2NNXA

Crystal structure of the h46r, h48q double mutant of human [cu-zn] superoxide dismutase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVQEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disease-associated mutations at copper ligand histidine residues of superoxide dismutase 1 diminish the binding of copper and compromise dimer stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2nnxA00
2WZ0A 1SOSA 1DSWA 2WKOF 5KBMA 2APSA 3F7LA 3K91A 2VR8A 1E9OB 1IB5A 1PZSA 2ZKXA 1SXNA 3HOGA 2WWOA 2Z7ZA 1PTZA 2ZKYA 2AQNA 1BZOA 2LU5A 1JCVA 3ECUA 1COBA 2AQRA 2Z7WA 3PU7A 1Q0EA 2C9SA 1MFMA 4A7UA 1E9PA 1N18A 2JLPA 4B3EA 1OAJA 1EJ8A 2WWNA 5KBLA 2WYTA 1S4IA 3KM1A 4A7VA 1F1DA 1L3NA 2AQQA 2R27A 1UXLA 3CQQA 3GZPA 2JCWA 2XJLA 2WZ5A 1E9PB 1EQWA 1YAIA 2E47A 1SPDA 1P1VA 1YSOA 2WYZA 3GQFA 4OJAA 3KH3A 3SODB 1SXSA 2XJKA 3H2QA 4L05A 3T5WA 3CQPA 1OZTG 2K4WA 1JK9B 2C9UA 3L9EA 4A7GF 1F18A 3RE0A 1B4TA 2V0AA 1IBFA 1XTLA 2C9VA 4OH2A 3S0PA 2AQSA 1SXBA 1OALA 1CB4A 1BA9A 1JK9A 3KM2A 1TO5A 1CBJA 1SDAB 4FF9A 1QUPA 5CU9A 2ZOWA 4N3UA 3H2PA 1IBHA 3ECVA 1SXCA 2GBVA 4N3TA 3GZQA 2E46A 1U3NA 3KH4A 3GTTA 5KBKA 1TO4A 1F1AA 3QQDA 4A7TA 3GZOA 2GBUA 2AEOA 3MKGA 1N19A 2Z7YA 1ESOA 1IBBA 2VR7A 4MCNA 4A7QA 2Z7UA 3ECWA 3HFFA 1Z9NA 3KBEA 1RK7A 2AQTA 4A7SA 3HW7A 2NNXA 3QQDB 3KBFA 1AZVA 1DO5A 1B4LA 3F7KA 2Q2LA 1KMGA 2WZ6A 4BD4A 1HL5A 1YAZA 1Z9PA 3L9YA 4A7GA 2WKOA 1SDYA 1E9OA 2GBTA 2AF2A 1OEZW 1SXZA 1FUNA 1HL4A 2SODB 3LTVA 1SRDA 1IBDA 1PU0A 2ZKWA 4MCMA 1OZUA 2VR6A 4U4IA 1SXAA 3CE1A 3GTVA 1F1GA 1UXMA 1XSOA 2AQPA 1E9QB 3MNDA 1E9QA 4BCZA 4BCYA 1XTMA
chains in the Genus database with same CATH superfamily
3DETC 1RHFA 2BNRE 2EINB 3BT2L 1KB9J 4FLOA 5KBMA 4HWNA 3F7LA 4H26A 5DUBB 1BLNA 4KX8A 3U1QA 4XMTA 1QQDB 2JCCB 4IMKA 3HI6L 2YMOA 1YJDH 3WLBA 2HWZH 2PXYA 3X3FL 2QSVA 3JWNE 4JFZH 3PU7A 2H1LM 4WFFE 4YX2L 1K8DA 3FO9A 3HR5A 2OK0H 1X5JA 1IGML 3MLTB 3SE9H 2YARA 3N1FC 1UD2A 1NCBH 3PDOA 4ODUB 4ZO6A 4CC1A 4M29A 4F1SA 1RERA 3VXPB 1A25A 1DDHA 4YDVA 3QHZL 3HN8A 4L0PB 1KB3A 4RA3A 3SCMB 1KBPA 3KW8A 3RZCA 4FG2A 3LN9A 5JHDB 2ZYSA 5B1BB 3WEAA 3JWDH 4CU6A 2VXQH 3DX9B 3NRQA 1ZMYA 1I9IH 4NQDD 4GY4A 3UAJD 5IT2H 2XT1B 3NSXA 4TL4A 2WWKO 1F41A 1VA9A 2BNUA 3AGVA 5EZIL 2OSWA 4IBUA 5DD3L 3U9PH 4GO8A 1CI5A 2PR9A 5GJTH 2R69L 3QIUB 1DCEA 1KJ2B 2R83A 3U83A 1U8OA 1DJXA 4AIZA 2MQGA 4HJIA 3C12A 5IQMA 1WA1X 1JNLH 4G9FD 3WNJA 4LL1A 3RZWA 4A2GA 4KXBA 5J13B 4OQ1A 1AQKL 2X6BA 3I75B 3S8WA 1ED3B 4GYBA 1B3IA 1AQHA 4ZD3H 3MUZ1 5BV7L 1J05A 1ZS8B 3DXAE 3HRZA 1GHFH 1IBBA 5CILH 5LUMA 3K5RA 4JFQA 3DIDA 3A67H 2CA3A 4U0RB 3V7MA 4NO0B 3KGRA 3BZEA 2QR0A 4IRSA 1CR9H 1T2XA 1MCIA 3E8UH 3LNIA 4KC3B 3E6FA 3JV4B 2WLYA 4EZLA 4AYID 4ZQKB 3HFML 1D3CA 1NZRA 1OKEA 4J3XA 3DTUB 1CC3A 1N7ML 2WCPA 1T04B 4J23A 4GQ9H 3VG9B 1YA5A 3HZVB 5C0RL 4GAJH 1M6UA 1PJ9A 1SY6H 4XB3A 1CD0A 3IN2A 4O2FA 5DSCA 1NUFA 4KVNL 4MAUL 2J6EH 1UKTA 1YZZA 2FUQA 1RIVL 3GSRA 3M88A 1E6JH 4TLTA 1GAFL 3RWCB 1QFWI 3U46B 1KBWA 1UH3A 3GSVB 2A6DB 1GYWA 4MXQD 2NUPA 2UXGA 2WO2B 1JF5A 3G5ZA 2K4AA 4NM8L 1W6WA 3L6FB 1F00I 3LQMA 3NVQA 1G7PB 3L95B 4AUYA 4KGLA 4YHIB 3S5LA 4L8CA 3B7UX 1HAWA 4OLVL 1JZ5A 4HIIB 4CADA 4XMPL 4UWQB 1COBA 4XBPB 4KO9A 2XBZA 3OG4B 4YZWA 2GTWB 1G9HA 1BQHG 2NSQA 4JO2H 3KR3H 5DI8A 4HU2A 5FDYA 1MW0A 2ARJA 2XACC 3LCYA 4ODSH 1F2QA 2WWNA 5L0QC 3U0TB 3WD5L 4UQ2B 1OTUC 3VA6A 9CGTA 2ESVB 2PO6C 2WXRA 3O41B 2MMXA 1A64A 2FYYB 4HCIA 1BREA 1ZD6A 3HVNA 4J8RA 4Q2ZA 3CIAA 1KPVA 4N0UB 1EV2E 3T09A 2BRRH 1QKZH 1LMIA 3FFDA 2ITCA 4QY8B 1BXXA 2VLRE 3BKMH 4JGMA 3WE6A 4EJ1C 2Z35B 2CH8A 3ULVC 2DD8L 3KCPA 3QULB 4U1HB 5F7BA 4LIQE 3LSOA 1KYAA 2EDDA 3VVWA 3N0AA 1EHKB 1E4XH 5I8KL 4JHBA 2WZPD 3DA0A 1WQVT 3BZFB 5HYJA 1EHAA 2ESVA 3V5KB 1SXCA 4F80A 1ZHLA 3GZQA 1U6AH 1MCFA 