;  4U3F H;  1YIJ V;  2HEP A;  4X1Y A;  5IT9 N;  2W0X A;  3SDL A;  4YJ3 B;  5C8Y B;  3DTU B;  4X1Y B;  4X89 A;  3ZIA G;  1NTZ H;  4P9O A;  3GVM A;  4B3T B;  5BY1 A;  3ASN B;  4X9Q A;  3RWR D;  2ZD9 A;  4PDL A;  3P3N A;  2EIK B;  2R70 A;  4FFB A;  3BA9 A;  5LOV B;  4PI0 A;  3RN4 A;  2EIJ B;  4UCT A;  1YJ9 V;  4Z2W A;  1QQH A;  1EFR G;  2ATK C;  3BRC A;  1KU9 A;  2AW9 A;  1JR9 A;  2R9A A;  2V7Q G;  4CC5 A;  2QEX V;  1YJW V;  5B3S B;  4O4I B;  4FLU A;  4YIP A;  1PD3 A;  2V1D A;  5JQG A;  4DUZ B;  1VQP V;  2CGN A;  4W4L A;  4DK0 A;  1OZ0 A;  1EM1 A;  2EX3 A;  2ARH A;  1SF9 A;  2YEV A;  1E1Q G;  3CCV V;  1X59 A;  1AR1 B;  1F7Y A;  2ZE8 A;  1AP6 A;  5CN0 A;  3K5L A;  1I94 B;  4XBF A;  3CCE V;  1YSC A;  1Q6I A;  1KKD A;  1SQQ H;  1R3K C;  2Q0A A;  3G67 A;  4PD4 F;  1MAB G;  3JD2 A;  3K06 A;  5LHH A;  2DE0 X;  3Q4H B;  5DM6 V;  2FL4 A;  2ETN A;  2Q6A A;  3JAS A;  4WFG A;  1VF5 B;  2EZP A;  1SC5 B;  2N04 A;  2R9R B;  2UUC O;  1K34 A;  2KKW A;  2EIL C;  1MZE A;  3ZHT A;  2GTS A;  4IT5 A;  3OMA B;  2HVJ C;  4WBN A;  2HG5 C;  5DED A;  1WAZ A;  3STL C;  1VF7 A;  3CP1 A;  1Y76 A;  1XNR B;  5FL7 G;  4HBN A;  3A0H Z;  3AG3 C;  2XT9 A;  3B77 A;  1Y66 A;  3FYE B;  3E2E A;  1M93 A;  3HKB B;  3IGA C;  3HKD A;  4PA9 A;  3DC5 A;  4WFB V;  3ZRS A;  3SYP A;  5JJN B;  2XAS A;  1MNG A;  3B8N A;  4I0X A;  1VIB A;  2LGQ A;  4YJ3 A;  2ZIM A;  5JVD A;  4CS3 A;  1N33 B;  3ZJZ A;  4QPK A;  3TXS A;  3A8T A;  3H9V A;  5JJE B;  1YJN V;  4KXR A;  3SYC A;  3H01 A;  1YF2 A;  1JFF B;  4D6T H;  1SZT A;  1YTF D;  3CE2 A;  3JAL A;  2F95 B;  5KMG A;  1AIL A;  2QE7 G;  1PP9 H;  1BCC H;  3DSQ A;  3SJQ C;  4CH4 A;  1IXM A;  5L3C A;  1K7D A;  2X6C A;  5KA6 A;  3H1H H;  4X20 A;  3R65 A;  5CA1 B;  4QJF B;  3PJS K;  2UXC O;  1PV0 A;  1ZAU A;  4TV9 A;  1M4U A;  2IJK A;  1Q81 W;  5H6R A;  1I0H A;  2E5L O;  3DXR A;  1SZX A;  2DQ0 A;  4QE7 A;  4DR7 O;  1G1X B;  4ZIB A;  4JTD B;  1V9P A;  3I5D A;  2LO1 A;  4BAY A;  5KHK A;  2F66 C;  4K8Z A;  1XOU A;  2YIB D;  2H94 A;  2IJH A;  1K97 A;  3HR0 A;  1QVF U;  1G4Y B;  1D2D A;  1XMO O;  4LF8 B;  4FLX A;  3RBZ A;  5IJ9 A;  1K73 W;  1IX9 A;  4KHP B;  3SPG