2NNXA

Crystal structure of the h46r, h48q double mutant of human [cu-zn] superoxide dismutase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVQEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Disease-associated mutations at copper ligand histidine residues of superoxide dismutase 1 diminish the binding of copper and compromise dimer stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2nnxA00
3GTVA 1BA9A 2E46A 1Q0EA 1IB5A 2JCWA 3F7KA 2SODB 3PU7A 3MNDA 4OH2A 3SODB 3T5WA 2Z7WA 2E47A 1JCVA 3KM2A 2Z7YA 2AQTA 1F18A 5CU9A 2JLPA 1N18A 3CQPA 1UXLA 1Z9NA 5KBMA 4A7GF 4FF9A 2WWOA 2WZ5A 2WZ6A 2ZKWA 2XJKA 1TO5A 2APSA 1YAZA 1FUNA 3CQQA 1E9PB 2AF2A 4N3TA 1SXZA 1E9OA 1E9QA 2WYZA 1UXMA 2AQRA 2ZKXA 2AQPA 1IBBA 1XTLA 1XTMA 2NNXA 3ECWA 3LTVA 1EQWA 2WZ0A 2K4WA 1OZTG 3HW7A 4A7TA 4BD4A 1PTZA 1JK9B 2VR8A 3KBFA 3MKGA 2V0AA 1L3NA 3CE1A 4BCYA 2VR6A 1SOSA 1YAIA 1XSOA 1E9PA 2R27A 1CBJA 4B3EA 2GBVA 2C9VA 1Z9PA 3S0PA 1PU0A 3GZOA 3ECVA 2WKOF 4BCZA 1U3NA 1SXBA 1HL5A 1SXCA 1CB4A 1DSWA 1F1DA 2XJLA 1EJ8A 2WWNA 3GZQA 4A7GA 2AQQA 3KBEA 3L9YA 2AEOA 3F7LA 1JK9A 2Z7ZA 1IBFA 3KH4A 2ZKYA 4A7QA 1MFMA 1SXAA 1S4IA 3GTTA 1F1GA 3GZPA 4OJAA 4MCMA 1COBA 1SDYA 1N19A 5KBKA 4L05A 1B4TA 3KM1A 1E9OB 1ESOA 2VR7A 3K91A 3H2QA 1BZOA 2GBTA 2LU5A 2C9UA 1RK7A 1SPDA 4A7SA 4A7UA 3KH3A 2WYTA 1OZUA 1SXSA 3GQFA 1PZSA 4N3UA 3ECUA 1B4LA 1TO4A 3RE0A 4U4IA 3H2PA 3L9EA 1SRDA 1OEZW 5KBLA 1IBDA 1P1VA 1OALA 1YSOA 1IBHA 1HL4A 1SXNA 1DO5A 1OAJA 2GBUA 3HOGA 2AQSA 3HFFA 3QQDA 2C9SA 3QQDB 1QUPA 1SDAB 4MCNA 1KMGA 4A7VA 2AQNA 1E9QB 2Z7UA 2ZOWA 1AZVA 2WKOA 1F1AA 2Q2LA
chains in the Genus database with same CATH superfamily
5D4JA 3RB5A 2E9IA 1U2YA 3QUZB 3NGBC 4JFFA 1T66D 1XAUA 3D18B 4WFGD 4Q6YA 3ARDA 2ICWJ 4IK6A 4S0HA 2IADB 3GMMB 3NGBB 3V52L 4U1JB 4C59B 3U4BL 1P5UA 3KPRA 5TPWL 1KLFB 4QXWA 4F7PB 4ZMZA 4X4KA 6CGTA 5B3SB 1TQSA 4X5RA 3BAYA 2FX8H 4AZ8B 2Z31A 4AL8H 1E3FA 1A6ZA 4DJMA 4NZJA 5E8OA 5BUPA 2DTML 3HNVH 3KEDA 4F3FB 3KPSD 3NJLA 1O6SB 1ZT1B 1TEYA 4LO9A 1UZGA 3DX9A 1DQKA 2ZUWA 4G80A 3IE9A 4ZAKD 1OZTG 1QTPA 1O5PA 2C7UB 3I02A 4XBEL 2W65A 4R4FL 1ZA3B 4MLIA 4XPHL 4JDZA 4WTXA 3TO4A 2FL5B 3OB8A 1E43A 1SOSA 2VABA 1HI6B 2UYLB 3OKLB 4HZ1A 2BOCA 3QDAA 4PGEB 5D1ZA 1MHPH 3MLWL 3VFWA 4HS6A 3MV9E 4HSAC 3JT2A 3QR0A 2YAHA 4JG5A 1TPXC 1DQTA 3WFCL 4AENB 3A21A 3F84A 4Z7OB 3LNDA 1RK0B 3H6AA 4OGAD 2O5ZH 2IBGA 2VO5A 1TPXB 4K8RC 3K6IA 3OF6D 4F9LC 4D9LH 4FQJH 2O6DA 5EBMB 2UY7B 4KXZI 3GMLB 3NJHA 1EV2E 3NZHL 2OMUB 4ZODA 3IPEA 3O2DL 4Z78B 1DCEA 3US1A 4AV5A 1CZ8L 1CVSC 2VMJA 4Z7WF 2NMSA 1VJSA 1EAOA 4FULA 4MQXD 4Z0BL 3G6JA 3VNYA 5EUKA 3HN3A 4KJWD 1U3YA 1WAAF 3SKOA 3CHOA 3JWDL 3AY2A 1OVZA 3SZ6A 2CO1A 5KSBE 5I5IA 1ECYA 1QR1A 3WELA 4O2EA 1QX1A 3WDHA 5HGBA 5IQLA 2HX7A 3ZSSA 3ZZ1A 4DWHA 1FZOA 1NCBH 2R29A 2ZUUA 4Y1AD 1AZRA 2P8PA 4LPXA 5TE6L 4A6YH 3ET9F 3GGWB 5B4MD 3MNWA 3JTSB 1SLXA 3I6GA 3MRIA 3SDXA 4RDQG 4KK8D 2N4IA 3VXTA 3ARFA 1MZYA 3IFPA 1FYTB 4ZDHA 1YA5A 4HH8A 3T08A 5FO2A 3TIDA 2B59B 1TR7A 3PNWA 1JMXA 3QJOA 5BO0D 4OZIF 3KBHE 1PYWB 1RCYA 1N8ZB 5I1JH 4L1SA 3WY4A 3HNSH 4IRJA 3U4EB 2OZ4H 1DJWA 4A1RA 5J89A 4WO4D 1QZ1A 4Q0XH 4Y4HC 5CINH 3VMNA 5DD1L 4JJOA 5T5FA 3H55A 3B7RL 2GK2A 1YMHA 1FO0H 2XXGA 4Y4HB 3G6AB 4OLVL 4Q9RH 4TQ8A 4ZUVB 3NEEA 4I0KA 4AGPA 2EZ0D 4ANKA 4YLQT 3IDIA 1QHOA 3PWJB 4NN5C 1NBQA 2CDGB 3VI3F 3ZE0F 5BW7C 2MH4A 3QPKA 2VLLB 2CUMA 3NN8A 4WTZG 3U6XA 2C9RA 4YC2B 4NN5B 1GGBH 3Q01A 2OR9H 4U3HA 4ZPVB 1W0VB 3BT2L 3VXQB 1U8MA 5E1AB 2E9JA 4OKVA 3FTYA 1KBVA 4MMYB 4YFEA 3SN6N 5GIRA 5T8IA 2ITCA 3RWHB 3P0VH 4FQ2L 4W4OC 3I6KB 4JM4H 2A9AA 4NUGL 4U0RC 4HZLB 2PWGA 3BH8A 3EO0A 1Z0MA 2HFFB 3ALWA 4P3DB 4ZX5A 3EHBC 4CVXA 4U0RB 4O2FB 4M43H 3Q5OA 2VAAB 5I17B 5B3NA 1ZT4A 5IHHA 2VN6A 5J6HA 2ARJA 3EHBB 1FVCB 2A6KA 2EDWA 4WI7A 3FSZA 4LCWD 5BCAA 3GZKA 4G9FA 5IBLC 5F71A 3L4ZA 3RL1B 3ZTJH 4A7GA 3F12A 1BG1A 4FTVA 1R3HA 2W92A 1DJSA 4N2BA 4LGSB 2X4RA 1K4DB 4EOWH 2IH9A 2G9HB 3JWOH 5EN2A 2XV2A 5CP7B 3ULVC 4MAYD 1M1XA 3LOWA 3OC8A 4ORGB 1E2VA 5EUOB 5DVOA 4MLSA 2LAAA 2C3WA 4HKZA 1TTRA 4H8UA 4UBDC 4LHUG 5EZIL 2A9ML 1P7KA 4BQBA 3MV8B 2VDKB 1UT2A 3W39B 2BC4B 3G5VB 4OFDA 3VXSD 1PLCA 1DJYA 4HXBH 1UOLA 4DVBA 3I3BA 4K3JL 2ZCKH 5C7XL 2A6IB 1YO4A 5EU6A 4DVRH 2YPVL 3H9YA 2VMDA 5ICXA 2OFQA 4N2MA 4QT5B 5IHBA 3LYRA 3MHZA 3L3IB 3HE7A 3QNXA 2R1YA 4PB9L 1SDAB 4A2MA 4ERSL 5GGQH 1JMZA 3BFOA 3MGTA 5T1MB 1FJ1B 2IOIA 3QUXC 3SYOA 1MPAL 3W0WB 3UYRH 5HD8C 2AV1B 4A2LA 2B4CH 4P06A 3VM7A 3P4LA 4W70A 3QUXB 4R4ND 1RY7B 3AG3B 5FUCC 4Z3JA 5I1EL 5HHNA 3LJ3A 5FO9B 4HCFA 2D2OA 4DGVL 2YGQA 1NCCL 1H6TA 2IOMA 3T3MF 2BVUA 4EUPB 5HHQB 2ZX8A 5IJKA 2NXYD 4M9OA 5IB1B 1IEAA 1MJUL 1UVQB 2WWOA 5AW2B 3UTSB 3ESOA 3FCBA 7CGTA 3V2AR 2XNAA 3BZEA 4HBCL 1W72A 2FBJH 1ZRUA 3DV6A 3GSVA 1SYSA 3E8UH 1I53A 4LCWE 4G6FD 2F5BL 4U7KA 3F7YA 3FU0A 5ENWB 2ZWLT 4PTTA 4NKIL 2KQNA 2XX0A 5JOEA 1MFVA 2ZXDA 5GSRB 2ETWA 2OP4L 3UERA 1SEQH 1RZIA 1B4JL 3O8XA 3QYCA 4ENZA 3GDCA 5MHSD 4PS4L 2EKSB 1QLEB 3BAIA 2AEQH 2BH0A 4NUQA 4WTZA 4G82A 1VGEL 3FT1A 3RWJA 3OVUB 5C6TL 4E0RA 4H13C 4MCYA 4OCYL 4JDEA 4BFNA 3VXSE 5LCVL 