4JFEE 4FLRA 2P47B 2IAMB 1YDPB 1RZFH 2WLIA 1ZXKA 3C60A 4IDJL 1T80A 4LZKA 4OLZH 3ZVVA 4Y4FD 1BFVH 4WU5B 1KG0A 1TYJA 2UVFA 4KH2A 4QGTA 2MNUA 2PR4H 4GEIA 4JFOA 1JSYA 1D5MB 2CM5A 3O6FA 4ZUTA 4R83A 2ZNWA 4JFEB 4XVJH 4Y16B 4UTBA 2JV6A 4HPOL 3CG8A 4HWZA 5TQ0L 1CT8A 3ATFA 2HVJB 3ARGA 3VB8A 5K9OB 3S34H 1O7DC 1O9WA 2D31A 5G55A 2WBJA 5B4MC 5F7DB 3CDYA 1RIHH 4Y4HD 4L1TA 4NQEB 3U36A 3AXLA 3AFLA 3FL7A 4N0YL 3EOAB 2APVA 4PJ8D 1FYTA 5I17B 4HIHB 4G1MB 2H6UA 3Q9PA 1TXKA 5GGVL 3QORD 3TXAA 3C5ZC 2A77L 4NSKB 4IJTA 4YLCA 3FSOA 1YECH 3SBRA 4L9LC 4YXHL 4LLAA 3H0TA 5T33H 4HKXA 1ASPA 1H9DA 4K9EL 1UXWB 3MXVL 1JVKA 2CLRB 4M62L 3NABH 2CLVA 4KQ0A 2I9TA 1TJHL 2X1PA 3K91A 5F9JB 5CJ8A 4BWUA 5EFIB 4M1GH 4UQDA 4XCYA 3SGJC 4DUWA 3D2TA 1PTZA 1CURA 1EZVY 3P54A 3EBGA 3U48A 4IW4C 5MP6H 1WEJL 4PLKD 3HRZB 3WGUB 3MYZA 1NC4B 1NFIA 4I3RH 3C08H 4G6JH 3RWJA 2FGWL 1VFAB 3K4DA 2WYHA 4FNUA 4P23B 2JFCA 5KSBF 2DQFA 2V7HB 3RRQA 2DQEH 5IOPA 3N0PB 2B4CH 1RIUL 1AXIB 1K4DA 3BLPX 5FFLA 1S5HA 4HWBA 3K0WA 2NOYA 2P46B 4DP8X 5DJCA 4QXGH 4QLWA 3ZRSA 1G9NC 3O2DL 3RTQD 1I7UA 5E2VL 4PCTA 3EGSA 4X80L 5DD0H 5MEQB 2FSEA 3RWDA 5KN5B 3T0XA 1JZEA 2VLJB 2L7UA 4ALAL 3MRGB 1MCOH 4R0LC 4EIUA 5HYSG 3OR6A 4AQAB 1FPTL 1E8ZA 4RGNC 3G9VA 3MZTA 4OCXL 4Y7MA 5DMKA 1IAIH 4LMQE 3VSTA 4AJVA 4V1DE 1INEH 1KN2H 2HP4A 1XZ0B 2K70A 1QFOA 2MCPH 2HTLC 5T3XE 1CVRA 3SDXB 5KVDH 3FH7A 2VZUA 1J0ZA 5DVPA 32C2B 3O6FD 1A3LH 2CXGA 1BQRA 2ALAA 4XHQA 1JGLL 5GJSH 2GI7A 1KTLB 5KSUA 3RQ3A 1RUML 2WTRA 3I6GB 3RWEB 2WXLA 1E5ZA 3SPJA 5KW9L 3HI1A 3WTSA 5TE6H 1BZ7A 5I6MA 1JWMB 5IFAH 4PY7A 1USQA 5KVFE 5GHWH 2W9EL 4JFFE 3V4UL 4A7GA 5EZOL 3ZZLA 1Q0XL 1MAJA 2H41A 2ZOLA 3BESR 4WEEA 2BIQA 2APXA 4H0IA 4B50A 1CVSC 3B9KD 3BCFA 5BMFL 1GZPA 2YPVL 2J3SA 1JGEB 1MFAL 1FNHA 2DRUA 3PHSA 2X4UB 4EXKA 3NP4A 1E9QA 5I18L 2Q3XA 2HPOA 4M9OA 4Y4HC 5FYKH 2IGTA 3LSOB 4ZUWA 3GGWA 4YZFE 4LSVL 3VFNA 3WFBH 1N68A 2VM4A 4Y2NA 3DGCR 4I87A 3WFEH 4MAYD 3AS2A 4OLUL 3ZTEA 1TNNA 2ZE0A 3TIDB 2Z8SA 5D1ZC 3D4CA 3RL1A 4MA3B 2HRLA 4N2AA 5F7EL 3A22A 2VR9A 1WBYA 5GRUL 2ADYA 3PGCB 3FOMB 4FA8A 1J18A 3O3DA 5BCAA 2X70B 5AKVA 1JF6A 2C1PB 4XP9H 5C07A 3QWNA 4Y1AE 2XZZA 4F8TA 2YGOA 5I8OH 2V9RA 2VDLH 3UCRA 1SEQH 4UOW0 3DHUA 3IXTA 4IEFB 5I1KH 4PG2C 3DIFA 4XBGB 3IDNA 5CD5C 1LO0H 4P2RA 4MRCA 1QR1B 3PDOB 5A2LH 4DN4H 1TLKA 4H8WH 1QP1A 3QFJA 4L05A 3QEQD 2L7QA 3I3EA 2VLME 5IOKA 4PG9A 3D9AL 1FAIL 1WD8A 3M1CA 5D6CA 1NFIB 1QAWA 2I60L 2HFEA 2JJVA 5HVFB 3QI9D 1E50A 4I3RL 4AYFA 1T66C 2Y1VA 3MRNA 4KTGA 2EC8A 3VFWB 3ROLB 1DQTA 2VN6A 3V55A 2CU9A 1IGTB 5DTFB 3LRLA 3TA3C 1AJ7L 3WJJC 3KNBB 1OTUD 1CYWA 5TFSH 5FUCE 2HJKA 1KJVA 1KIPB 1R3HA 4HKJB 4MXWH 4KK6C 5D7KD 2XNAB 1BFSA 1LE5A 3OKOB 4MMZC 2EE0A 3LZOA 3SKOA 1FNSL 4BZ1A 4MQ7B 1YEFL 3ULVE 5EOCH 4FFTA 4LU5L 4JDVA 3VGGA 1GGUA 3GLEA 4FFVD 4B9ZA 3VFMA 5JLZB 3RPKA 4WO0A 2V2TB 2DLHA 2V5RA 1WZKA 4FXKC 4AIXA 3PGFH 4R97B 3KBFA 3MFFB 4FNPA 5KS9B 1S3KH 5A2JH 3JYBA 1G6RH 2AVFA 1JTOA 3GPEA 1TPXC 1WZLA 3CU7A 4Y19A 3U2JA 4NWUL 1H5BB 2HJFA 5C0BB 3BQUB 4XX1E 1NBZA 5AD0A 4JJHA 2F58H 4HBCL 1YYMH 2VZOA 4GNKB 4JREB 4ORGB 1P5VB 1P5VA 5EC2A 4BUHA 3MJ8B 1KFAL 1MCBA 2VDQH 3CXDH 3CZEA 3SOTA 4P23C 1PGRB 4APQB 4BDVB 3X13B 5IROA 4JO5A 4XZUA 4IGBC 3T2LA 2D0HA 3VWKB 3QR2A 3WEXB 4AYSA 1K8IB 3OKKA 1N0LA 3F6LA 1WK0A 3C5SA 4XT1C 4HZAA 2BNRA 4LCWE 3MLZH 1QACA 3BMWA 1RFDH 5HXMA 1E9OB 3QDJE 3LNDA 1AS7A 1W15A 5IQ7H 5EZIH 1QSED 1C5BH 1Y6MR 4FA6A 2CUAA 4YXLH 1BM7A 2NY6D 3SE4A 4E41A 3K6OA 2YBRA 4PJGB 2ZF8A 5ICUA 4XNZC 5TQ2L 2A7BA 2EXWD 2EUVA 3PGDB 2YWZA 4U7SA 3FCBA 1UJ3A 5D7LA 5FFOA 1PG7L 3QQ4B 3LPFA 3C09C 3FB8B 3DX8A 1CF8L 3MRKA 3WSQL 2XYBA 2O6CA 4ZPVA 1DBAH 5GS0L 4CN4A 4X0NA 3HS0A 2WXFA 3ESVF 2CO6A 3HHSA 3X14A 1EFXD 5KVGH 4UT7L 4B9CA 3C8KA 5EEZA 5CJOL 5GRWA 3H2QA 4PVLA 1A3LL 