A;  3LSQ A;  4JI6 O;  2AZ0 A;  3FFQ A;  2R72 A;  1F4N A;  3JD4 A;  2CAZ C;  1FAF A;  1I5X A;  1CEZ A;  4UVB A;  2ZCE A;  1XRE A;  2ZM6 B;  4GZR B;  2BOB C;  4RWU A;  4X62 O;  4JTC B;  4JV5 O;  5B1B C;  1SQF A;  1GRJ A;  5KUK A;  4LFB O;  4GUN A;  1JQ0 A;  3UM7 A;  4FM2 A;  4LFC O;  1X4T A;  1S5L Z;  5LMN O;  1V54 B;  3VBB A;  4B3R B;  3M7M X;  3CCL V;  4PDM A;  5GTI Z;  1P7G A;  3HKD B;  5B1A B;  4O2B A;  4JI4 O;  5HFL A;  4Z1V A;  3C3S A;  2YXL A;  5J2U B;  4I0X B;  2JEX A;  3OT7 A;  5CBF A;  4WFF A;  2NNU A;  2BCC H;  2WWW A;  5D5P A;  4I55 A;  3R66 A;  3CJH B;  3FX7 A;  3ZHU A;  3NXS A;  5IWA B;  2DMX A;  2ADP A;  2QKA A;  4UCO A;  5A9G A;  3WU2 Z;  1FXK B;  3K03 A;  3RYI A;  5EIB C;  3TET A;  3AG1 B;  1D5N A;  2PGG A;  1AB3 A;  1DK1 A;  5IJ0 B;  1FXK C;  3JCZ A;  3UT5 B;  1U97 A;  2K1E A;  2V4D A;  4K0K O;  1VQ6 V;  5BR8 B;  4MTF A;  3AK2 A;  4X20 B;  2WLK A;  4A5U B;  1KMI Z;  2HKO A;  3RT3 C;  3OMI B;  5GW7 A;  2UXB B;  1BQZ A;  4DV2 B;  2RJZ A;  1S3J A;  2D3O W;  2IU0 A;  5DN6 G;  2PI4 A;  3IAY A;  2P5O A;  1UJW B;  1SS3 A;  4JI1 O;  1VQ4 V;  4UFZ A;  5D5Q A;  1G8M A;  1H2L A;  2PYL A;  3RFR A;  1BGY H;  4WFH A;  3G71 V;  5IJ9 B;  5EZY B;  1I7F A;  4UCS A;  2ZQM A;  1ZTE A;  5CMU A;  1OHH G;  1BQ0 A;  4LF9 O;  2A06 H;  2DYR B;  2NN4 A;  1OCR C;  1KYO F;  1OV9 A;  2Y4U A;  1S77 D;  1N34 B;  3E35 A;  3BY6 A;  1BZK A;  2JS3 A;  4PHZ A;  3X2Q C;  1QLN A;  4N21 A;  2VQE B;  2VWK A;  2YI9 A;  5FNV A;  3ABK B;  2WA4 A;  3SPH A;  2X6B A;  2UXD B;  4JI6 B;  3BHP A;  1YCI A;  2LQT A;  4B3R O;  3GWK C;  4H13 B;  2Y69 C; 
#chains in the Genus database with same CATH homology
 4KP4 A;  1GO3 F;  3DGE A;  3CCR V;  4GX2 A;  2DWE C;  3LDC A;  3EHB B;  3CC2 V;  1HWY A;  3WG7 B;  4MTG A;  5EC1 C;  1WPX A;  3K9A A;  3IC7 A;  2F43 G;  4ASU G;  3OR6 C;  3TCU A;  1L1F A;  4XDJ A;  1M90 W;  2WLM A;  3F7Y C;  2AHY A;  2PI5 A;  1K92 A;  5H6Q A;  4XDL A;  3HPL C;  2IJI A;  1Q86 W;  1GTO A;  2OCC C;  1NH2 D;  1H2G A;  1WLE A;  1RPR A;  1R6N A;  4FPP A;  4UVC A;  2QTO A;  2GSM B;  1Q82 W;  1N8R W;  4MTO A;  4FIP C;  2WAM A;  1FXH A;  4R50 A;  2QA4 V;  3CYO A;  1QR8 