4ZSOB 1RU9H 1BXAA 4RGMC 1CTMA 1KXQA 1NGXA 3TBVB 3FN3A 1KIRA 3AMKA 3PY9A 2DH3A 2YS4A 4WHCA 4RGMB 4Z5RB 3JTTB 4IYKA 5EPMA 2X1WL 3D6GA 2UWEF 2BP8B 3WMPA 4XMVA 4PRAA 4YO0A 3L4UA 1WHPA 3WU1A 1T6VN 4XBPB 2HZHA 3UBXB 3WKQA 2YKLL 5I76A 4KNTA 2Q87A 1IRAY 2QGDA 2YWYA 3MXWH 1FN4B 4H26B 2CKBB 3OC5A 4LOFA 4E9WA 1K4CB 1NIAA 1C16B 2DQIL 1NAML 3CVBA 3SQRA 4F92B 2HVBA 4YSUA 5JW3L 1LE5A 3KLHC 5FUZH 4D0DA 3OWRA 4F58H 4XXDB 1HILA 3GBMH 1X5XA 1HU8A 5IJVB 2DMKA 2WXGA 1B2WH 1FFRA 2WKLA 1T2QH 3FN9A 5JPNA 5JZ7D 4NZTH 1OCOB 2DLHA 1BAGA 1JHLL 1E3ZA 2WXMA 3CLFL 4N9GB 5DHEA 1OP3H 3P4OB 4BXVA 1WBXB 2OTWA 5JPMC 1NMCB 1KG0A 4LHUA 5DS1A 4NC2B 3TGXA 2V5TA 4ZTEA 4JY5L 2FWUA 3I3EA 4Z0XB 2X05A 3MFFB 4LQFH 5JPMB 1E5UI 1PY4A 1M56B 2W9EH 5TGBA 1ZEAH 4MD0B 2G3ZA 5J6GB 1IB5A 2G2RA 2GC7C 3F7RA 2EDXA 4KDTA 4IHOB 4IJ3C 5HHVH 5KWYC 1MHHA 5AOIA 1YJDC 5F9JB 2G0KA 1MCSA 4H20H 4IJ3B 3D39B 1QVOA 4RWHA 3O45B 5BVPL 3C08L 5C7ZA 4LSSL 3O3AB 3K4DA 2BSED 2EH7L 3OM3B 3RVUC 4BFIB 5I8KL 1BYOA 4GAYA 1ZS2A 4AYSA 1HSBA 2CU9A 3VGHA 1R0AL 2BWIA 3BP7A 4I9WD 3BP4B 2PPAA 4JGUA 3NDYE 3BCFA 3I74A 2QGCA 4JR9L 3UJIL 1K6QH 1UJ3A 4M62H 4Y16C 2QEJA 3A6CL 3KVQA 4B7IA 2I9TA 4XPFH 5LGYA 1AGFB 1NC2B 3ULUC 3FU7A 2XZAH 5LQBL 2ZOTA 4Y16B 4P5TC 4KKRA 3T4AC 2A0LC 2DBJA 3ALPA 1X9QA 3O6LH 3KCPB 4QXUL 2X40A 4NRZA 4XCNA 5EBLA 4P5TB 1GW6A 1MCNA 3T4AB 4OLXH 2EO7A 4FLOA 2OK0L 3K2KA 3MZTA 4HG4J 3ENEA 2V0AA 2BNUB 3KLSA 2WGXA 5G4MA 2OCJA 1SDDB 1Q9KB 4C54A 3SE4A 1KBGH 4GUPB 4X7TB 2FTAA 4UDUB 1T0MB 3L5WA 4TSCL 3LZFH 5AZ2H 2CHDA 1FDLL 1A4JA 5FO8A 5EF3A 3QH3B 5I6KA 1TZGH 1S9WA 2BSRB 2GITA 4UM9A 4LFHG 1PLBA 3P1VA 4RMRA 4L1LA 5JR1L 3P3YA 1JNLL 4MD4B 2KI6A 5H37H 4G8IB 2AKRA 2OMBA 5A2BA 5LAXA 3QI9C 3F5WA 4NKMA 1EJ8A 4PQXA 5HGAA 4ZOBA 4WW2B 1KJ2L 2PO6A 3BW9B 3TBCA 1G0YR 5E8EB 1FHNA 1HQRB 3LKOB 3QI9B 3R0NA 4KK5D 2RFXA 3EJZC 4L8CB 1EXGA 2AHIA 2BS71 4FTDA 5BQDA 1T1WB 4JKKA 1QSZA 2WNWA 3AQYA 1SHSA 4JCLA 1A3LL 5ES4B 3O6FD 4X0KA 4K94L 3QDMB 2F5AL 4MBRA 4MBOA 4X6CF 1FLRH 3VGGA 5KUKA 2BFVH 4B9KC 3HPJA 1XMEB 2EC9T 2FGZA 4ICXA 4PGBB 1G6RH 3WMQA 5I30L 4BH7B 5ICYA 4KPHH 5KJ4A 1OEZW 5E6UB 3NIFE 5CEXB 2EVGA 1HNYA 1CDYA 2H6OA 3TEZA 4XMUA 1QKZH 5IF0A 1SZNA 4PW4A 3MSPA 5ACLA 4WHTA 3QNZB 3DLQR 5DJYA 1P69B 3T3PE 1OOAA 5F7NC 3IDUA 1IO4C 3US0A 4MA7H 3LXCA 2I27N 3MRPA 4XVSH 5FOJA 3IU3A 2P46B 1QBLL 1T5WA 2EDYA 3OQRA 3NFPB 4P23C 2YQ3A 1YHPA 2YAEA 4N8PA 2FJGB 4HIXH 5CD3B 5DEZA 1GZPA 3ZDYF 1ZXKA 3CMOH 3OR7A 4JO8A 1YN6A 1IT9L 4F8QA 3MRLB 2NY3D 2PP9A 1Z3GL 3QYMA 3VWJA 4IRSA 4EI5A 1SYVB 3GLAA 5HHOB 1I1FA 2YMXL 1K5WA 4M5TA 1AKJD 5T5NG 1YAZA 1WBZA 3U83A 3D05A 1CICC 2AQRA 2EDNA 3ARTA 3FQXB 2LLLA 3QWRD 1SY6H 3VSTA 1USQA 4MJJA 1CICB 1JWUB 2B5IC 4U2ZA 4WFFE 1I7TA 1KLGB 3AXLB 4RAVA 3RWEB 5C92A 3FKUS 1ZLVK 4CRPA 1HNGA 2B5IB 1XO8A 5EBWA 2D7TH 4UQ2B 5DHMC 1XL4A 3MRRB 3VG0H 4NQEA 4BHUI 3MOQA 4MGXA 3ZY7A 4Y7OC 1KY6A 2Y36L 1S3KH 1AGCB 3FPXA 1G7PA 1WRFA 1RZ8B 4R7NA 1U8JB 3PWUB 3LZNA 3WNMA 2GBVA 1VGKB 4MKTA 1F3RB 2M26A 1M7UA 3HMXL 1A47A 2NR6C 1LLAA 2K45A 4W9LC 3SE8L 3NK4A 3HS0C 5D2NE 3BHBA 3AABA 1JZEA 5ILTH 3JYCA 1NLBL 1JWMB 1DSWA 4KV5F 2NOYA 2YAMA 4K2UH 1EZUA 3MR9B 5KJ7E 3HS0B 5F0PB 3FONA 3L9YA 2J5LB 2DM3A 2WTRA 4XRCB 3ATAA 4RWYL 5BUAA 1TTGA 4JKNA 3FT0A 3TJEL 4WI3A 2BIOA 3MDJA 4W6YB 5B3JF 4WU7A 1CK0L 2D7NA 3GBDA 5IFAH 5FLVA 4A6YL 5D1XA 4L5FH 4Z18A 4ALAH 4ZFOA 3MBEC 3OB0K 3VH8B 3SDAD 2ENJA 3EDKA 1OB0A 1ORSA 1XF5B 2Q1EA 4JFWA 3MBEB 1E4XI 5I8CB 1MF2H 2IBZX 4GY4A 5LGKA 4GRLC 3OZLA 4GT0A 3SE6A 1OALA 1JK8B 4NQQA 3K0WA 5DD3H 2OZ4L 3GMNA 4GRLB 1GYUA 3B9KD 5CINL 2ATPA 5DMYA 3B1TA 1G7QA 5D1QE 2BNQD 4I18A 5ID1A 4FNUA 3EGXA 4Z77A 2VL5A 2YD9A 1NM4A 1Q9OA 3L5XH 1SVZA 4PMEA 3SO5A 4ZOEA 4BFBD 5LLIC 1R3LB 2CMRH 3KYAA 5H8DA 5EOTA 4WUKH 2QPSA 3G7TA 2B77A 2O6PA 2VM9A 3C75A 3LIZH 5C0AA 3RUGE 4OLUH 5IHUL 3EJRA 1KNOA 4BK5C 2OR9L 3UIYA 2G5BA 3C6EA 4PJIB 1DO6A 2P45B 2HG5A 4G7VH 4H0LC 2D3VA 1CO1A 5C0GA 3C5ZB 3RWIA 3STLA 2VDPH 4R7DA 3BIKA 1KCKA 4Z3EA 2ZUQC 1F8TH 3M17B 1X7SA 3ZU8A 3OJVC 4NQDD 3HE6C 1UGNA 4Q89A 1Z1WA 4FQHB 4S1DC 1GGIL 1NFDF 4M43L 3HNTH 3W5MA 3HE6B 4LOUD 4PWFA 5C08A 3HUJA 1CDUA 1YEKL 2VOTA 1AJ7H 1A1MB 1JHTA 3CAFA 3KXFB 3CN0A 4HALA 4OGYH 4RFEB 4E42A 3MV7E 1E27B 1KFGA 1YY9D 4YDJB 3O3DB 5LXGL 4AGOA 2CBQA 3DX1A 4NKDA 1QBAA 2VSDA 1RKRA 2YQGA 4PAZA 5F93C 3FUJA 3SBRA 1HE7A 4MNQD 4N0UA 2A6JB 3GSOA 2MCPL 3P9MB 4PUBH 3UJJH 3P4NB 4PY8I 4BFGA 1IKFH 4WQOA 2QL1A 4AQAA 2W0LA 5IREA 1EXHA 2YHGA 1BVLA 1PX8A 4QRQB 1PMYA 1EPFA 2QMKA 2LU4A 3DGCR 4ENEC 5MENA 3KBEA 2BNQE 3BIBX 2RALA 4MX7A 5M7QA 2Q7AA 4OFYD 2R56H 3CNKA 3BESR 3DTUB 4GBXD 5I73C 1CFBA 1IC4H 3MLVH 2WUBH 5FOBA 1A2YA 1PL3A 2VITB 1MFBL 3CHQA 3I75B 3GUTB 2IH3B 1PAZA 5GGQL 5MEOA 1GKEA 4ADIA 2G3MA 3UYRL 2VQ1A 3ARDC 1RUQL 4JPWH 2EADA 4F24A 5C2BL 2B4CL 3FFCA 4JFFB 3N50A 1ROCA 1JVLA 1P5UC 3K4AA 1MWAH 3ARDB 4RGNC 1LL1A 3F58H 4PJGE 3AS3A 5EOQL 2YA1A 1P5UB 3KPRB 3AMLA 3OQ3B 1MWOA 3OL2A 1UQSA 3EYVA 2Z31C 3BKYL 2JVUA 1KWGA 3Q8CA 4C4KT 1KB9J 2FZ3A 4YHOH 2A4EA 2UZYA 3AT0A 3HZKA 2Z31B 3NEOA 1R5WB 1A6ZB 2J21A 4XN8A 5E8OB 3TT1L 3VWKA 1MZZA 3GIZH 