5D1XE 3CX5K 2EEDA 3D08A 4R4FL 4XC3L 1MJJA 3N50A 5AOJA 4NQDA 5J0BA 2R2HB 2JH2A 3MV9D 3ZHKA 4OZIA 1E4KC 1X6LA 3P77B 4V33A 1OTSC 3IDXH 1A4JA 2DEWX 4N22A 3WL9B 1F4XH 2ID5A 3PRZA 1SY6L 2BERA 2F9BT 3K6NA 2VN4A 3NDZE 4J6IA 4P5MA 2F7OA 1XF2A 2MOVA 3CBRA 1GGTA 4IIQB 2X0UA 1YNTF 4N90E 2AKRA 4EUPH 1YQVH 3V9CA 3KS0H 5CP7A 3V0DA 2ICEC 1NGWB 2VB5A 1BG1A 1G4MA 1PZAA 4P06A 5GRVK 4M93B 6PCYA 2GHZA 1GA2A 4PRPA 1C16B 4PTUA 2OS7A 3VI3F 5KSAC 5KVEH 5DZOA 4L8BA 1U8NB 2AQ1A 3MLSH 4FXTA 4TVPD 2GABA 1BZ9B 1V3JA 4FQ2L 3Q8BA 3D85B 1DVFD 4RDQG 3G7TA 3KL3A 3OHMB 1SDYA 3THMH 2WD0A 2VO5A 3ZTNL 1T4KB 4I3GA 3ARZA 1TQBC 3KWUA 3KLLA 4X9YA 1LQBC 4MFHA 2GIYA 3QGVA 1FGVH 2X12A 4U1LA 4ABUA 3K6SA 2XTJC 4Q9RL 4UQ9A 4YSTA 1QFUH 2LV4A 4JO1L 2J88H 3FQNA 4TOYH 4LQFL 1NL0L 1XTMA 3RTLA 2ZWZA 2W92A 2IPTL 4PRNA 4QT5B 4ZTOH 2VXTH 3UZQB 1J9CT 1T03L 1OXYA 1BGXL 3C6LC 1CTMA 2RIKA 2P8MB 3RPIB 2CBOA 1IJ9A 2JF1A 4PVNA 3FUJA 3GTNA 3BWSA 2R29L 1IC4H 1FN4B 3IKCB 4BE5A 4WO4D 4JRYD 1NGPH 2BVQB 1CIUA 2J1YA 4ONFL 4Y2DD 1CFBA 1KCKA 1CUOA 3W38A 2NY1D 4KY1L 1WFIA 4PJEF 5B39B 4NGHH 5FO9B 4NQCB 5EZLB 3U0PA 3BWUC 1NC2A 2R1XA 1D9KC 3QZMA 3JV0A 2WYTA 4P2OA 4RFEA 4B0MM 4TUKH 2F19H 2UX7A 1FNEB 3LHPH 1LNUA 1E9PB 3MR9A 4NDMA 4WJKB 4XE0A 3UROR 1JGVL 3BWUF 3UZVA 2H9GA 3OPZL 4JHAL 2FR4B 5MERB 4WHDA 1H3WM 3MRIA 4L4TB 4FQHB 1A22B 1UHVA 4GP5B 4F7EA 3B9VA 1FN4A 1SOXA 2IQ9L 3DO4A 3IKCA 3MV7E 3P9MB 3ZE1F 4HKXB 4YFDB 5E23A 1F3DJ 1WWWX 3L9EA 5CUSL 4PJEA 2VOTA 3DPBB 3MZGB 5H2BB 1EEYB 1IIIA 1CE6A 1FCGA 5GGTL 5K33A 3W0WE 1AGCB 1YJDC 5E00B 4TL5A 4HUNB 2JK5A 4Z78B 2J55A 4L3ED 1JERA 1D6VL 3BSZL 3NACL 1INQB 4AGQA 4RAHA 3IT8D 4EAEA 4E5XA 4UQBA 4EUPG 5GIRB 5DVMA 3E8UL 2XSKA 3EH1A 4RGOH 1BQSA 4IHOA 3F7PC 1TQWA 4ZUSA 4EI5A 1JVOA 3MRPB 5J7CC 2H47C 4M9PA 1RH8A 5F97E 2H9GB 4FQLH 4GKOA 3IGAA 3UACA 1ONQB 1JXGA 1J5IA 3QO1B 4JRYE 3NIGB 1NBQA 1TG8A 1D9KD 5JW4Q 2A6DA 5BZXA 2LVCA 1JDAA 3SYPA 2J6EL 3DDFA 3VFSB 3JWDC 2ZXEB 4IBVA 4AVJA 4ZW3A 3KPMA 4KPHH 3ETTA 5KJRL 3MV8E 2NMSA 4LASH 2Y5QA 4MAZA 3QJVB 5FUOH 2EKSA 2EXYD 2D8KA 1F90H 4WTZG 4ZAKB 3TBCA 3G6AA 5C0ND 5I1GH 1KMGA 1MFCH 4G42B 5CSBA 2X2HA 3QCVL 3VWKD 5IFHH 1KT2A 3DURA 2V3EA 4FQIL 4K07A 5CP7B 1A7QH 2DIEA 2OXGB 3NFNB 4PJBB 4PRIB 1O6TA 1FUNA 2IOMA 1GSMA 4H5SA 1CXIA 1T1YB 2F7RA 4KRPB 4GLRH 1R24B 4ZSOA 4BFOA 5CLWA 1MVUA 3TBWB 3MOBL 1I7RA 4G7VH 1GL4B 3TCLB 1KTBA 2C26A 2R4SL 5FA3B 2Y23A 4G8GA 4BSWB 5LDUA 3B5TA 2ZIDA 3QQ9C 1UEMA 4FERA 3TFKC 3MRLB 3I2CH 1MVYA 1NIAA 4YS4A 5C2BH 2A9ML 3NTCH 2NW3A 2HYMA 4PV9A 5JW3L 1MWAB 5HJDA 3T6XA 5EORH 1TZHB 4WU7B 5CSZA 1LO3H 2MQ3A 1ZA3A 3PIQB 3QPQC 4XPBH 1EGJL 4H8PA 2XN9B 5FUCC 5EEWA 1WV7T 2OSLA 2PTTB 1OP5K 4IRJB 3ZDZB 3Q48A 3T08A 3B3IA 1P7QA 4PREA 1XD0A 3CVBA 1WICA 4AZUA 1XF3B 2DQHH 1RZKL 2HG5B 2Y6SD 5IY5B 4NQUA 5DEFB 1H0DB 2EE9A 5EULV 4MJ5B 4R7DA 3T1WA 4OM0L 2IDTA 1AVAA 2B1HH 1J0IA 2XCMC 2E27H 2WYZA 4QOKB 5MENB 3FTZA 3L1EA 4E42A 2H32A 2BHYA 3QULA 4XXDA 3VE0A 3WEBA 2QHLA 2W91A 3WL9A 4HZLA 4NKOA 1HEZB 4Y2DA 2BDNL 3TBSA 2V0AA 5K9OA 1CLZH 1P4LB 5FM5O 4DKTA 5CN3A 1E7VA 1MQKL 1CFMA 2VDKL 2HMIC 2Y2YA 3ZL4H 3VUAA 4P3CH 5D1QA 1M57B 4ACTA 4Q56A 1Q94B 5ITFB 3JTBA 5F71A 4HC1L 4TUJA 4Y19D 4YHLH 1H15B 4MYPA 1UWEL 2IANB 4IKNA 5E6IA 3AWEA 5IB1A 1AZRA 3CVHB 3UYRH 2ZP0T 3SE8H 4WCYH 3B43A 2D73A 3OKNB 3QNZB 1G7JA 4NQSA 3GXTA 1CJYA 3BJ91 4YHZL 2BSTA 1RY7B 1IFHH 4JFFA 2C5DC 4H4NA 3CC1A 1S5IH 4JFUA 1KGYE 4WI9A 3HBPA 1NINA 1DSFH 1G84A 1IZJA 5EU6A 5I6OA 1B0IA 5DVOA 2P7TB 1A4CA 4WUUD 4MD4B 2G5UA 1G6VK 4ANUA 2DWEB 4OGYH 5AL0A 1OGTA 4OFDA 5I74C 4HUVA 5CFHA 3UCQA 3REWB 3V6OE 3HC3L 4LLVB 4N9OB 4PJCF 3HR6A 4NHUA 4V1DA 1HNFA 2QHRH 5I1JL 2X44D 4GRLA 3QCUL 4Y5YA 4CJ0A 2DZEA 2E4TA 3G6DL 4HS6A 5L2JA 1CO1A 2VDRL 1JHTB 1FO0L 1T04A 2F74B 2FO8A 3FSAA 3QEGH 