A;  1VQO V;  5J9P C;  5B1O A;  3OR7 C;  4U7O A;  5CBH A;  4JAS A;  1W2B U;  4LP8 A;  1COW G;  5IYB O;  2XAH A;  3FB5 C;  4FK5 C;  4GX1 A;  5CA3 A;  1W0K G;  5EC2 C;  4JAV A;  1V55 C;  5KUM A;  4CBC A;  4TT3 G;  1VQ9 V;  1SRY A;  3M99 B;  3X2Q B;  1W0J G;  1M56 B;  4UUJ C;  5LHG A;  1AJQ A;  1R3I C;  3FB7 C;  4PA4 A;  2A9H A;  2KB1 A;  3ZMU A;  1QR9 A;  1NR7 A;  2Q67 A;  4JGS A;  1EZJ A;  2FTK A;  1CPY A;  2DYR C;  3B8M A;  1F51 A;  3W7X A;  1MG1 A;  1VQN V;  4MVQ A;  4LC1 A;  4QPJ A;  5IYC O;  2H8P C;  5H9C A;  4P9P A;  4YXW G;  1PL0 A;  2JEU A;  4BIU A;  2DQ3 A;  1S5H C;  4TWK A;  1GM8 A;  4RUE A;  1YIJ V;  4MVO A;  3ASN C;  4PDV A;  1SER A;  1NR1 A;  3DTU B;  1KEC A;  2MK3 A;  4DXW A;  4WFA V;  4X89 A;  4R8C A;  3ZIA G;  2BOC C;  4JAU A;  4P9O A;  4RUF A;  3ASN B;  5IDJ A;  3FKS G;  3ZRW A;  2ZD9 A;  4PDL A;  2EIK B;  1S72 V;  3OEH G;  5B3S C;  3P32 A;  4G2K A;  4U7N A;  3LDD A;  3CCJ V;  2WLN A;  3ETE A;  3CCU V;  2EIJ B;  1YJ9 V;  4Q20 A;  4H37 A;  3SPJ A;  3QO8 A;  1QQH A;  1EFR G;  3SYQ A;  2ATK C;  3ASO C;  4BIZ A;  2HR3 A;  1KP3 A;  1M56 C;  3ABT A;  1YIT V;  2V7Q G;  3W7W A;  3WFV A;  5EBW C;  2QEX V;  1YJW V;  5B3S B;  3JD3 A;  1PD3 A;  2V1D A;  1VQ7 V;  2B1I A;  3FB8 C;  3CD6 V;  1GK9 A;  2WPD G;  2W6I G;  2ZDI C;  1VQP V;  3CPW U;  1OZ0 A;  3OGC C;  4EKW A;  2EBO A;  2ZDI A;  2IW5 A;  4BW5 A;  1M1K W;  5LHI A;  2IU3 A;  2YEV A;  1E1Q G;  3CCV V;  4X8A A;  2XAQ A;  1AR1 B;  1GM9 A;  2OTJ V;  3TK1 A;  1Y4M A;  5CN0 A;  1FXK A;  4XBF A;  3CCE V;  2X6A A;  1YSC A;  4R6Z A;  1SES A;  3ZRW B;  1KKD A;  4UV9 A;  4KFM A;  4XDK A;  3ABU A;  4PA3 A;  1R3K C;  5B1N A;  1ARO P;  3ZRX A;  3CC4 V;  2YSU B;  1JX9 A;  1MAB G;  1M57 B;  3JD2 A;  3K06 A;  5LHH A;  3ABL B;  5DM6 V;  2W6J G;  3KG2 A;  1XL6 A;  2Q6A A;  4CZZ A;  3W7T A;  4WFG A;  4JTA B;  1VQM V;  2EZP A;  4GCZ A;  3ZRV A;  4HAM A;  5LGT A;  4JYC A;  2OT5 A;  4I5S A;  3ZCC A;  2R9R B;  3WG7 C;  1PNM A;  5HFM A;  1K34 A;  3AG4 B;  3RVY A;  4H33 A;  2EIL C;  1BHB A;  2Q69 A;  5IY5 B;  3AG2 B;  2Y69 B;  3OMA B;  3ABM B;  3CME V;  2EIN C;  2LFR A;  3T4Z A;  2HVJ C;  2HG5 C;  1JVM A;  3LNM