1JNHA 2GUOA 4GFTB 1B9KA 2NZIA 3WIHL 3DX9B 2KZKA 2PPCA 4G80B 4Q2ZA 3X3FH 2WQRA 2APTA 3QHZH 1CDJA 3TWYA 3I02B 3P9LB 2W65B 3QORD 4JDZB 4HU8A 2XETA 4AH2A 1SEQL 3TO4B 4MNQE 2NCEA 2VABB 4XT1C 5AOLA 3GSNA 4LCIH 2BOCB 4GUQA 2C3XA 1G5GA 2EAEA 4ZNEE 3EJPA 5HGHA 3VFWB 3WYRA 2XQYK 4HS6B 5E51A 5E4OA 5FM4A 3NP3A 4FFZL 3ZYIA 1HINL 1EAJA 2AI0L 5I5RA 4HGMA 1BVOA 4NSKA 1SQMA 4QRBA 2XY1A 1T1YB 1MJ8H 4YHMH 3S2AA 1RVFH 2EXWC 4FG4A 5EWIL 2VQUA 2AP2A 2VC2H 2PCFA 1U36A 4GG6F 2I07A 2MIZA 3OR6A 4F2ME 3N42F 2P48B 3G6JB 4KH2A 4Y5VA 5EUKB 3LQAH 4NP4L 4XPBL 4F7MA 2X89A 3SKOB 2GAZA 4TVUA 3ZO9A 1E8XA 3UEZA 1CG9A 3QCUH 5I24A 4P2AA 4R3SA 3RVWD 4M5SA 5JXEA 2PKDA 4O2EB 4HOMA 5FUZL 5HGBB 3CV5A 1HTYA 3N0PB 4A7QA 3BQVA 1U3ZA 2R69H 4LHJB 4O2CA 1FZOB 5SX5H 2P8PB 2OJ1A 4WKZA 5I1LA 1F2XK 3ZYJA 1JZIA 2ZG3A 4U33A 1KB3A 5FAAA 1QI4A 2EABA 3MRIB 2IFFH 4QNPF 3SDXB 4X4YA 3UMNA 5I6MA 3VXTB 1XSIA 5IP4A 4LPWA 3ZDXF 4IOSA 1SHMA 2UXFA 3EF4A 4JPVL 2GTQA 3TIDB 3GO1H 1JGLH 3PNWB 4LQFL 4IRJC 4A7SA 5F7FA 1YDPA 4IRJB 4LCUB 3T4YA 4UWQB 3E3QC 5DVPA 3GBNL 4FABH 2WNGA 3ZE2E 2A74A 4N2EA 4DUWA 4K3EL 1YMHB 1G7JA 1Q0XL 4JREC 4NQCD 2V17L 3ZHDA 5EIIG 4HEPG 3IDIB 3QEQE 3JBG7 4XTRD 3FL7A 4JREB 4YHZL 2VWEC 3K72A 4OLWL 3Q2NA 4M62L 3SQBA 1JOIA 2X44D 3NN8B 1HN1A 5KSAC 2J8UE 3SGJA 2J4WH 1AQDA 5FXCH 5KSAB 4OKVB 3NFSH 3QQ3A 5I1GL 5E8PA 1JZHA 3DBXA 5GIRB 2C9AA 2ITCB 3QG7L 4K5LA 1MKFA 2XZZA 4GH7B 2G4GA 3NRPA 1CC3A 3JUYA 1UXSA 2V9TA 2Y0SA 1YEGH 3BH8B 3EO0B 1AC0A 2VIRA 3BE1L 3VFNA 4U1SB 4CVXB 4LSQL 2BRQA 5FA3B 1I85A 1ZT4B 3LNEA 5J6HB 2E8ZA 2ARJB 1E30A 2A6KB 5AAMA 1FI8C 4C8XA 4OVVA 4KKLC 4D0CA 3D85A 3T09A 4BZ1H 4G9FB 1KUMA 2W0FA 3F12B 5ANME 4FTVB 1R3HB 2AW2A 4XO3A 1V55B 2X7LA 3OLEA 1INEH 2X4RB 3CIAA 4FFWD 4LEXH 4Y2DD 5FKPA 5B8CA 5I66A 5AVVB 5LBSH 4CW1A 1YAIA 4P05A 1TSHA 5EN2B 3TLRA 4NCDA 1M1XB 1X5YA 4XHJD 2ROYA 2Y7LA 3ARGA 1NTDA 4B6ZA 2AABH 5AL8A 1F58H 1JZ6A 1P7KB 4YXHH 4UIKH 3BJ91 1FLRL 1NGWA 4YDKL 3DX8A 2YFOA 2BFVL 4A2HA 1AQ8A 3V0AC 5FV2A 3WNIA 3D3VB 5FWRA 2HTLC 3BPOC 4DVBB 3PWVA 3IAGC 4B9CA 1CGSH 1N10A 2X41A 3HE7C 3OG6B 4KPHL 4NQCE 4YIQA 2UXTA 5EU6B 5ICXB 5I6LA 3BPOB 3U0PA 2AXJA 4JO2L 2Y6TE 3BUBA 5B21A 5JW4N 1G9HA 2D0HA 3HE7B 3QNXB 2IGFH 2R1YB 3AUVA 3QULA 2E7BA 4NUJA 4JRXE 1AGDB 5CILH 4A2FA 1ZY9A 3MGTB 4PJXE 3EJSA 4M7LH 2WP3T 4QI3A 2OLDA 5KSVB 2FWOA 3RVTD 1MHCB 5HHNB 1N4XH 5CEZH 4FJYA 1KLUA 1OW0A 5K59F 4KU1A 5D1ZI 3U2SA 4BUQA 5IJKC 1VHPA 1RHHA 3CMOL 5DWUL 4ILDA 2VDQB 2XWDA 3O3UN 1NC4D 1QYGH 1YCSA 3DNKA 2ZXGA 1RUKH 1IEAB 4WY7H 3O2WH 1T7YA 1XCWA 2XNAB 3V6FA 4Q6KA 1W72B 4R0LA 3DV6B 3GSVB 4XX1E 1SYSB 3GIVA 1A5FH 4GI6A 1IEBB 3R4DA 3F7YB 3IFLL 3IFNH 3Q9QA 4OFVA 3UH8A 4ZYKB 5D9SA 3HRZA 1W9XA 3EYSL 4PTTB 1G87A 1EA9C 4LU5H 1KXTA 4QGTA 5D96C 4DP9X 3F04A 1OT4A 1HH6A 1RZIB 4UT7L 2HKFL 5D96B 4HEPA 5EIIA 3UEQA 5FGCE 2D7TL 3UTTD 1PZ5A 3T0EA 3VMPA 4HCRA 3FRPG 4M1CC 5DJ8A 3VXMD 3SDDD 4XPGL 1XDTT 1S3KL 1NKRA 1X9RA 4KX8A 4E0RB 2V37A 4MCYB 4JDEB 4LLAA 4YVUA 3WL9B 1A1OA 1S78C 3L1GA 1ULVA 5AOJA 1QTSA 2XYBA 1ZLDA 2WO2B 4TTGA 1NGXB 3TIEA 1KIRB 4AGQA 3WIAA 3BEVA 3IJEA 5AYUH 4HS8H 4MQTB 5ILTL 4WAFA 3A67H 4XN9A 3CLEL 3P11H 5EPMB 3BFWA 1PSKL 4K2UL 4X8XA 3DRTA 3FO2A 3ESUF 2ZG2A 4PRIA 5H4YA 4PRAB 1DVQA 4YO0B 2I60H 3IVKB 4PS3A 5TH2A 4L37A 5EU4A 1E3XA 5D72H 2CCLA 5JHLA 4OV5A 3L95A 2VLJA 5H2BA 4ZMYA 2LR4A 1Q90A 1UM6L 3DSFH 2AXGB 2XQ0A 5FW6A 2WXLA 1NGQH 1Y7VA 5LBGA 5HP5A 5KBNC 1MAKA 4FHKA 4OZHF 3AG2B 4M1GH 1BLNA 3ML8A 4D0DB 5C8JA 5JPNC 4OZ4A 4TSAL 1BHGA 4AQOA 1HILB 1OHQA 1MF2L 2WB1A 1OM3H 4B0MB 1H6EA 4R84A 4AVIA 5JPNB 5KZCD 4XMTA 1BFOA 2WXNA 5DD3L 1QFWM 3B2MA 3PP3K 2OTWB 4GQPH 1KG0B 3L1OL 2IC2A 1IV8A 1HK6A 3BWUC 2QTVA 3EOAA 4TTDC 3WFBL 5EBGA 2DIBA 2YARA 3L5XL 4LMQI 5TGBB 3TN0A 4LVEA 2G2RB 4ZS7L 5DT1L 4JAMB 5AW3B 5JHDA 1SXSA 5DFVC 1MHHB 3NRFA 1JZ7A 5HI5C 2VXQH 3WNLA 1QVOB 3VXME 2RJMA 2X0WA 3DJZA 4Z9KB 2J25A 2VSCA 5FB8A 1UCTA 3TYFA 4HFWA 2DQUH 4GAYB 4N8VA 1HSBB 3DIDA 1UADC 3BP7B 4IRZH 1WWCA 2XTJD 5DCCA 3N2JA 4Y1SA 2F58H 1UJ3B 3ZDWA 1UKSA 2HLFC 2VLMD 2F61A 2X87A 4FERA 5ABDE 2I9TB 1F8TL 3MNDA 3GRGA 3MPCA 3D06A 4U1GB 3QFJA 3LD8C 3L3OA 2EKJA 2CZNA 1DLFL 4MWFA 4NRZB 4XCNB 5EBLB 2JELH 5FYLE 5LWYH 3LD8B 4M5YL 3SE4C 1NUFA 4NIYE 3RJQB 4BSVA 3IK2A 4XPTH 1MY7A 5F1IA 1HAUA 4QMEA 3L5WB 3SGDI 3DX2A 3JZ7A 4NO0A 1S9WB 2BP5M 2GITB 3KDMA 1MCBA 2AK1H 4UM9B 4TYUA 4HWZA 4NN7C 4YWGH 2FECI 4JM2D 2AKRB 3VD3A 5LAXB 2V5YA 4P9ML 4NKMB 2PTVA 5EZPA 5HGAB 3FRPA 5D7JA 2YEZA 2PO6B 4NN7B 2FQDA 3FTGA 4EN3C 2V9UA 3Q48A 2RFXB 2P5WB 4Q8BA 4F8OA 3QW9A 4WK2B 3K3QA 3GDBA 4EN3B 3MCKB 2ZP8A 4N2NA 2HA1A 2QQKL 4X0KB 1CBJA 3MLVL 1GTNA 1ERNA 4NZRH 4KI5F 4U7MA 5PAZA 2BSDA 2DLFH 4DKAA 3ESMA 1F2QA 4ZFGH 2MWCA 3HPJB 4N2CA 2WWMC 4JZOA 4ODVH 1U3NA 4I2XA 1EIBA 1RI8A 1ZLEA 4CU8A 4DP0X 5ICYB 7PAZA 1BPVA 2Y7OA 1R33A 2FO4A 3O0LA 5CEZD 1JZ8A 1X5MA 4P9HH 5IKCA 1CBVH 3HMWL 3H9HA 5IF0B 2VLRA 4CMHC 4KO9A 1MI5D 1GSMA 1SXAA 1YG9A 2BHZA 2P80D 4WHTB 1BXUA 4HFUH 2AERT 4J3OC 5DJYB 3ZDZB 3V0FA 4CMHB 4YDVA 3FU9A 2J56A 4YPJA 2QZ5A 2GCYA 3GD1C 2ADJA 3MRPB 3IU3B 1LO4H 1T5WB 2FLMA 1BF8A 1E4KA 1C9SA 