1D5XB 4K0OA 1T1WB 3RGHA 3QZBA 3WE1A 4JRFA 2FIKB 1R5WB 4H8WL 4RMQA 1NCWH 1LEKA 1S9WB 3KDMA 2WLLA 3MJ9L 2JJSC 2HLAB 5IHUL 1FJ1A 1JMZA 2YKLH 3HZMA 4AYMC 4LGSB 4ADJA 1JPFA 1XF1A 3RWDB 3S6CA 4DP6X 5GJTL 1J86A 2XI9A 4L29B 3ARDC 3GSXB 4A2MA 4L29A 1RPQA 1C8QA 1BSIA 5F1OB 2WVUA 5J1SC 1OW0A 4GW1A 5KVFL 3FQWA 4KROC 2AK4B 3F3HA 3Q6GH 2VLRB 4HBCH 1IQDA 4Y5VA 5HYQA 4MAUH 1T1WA 2WVVB 1U8IA 2H1PL 1H3PL 2F2HA 4CMMB 1I8KA 4LFHD 5AAPA 4HXAH 3H6AA 5DS2A 1CFQA 1LO3L 3TPKA 3QEQE 3QJFB 4NUGH 4PYGA 4JUTA 4N6RB 4G7YH 4CNIB 1S7WA 4IRJD 2X53A 1H3GA 1I82A 2PTUA 3NN8B 2XWCA 4X50A 5EU4A 1MVUB 2YZ1A 2O6PA 1OARH 5CN1A 5C0FA 4IM8A 5G2NA 3RDJA 3MDJA 4CILA 2FZ3A 1ONQA 4Q9CA 2OQJB 1RUKL 4CU7A 5LGHL 4XX5A 3KE0A 5E5RB 5J57B 3MACH 1GTNA 1E4HA 3N9GL 1A66A 3VD2A 3ZL1A 4LLDA 2W94A 1I8IA 1CDYA 1R46A 5DFAA 3ZYJA 5J12C 2R1YB 3WIFA 1C1EH 5F89B 2LAGB 3CN4A 3C5ZA 4POZD 2FHBA 2VUOA 5JDJA 1GIGH 4RGNB 3ULVL 4J3OF 4M7ZC 5AVTB 3T0EB 1U8HB 3MRDB 1IZKA 3VMOA 4HK3N 2ARWA 4X6FA 3NA4A 2BNQD 4PY7B 3VXMD 3DV4B 3DVNA 1WS8A 3HE7B 1TETH 2H8PA 4ZMZA 2QT6A 4MBRA 4UQIM 4PJFE 3IPBA 1BFOB 4UOZA 1QA9B 3T77B 4EIBA 4AE1A 2CGRL 5DJ2B 2V37A 3CZSA 4PQXA 2PWHA 4PJ7B 4FQCL 4XMPH 3OGCA 4JZOB 2C3HA 2XG5A 3K46A 1XR9A 4OCWL 3EDKA 3DDGA 3NYKA 4M56A 3ZKNC 4XOAA 4EO5A 4IBQA 3WAJA 2NX5D 3FSWA 3QZWA 2EYRA 3VAEA 5I74B 2AJZB 3M86A 2K3TA 1HINL 2OCJA 1M3IA 2P1YA 3EFOA 4WV1C 5EU6B 3U4BH 3HG1B 4L4VE 3GXIA 3BPLC 4ZFGL 3IB4A 3CPLA 5DRXB 3NZ8A 3I02A 4AM0B 1JPGB 5DRXA 1QLEB 5B8CA 2UXVA 1F02I 2I27N 4R4FH 4L2LA 4G5ZL 3BZDA 4NSKA 1R47A 1BQUA 4OLEA 3FSZA 5TDOB 2CDEA 1PPIA 8CGTA 2BP0A 4BFKA 2PXYB 3DRTB 1FZMA 4ETQA 4X0KB 5T3ZE 1VDGA 4V1DD 1NMAL 1KBKA 2XQYA 4M3HA 4FD0A 6FABH 4MWFB 1I1AB 1MHPL 2C9PA 3QPKA 3VD7A 3Q06A 3O81A 5L8KB 1A0QL 3D69B 3QIWB 2BVQA 4JW3A 3FF7A 4G3YH 4I89A 1U8QA 4IIZA 1AFVL 4YDIL 4DEUA 3QFJB 4DP0X 3VQ2C 4CUCA 2NRDA 3VYOA 1ETZA 1UB5B 3WTTA 1BVKA 2VMJA 1P1VA 3FU3A 2G60H 5ADOL 3QWOA 3ARTA 3KH3A 3NJVA 1NL0H 3HNSL 5DD6A 1JTTA 2N1KA 3KLKA 2VM3A 4K9EH 4JR9L 2VXUH 4UZUA 2V5TA 4U33A 4QT5A 3OXRA 4DGVH 3MXWH 4D3CL 2BOBA 1UYWL 4CRPA 3QFJE 4POZC 4N0CC 1NFDE 4R9HA 3BQUD 5IJVA 1QSVA 3WNPA 1IM9A 1WAAE 1SOQA 2D7OA 2F15A 3MV01 4HT1L 3P9LA 3MNZB 3UPAA 4XNYL 3ZE0E 5IHBA 5D5MF 4XB8A 4DGYL 3OR7A 3U0WL 4JQIA 1MH5A 2UY7B 3DK0A 3EYSH 1NCDH 4C58B 2A77H 2VDLB 3GTTA 2W80C 3HC3H 5DO2C 5EU6D 1WHOA 3CFJA 1MNUL 3H42L 1SJEB 12E8H 2ZP9A 3D87B 4HMCA 4Y2LA 3MJ7B 3GXMA 1UWXK 3AROA 1XCTA 4D94A 4JM2B 5FKPB 3D18A 4M7ZB 4KX7A 3BAIA 5TK4A 2YAHA 3FAXA 4XCEB 2G2NA 2F61A 3QHFH 2Y7NA 5ABZA 5JPMC 4LPWA 3BP6B 3OAYH 1O6SB 1TZOA 5BVJA 5AD0B 3WGVB 3RAJL 3ALPA 3E6FB 1PAMA 2OMXA 1J7VR 4OZGA 1AGCA 5E00A 1BBJB 1CE6B 4LARL 1AS6A 2AF2A 4QF1A 4XI5C 4JBSA 3IDIB 1T7YA 1QR4A 5KBDA 3TT3H 3TF7C 4ZT1A 3TEYA 4ZD3L 4K23H 2ZWKA 1B6DA 3HNTH 4OIAA 3OJDA 3KAAA 2X9ZA 1NTDA 3RBGA 4BCYA 2DM3A 5C08D 1KLGB 3DSNA 3UBXB 4A2DA 1JNNL 2FEEL 4U2YA 1V3MA 2WKOF 2AJ3B 4ZO7A 2UZPA 4A04A 1KENH 3VFSA 1A7BA 2VR8A 4JHWL 5C9JA 5L8JB 2E76C 3TJEH 4F2EA 3MV9E 1IE4A 3FB5B 4OM1H 5IHZB 3B5GA 4DZ8A 3QJUB 1BXUA 3L3KB 2AC0A 2HJLA 1JCVA 2CNZA 3LKQB 5E6RB 5C1MB 2XLLA 2CBMA 4UT6H 3SZ6A 5F1IA 3VXRB 5C09E 3PPEA 4QHLA 4Y9EA 1TZIA 4D8OA 3UTTB 2M2DA 4ZOCA 1RZ7L 1O5DT 1S4IA 3DBSA 2VDNH 4AL8H 3K0YA 5K9QI 2P5EA 3SE6A 2WXGA 4MMYA 1X9LA 3D0VA 3KMDA 1I8LC 1ID2A 1YSOA 2CBQA 5MEPB 2W88A 4YHYC 3K81A 4LDEB 2D7TH 2FRGP 4ZS6C 3OMIB 1G0XA 4UOQA 4ERSL 1MSPA 2OL3H 3FRUA 3GHPA 2O5NA 3QDMD 4EKJA 4F3FA 5KYUB 2Y0SA 4MQSB 4BELD 3MV7A 3ZDXE 3B8YA 1WE5A 4OVUA 2L3BA 4BIKA 3KCPB 1D5MA 1A3QA 2XYCA 1AHWB 2ZUVA 3I3BA 4HGWA 1AYRA 2YPKA 4ODHL 3U9WA 3X17A 1QASA 2J8OA 2V7NA 4P5TD 3RNKB 1M05B 4ZMXA 1RPUA 2AJXH 3ESNA 1ZIAA 2IBGA 3SE9L 5CGYC 1B2WH 3BEVB 1DBBH 4PRPB 3PL6D 3GKZA 5ILTH 1AE6L 5HHNA 5CINL 3S37X 3D48R 4Q6IC 