B;  2OTL V;  3MHH C;  4ZBM A;  3ZMZ A;  2P7T C;  1RM1 C;  1RPO A;  3E8G A;  3ABK C;  3STL C;  5IY5 C;  1NKD A;  3CP1 A;  2IH3 C;  2XAF A;  2LP7 A;  5FL7 G;  4JF3 A;  3A0R A;  1AI7 A;  3AEI A;  3OAA G;  3OMN B;  3SPC A;  2XAJ A;  1BHA A;  3K08 A;  3AG3 C;  3SYO A;  3B77 A;  2WLL B;  3T1C A;  1Y66 A;  3FYE B;  3G4S V;  3LDE A;  1QLE C;  1DTO A;  3W7U A;  3E2E A;  4P2Z A;  1OCR B;  2X0L A;  1AJP A;  3IGA C;  2XND G;  4PA9 A;  4UXN A;  3ZRS A;  4WFB V;  3CC7 V;  2JIZ G;  1VQL V;  1OCC C;  3SYP A;  5LBQ A;  2XAS A;  3B8N A;  1AI4 A;  1K4D C;  1JOY A;  1K5S A;  3OFN G;  1EBO A;  4KUM A;  1K5Q A;  3ZJZ A;  4QPK A;  5L3B A;  1S0V A;  1YJN V;  1VQ5 V;  3SYC A;  1S76 D;  2EIN B;  3ETD A;  4GT1 A;  4RAI A;  1PNK A;  3H01 A;  5EBM C;  2UXN A;  3P30 A;  1SZT A;  4MT8 A;  1YTF D;  2EIL B;  4MVS A;  4HZ3 A;  4JYB A;  3E8H A;  3ZN0 A;  2EIM B;  2QE7 G;  1K4C C;  1VQ8 V;  1J95 A;  3CMA V;  3SJQ C;  1FFT B;  2A0L A;  1IXM A;  4UVA A;  1R73 A;  1K7D A;  2QM7 A;  5L3C A;  3RVZ A;  2DYS C;  2NLJ C;  3K0G A;  2X6C A;  1LNQ A;  5KA6 A;  1Q7Y W;  1R3J C;  2XAG A;  3D36 A;  3R65 A;  1PKX A;  3OM3 B;  4MW3 A;  4MTX A;  3SPI A;  3PJS K;  4QJF B;  4WCE V;  1PNL A;  5KA5 A;  3QO7 A;  1QBZ A;  2X7R B;  1B6Q A;  1NH2 B;  2IJK A;  1Q81 W;  2HVK C;  5H6R A;  1OCO B;  4QE7 A;  2DQ0 A;  4PDR A;  3ZMV A;  4MSW C;  1SET A;  4JTD B;  3ZMS A;  1V55 B;  3E8B A;  4PA7 A;  4BAY A;  2M7W A;  2JJ1 G;  3MHS C;  4UV8 A;  5BZB A;  4MS2 A;  4LBE C;  1NVP D;  2H94 A;  1BMF G;  2IJH A;  1K97 A;  1QVF U;  1G4Y B;  2XOK G;  1JCH A;  2IJJ A;  4PA6 A;  3RBZ A;  4OXS A;  1K73 W;  2ITD C;  3IFX A;  1OCO C;  1NBM G;  3ML0 A;  3OW2 U;  3SPG A;  1GMG A;  1R6K A;  3LSQ A;  3ASO B;  5LGU A;  4N23 A;  1JPX A;  5C93 A;  2Y48 A;  1F4N A;  1R3L C;  3JD4 A;  1AI6 A;  1I5X A;  2P90 A;  4MVU A;  1CEZ A;  4UVB A;  5L3D A;  2C2A A;  5B1A C;  5L3G A;  3RW0 A;  3AG3 B;  1DF5 A;  2BOB C;  4LCU C;  1NVP B;  4TSF G;  4P30 A;  2CK3 G;  3QNE A;  4PEL A;  4JTC B;  3FYI B;  3VOU A;  2HJF C;  4DO2 A;  4GX5 A;  5B1B C;  2Z3Y A;  1YTF B;  2ITC C;  3OUF A;  5KUK A;  2W0F C;  1JQ0 A;  5E1A C;  2JK5 C;  4WFE A;  5B1B B;  3UM7 