4HUNB 1GZPB 1KGCD 4PJAE 3OR7B 3VWJC 3J27A 4IRSC 4EI5C 1M2OA 2KPNA 5GRYA 3CHPA 5HPOA 2XRAL 3BAEH 4JJHA 5CCKL 1U3JA 1SXNA 1JF6A 1PKQA 3QUML 3VWJB 4IRSB 3X3FL 4EI5B 5C6PB 1WLHA 1I1FB 2VRKA 2IAMA 1KV3A 4G8GA 4TLKA 4XNAA 4HXAH 5G2NA 4MXQC 2IQAA 1FIEA 3BP6A 2SODB 5H94A 4OTXH 4JFXA 3TTSA 4RAVB 4E9XA 4ZMXA 1R1CA 4BQ8A 1SMOA 3V95A 3QUYA 5EBWB 3TP4A 3VXUA 5T1KA 4EN2A 3L3DA 4NQEB 3D12B 1RMFH 4AEHH 2KZ1B 3CXDH 1HHHA 3O6KH 5IG7A 2IPTH 4I1NB 1BOYA 1QFOA 2DMBA 4K3DL 1OSPH 1G7PB 3D4YA 1U58B 2DQTL 2Z64C 4R7NB 2IQ9L 5BRZD 1CWVA 2D9QB 5KVGH 2VC2L 3A4DA 3WHE0 5MERA 4B3VA 3WO4C 3WD5L 1BFSA 3CZFA 4XAKE 1JZ5A 3UFIA 3DWTA 5C0DA 2JJWA 3WO4B 5CEZE 2PPFA 3BHBB 4PJ7A 5IBLD 1CDIA 4UI2A 4FE9A 3S5ZA 2ITDA 3Q2VA 3UJTH 2JQMA 4X6EA 1FYTE 3Q3GB 3FONB 1BFVH 2WTRB 1JPFA 2F7PA 5EA0L 1JXKA 1M9SA 5DJDA 1ORQA 3IJ8A 2VR6A 1R3JA 5FYLL 5CN3A 4YHLL 5ANHA 4ZW3A 4WU7B 3OAUH 3AG1B 3MV8D 4ZMPA 2HVKA 3K6SA 1MOEA 3MLSH 5D1XB 4IW4C 4D94A 1KGCE 1I9IH 4ZFOB 3WN5A 3DETD 2J6EA 1FIGH 1PW3A 4HOWA 3D07A 1ORSB 2XFXA 2B3RA 5LGHL 1LP9A 4IDJH 5J1SC 2OI9C 1CL7H 2H2PD 4NZUH 4AQ1A 3OAYH 4N2IA 2MQ0A 2X4QA 2J12B 4I18C 5BPPA 1ML0A 2OI9B 1RULL 3GMNB 2HJKA 4KAQL 4YDMA 5KYWA 3FUFA 2X70A 2ATPB 1G7QB 4N0YH 4I18B 1MXGA 1N8OE 2CO3A 3LEVL 1EERB 2RCSL 1CLZL 2W59A 3EGXB 1JPTL 4TL5A 4AJVA 4PJ8D 1SN2A 2X2YA 3SDYL 1AQKH 4Z77B 1QWUA 1Q9OB 4BBWA 1N5AA 5I6PA 1F00I 1ADQL 5I1KH 3K71B 1ASPA 1MELA 3T6ZA 1YY8A 35C8H 4I3SH 5EOTB 1RK7A 5DUBB 4QTHB 4Z7WE 1VF5C 3FRUA 2YUZA 5C0AB 1S7UB 4GKZA 3L4WA 2MJWA 4PJCF 1WAAE 4JFOA 2VISA 1KNOB 1X4YA 2EC8A 4KRPB 4RA3A 2I7OA 1HL4A 2G5BB 3IDGA 4ZMNA 2HG5B 3W3BA 4Z7QF 1A6WH 3TYGH 5C0GB 1WIUA 3BJLA 3RWIB 4AE0A 3STLB 4R7DB 5DHVA 5TQ2L 1WUNT 3S5LG 5TQ0H 4G71B 2AXFA 4UM8B 1EUUA 1UD2A 4KGLA 1BA9A 2O6EA 4GYBA 5CUSL 1V7NH 5HDQL 5AW7B 3HEIB 5JMOC 2UUDH 3NJKA 5C08B 3LEXA 4L9DA 2XTLA 3HUJB 4DK3A 3V0EA 1KIUA 3IDXH 1P4UA 1J5OL 3ULVE 3A6BL 3WAKA 4TL4A 4OCSH 1OAKH 4DGIH 4E42B 4ZUSA 3MV8E 5JOPD 3DYMA 5KBDA 5DQDL 1IX2A 4NKDB 3UL4A 4B9YA 5CM1A 1INEL 4OT1H 1URZA 3DBSA 3O41A 5LBSL 2JIXA 1VFMA 3K2MC 4JO1L 2DI8A 4M00A 4N0UB 1FFPA 1N12A 3EADA 3GSOB 5DHDA 1D7DA 2NNXA 3BYTA 4AQAB 3MRQA 2AABL 3TC9A 3OKDA 1KYFA 1BVLB 2EIEA 3ISYA 2Y24A 1WWBX 1GGTA 4UIKL 4D9QE 3TT3H 2KMWA 5MENB 2FEEI 1DBBH 2HLEB 3VD2A 2X4SA 4U6XA 4MX7B 5C3TA 4XP5L 3CCHA 4PP1C 3CPLA 5E1GA 5F6HI 4NKOA 2GSIA 1DSYA 1S9VA 2PF6A 5FUCE 5FOBB 4M8RA 1A2YB 1JL8A 5FYJU 1EO7A 3WKNA 2C9XA 2JCCF 3UTSE 5D6DC 3OJMB 1OCWH 5EUOF 3S4SG 3KLHD 2VQ1B 4RH4A 4XCYA 1RZ7L 3CH1A 5ICUA 4MJ6A 4OI8A 3FFCB 4LGRB 4L8SA 4ETYA 4ZD3H 3S3PA 3APMA 5CEZL 3NH7H 4MZ3A 4MJHA 3PXHA 4Y8DC 2FT8A 1KN2L 2C9QA 1ASQA 2X9WA 5T1DL 1UQSB 4RFNC 1QNZL 1KB5H 3QEGL 2XA3A 3EYVB 2DYPA 1Z6JT 1YPZF 3LVTA 4XNUL 2HRGA 5AYQA 4ES8A 1EJ6A 4NZFA 4CSZA 1I1AD 1B90A 4RFNB 2UZYB 2ZKHL 3HZKB 5BUGA 5B7MA 2LW3A 5GHWH 3F05A 5E8DH 5AB2A 5CKGA 1JNHB 2ZAHA 2GUOB 5JOPE 4OD1H 3RWDA 3MLRH 1CCZA 4BGLA 3KYMA 4ZSOE 1U30A 4F57H 2E76C 3OGOE 4YXLL 1LTXA 2FEDC 1IZJA 1TMQA 4AH2B 4ZFFA 1B9ZA 4G6MH 3CSYA 3H0TA 4DP6X 3GSNB 1MFNA 1QMUA 3L3JB 5CN1A 3RX7A 2AC0A 3L7EB 5HGHB 3DURA 5D71H 2BHFA 1GHFH 2F7RA 3O4OC 1UWFA 4FYSA 1ZLUK 3SY0A 1NCJA 1L0XA 3F7PC 1QP1A 4LLMB 4ODBD 5AUMA 3RA7L 3WEOA 3P9WB 3O4OB 1HQ4A 4NSKB 4FHJA 4HJJH 3S5LA 5AYUL 1L9RA 2G3XA 1V3MA 3W82A 3SGEH 1BBDH 3T3ME 2Y5QA 3REWA 4Y0GA 4Y5VC 2PCFB 2YPVA 1G7LA 3SKMB 4BKLA 4JG1L 2I07B 1HL8A 4LKCB 5JYLA 2GYSA 4RDBA 5BO1L 3OR6B 4Y5VB 2G60L 1OY3B 5JXEC 1OT2A 4F7MB 3DSFL 2GAZB 4E36A 1N7MH 1CG9B 1NGQL 2YWZA 3VJ6A 2IG2H 2COQA 4R3SB 2AJ3B 4Z7UF 2HJFA 1F6LL 4GO6B 4R7LA 1FE8H 5DZOA 2PTUA 4K55A 3IU4L 1D5ZA 1NCNA 1IBYA 4CNIA 5ELIA 1KACB 4O2CB 4D0BA 1UH2A 4WTWA 4ODHL 3ULVL 3WTSA 1OM3L 4WKZB 5I1LB 3IMBA 2XIIA 3RNQA 5KSBA 3D39E 4EIGB 2VDKL 5IW6B 2KYIA 4JB9L 4X4YB 2B14A 3BVWA 3G04B 2A7BA 3PHQA 2KERA 4RMWA 3TH2T 4X5PA 3ZZSA 2C1OB 3ETTA 1OAYL 1KJ3L 5DR5H 2F19L 2IH1A 1GAFH 1A7PH 3F7VB 1KTCA 1CXHA 4N86A 2BZ7A 4QF1A 5GRVL 3T4YB 3KPSA 5IT2L 1CU4L 2PABA 2VXQL 2XBZA 4EO5A 4ZAKA 2DQFA 2RTTA 4NYLA 2A74B 4AEFA 5FR3A 3ULUE 2BXZA 1G7JB 4N2LA 1G4RA 4PJDB 2AVGA 4XXCA 3SGJC 2IO5A 4M4RA 2WAHA 3K72B 4JRLA 4P23D 3SQBB 2F58L 3PCYA 3KYNA 1M53A 5IM7A 2Y06L 2IWGA 4G1MA 4GMSH 3H7LA 3RE0A 2DBLL 4NXSA 3H2PA 4PV9A 3GF8A 4AXWA 2YLKA 3SBWA 2ILLA 3RPKA 1TVHA 1IBHA 4I87A 3QQ3B 4P3CH 5E8PB 4PWJA 3DBXB 2JELL 2ICEA 3ZQWA 3OF6A 4TPRL 6TAAA 3HI6L 1UXSB 2X4OA 1KBBA 1OIOA 1I85C 2ZX6A 1KIQB 1U6AH 2QPFA 2VIRB 4QR7A 4RRPG 3VFNB 5AAMC 1ET7A 2C1PA 4X9BA 1X6NA 3ARSA 3WENA 1DVYA 2ADFH 3D0VA 3D2UD 4D0CB 3D85B 3QDME 3WS6A 2VDOH 1ZANH 2F8IA 4WWID 3ZTEA 1NAMA 1G9NC 3X14A 1SJVA 4YWGL 3V79C 3PREA 2W0FB 3RNKA 3Q2WA 3DK2A 3BEWA 3HZYB 1SQ2N 2X7LB 5B8CB 2LVCA 2AJYH 5FKPB 2I5YL 4OLYH 3ARGC 4BIKA 3LSOA 4QYOA 4CW1B 5I66B 5ETUA 2W0PA 1KPUA 1TO5A 3GXPA 4HD9A 3L4YA 4QRSA 4Y1AA 4NDMA 4OGXH 2WYZA 3QIBC 4Q58C 3ARGB 3OKEA 2OYPA 1REIA 1R9FA 3MCLH 3O0RH 5FGBC 1EHKB 2VLKD 4RESB 1NGWB 3DX8B 1S7SB 4CBZA 1G7MA 4F93B 4YQXL 4F80A 4UQBA 3PWVB 2H2SD 3PIQA 5E1QA 4B5ZA 4U7SA 4YIQB 4I3RH 3U0PB 2GK0A 3IT8D 2CKBL 4QXGL 4WO4A 4WW2F 3HHRB 1DCLA 4PB0L 3FHAA 3CN3A 