4JR9H 4H8HA 3M8OL 1YHPA 5JIHA 2COVD 3UTOA 1OK0A 4M6AA 43CAA 5TK2A 3EXJA 2J88L 3P0YL 3SPVA 4ETQB 3C6LB 4KRLB 1ACYL 2DOCA 1NCHA 3P73A 5TF0A 2NNXA 4PD4K 4YXKH 5IW1A 4JM2C 4WW2F 1PKQE 3ARGB 2HVJA 2DMBA 3SD5A 4M7KL 1MJ7L 1T5WB 1A8JH 1SLVA 1NCDL 1HYSC 4PS3A 4M6OH 5HYSA 5LGJB 3MLVH 4WJ5B 2CMRL 5T5FA 3GHEH 5F7HA 5FWQA 3DPDA 3FOMA 2HFEB 3LRHA 1AQKH 2B1HL 2MNWA 1IEHA 1I9JL 5HHVL 4AGMA 5HHMB 1U4FA 3TO4A 5CJ5A 4NHUB 3QHFL 4V1DB 4RMUA 1TJIL 2NW2B 2YGVA 4NN5B 5E5MA 3EKCA 3FHEA 5IB2B 1HCYA 1T89A 1UT2A 5IW1B 1VFBB 1KN4L 2H6OA 3P4MA 3NZUA 4P2RB 4A39A 1DSFL 2GJ6A 5IUSA 5CO1A 4L5FL 5ANME 4CN1A 1H8OA 3J27A 4H1LH 4JFDE 4WAFA 3TT3L 3U6RB 4ODVH 3HFMH 5J1AA 4XP5H 1S7RB 3MHZA 3N85H 2UX6A 4HIEA 2ZOUA 1KYUA 3GSUB 2KH2B 2PXYC 3ZQ9A 2VQUA 5FGBA 3T0EE 4HJ0D 4HV8A 2XV2A 3SE8L 5E8EA 5EO9A 4IIQC 2D3LA 3L9RA 1I75A 4DP4X 3CH8A 3VFWA 4PLKC 3RJQB 5BZDA 1E90A 3M45A 3UIZA 3W37A 4AW4A 5DS1A 3ET9F 5E1GA 4PMEA 4GAYB 5EZJA 2J4WL 1MNUH 1D7DA 1U8OB 3T2PA 2BPBA 3OL2A 2E7CA 4MCYB 4PUBH 4NNPL 1OIOA 2R2BA 3FN0H 4JFWA 4DW2L 2AGJL 5G5DB 4QYOB 1L4IA 3MU3A 3SY0B 1MCEA 2AANA 3B7YA 1EXUB 1Q72L 2XG4B 3EG9A 5DQDL 1AHWC 4WV1A 2NY2B 1UOVA 2JB5L 4O02A 4BHUA 4U1SA 4U2ZA 3ZT6A 2VXVL 5CFAA 2FHCA 4JANB 4E41B 2IG2L 4YSCA 2Y3NA 4YHOL 5CM1A 2X09A 5EZJB 3NEEA 1I85A 3RVVD 5F1IB 1VKXB 1ZKAA 4G42A 2YS4A 2EECA 1O9ZA 2IBZX 1UZ6F 1VZGA 4LDOB 1TTCA 3CZFB 1YG9A 4JFFD 4FQQA 2AJYL 4XZUB 3KXFB 4IRJA 5LJYH 1AD0A 1OCZB 3BUQA 3S37H 4FI6A 2X4NA 3F58L 3FT9A 4Z9KB 5C08B 4OQTL 1P7HL 1A7OL 4M8QB 1WVZA 2IH3A 3V8CA 3X12B 4HWBH 5KVDL 2FWOA 3HRZC 1SQMA 4ZDHA 4X4ZA 3HJ0A 3IXAA 5FO8A 3EH3B 2JKRM 4YHPA 2X40A 5KYWA 1GZPB 1ZV5A 3P4OA 4BQBA 3FO0L 3KPLB 4S1DC 3AS3A 4IRSC 4Z7VB 4UU9B 2B0SH 3N44B 3MBWB 2MTPA 4NIYE 3UPRB 3BKML 5F3HA 1ACXA 4XMUA 1KWKA 3V4UH 1U8LA 3T3PF 3BAJA 5KVEL 3OKMB 2HVKB 5JHDE 1VEMA 1AR1B 3EJJX 4GO6B 1U36A 3LOWA 1PIFA 1X5IA 1WBYB 5BMFH 2W0FB 1YPZE 4BZ2L 2MHAA 5CEZE 4YPGA 1U3JA 4IKKA 4C83A 3S34L 4F7MA 2CHNA 2JELH 2FCBA 2DS4A 1WAPA 3SE3C 3U9UB 2CIIB 4XNQA 1CBVH 1ZWIB 5I1LB 1XCXA 4ZUWB 4KHXH 4KROD 5C7ZA 1AG6A 4JO1H 2JLLA 4F20A 4EF3A 3PHQA 5TFSL 4Q6IA 4BCXA 1I8MA 4ZI8A 1MCWW 2VABB 1J0JA 5SWQB 4ODTH 1DJSA 3BP4B 1DDHB 4A2EA 5D7JC 4AM0A 4UIKH 2F5AH 1HE8A 2WNKA 3MRHA 1IV8A 4F7CB 1DQLH 1QLRB 1MWAH 3L13A 5DK0A 5DJZA 4LBAA 4P4RB 1Z5HA 5SWSD 1F13A 4DZBB 2FNWA 1FZOA 3WFDL 1T22B 3MRRB 1J0HA 3TV8A 1Q9LB 1O5PA 1IM3A 1RLWA 3F01A 1BQLL 3D69A 4AQ1B 1UFGA 3OJ2C 4XXCC 3U4BL 1F1AA 3QP3A 1MJ8H 3S98A 3G08B 1LO5A 2JIXA 5JHDD 1HOCA 5CZKA 5KSVB 3QQ9D 4ZBJA 4DEPB 4JQXA 1WCBA 2CR3A 2C1OA 4EDXB 2DQMA 1UT1A 4A63A 1XH3B 1F11A 3MROA 5HDWA 3VA2C 5FYLH 4Q7DA 3AC0A 1SOKA 4B96A 1DP0A 1S7UB 1TMCB 4GBXD 1OAQH 1XQ4A 3L5XH 4UCFA 2OI9B 2B7DT 1EH9A 3JV5A 4U31A 5EG6C 1IM3D 4HPYL 4FJ6A 4ISVA 3KNBA 1KXVA 1B9KA 1U8MB 4KRMB 4K5PA 4N2EA 1ETB1 4QRQB 4Y2OA 1RAMA 2ADIA 1CL7L 2IGLA 2DM7A 2VISA 3EFFA 4I4WA 1AI1L 1E5AA 5F96L 5CIPA 3UTSA 3VFUA 3PWJA 2ENJA 4PJ8C 1QX1A 3F7YA 1DJZA 4FHBD 4ZAKD 5GGQL 2YLHA 5FB8B 3I9IA 4UUJB 3R8BB 3M17B 3C5SB 5IVXB 1WFTA 2BHZA 4PJAB 2FECI 4Y5YC 2ZWNA 1LWHA 4WRLA 3ZDYB 1KIQB 5CGTA 3CDZB 4LEOB 1ZTXE 3S37L 3BH4A 4NO0D 5F6HI 1HNGA 3DJ9A 1ZDQA 1DVQA 3KPNB 1UD8A 3G5WA 4XE5B 2YOCA 3HAEB 3H3KA 4QHNB 2DMKA 1KXQA 3G5YA 3S7GA 3V4VH 2PP7A 1L0YA 2HB0A 3H9YA 3KPRD 3BLKA 3RWHB 2G5BA 3FOLB 1NBZB 3INUL 1A9BB 1UZ8A 4E9VA 2X89A 3ZKMD 3HNVL 4B95C 4XTRC 1WA2X 2BSBA 4KK8D 4PJDF 5I0WA 3ZJAA 5F89A 1KY7A 2OMWA 2ILLA 1CI3M 2A0LD 1DEEB 2IV8A 3VGAB 2V3DA 5I8EB 1ZT7B 1MFAH 3H42H 2JB5H 2FO1A 1P7BA 1KNOA 4OGAC 4PJFA 3HKFA 4Y9GA 15C8H 4BINA 2QLVB 1TJGL 5AVYB 1KIUA 1G9MC 4PJXA 1WYJA 4XN4A 1RK0A 1P7KA 4KJYB 4MS6A 2ZOKB 5I2IB 2DI7A 1WFOA 4BZ1H 2H0EA 1XTLA 3LIZA 3PCYA 5KVEE 2IOIA 3O4LD 2XQBL 4L8BB 2VKXA 3L4CA 4JJ5B 4DERA 2YAQA 1A7RL 