A;  1AJN A;  1FXV A;  1V54 B;  3LUT B;  3VBB A;  1P4R A;  2A79 B;  3JD1 A;  3I56 V;  1KC8 W;  4MVR A;  3CCL V;  3EFF K;  4PDM A;  1CP9 A;  5LGN A;  2DW4 A;  1OCC B;  4FJC C;  5B1A B;  2YEV B;  3CCQ V;  5HFL A;  4RQF A;  3ABL C;  4MW8 A;  4E2L A;  3E89 A;  4JPR A;  2Z5U A;  1H8E G;  3MD0 A;  2JEX A;  2P6J A;  5CBF A;  4WFF A;  3F7V C;  2NNU A;  2WWW A;  4L87 A;  3ZN1 A;  4F4L A;  5L3F A;  1OCZ C;  1E79 G;  1BL8 A;  1ZWI C;  1JJ2 U;  3NXS A;  2B5U A;  3SYA A;  2LFS A;  4WF9 V;  1FXK B;  3K03 A;  1I5Y A;  3TET A;  3AG1 B;  4X88 A;  3ABM C;  2R9I A;  1VQK V;  4ZKI A;  2ZXW C;  1FXK C;  3UKM A;  2WLI A;  3JCZ A;  1KP2 A;  3AG2 C;  2EJR A;  3OE7 G;  1OCZ B;  2K1E A;  2B1G A;  4QNH B;  1H8H G;  4Z1M G;  1KQS U;  1YHQ V;  1YI2 V;  3LSS A;  2GHY A;  4GX0 A;  4RO2 A;  1VQ6 V;  1AI5 A;  4MTF A;  1NJI W;  2HFE C;  2WLK A;  2ZR2 A;  3STZ C;  4G28 B;  2HKO A;  1M57 C;  3OMI B;  1ENV A;  4J9Y B;  1FS0 G;  5GW7 A;  4HYO A;  3T4D A;  1QLE B;  1GM7 A;  1S3J A;  3JD0 A;  3CCM V;  2D3O W;  2IU0 A;  5DN6 G;  2PI4 A;  3K79 A;  1V54 C;  1K8A W;  1UJW B;  2EIM C;  1MOF A;  4R7C A;  3GWO A;  1DF4 A;  3D3I A;  3OUS A;  1VQ4 V;  2WLJ A;  3W7S A;  1G8M A;  1RM1 B;  2WLI B;  4QE9 A;  4G27 B;  3AG1 C;  4WFH A;  3G71 V;  3FB6 C;  2DWD C;  1THZ A;  3E83 A;  1M9N A;  2EZO A;  2ZR3 A;  3T2M A;  3AG4 C;  3G6E V;  3CXC U;  3E8F A;  2ZQM A;  2QKS A;  2ZXW B;  1GKF A;  1P7B A;  1E1R G;  3HB3 B;  1K3E A;  2WLH A;  5CMU A;  1MSW D;  1ROP A;  1TUE B;  1NQT A;  2JJ2 G;  1OHH G;  2OCC B;  2UXX A;  4FMT A;  1F23 A;  3K3W A;  4QIW F;  5CBG A;  4RQE A;  3I55 V;  2P67 A;  2DYR B;  4I9W A;  5IYD O;  2WSS G;  1QCE A;  5EK0 A;  4J9Z B;  3K0D A;  2EIJ C;  3F5W C;  3QO5 A;  2DYS B;  1OCR C;  2AHZ A;  1DLB A;  1K33 A;  3K04 A;  3CCS V;  1K9M W;  1XL4 A;  2IH1 C;  2Q68 A;  1H38 A;  1S77 D;  3E35 A;  3OEE G;  3BY6 A;  4MVZ A;  3BEH A;  2JDI G;  2EIK C;  5L3E A;  2QM8 A;  4MVM A;  3ETG A;  3X2Q C;  1QLN A;  3GB7 C;  4N21 A;  5EBL C;  3ABK B;  1QVG U;  3SPH A;  1KD1 W;  2X6B A;  2HLD G;  3ZMT A;  2WLL A;  3E86 A;  3JYC A;  1ORQ C;  2Y69 C;  1F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...