4XP1H 5INDA 1NL0L 1XBRA 1U8IA 2W9DL 3QULB 3FU8A 4NUJB 3BQUC 3PWPD 3PF2A 1IVLA 2W60A 3LNIA 3MBED 3PP4H 4ZTPH 3BQUB 1KDIA 2ED6A 1OW0C 2IDFA 3O2VL 4GI9A 1OPGL 1ZHKA 4CKQA 3LEYH 3MJ6A 3VD1A 2HRHA 4G7RB 3D33A 5GGRA 1KLUB 2CWRA 3U2SB 1TFHA 4YSQA 2VJ8A 1FGVH 1RHHB 3OXSA 3W1ZA 5BMFL 2EE3A 4DP8X 3CN2A 1JK9A 4I0PD 1S7QB 1THCA 4OUUA 1UWGL 4R0LC 2VQTA 1FRGH 1NSNH 2W1NA 3B7TA 1BM3L 3JV5A 3SGKC 1WE5A 3UZEC 5F3BA 1J11A 3V6FB 3LKQB 4RRPM 1U8PA 3VSVA 3ZHLA 4R0LB 2C34A 1JBJA 3VO0A 1XH1A 1KULA 2GY5A 3S88L 3GIVB 3HRZC 1C5CH 2ZCHL 1INDH 4EZLA 4TUKH 1YJDL 4FN0A 4X7SL 1TTUA 5D9SB 3HRZB 3U6RA 2VDRH 1KXTB 4OTXL 2B15A 5F7AA 3IF1A 4LCWA 1OTTC 3T0EC 1HH6B 4NM4L 1BX2A 2A9CA 1PZ5B 3T0EB 1KJ2A 4UTAL 2PPDA 4RSVA 2WPGA 3IN2A 4PS8A 1PX4A 5DJ8B 2D7PA 5FFOA 2VLKE 5DURD 2YBRA 1OSPL 4S1QH 1R19A 4MQ7A 4U6VH 4S1DD 4MAYA 1RZPA 4QWWC 2WTPA 2HWZH 3ZUNC 3MJ9H 2C4FU 5DFAA 2DWEA 4NBXB 5DEGA 3TIEB 1DVFC 3CUPA 5DRNA 5I6OA 5I8OL 3BEVB 1CFSA 2Y07H 3IJEB 4NT6A 4XMLH 2QQNH 2FYVA 2NUTA 4QJ5B 2IJ0C 1VKXA 1CFQB 1EDQA 2CO7A 3VXSA 3ZDYE 5I6NA 3RGBA 3DRTB 3FO2B 4RRPA 5HDBB 2OCFD 2EXSA 4PRIB 1BFVL 4ZFQA 2FHCA 1LE9A 5TH2B 3LMJL 4L37B 5EU4B 2MCMA 4OV5B 3L95B 3INUH 5H2BB 4E9LA 2ZP9A 4MJ2A 4WFHD 2ED9A 3OAUL 2GJPA 1S5IL 4QDGA 1XTLA 4BQ6A 3MLSL 1L0PA 2WD0A 1DN2A 4LCVA 1I9IL 4UOZA 4PYGA 5TTRA 1AACA 1BEXA 1BLNB 4KDVA 5C8JB 2AJUL 5HHXH 1TJGH 4JRYD 3ETBF 4OZ4B 1SHWA 1KBKA 2OR8A 1YEFL 2XA8L 1I9JH 4OF7A 3BT0A 3CN4A 3RU8L 4NLAA 1BZQK 1LO2H 2PETA 1BFOB 5KAQG 2R2EA 2FWLB 4N0YL 2ARJQ 3KWVA 4QKXB 4FL4C 2NQDA 3EOAB 2YXVA 4NXKA 3B3BA 1ZTXH 1AQKL 5DC0A 4KMTL 3ZTJG 2YD5A 3ECVA 3LKRB 5JHDB 3MO1A 35C8L 4I3SL 2H1PL 2OSXA 3BWSA 3AG4B 1OGSA 3OJDA 3ZL2A 4B9PA 4RGND 2X3BA 3W5NA 1ZAGA 1YEDA 1ND0B 2BIIA 4RMUA 4OLEA 5FB8B 2WOBA 4HFWB 3TYFB 4KV5E 5CGTA 1KCRH 5CGYD 3IWVA 3TYGL 1U8CA 2VDNB 4TLTA 2GFBA 2EDBA 3S3CB 5I1CH 3L3OC 4Z7AA 3PAZA 3GI8L 5IMKA 4KTYA 1NA8A 3PPSA 3QFJB 1AHMA 3L3OB 5C07D 2AMGA 3IJHA 4MWFB 5AB0A 1QSED 5EU3A 2Y3AA 1C08A 4TOYL 4H25A 4WFHE 2A9NH 4OCSL 3DTXA 3ARWA 2CLZA 3HG1D 4BSVB 4X7CC 4N8CH 2ATKA 4PJIF 4Y2OA 5F1IB 1ZJBA 3G5XA 1PNDA 4EI0A 1UUSA 4ATTA 5CD5C 3B2UC 4IGBC 2O5XL 1F4AA 1AXSA 3EAKA 3IS0X 4NO0B 5LNEA 2C3GA 1UACL 1OGPA 1IAIH 3KDMB 4HMEA 2V9RA 4A6YA 4NIKB 1HCYA 4HWZB 4XNYL 4J3XA 3VGAC 3VG9C 1DLHA 3RZCA 4M6OL 2M1KA 3KPMA 3FRPB 3M45A 5D7JB 4LLDB 2YEZB 5E5MB 5J5EA 3NSCA 3VG9B 3VGAB 3TT3L 3FTGB 2EXWD 3Q8EA 4N5ED 1ITCA 4FF9A 4KOBA 3VFMA 2ENYA 1MSPA 2EXYC 2H32B 1K85A 3DJ9A 3WIFA 2F54D 1AI1L 2OZ4A 2K9FB 1AR1B 1Y0LA 5F1NA 1RZJC 4NKQB 4RGNE 2Y72A 1JYXA 1VFAA 1KCVH 2YXMA 4JZOB 5CSBA 4AQ8A 4UNVA 2NXZD 4I2XB 2FJHA 4O4YL 1SOXA 3ESVF 2KQMA 3G3LA 1EBAA 3LCYA 3RILA 2J44A 3HW7A 2FO4B 2R0KH 3H42H 4LPTA 1CS6A 5IKCB 1TTFA 5F7WC 4IBYA 3H9HB 5DYOA 5IY5B 1JFQL 2VLRB 1EDYA 5SWZD 1N5YH 4RNRA 3G08A 2BSEA 2NDGA 1J8HB 2FLBT 2HMID 4YDVB 1ZV9A 4YSEA 1U2HA 1KB5L 4QRPD 5EU7E 1E4KC 4FS0A 2X6BA 4N1EA 5AL0A 5C07E 2ADJB 2NZ1A 1NPNA 1U33A 1EDHA 1QSEE 3IXAA 4JHWH 2DQCH 5GHWL 5E8DL 3QRGH 1MH5A 4LE8A 2WWNA 4N4YB 4QHNA 2B0SH 4DESA 3WUZA 4F9PA 3MLRL 2IAMC 4DKEH 1PKQB 4HWNA 4TVPH 5F96H 2H1XA 3C87A 3UGUA 4XPAH 5HJ3A 2IAMB 4G8GB 3NIDB 4K73A 3S37H 3FH8A 4CUCA 3IE4A 1TMCB 2VR7A 4YX2H 3GI9L 1AGEA 2IQAB 3BP6B 2Y5EA 2ZT9C 3PUCA 5H94B 1DBJL 4M02A 3QUYC 5D71L 2WYTA 4JFXB 1I3GH 4F5CE 4UT6H 2CM6A 4H0GA 5ICZA 1FNSL 4NUPA 4OV6F 2DF3A 3G6JE 3QUYB 5LG6A 2F54E 3V4PL 4YK4C 3VXUB 3MYZA 5T1KB 3IMTA 4WENB 3L3DB 3VFSA 1R3IH 3F00A 5IG7B 1JCKA 1HHHB 3GJFB 3TNNA 2CIIB 4WLCA 3CVHH 4YK4B 3HAEH 3IPFA 4I1RA 4S2SA 5T3XH 5MERB 2JJSA 3Q8BA 4AJWA 3FB5A 2WJ5A 3O6FA 2R1WA 1HH9A 4AEIH 4F7TA 5C0DB 3VYPA 3E0GA 4HV8A 5AALA 2F7QA 1RUML 4N6QA 1U8OA 3SDXE 4HOXA 4D9RD 5SWZE 2ITDB 1NCGA 2PYED 4V2BA 4X6EB 5JIDA 2E7MA 1BF5A 4R7VA 1CQYA 1J18A 2CUIA 1VSCA 1JPFB 4OQTL 1FE8L 1NCWH 3BLKA 4KVCL 2BHYA 2NUPA 2FQEA 4TSBL 1FCGA 5DJDB 1ORQB 2WZ5A 1R3JB 3RAJH 5D2NA 1VDGA 4KKBD 1BZDA 4UZUA 2GPZA 2HVKB 3FUDA 3K6SB 4X4XA 1IE5A 4QHUA 3WN5B 3DMMD 5EH1A 2DD8H 3E3QE 3QO0A 4XMKH 2NPLX 5KSUA 4AQ1C 1TQUA 2HTLD 5DR5L 1LP9B 4AQ1B 2X4QB 3IN0A 4U1NB 2DWDB 1BW8A 2AS5M 3B43A 3WIIL 2HJKB 5KYWB 2VWEE 2X70B 1GZHC 1XCTA 3V4VH 1HXMA 2DRUA 3TBBA 5BZDA 1N5AB 4FYQA 1AKJA 3W9DA 3SYAA 5FHAL 5H37G 3RFRA 1R6VA 1Q1PA 1XF4A 2WQVA 1YY8B 3BOVA 5JIHA 3T0VA 1VERA 3QWRA 4GJTB 4IIZA 3I50L 4IBVA 4FFZA 4JFOB 2VISB 2BWDA 4UOQA 2QQLH 2XQBL 1NAKH 5DO2C 2NY6C 3LX9A 4XCCH 2CGZA 1J88A 5TE4H 3N1PC 3UPCA 4JFDD 1AG6A 3FO1A 4FTVE 2NY6B 4I77H 2WCPA 1LO3L 4EVNA 1KYDA 4ZX3A 1AXTH 2AXFB 1OAXH 2DLGA 5ITFA 4D9RE 4G5ZH 1U6AL 2PYEE 1GIGL 3FUMA 3PGDA 4PREA 3TOPA 3ZL1A 3JWDC 2V5SA 2FH6A 2EH8H 2WVTA 3C2AH 3LEXB 3ZDXE 5C70A 1WITA 2ADFL 1SN5A 4IKLA 1KIUB 5BZZA 2VM4A 4BM7A 1PF3A 3BDYH 5EOCL 3JVGA 2RIKA 3QHTC 3D3VE 1FPTH 4POZD 3KLDA 4TXVB 5DDHA 5E9AA 2AJYL 1AY1L 4JKLA 4J3BA 3O41B 4YHNA 2JIXB 5EU6E 1ZTXE 2EECA 2VZUA 2JKNA 5FYKD 3MV7A 4ANVA 1FFPB 3ARRA 3DOSA 3MOAH 3MCLL 3MRQB 3O0RL 4PJEA 3OKDB 5DK3A 3SDAA 4Q4IA 1B88A 3S8WA 3IXTA 1BOGA 1IIKA 3BVTA 3ES6A 4X83A 4ZS6D 2X4SB 4NHCH 4U6XB 4E9TA 3BKCH 3CCHB 4A7GF 3CPLB 4YDNA 4NKOB 1C12B 2GSIB 3FSVA 