2NXZC 2W5PA 3EHBD 3ERXA 3RWGB 3FQYA 4JQVA 5KEZA 3MJWA 3RVTD 2K3HA 4OLWH 2Q86B 1MZYA 3T0VA 5FLUA 3QT2A 4PB0L 2VTFA 2DQUL 3THML 3LMJH 4BQ8A 2CO3A 2ARJB 1NCJA 1U3HC 4L23A 4JFDD 3DO7B 2FT7A 3KG5A 5AOMA 3WFBL 4M61B 1NEPA 4PJHA 3BEWB 4WVRA 1PKQA 3ARVA 4CC4A 4Y16C 4K8RH 3OAYK 1W72A 3MRCA 4XX1G 5MEPA 5E4OA 4L1DA 2QPSA 1XB6A 2BOCB 1NBCA 4HOWA 1F8TL 3P77A 1CFNA 4FL4C 4XBEH 4KKZA 3JQOB 2HFTA 1YJDL 2VITB 2ICWB 4UAOB 4J3OH 1Q8MA 5E95B 4ZMLA 2E7LC 1B4RA 3MLUL 1SMDA 4XPHH 4MWFA 5JIKA 4BD4A 3D85A 1DDTA 1NEZB 3BDYH 4NENA 1K3IA 3CFBA 3MRBB 2ZCHH 3V4VB 5CMAB 4MKMA 1UATA 3L5WA 1UZ6E 1GOFA 4LSUH 4PWKA 4UV7L 1HFUA 1IKOP 3RNKA 5JOPE 2FJFA 1H19A 2W07A 4M5ZL 1T6WA 1CICD 4NO5B 3RJOA 1WZAA 3R19A 4D9LL 5ANHA 4OCLC 3W56A 3T65A 2A83B 4R7XA 4JFTA 1QFWL 3RWIB 3C60B 4NP4H 1QHQA 3TBVA 1U21A 4RDQF 5DS8B 3MGOB 1BD2D 4A6YB 4WTZA 3FTGA 3ASWA 3JUZA 4JM2F 4WW2C 1Q9WA 4N9GA 3IMWA 4BFNA 3KPSE 4K9JA 3MXWL 4D3CH 4OAWB 3ECUA 1S2EA 3INOA 4X98B 2UZXA 1P4BL 4X4ME 4UNUA 4NNYB 1ZCRA 4BFGA 5A2CA 3RVUC 4JDVB 1K8IA 3OKKB 4GQ9L 4Z7NB 3WUWA 5ID1B 2ICWI 5ILTL 3SJVB 2XICA 3BE1L 3P11L 3V5DB 5I1JH 2LAAA 3FNKA 1BZ8A 2AAVA 2WLKA 1Q9KA 4DTGL 4HJSA 4JKPL 1RPKA 3D18B 3ZSTA 1HIML 5CEYB 2O61B 1QNZH 1GAFH 4P8QA 1IC4L 2PETA 3BQUA 2OYPA 3VD0A 4NN6C 4L1SA 4AV0A 4S0SD 2HMID 3PWUA 3EOTH 1AG0A 2AQ3A 3IPEA 2CLRA 1P84J 3SGDH 1N3NA 4YGVA 3CFUA 2BZ7A 4AENA 3US9A 3B1UA 3ZQWA 3I50L 1A6VL 1PF3A 3P1VA 1MELA 2MCMA 4PB9L 1JP5A 1TO5A 1FJ1B 3N85L 3OJDB 4HH9A 2A4ZA 4K3HA 1NDMA 1FL6A 1R19A 3OB0K 5F0JB 1G7HA 3DGGB 2DAVA 2FSEB 2FDBP 3OQ3B 1CDHA 5I0YA 3SOBL 3X2QB 3T4YA 3OHXC 2EVIA 2YPLE 3FZUC 4P2QE 4FCHA 3W3BA 2JB6A 3LN4B 4ELMF 2YAFA 3QJOA 4XTRD 5DO2D 4WFGE 3O6MH 4QRUA 3T71A 1ZLUK 1OSPH 4Y8DC 1HJCA 1YYLL 3WN5A 4QOKE 3WN5B 4GAYA 5MENE 3QDAA 4B9PA 4YPJA 1IMHC 1EA9C 4DEPC 4L5FH 4AV5A 2BP8B 1W80A 1INDH 5TGBA 1DVZA 2CHWA 3GJEB 3AAZB 4OCXH 1QTPA 1GPOL 2ADJA 4UIMA 3HAEH 5GRYA 2OJZH 1JPSL 1U95A 2Y7QB 4NKQB 2DL2A 1QW8A 4WUUB 2LFGA 1JV2B 4R26L 4AZ8B 1D9KB 1T1YA 4I0CC 5AVSB 2YQ2A 1NCOA 5A6MA 3VNZA 4LLMA 1CGWA 4C4UA 2CO1A 3UTQA 4ESKA 2XWEA 3V0WH 2WSKA 1RZFL 5GPRA 1QPXA 4AL8L 3KHOA 4JKMA 2RAMA 3BO8B 4PGJA 3K5SA 4WKXA 2WQSA 4HBQA 5B38A 1AS8A 3IFPB 3M1BA 1PYWA 2F54D 1SXNA 3OAWA 5L2KE 3T6VA 4P3WA 1WD9A 1I8UA 1TFHA 3QORC 4J3OC 5EU6E 2EC9T 3DVIA 3QI9C 3TBSB 3HI1B 4YDLB 3MBEC 4GAAA 3ZX1A 4RESB 2EVJA 1DVFC 4LPVA 3F84A 1QQDA 3TYGH 4A2LA 4EZKA 2BOLA 3RUGB 1OB1B 1KPUA 2YAOA 2WGNB 4X7SH 5KG9B 2R27A 2ZUYA 1GW0A 2BK8A 1ZLSH 4AKQA 1T3FB 3WIHA 3L1OH 3TEZA 1FI8C 5I2IA 3B8SA 1CK0L 5I1IL 4FADA 3TONA 2AK4D 4Q9QH 4N9GB 1EEZB 3LXCA 3SODB 1M56B 2EKJA 4AT6A 2NY3D 4HFWA 4YSAA 2H32B 1OW0C 3NG5A 3H54A 3VVVA 3CN2A 4P46C 4JB9L 2K4WA 3SKMB 4H2CA 1SGKA 4NQQA 1AQMA 5AW5B 3WMQA 3L1GA 3V0GA 5EUKB 4HIPA 2HLFC 3FMGH 1A4BA 3ULUD 4BQCA 1GZHA 2OK0L 3WY2A 1XR8B 3LEVL 4NO5A 3HCVA 4XBEL 2GJPA 3OBAA 1OALA 3EZJB 4F2FA 3BLBA 1OTSD 2K45A 4DJMA 1NMAH 4XN1A 2FJGB 4NLHA 3C09B 2GAZA 3FTXA 5D1QD 3PV6A 3NA9L 3SGEI 3WKQA 2BX5A 2A73B 5T3XH 4LLWA 1BEYL 3VI4F 3LKNA 5T3ZD 4G80A 9PCYA 2OL3B 2ZXQA 3U9UA 3TBYA 3SKUD 5I1DB 1N5AA 5FYLE 2MCAA 4O58H 1WIUA 4FG4A 1S6NA 1KCVH 3F7RA 3D7PA 2SEBA 4NFDA 4D8PB 1L9SA 1X7SA 3BKYH 1RL1A 4NRZB 5I73B 5HJGA 3OV6A 4JRLA 1A6WH 3RVXC 1A9EA 1TCMA 3N55A 1DHKA 2HFFA 5DLMH 2ZPKL 3MX0B 3QIBA 4HK0A 5CZXD 2E75C 4OUOA 2PWGA 1GY1A 5INDA 3PABA 1QLRA 1F11B 3MROB 2OMZA 3ARYA 5C6WH 5KYNA 1M1XA 5IB1B 2NX5E 3ZK0A 3FT2B 4G6KL 3QHTC 1AIZA 1SRDA 4GRLD 3P9MA 4Z7UF 1MFBH 1E8WA 4NPYB 4F27A 2YXFA 2CK0L 2Y1ZA 1GS8A 1G5AA 4D8PA 4R2GC 1OM3L 1NEZG 3CH1A 2GHWB 5CEXA 2ZD0A 1S9WA 1AYOA 2ZXAA 2DKMA 1LEKB 1R5WA 3GNML 2QQKL 3KDMB 4FZEH 4QXGL 2WOBA 1INDL 2B77A 4J3SA 1P5UB 4MQXD 3PP4L 3OR7B 4POYA 3ATEA 3VXME 4NQCA 5EZLA 3U0PB 1MAMH 3SBQA 2VL5B 1WZ1H 2XRAH 5TH2B 