5A2JH 3B9KA 1NMBL 4XP1L 4PJBF 1DQVA 2BNQA 1CTNA 5GRJL 4NPYA 4L8SC 5E2TH 1VCBC 2H0FA 2APXA 4XCYB 3CH1B 4MJ6B 2X2HA 4XXWA 4L8SB 4KRNA 4XBMA 1GC1H 1RL1A 4R5XA 1G9MH 1OGAD 2JKSA 3N1GC 1PTZA 2RACA 2ZX7A 3AY4A 4JFDE 4HULB 4W9GC 5B1JA 2JKIS 5A40E 4CJ1A 5DUPH 4N2HA 1XGTA 3PGFH 4F7CA 2X10A 4P5KA 2DYPB 1FRGL 3FCTA 1WZMA 4TVPD 5CN2A 3I6LD 1BZ8A 3VVVA 3B7SA 5ID0A 2KC0A 4PJGA 2XBDA 2HVJA 4XN7A 3WFDL 2EACA 1C5CL 4NQDA 2XYCA 4TUKL 1JUFA 3IKCA 3RWDB 1VESA 4P0DA 3BGFB 4YSOA 4F15C 3KYMB 3L2NA 4DO5A 3NCFB 1FAKT 3B83A 3JYBA 4HWBH 1KXQE 3EBAA 4F15B 5AVUB 1KJMA 5FYKE 5H37A 4ZFFB 3G5YA 3CSYB 4JFUA 2KL6A 3H0TB 1COBA 4X99A 1NBZA 2IAND 3LN9A 2ZJSH 3M1CA 5KVDH 1LD9A 3WGVB 3DURB 1AE6H 3P2BA 1SPDA 5CP3H 2J1YA 4U6VL 4MNQA 1IAOA 2MSPA 3GHEH 2CDEA 1HHGA 2R4RL 3GS0A 3O9WA 5JIIA 2HWZL 5AUMB 1EFQA 2P7TA 4R4BA 1KDJA 2EEFA 2GKIA 1HQ4B 2KLSA 3C5JA 2NW3A 3APCA 4LEBA 3S5LB 2QQNL 3QXDA 5K59E 1XEUA 2YZ1A 1KYAA 2FBRA 1K5NA 4PJFF 1MNUL 3REWB 4WI0A 1G7LB 4OFYA 3TM6A 1PEWA 4BKLB 1ZGLP 2R4SH 1LVEA 4F8LA 4GBXA 3RWCA 3TJPA 3INUL 1X4ZA 4OM1H 5DMGC 5FFLA 3J7HA 5C0RH 1J8KA 1OGAE 2GG1A 3BVVA 3VJ6B 5FM5M 2XOTA 2CG9X 1T66C 2P5WD 2HJFB 5HGGS 2D73A 2H0JA 5C1MB 1LHZA 1THAA 4G6AD 4QOKD 5HHXL 4EN3D 4F2MA 1D5ZB 3ZKND 5I71C 1JYNA 1XH0A 2GSGB 4TVPE 4CNIB 2CJUL 4MS8D 5E2VH 3I6LE 5IROD 2QT6A 1GYWA 4D0BB 5CWSA 3NAAH 3C6LD 5I71B 3RDTC 1RLWA 1FUNA 2OMZA 3RNQB 3ULAB 5KSBB 4GO8A 2AF2A 2B16A 3ZSTA 4HWEL 3PHQB 3LKNA 2WWMD 4NC1C 5F88A 1P4BL 1ZTXL 4JO5A 2IH1B 5K9OA 2OAAA 2HTKD 2GQHA 3V9CA 4QF1B 1UT1A 5DJAA 3KW7A 3KPSB 3OG4B 1KWKA 3TEYA 3IETA 4DPAX 2DQFB 4J3OD 4NYLB 1SOQA 4RFOH 4XXCC 3QORA 4O58H 3EH1A 3KYKH 4XX1G 3EO1A 5K1VA 2CGRL 3W11C 3S4SB 4B97A 3OTTA 3FT4A 3BKJH 3HBZA 4IU3A 4M4RB 2ESVD 2NX5D 1XQ4A 4I5BA 8CGTA 2IAAC 4FKKA 5ITFB 2XWJA 3WY3A 5EEYA 4FP8H 1IUZA 2VDQL 3KYNB 4BCZA 5B38G 4FXKC 1SLUA 4OGAC 1EFXB 4RSYA 3BWUF 1M2VA 3PRZA 4PV9B 4AXWB 4EKXA 3BMVA 3BAKA 5C9JA 2ICEC 3UX9B 1WA1X 1TVHB 4FXKB 4JS7A 32C2A 2FK9A 2VSKB 2ICEB 2DQMA 1EEUA 1DZ0A 3N41F 1MQ8A 2A9NL 1FVDA 1RD6A 5KVEE 2X4OB 4G3YL 4XP4L 4YHKH 4AUJA 3FUHA 2P5WE 3HZVA 2X2UA 4R9HA 4PJHB 2C1PB 2LE9A 1A3QA 2VDLH 2EDQA 2XG4A 1RIVL 1W6WA 3D0VB 3EYUH 4Y9BA 1DJXA 4W9CC 4YS4A 1I7RA 1NAMB 3AU0A 3GK8H 3ILEA 3X14B 5IEKA 4NAQA 3BEWB 3B34A 2QVKA 3SYPA 3UGXA 4KI5D 1JTOA 3HOGA 3L5IA 1F41A 4E68A 1PQZA 4OJEH 4DAGH 4U05A 5ETUB 3QJRB 1KPUB 1RIHH 4JFQA 5B4MC 1X44A 4WI2A 4DPRA 4Y1AB 4NDMB 4HPOL 3CG8A 2CNZA 4AJ0A 3OKEB 4KK8C 1AZVA 4LAQH 5FYKL 3CSFA 1UKQA 3L6FA 3UACA 1WV7T 3QIUD 3QQ9D 5CEYA 4UQ3A 4K7PL 3TX4A 5DZVA 5AEAA 2WZPD 2D3NA 3KAAA 5CJQH 3ZDZE 1LDPH 4PR5A 5JQIB 5DS8A 1CE6A 1G7MB 3VDCA 2DM4A 4ZXBD 4OBRA 2GC4C 5CJOH 9CGTA 4WO4C 4HUCA 3PIQB 3ZE1E 1BVNT 3MRFA 4UUJA 4J6IA 1GJWA 3ZX1A 2WIIA 4FFTA 4X4ZA 2GK0B 3KHOA 5HTSA 4XAWH 2R0KL 4WO4B 3KWUA 2N3JA 4LSUL 4ZRGA 3VFVA 3KR3L 2ESVE 3QO1A 2OYKA 1U8IB 2OL3H 1N5YL 2EZ0C 3MV11 4UANA 1DBAH 2AQPA 1NCIA 5E6SB 2W60B 1LNUA 4NQCA 4CILA 1HOCA 3QRFM 1E8YA 2VXVH 4I48A 5GGRB 5DJXA 3HZMA 4JHWL 1AOZA 1CXEA 3VNZA 6FABL 3QRGL 3OXSB 4PJXA 4G42B 1JK9B 5AKSA 4ODSH 3KPLA 3BUYA 3CSBA 1U92A 4ZZFA 4OUUB 1EEZA 3IB4A 5IW1B 3AJ7A 2JMRA 4HJIA 3WKML 3BKML 1T4WA 2BVQA 4TVPL 1BSIA 5AWNL 3VI4F 5F3BB 1U8PB 1TQVA 3J07A 4H7VA 3S37L 3FQWA 4XBGA 4JHVA 4OF6A 5J11C 2FD6H 3H54A 2IALA 2MTAA 3RKDD 1XH3A 4URTB 4PBWD 4EPSA 2Y2WA 5J11B 3U6RB 3BWAA 1D6VL 3DHUA 1I3GL 3ATFA 2PP7A 3IF1B 4LCWB 1VLXA 3QE5A 1QUNB 1BX2B 1HS6A 4M29A 3NABH 5F7YC 1EX0A 3WFZA 4Y2DA 1UB6A 3A4EA 4MAYC 5B38A 3QG6A 3CVHL 2YBRB 1JXJA 2A77L 3BZ4A 3FPYA 4MQ7B 4MAYB 4B53A 1CGWA 2WO4A 4NQSA 4B5EA 2DWEB 4ZTOL 2XVLA 5DEGB 1B4LA 4FI8A 3CUPB 4U4IA 1CT8A 1I3VA 2JLLA 5DRNB 3UYPB 3GBLA 2KKQA 1CFSB 4NT6B 1F45A 1Z9SA 2NUTB 1WWAX 4X80H 2NY2D 1VKXB 2CO7B 3VXSB 5EO9A 3SPJA 3P02A 1P1ZA 1ETJA 2QPEB 1AGBA 3MTRA 1QACA 2V7NA 3MJGX 1LE9B 4Z8FH 1WS7A 2UZXA 4PP2A 4WI5A 2QPUA 4YDIH 1PIFA 1MWAA 1L7IH 3KPTA 2DDQH 1PVHA 3OJ2C 3MRHA 3N6YA 4R4NC 1ZLVH 2H3NA 2K9UA 2JFCA 4AL8C 3UBHA 1S7VA 3F6LA 3UTZA 4POUB 1OTSD 4HMCA 4ZK8A 3L16A 5DZJA 5DD0H 3DK0A 4P5RA 4PP1D 4MXVF 3TTYA 2NXYC 2OMWA 1PLGL 2R2EB 4HUKB 1F90L 1HSAA 3NACL 4XP6H 1NC4A 2NXYB 3QR2A 3QUMA 4GRWF 3V4VL 4ADGA 1DUZA 4Y89A 5I2IB 2IGTA 3H9ZA 4E9RA 3AXIA 3A4AA 4KKZA 4N20A 4G6FB 1UEYA 3V7MA 3QRBA 2QSVA 2P49B 1NOLA 3MO1B 1NUDA 1F56A 2A9BA 2Y2TA 4X98A 3S48A 2DJSA 4HK0A 5E2WH 2O61A 1YEDB 5IFJA 1BEYL 3LS5L 2XVGA 3CX5K 5C08E 2QQLL 3NK3A 4K23H 4WGKA 1NAKL 2IWFA 2DQGL 3FU6A 1U8CB 5LG1A 5I28A 3UTTA 4N0FA 2GFBB 5TE4L 3TPUA 1CLOL 3OB0H 1BLIA 1H3UA 2MRYA 3VXMA 2R0WH 3NFNA 3SDDA 4CC4A 2F7IA 2ZWYA 1I75A 5A43C 3D0LA 4JRFA 1KFAH 3QPQD 2PW1B 4DO4A 5GJTL 5A2IH 5IMKB 4LSTL 2EP6A 2C7FA 1NCDL 2DZEA 1PNCA 1T4KB 1U8HA 1UG9A 1L7TH 1E4XH 1A7BA 2FEDD 5EU3B 3P40A 4A04A 5AZEL 4JFPA 4H25B 3B1UA 2X0UA 2NYZA 3DTXB 5M95B 2CLZB 5ACMA 1UWEH 2IH8A 4Y2OB 2ATKB 1QAWA 5MEQA 1SFDA 3G5XB 1FPTL 3KWWA 2XZQL 2FB4L 4AMKH 3VB9A 3EFDL 2EDTA 3RVXC 1SUJA 2R69A 1AXSB 1QPKA 2I24N 1OARH 1ZK5A 2ZQKA 2JTYA 1IIIA 4GSDL 5AVRB 2VL4A 4A6YB 4APQA 3KH3A 4GW4A 1CVRA 3OX8A 2ZUYA 3IGAA 1DLHB 3TH3T 1DVXA 1HCFX 1EHLL 2M83A 