2XY2A 4XPFL 3HUJB 2F58L 4G7YL 1NIDA 3QDGB 4MJJA 5ADPL 2A38A 3PS6A 1BF5A 4KVNH 3NSFA 4MDJB 4NZRL 4MQTB 3CXHJ 3LHAA 1M71A 4NLAA 4IU3A 2EDKA 4HIJB 1M71B 2BW4A 1YN6A 5LGHH 1HL9A 4OLYH 3U30C 5I1CH 1OOWA 1J5OL 4EIZC 1BM3L 3QSKB 2EKSB 3B34A 1EEUA 3GZPA 5FYKE 1NAMA 3TZVC 3F6IA 3QC5X 4OF6A 1SJXA 5JPNB 5AW3B 1PFOA 4L4TE 3AJ7A 3FB6B 2VXVH 2OMVB 4P49A 1IGCH 4X7TA 4HF5L 1OCCB 4JFDA 3NCJL 5G5DA 1I7TB 4LK4A 4OI8A 2QVTA 1N0LB 3WFEL 1HXKA 4JHWH 2X6UA 4TQEL 1MFCL 4M8QA 4BRVA 1YEIH 4MA7L 2DTML 3RWCA 3TCLA 2X3AA 3MYJB 4UM8B 4DCQA 4ZPTA 4XVOA 2EYTB 1DSYA 4CC4C 1G7MA 1I4FB 3UBGA 3L3GA 4LSRH 4ZTPL 3L2MA 5BO0D 1U2YA 2FBJL 1NAMB 1X44A 1KDJA 4QRAA 3NCMA 1MCLA 4YMPA 1OSYA 3BN9C 1LD9A 1RZPA 4F8OA 3R4RA 3QQ4A 4LO9A 4NKOB 1HHIB 1JXFA 4HALA 4HJ0C 3X1EA 4DKEH 5IW6B 2YPLB 4P2QB 2G9HA 4AIEA 1HWHB 4OF0A 1OCRB 2ENYA 3MAWA 1NLDH 4IJ3C 4GG6F 5DI8B 4XZ4A 3MPCA 3MCKB 4NZUH 3VXMA 3NCXA 4NHCH 1BIIB 1CGYA 2AXFB 4LGPB 4UM9D 4PJ5B 2VQ4A 5ISZB 1HKLL 5D72H 1UC6A 3V52L 1CXEA 4R3SB 1KB5A 3FUHA 1XR9B 4E0RA 4XO5A 2R2HA 1R6VA 4RRPA 2DM2A 1LO2H 4JFXA 1Q9OA 1J8HD 3KCWA 2DQGL 5H94A 3QQNA 2JCCF 4FXGC 3LTVA 5FYLD 5IR1A 4XOEA 3L4ZA 4PW4A 5JQ6H 1DO6A 2VE6A 5DJ6A 3VCLB 5E9DB 2ZCLL 5E9DA 1TENA 2WQ8A 2KHAA 3IDUA 3Q3GB 2AV7A 2AQPA 4J1UB 4LVNB 2XZQL 4DT2A 2CJUH 2EIJB 4LHUG 4MA1C 2F8XC 3K2KA 2EDHA 4ILDA 3D1MC 2BSRB 4PLNC 2GK0B 4NUJB 5BZWA 5IGXH 4I9XA 4ZW8A 2CPCA 4LVEA 1XF4B 5EF3A 3IDYC 3ZDYF 2VZSA 1P6FA 4FFYL 5AENA 2Y72A 4BK5A 5HPMB 1F6LL 2X4RB 1HH6A 3QZNA 4P2RE 2NT0A 4ETYA 4FXLA 4AGLA 1A6ZA 2D9QB 1H6EA 1BVLA 3DX6B 5FHBH 5AB2A 5IV2A 4QRPE 3SJVD 2C4FU 4TTDC 2QELA 3QZWB 2WLZA 5DJ0B 4QRPB 4BUGA 3G5VA 5LG6A 2H6PA 3GZKA 4E9LA 4HJJL 4ODUA 2QSQA 4WO4A 5T1DL 1BOGA 2A74C 5AWNH 4U6TA 1WHPA 1WUNT 3LRMA 4ZOEA 5JR1H 1DBJH 5ELIA 1WCBB 3WG7B 1EAPA 3V5HB 4EI6B 3MRJA 2IQAB 5DYOA 3T3ME 5JPMA 2OW6A 1XR8A 3P0YH 3UG3A 2YAMA 3FT2A 4OF8A 5D1QB 4YHML 4UDTA 4GUPB 1CDIA 2QZQA 1NBYB 1WO2A 4Q0XH 1UA7A 2NXYB 5BNXD 2EABA 1IM3B 5BRZE 4OGYL 1U58A 2V9TA 3VRJB 4GMSL 2CSPA 1CB4A 5BVJB 5D93C 1JK9A 3IFOA 1M3JA 3Q43A 4JQXC 1BM3H 4OAWA 5D55A 3VI3B 5EC1B 5DZNA 4XCCL 5LWYH 1JUFA 5FW7A 2ZOWA 2G60L 3ECVA 3GDCA 3Q5TA 1B9ZA 3HG0A 4TRPL 4EEEA 3FQXB 3RZCB 4KXDA 3I75A 5I19L 3IJSA 2J8UA 4ZOBA 5I0XA 4FGMA 5GS0H 4DGVL 5EU4B 2JQZA 1RUPH 5EN2B 2XFXA 5KUMA 1EZVX 2E86A 4WJ5A 2BSSB 3V9EA 4AQ1C 2DQDH 3BPLB 4BH8A 5AOZA 4EZMA 2HJFB 1RSYA 2ICCA 2WCSA 3QJZA 2DH2A 4LLVA 3FQUA 4E41E 3REVA 3L5HA 1RQ5A 1BECA 2FBJH 4KNUA 5HSFA 2PYEE 3A3YB 3ARFA 2CE6A 3MBED 4EDWL 2CAKA 4LCYB 4LCWA 3KLAB 4JVWA 3OVUB 3V0JA 4I0PC 4YE4H 5HD8C 5IF0A 2YPLD 4P2QD 4G6MH 5D7EA 3BKJL 3CHPA 3V9FA 3U30B 4E68A 1ADWA 4ZX4A 4IQHA 1YEKL 1BIIA 2FB4H 4PRPD 3VJ6A 1H6UA 2JQAA 2RACA 1NCCH 2ITDB 2WZ0A 4HCRL 4I9WE 4G71B 3HG3A 1XMWA 3ROOA 4XAWH 5A2AA 1QEWB 1MJJB 1RIUH 4OU3A 2WAHA 3KYMB 1Y7VA 3IRZA 1Z3RA 2AJYH 1C5DA 2GFBA 4QUOA 2VE6B 3I50H 4ZSOE 3QEHA 1IBYA 4K23L 5GZNC 4HIXH 4J3TA 3CAFA 3IJ7A 3L45A 1RK1A 1PYWB 2ZCLH 1BQ5A 1GPOH 1XGRA 3GEWB 2Q87A 2AHIA 2UWEE 3QPXH 3F65A 1AXTH 2EICA 1DBML 3NZHH 1RJLA 3WKMH 4BV1A 2ATPB 3CXHK 1ZHKA 3NSJA 2AXFA 4NZDA 1CZ8L 3I2CL 1KBVA 1U0QA 3EJSA 4XVTL 1KLFA 4PWHA 2VRQA 2P5EB 5HHQB 1RZQA 4TUOB 1B4JH 5E9DE 3Q8EA 1CFNB 3CJJA 1KTCA 5HHOD 1CD1B 2YFOA 4PWFA 1CTOA 2WOYA 3CZKA 5D8JH 5HHME 2DJUA 3KYOA 5AVQB 1YNTA 35C8L 3NFSL 4GUOA 3UBHA 4BA0A 1RJCA 3ESMA 3LKQA 2IFFL 4X9FA 2UZIL 2GT9B 4AH2A 1M2VA 2KPWA 2DW5A 4IIQA 1ZV2A 2YN5A 3PJSA 4TNFA 4KROB 4QHLB 1GGCH 3L5WB 2XN9A 4TQHA 4BE6A 3PIQA 3I84A 3CVDA 1P4UA 3RLSA 1NH6A 3VX1A 5M94B 3P3YA 1MJ7H 2LABA 1F4AA 4MA3A 1QHPA 1G0DA 3RUGA 1S7XB 1J5CA 3HBQA 2WLMA 3ZKXB 3VGHA 4A7TA 2YN3A 4R3SA 3EAKA 1HYRC 2D7MA 5E4EB 4QRPA 3WFHA 3OB0H 1Y1UA 4LCIH 1QVOA 1R3IL 3MRMB 3UL4A 4JHVA 2K1MA 4AEHL 1QWHA 4R90L 3SKOB 4LKXA 5F3BA 