2F2HA 2EUVA 4KVNH 3AAZA 5ISZD 1A6TA 1J9CT 5J12B 4JDVA 4PJCE 3DOIA 3G9VA 4PCKA 3VFMB 3FFCE 3Q8FA 4P46D 1I3UA 3BKCL 3AQZA 4AIOA 4ZMLA 3WIFB 3IGLA 3E80A 1AFVH 1F4WL 5LHDA 3VXOB 4TNGA 4Z7QE 1D5MA 2Y7MA 1Y0LB 3QJHA 2DMGA 5F1NB 1RZGA 2D8KA 2EDDA 1BFTA 2R8SH 1BZ7A 1OE3A 1VFAB 4J3SA 4KWUA 1ZJAA 3EH2A 2FJHB 5HDRA 3NCCB 3AUWB 4LRIA 1ADQA 5AD0A 12E8L 1MCQA 4ACTA 3RX8A 4KO7A 2X4NA 2BWQA 4PIBA 5BS0D 5DYOB 3DI3B 4G6JH 4ZFOL 1DQMH 3GSWA 4LSVL 1ZGLM 1HZHH 3G08B 5DI8B 4EXKA 4KOCA 2AZAA 4X8GA 2HUEA 1PDKA 3EOTL 3O6MH 3BN3B 4XNQB 1NLDH 5L6YL 2RD0A 3IXAB 4F9PC 3RPBA 1MH5B 1A7QH 2OW6A 3Q13A 5CFHA 2EUZA 5GS2H 3T3PB 3L3HB 5KOMC 4QHNB 2VZ1A 5DRZA 1ZA3A 4NOFA 1UOVA 1UWXH 4DUXA 4O51A 2AGJL 2A2QT 4WEBL 5D2LF 3IGUA 1JZGA 1PG7L 3DUUB 2QV4A 5HJ3B 2WQWA 4BZ1A 5I15L 4PJAA 2H0PA 4WVRA 1KGXA 2YPLD 1KGYE 3JWOC 3ERXA 1XZ0A 1NUNB 5D93C 1BG9A 1AGEB 1BXXA 4P5MA 4AENA 4CC0A 4MA8H 5LBSA 1AE6L 2L7UA 4A68A 5M94B 4KITB 2VGLM 3V4UH 5GZOD 2R0LL 3CVCA 5ICZB 4Q9QL 4XMZA 3ZMNA 4R5TA 3WFEL 4F8TA 1ZGLA 5F7MC 4JM2A 1MCLA 4KK5C 2MPVA 4LSPH 3SKJH 3VFSB 4F9LA 4EBQH 1JZDC 2OMUA 4KX9A 3K6NA 3TNNB 5I19H 1NANI 1N6QL 1MEXH 5J1AA 5GGRY 3FO0H 2DEWX 2VZVA 4S2SB 4LCYA 4XWGL 1P4LA 4K9EH 5D4IA 3OPZH 5JLZA 2R4SL 2R1WB 1VACB 1HH9B 2XN2A 1KPRB 4F7TB 1TETH 4HV8B 1J0ZA 1U8OB 2B4CC 2NY7H 3L9EA 4ZO7A 4KJPD 2UV3A 3GKWL 5D2NC 3T2PA 2BP3A 2P5ED 3JWNH 4WDIA 1H8OA 2X1XR 2A38A 2BK8A 3V4LA 3BLBA 3NCJL 2NUPB 4OF5A 5IUCA 3GGWA 4PRDA 5E2UH 5IESH 5D2NB 3FUKA 4U6TA 2GTZA 3VA2C 4EUPG 3QIBD 4A66A 1MI5A 1T6WA 2P80A 2W0KA 5IVOA 4UINH 2WNXA 1V3LA 4X4XB 4QHUB 4YSDA 2HH0H 1GW0A 2CBPA 4GAFB 2R0ZL 4NOBA 4FEIA 2E47A 3Q6FA 1SMDA 5KSUB 4NPJA 3S36X 3ROLA 1SM3L 4PJDE 1L9PA 3U4EA 2O1AA 1JAEA 4HSQA 1DQDL 3FOMA 1KCBA 2NY3C 1H0DB 5E0QA 2ZXCA 1XXDC 1MY5A 4XVTL 3UC2A 2YPLE 3S8FB 2NY3B 4MQSB 1XCTB 3BQUD 4AZUA 4G72B 4AYGA 4OF0A 2NY0D 1D5XA 1E2ZA 1HXMB 1KXHA 4U1MA 1VFOA 4PLNC 4K15A 2RMNA 5BZDB 4PSRA 3WEMA 1YNTA 3KYKL 2BVEA 3PG2A 1AKJB 3W9DB 3PXLA 3QAZC 2WXOA 4JY4A 1PZBA 1XF4B 3MROB 4PRBA 5F70A 2AXHA 4AC4A 4OCWH 3QAZB 2ZCZA 4RMBA 2FX7H 3HI5L 1QBMH 1QNIA 4S1SL 3P0YH 4GS7B 4Z7UE 2QGEA 4KK9D 4X4ME 2XDHA 1HCZA 3FB7A 3I6KA 4PGDA 2V3EA 4Z7WA 1KCSH 4M48L 2DH2A 3S35X 3QPXL 2ZUXA 4P2OD 4W4OA 1IMHC 4JZNA 1OXYA 3FO1B 3TBYA 3ZL4L 1WAAA 5ALBH 1S7RA 4EVNB 1PG7W 4B9FA 2VNCA 3UBXG 5BRZA 3PGDB 1WJ3A 2WXKA 2VW7A 4PREB 1H8SA 1XFPA 2UXVA 5E8NA 5EEXA 5CLXA 2P5EE 2UVEA 3RL1A 4D3CL 4G1EA 1XB8A 4UQDA 3JVGC 3EYUL 5IMLA 4BUHA 3UROR 1A66A 1MCHA 3VXRD 3ZKSD 1UD6A 3JQOB 5FF6A 5IB3A 3TASA 1FORH 5CP7A 1CFVL 1XH2A 5DDHB 4NJAH 3Q9PA 4DAGL 4XX5A 4YHNB 3A23A 2YUWA 1RIHL 5F8QC 3CFQA 5KN5A 1H3VA 3MV8A 5CIPA 4ZPTA 3S36H 3DOSB 4LAQL 3SDAC 2HRLA 2VR3A 4PJEB 1DVFD 4DEWA 4GP8B 3SDAB 5A6IA 4GP5B 1OQXA 3IXTB 4H4NA 2A6IA 4X5LA 2YXWA 1FQ9C 3B7YA 3TWCL 1BOGB 3ES6B 5I6XC 4QT5A 2YN3A 2OSLA 4FZ8L 3B9KC 4LVHC 4R83A 5I6XB 1WFMA 1T04B 3QQDB 1GXEA 4XAWL 3ZRSA 2VXQA 3B9KB 2DI7A 1SVCP 1QW9A 4PG2A 2IDTA 2B1OA 2BNQB 2OL3L 5FCUH 2AV1A 4HIHA 1DBAL 4PJ8A 5DUML 4GW5A 4NPYB 4XXWC 1JGUL 5A2FA 4B7LA 4IRZA 4EIBA 1MW2A 1AZNA 2BIQA 2XHNA 3HLKA 3B7UX 3OD3A 4J6RH 5DLMH 4XNBA 2JB5H 4XP9L 2VXVL 5IBTH 1GCFA 5B1JC 4EUPA 5EF0A 3N40F 4IMKC 1AZCA 1ZCRA 5CLZA 5GS2D 1AZUA 3S35H 2KS0A 3NTCL 1CMOA 4PLKC 3GUFA 4L0PB 1XGTB 2Q7YA 2P1YA 4F7CB 2H5UA 5JW4Q 3N85L 2W38A 3P30H 4P5KB 4P2QD 1ZTMA 2P47B 5ID0B 4JEGB 3KDPB 5ENWA 4GKOA 4PJGB 3AWEA 4NO2B 3WE6A 2HVJB 3T0EE 3SQOH 2EIJB 2ZXAA 4NQDB 1NKGA 2WQSA 3M1BA 4LOUC 3ZRCC 3ZTNH 3UYOD 4L2LA 1JUFB 3IKCB 3HC3L 2HFGH 1XEDA 3S97C 4AMXA 2VMCA 3UCRA 2VDMH 2B1AH 2C4XA 5D7HA 4KHXH 5MI0C 4Y4KC 1TTAA 1E8WA 1KJMB 4EQ2A 4OI7A 3ZRFC 4YMPA 5MI0B 4Y4KB 1FLTX 5EEUA 1NBZB 3HLAB 3VGFA 4LXFA 3WO3B 1ZWIA 5E4EC 3NJXA 5HDBE 4PRIE 1LD9B 2HRPH 3C5SA 4G59C 5MP6H 4UMSA 3TBVA 4N90D 5IQ7L 2Q9OA 1UM5L 2VXUH 5CO1A 3L48A 5E4EB 4MNQB 1IAOB 4LBEA 1HHKA 2CDEB 1HHGB 1AS6A 1ZE3H 4AITA 2FBOJ 4XODA 2P7TB 4R4BB 3T2LA 2DWYA 2NW3B 3C5JB 3QXDB 4MJ5A 1WDAA 3UBXA 4WK4B 4GBXC 3U0WH 1FC1A 4JL2A 1K5NB 1WFIA 4L3ED 4PVLA 5KS9E 4WI0B 2KHAA 1FN4A 1AAJA 3N9GH 4GBXB 4IGBD 4XMXA 3RWCB 5KOVC 1L7IL 7PCYA 1QLFA 1S8DA 3IDMA 1WBYB 2JWYA 4PJ9D 4DN4H 1PD0A 4TNVK 1ID2A 1G9NL 4ICWA 3P69A 2Y7SA 3X1BA 3M8OL 2J1XA 5IB4A 4HPYH 1W16A 1JDCA 1M6UA 5CJ5A 1ONQA 3RIAK 1WBXA 3BWZA 5DD0L 3D0AA 4DEPB 3ZZQA 2AQ1A 1QRKA 2OMZB 4TKWA 5IEHA 4Z0XA 3MFFA 4B9JA 1PGRB 3NA9H 4MXWL 4NNPL 3LKNB 2GT9A 1TJMA 4G8EB 4OCXL 5BV7H 5F88B 1I1AA 3T6XA 5K9OB 3A24A 2R29H 4CN1A 3EJUA 5E5LA 4QYAA 5IQOA 3O45A 3SBQA 3AACA 3O3AA 5DJAB 1NDMA 4GMTH 1J8HD 3HFMH 1OSYA 1ASOA 3IETB 1JNNL 4DQOL 1BGXH 1ZD6A 5AVYB 3QFJE 3QA3A 5DZAA 1BQLH 2HFEB 2NZ9D 4LB8A 3EO1B 3EF7A 4K23L 4N90E 1RZFH 3FT4B 4EXPX 4P3WA 5AAWA 3CIQA 4IU3B 4I5BB 5IQ9B 2W5PA 4MB5A 2XZCH 2XWJB 5FK9A 1IGMH 2R0WL 5T5FH 3D9AH 3QWQB 1TZOA 2RH0A 3KPOB 4KXCA 4UV7L 5KYUA 4F33A 1TQWA 1M2VB 2UWEA 5C9JB 4JJ5A 3MMEB 2FYYA 1AYOA 4AG4L 4JG0H 5K9QG 4QLRA 4FDWA 4L3EE 2BNUA 32C2B 3OMNB 1L7TL 3PP3H 4BRVA 3MLZH 4PH8A 2YRBA 4OJFH 4RVBA 4WIQA 4M7JH 5D5MF 5TJWK 5T1JA 2F6AA 4HC1H 5G4NA 1UHVA 1AYRA 1FVDB 1XCXA 2QQQA 5GQBA 3BVXA 1UWEL 1LO0H 5F9OL 2A5UA 2X88A 3HZVB 1CD8A 1ED3A 4AMKL 1XF2A 2DTSA 4ALAC 3TJHD 1JGVH 2XG4B 4Y5XC 5GRWA 1BAWA 2XN1A 4ZW6A 3RP1A 1I7RB 1RUPH 4Y5XB 2CPCA 4UV4H 4KVNL 3ZKMD 2WJ7A 5DMKA 4BGDA 1PQZB 1T1WA 1TENA 1TJHH 1F4HA 4JNXA 3ABZA 4JFQB 1KXVA 4UYQA 1WIPA 2BOBA 4UQEA 4FYRA 2YIHA 3HPLB 1YC7A 5BZWA 1GA2A 3L6FB 4IBWA 2EYTB 2XKUA 1QFUL 1WAEA 2YD0A 4UQ3B 5CEYB 3SE3A 4BFOA 3MJ8A 1J8HE 4XI5D 4PR5B 5DS8B 1CE6B 4TNEA 5D7SH 3MXVH 3X12A 4GPVA 5BRQA 5JHLL 3MRFB 2WIIB 1KYOK 1C7SA 1N64H 5BOPA 4AOFA 3MRMA 3VFVB 4YEFA 1NBYA 1B0RB 1T80A 4QHLA 4WV1A 5B39G 5FC9A 1CXIA 1HZHL 4XTRC 4OIIH 4JPIA 1LNUB 4NQCB 5KJRH 1Q0EA 3SGDH 1G0XA 5CD3A 2APVA 2DIAA 1A64A 4G8GE 1HOCB 2MQCA 2VDPB 4WSJA 1EGJH 3MA9H 3PGCB 3PJLA 5DEJA 3WY1A 4X5WA 4LOVA 4K7PX 4P23A 4ZNCD 1QW8A 1YNLL 3THMH 5DJXB 4HJUA 3HZMB 1BVNP 4JO3L 4WGWB 3VSQA 4RMVA 1A7QL 4PJXB 4WJG3 5TDPA 4K5MA 3H9SB 3EW3B 3BUYB 1U92B 2ERJC 1WZ1H 1UA6L 2YQ2A 4EDWL 1A8JH 2MQGA 4GEJA 2BVQB 1JG9A 1E9QA 3JSSA 4HW6A 3VXUE 1N0XL 4XBGB 4D7PA 3KPQB 2IALB 1HC1A 5A6MA 3LPGA 3PXJA 4JGMA 3E1F1 4HJSA 3RWEA 3LHPH 1F13A 3CZJA 3BWAB 4GAJL 2ZWSA 4KKNA 3T1WA 3NP4A 3D2UA 4BWWA 4KROD 2MKWA 3V4UL 4BD4A 5LXVA 3D30A 5A1AA 4FFWC 4Y2DC 5IJDC 1WZLA 4Y7MA 3CU1A 1HJCA 3SKJL 3MLYH 4LSPL 5D1ZD 3KWTA 3NIGF 2QLYA 3SPHA 4X6CA 3U4KA 1U8JA 4EBQL 3PWUA 4ONHA 3WDJA 4Y2DB 1UB6B 5B38B 4XHJC 5I19L 3QG6B 3GWJA 1GMEA 4D8PA 1MRDL 2X1QA 1T6BX 4MKMA 2BM3A 3BZ4B 1I8LA 4O9HH 1J0HA 1QFWL 5JUEL 4U1KA 5FGCB 4FNRA 4K9EL 3OPZL 2AJXH 2AEIT 2ICWA 2QPDB 1AO7D 4FCHA 1V27A 4HHAA 1M05A 2CALA 2VLKA 1CT8B 4P2YA 2YK1L 4CJ0A 4HQQL 2NY7L 1QLRA 1U4EA 4FOMA 3OKMA 5EO9B 1P1ZB 3SO3B 3D48R 3SDCD 1AGBB 3FQRA 2V7NB 2V7HA 2YN5A 3HG4A 4ODTL 3IJ9A 3QJFA 2X4PA 4UILH 2UZXB 4PP2B 5E2UL 1MWAB 2OM5A 3ETSA 4KY1H 1T7XA 5T3ZE 1OAQL 2HKAA 1IU1A 1BWMA 3PWPA 3K74B 3MRHB 4UINL 4HMDA 1X9UA 2DB8A 3IGKA 3KGSA 3MBEA 2HH0L 4XMPL 2H3NB 1KB5A 3RVTC 4YZFF 2UX7A 3E9TA 3ECUA 2DKUA 1S7VB 1A9BA 2Y25A 4OM0H 4TNWK 3EFFA 3UTZB 3VFPA 2OMNA 5IFHH 4MHHG 4PJ7F 4ABWA 2OR7A 1ZPLA 2F7OA 3D4CA 4H8WH 4V1DD 3HC4H 4DZBA 1MAMH 2ICCA 4I0PA 2VJ0A 5DU7A 3PPEA 1HSAB 3H56A 1NC4B 3QUMB 2BY1A 1J5CA 2E59A 4JN2A 2QV2A 1MFCH 1R3LA 1HXKA 1DUZB 2CJTA 1H8LA 2AJSH 4KO5A 1GS8A 4NI3A 3X1NA 3ZT6A 1CJYA 1SLWA 5GXBB 1NINA 4X98B 1IGFH 4HK0B 5C0JB 4NRXA 5B39A 5IFJB 1QBML 3B5HA 1FZKA 1LP9F 1E6JL 5GGSY 2CM5A 1J86A 4RLDA 3K8MA 4KZDL 3V4PA 4Q7DA 4BDVA 4PW9A 4XC3L 3UTTB 1KCSL 4N0FB 3TPUB 3EIFA 4R7XA 1AO7E 1T1XA 3UADA 4X6DE 3VDBA 3VXMB 3NFNB 4Z3TA 5ALBL 2ENQA 1T03L 4GQRA 3D0LB 5IVXE 4FFYL 2VC2B 4IBUA 5C0ND 3LQAC 3LN5A 3U1PA 5CLWA 1BAFH 3SKNB 1U8HB 3KS0H 1F4XH 1JIBA 1T89C 4U6HA 2N1KA 1A9EA 1WTGT 4JFPB 4JM0A 3QBTB 4KGJA 2Q8AH 4XVOA 3GYRA 3IBEA 1RFDH 3QC5X 4N0CD 4OQTA 1FORL 3KWWB 3FSWA 3FTSA 4NJAL 2A6JA 3ATBA 3FQ2A 3DUSA 4WRLA 3TVMD 5L4FA 3P9MA 3B2VH 2Z1PA 3K6DA 4WSKA 4XO5A 4GW4B 3OX8B 1ZDSA 1NCHA 1XT5A 3IGAB 4V1DE 5GGVL 1L4IA 4ONGH 3WTTA 3AAZB 3AM8C 4F1ZA 1YQVH 1A6TB 1N70A 1QWHA 4GKSA 4IQHA 4ZX4A 4JRYA 5D8JL 3MBWB 3CSPA 3QCVH 4X5QA 1TITA 1RIUH 4JDVB 1YECH 4MA3B 2B2XH 1KT2B 3GUTA 5KZCB 1MCOL 5JORA 4G83A 1GPOH 3BLPX 2IH3A 2EIZA 4YZWA 3VFRA 1D5MB 5DMGD 4YE0A 3QJHB 1RZGB 4JFYA 4LRIC 5KVFH 4FMVA 2HKHL 5FCUL 1BZ7B 5BRPA 3RPIB 4JFZH 2E9WA 1S5HA 3QJXA 1Y07A 2CK0H 5AD0B 5I23A 4PEEA 1IGIL 2JB5L 3TU6A 1Z66A 2X4NB 4PTUA 4TM9A 3SHSA 1DL7L 3GSWB 1S9YA 4NGHH 3RDTD 2J6EL 2HPOA 2CNYA 1KEMH 5EZOL 1FBIH 4AVJA 2XTJC 4KX7A 2ZOWA 1NFDA 2EJ1A 4A7UA 1R5WA 1PDKB 1RERA 2XTJB 1MVYA 2KH2B 4WI4A 5T3ZL 3MC0A 3ZIYA 2VJXA 2E6JA 3ZTNL 3NQKA 3P9LA 5ALCL 4W9HC 5DRZB 2CUHA 4MA1C 5C07A 4P07A 2DJUA 4O51B 4TULH 5FWQA 3V6BR 2B1AL 1HEHC 1QSEA 3GRBA 4GSXA 3W11D 3IKKA 4R90L 2IMNA 4PJAB 3QJTB 2BXYA 1ZKAA 2XWRA 3P77A 3HG1A 5K39B 1MREH 1EFXD 1XZ0B 4HH9A 1TVBA 4L1BA 4P5MB 3AT8A 4ZUUA 3FFDA 4BA0A 1A65A 2EICA 4FJZA 3V5KB 3RFZA 3UOAB 5MP6L 4JM2C 2HP4A 4GFXA 5GGUA 1KN4L 4HS3B 3UG3A 5TFSH 1BCIA 4M8QA 1ZGLB 1T1YA 4JM2B 4PD4K 2FT7A 3ECBA 4N68A 4X9YA 1NIBA 3B9DA 3AADB 4DGWC 4F5CA 2UVFA 2Q8BL 5J1AB 2QTEA 3U0WL 3QZLA 4E5XG 4LCYB 2WY3B 4FNPA 4WFGE 1P4LB 2F54A 3MACH 5JLZB 4TQHA 3N9GL 4L4VD 3LH8A 2N56A 3EJCA 1QA9A 5CSZA 1B3JA 1NIEA 2BS8A 4TQIA 3RGHA 5A3ID 4W68A 5EC1A 2CHNA 4NPKA 5CZVH 3MRKB 2CR3A 2PCYA 2K0RA 1J0KA 1VADA 4WDIB 5I8EA 5DC2A 3T2NH 3UCQA 1I9RL 4PRDB 1K72A 2CHWA 4NC1E 4ODWA 2GTZB 3STZB 1DHKA 4ZO6A 5SWZA 1ITBB 1MI5B 3KPSE 4P48A 3KM1A 5L9DH 1MHEA 3LNFA 1JP5A 5DD5H 3DHPA 4QRPA 3Q6FB 1ZLUH 4L2YA 2ROXA 4LESA 2VZOA 4GRWH 3ROLB 3ALXA 1R3KB 4LCUA 4LBAA 3IMSA 4L1DA 1NCUA 2XPZA 3CZSA 3FOMB 3U36B 4Y2LA 1WZAA 3CDGA 1D7CA 1BD2D 1A3ZA 4GMTL 4X6FA 2ZWZA 3HFML 3SE9H 2Z65C 1D5XB 4U1MB 5E56A 1YNTB 5KW9L 2A1WH 4FEMA 5KSBF 1UZ6E 2X53A 2KZWA 4G6KH 4PJFE 4JY4B 4PRBB 1RQ5A 5DRXA 2RGSA 1JYVA 1NUGA 4CDHA 3CSTA 4O5LL 3STBA 3VYNA 5KSAA 1IGML 3D9AL 4UU9A 2BLFA 5TF0A 4PJHE 3OV6A 5DQJA 2NYYC 3KLKA 3FB7B 5I0WA 4XN1A 9PCYA 4GG6A 4PGDB 4Z7WB 3BSHA 3HCVA 4L4VE 1NCAH 1LDSA 3MFGB 4JZNB 2YRZA 4OCRH 3TBYB 4U1SA 2BIMA 4HC1L 1S7RB 3TA4D 1CE1H 4DFIA 5FA3A 3RRQA 3TCXA 4HLJA 5BRZB 2G5RA 5AVZB 1LMKA 5E8NB 4QLWA 4Y1AE 3NYKA 4FQQB 2WZ0A 3FYEB