2D0GA 3Q8AA 3HC2A 3O3BB 3BPCB 3IMBA 3HTLX 2AABH 2YRPA 3MLWH 3SQBA 2JTYA 2PTVA 2UXTA 3DTXA 3MRQA 3BZFA 2Z3FA 1A9EB 4QTFA 5HYJB 4OFQA 5K9JH 3GSWB 5J6HB 4FCAA 3HG1A 3KGSA 4RLDA 3GMNB 3SE4C 2EE2A 3SO3B 1FYTB 3KVQA 1BEYH 1JV5A 1RVFH 1S9VA 4FNTA 5I76A 1NLBL 1OAUL 5HHPA 4LSSL 4YH6A 5J5EA 2AK1H 2BCKB 2B15A 3DX7B 4U1NB 1ZT4B 3B2MA 3QDJB 3P9LB 5CLZA 5ECGA 5I5MA 3QRGH 5JNYB 4XO3A 4UDUA 3GIVB 3QUGA 5A7BA 2E9BA 2UZYA 2VL4A 1F90L 4J3BA 1TTFA 2GIXA 3D0LA 4GAJL 3BZ4B 4K7PX 3D12B 4PUBL 4K7PL 5HYSB 3FFCD 4YC2C 5KOVC 3QUYD 2GUOA 1JPFB 4KUZL 5C0EB 2VLJA 2IPKB 4G6FB 5AB0A 3STLB 5GS3A 2A4EA 1UD6A 4BKSC 2Y22A 1G7QA 4FNQA 1OF2A 1EQWA 5I16A 3QJQB 1YUHB 4JAMB 3PHOB 2FX8L 1AKJD 4KKBD 4DZ8B 5JHBA 1TQUA 3RGVD 3ZDWA 1O7DE 4N0FB 1SEBA 1A6WL 2G2RA 5D1XD 1IEBA 3WN6A 4DN3L 1W0VB 2FX9H 4CVXA 4GXUM 5FK9A 4A7GF 3QXDA 5FK9B 5LXGL 2F53B 3O9WA 2OR9H 2Z65C 5J1TC 2JIXB 1F6FB 1MAML 1UM6L 3PWJB 4Z7WB 1OQOA 2VW7A 1PG7H 3WKML 4YWGH 3ESPA 1I8AA 4B9FA 3WFCH 4GQRA 3IDJA 4WO4C 2X2JA 3TH3T 2QQNL 5I6XB 4K71C 4EMZA 3BUTA 1E4WH 3FO2B 2G3ZA 3JWOH 5E7FA 3HE7C 3T6ZA 5C0BA 4I3SL 1L7TL 2QR0B 1O0VA 4L3FA 3HZKA 1UKSA 2F7IA 5C0AD 5FYKU 1NMBL 4FYRA 4YK4C 5IEKA 3NTCL 2R1YA 5KJ7E 3QDJD 1XHHA 4Z1PA 2VW4A 3UO8B 4KJPC 1FG9C 3S5ZA 4LCWD 1E7UA 4CA4A 2AEPH 4K3JL 5GISH 3KJ4C 1UVQB 3PQYB 3WJLA 4FE9A 4LVOB 2DYPD 4ZMQA 1RFDL 2X4QB 3WN5C 1BF2A 1YEIL 1KGIA 4PGCB 2IH3B 2J1KA 1W8NA 1I1RA 1QA9A 1E9OA 1ECYA 3MI6A 1QI4A 3L2LA 1QRNE 1A6UL 5DJ8A 2C34A 2V3FA 4HQQH 1QSZA 2FH8A 4WFHD 1E27B 3W9DB 1F4HA 4PWGA 4KFMA 2NQCA 1ZTXH 1F2XK 5FGRA 4PJCA 4F8NA 4B9JA 2C3XA 1TVDA 2GFBB 1EAQA 4HEME 1W91A 5JOEA 1NOLA 1ORSA 2OMWB 2YMTA 1NJ9B 5F3HB 4GJTB 4OI9A 2NT1A 1M42A 1I8MB 3JWNG 1IGFH 2Y36H 2ZKXA 3QJSB 2EUXA 3DUUA 3SN6N 2E59A 1NQBA 4JDTL 5DJAA 1CFVH 1I3UA 1ND0B 4JB9H 3OF6A 3Q05A 2IMNA 3VXUD 2RR3A 2VN5A 1T3FA 4AQ8C 2VGLM 4X6EA 4XNBA 2OJ1A 3ML8A 2JLPA 3FT0A 3SDXF 1JRHH 2XG5B 3FW6A 2MOGA 3LEVH 1YMMB 4N0UA 2QV2A 4E9YA 4YXHH 3VMNA 2CMRH 1N5AB 3A5VA 3NCBB 2Y5TA 2C7UB 1S3RA 3WV0A 1JN6A 4AX3A 2YD7A 1ZVSB 3D3VD 4MSWB 4WEMB 5CN2A 4BA8A 4G5ZH 2P28B 2BH0A 4H25A 4WWKA 5BJTB 3AQXA 2P5WE 3CV5A 2DV6A 1A5FH 1N26A 3OZKA 2KDGA 4X5LA 1SM3H 1MJ8L 2KDYA 1EBAA 1A2YB 5C3TA 2N4IA 3ZT5A 2DYRB 3P3UA 1QZNA 1O9VA 5C0CA 3MLYL 4KUZH 3AQYA 5D7IE 1OGTB 4IBZA 4LSDA 5IQLA 5DC0A 1MHPH 1SN0A 4R6UA 1TEYA 2OMNA 5ICXB 2Y1AA 1LWRA 3WYRA 3UC0H 2WC7A 1OAQL 43CAB 1JGUH 4ONOA 5ICZB 1KTRL 5DHVH 4AENB 1BD2A 1MXDA 3IFLH 1D5XA 4IS6A 1R3HB 2CD0A 1I9JH 1JF1B 2FLRT 2VCOA 5B1AB 2H3KA 4WKZA 2Y06L 5KJ4A 3WMSA 2FX9L 3QJRB 3GXNA 1E0OB 3MRPA 3KBHE 2XXMB 2IH1A 4GEJA 3WDHA 2IH1B 2DQIH 4TNWK 4GFXA 4L18A 1OAZH 4FP8L 3S5LG 5E4AA 4Q97A 4YSQA 2K7QA 5L88L 4Y19B 2NY1C 3FQWB 3KLQA 3OWEA 5H8DA 5F0MB 3TEWA 4GBXA 1C8PA 3QS2A 2VKWA 1X5FA 2YD1A 4IS6B 3LKOB 1Q9WB 3STZA 1ACZA 5LWYL 4WSGA 2WZAA 1U3HB 2X1OA 3QEUA 3VQLA 2E8ZA 2R7EA 1JDDA 3R4DA 5F9JA 5C92A 4WI3A 3L08A 2EDRA 1PFCA 1W72L 2OTUA 2GJ6B 5EIVA 4XMVA 5I8EA 3CHSA 2XV0A 3RI5K 3IAQA 1U8PA 4WUKL 3RAJH 2WIIA 3QUYA 4PJXE 5GHWL 2BCMA 2OULB 4A6YL 1T1ZA 1DQKA 1MHHB 1BAGA 3APCA 5DUML 4RWYL 2DBLH 2CJ3A 3B2PA 3W9DA 2AGJH 2EXYC 4BFRA 4GSRA 2O61A 2AQNA 4RFOL 3DMMD 4RMTA 5D70H 3ARPA 4NT6B 1AD9B 1F4YL 5T3XD 3APFA 5FOJA 3RYMA 4WI7A 4ORGA 3TX4A 4PI0A 1MWAA 4K73A 3VMPA 3RWEA 4DUVA 3RILA 1DQMH 1FE8H 2YD5A 1S78D 3GSNL 1UVQA 4IOIB 4ZUUB 3WCYA 1RURH 4UUJA 1R17A 3T0ED 1M7DA 4FC3E 1GCFA 2WTPA 4RWHA 4CL7A 3RWFA 3TJEL 1ND0A 4JEGB 3F8UB 1TOXA 3B2VH 4NBXB 5DJYB 4XODA 5CJXC 5TE4H 3GJFH 3MRGA 1QLFB 4OT1L 4M02A 5GGRB 2Y4SA 1AGEB 3UGXA 3RWHA 1WBXB 1RUMH 4N8VA 4R0LB 2LE9A 3N44F 3D3VE 1JRHL 1TZ8A 3CIQA 4K3EH 3S0PA 4H0GA 2VDLL 2CO7B 5LCVL 4PI2A 5IR1B 3UBXG 4CVZB 5IFAL 3QVAA 5IJCC 1XBDA 2ZTBA 2WNGA 3L3OB 3UC2A 5EOTB 3LEXA 2JELL 5BJTA 4UQAA 4BK4A 4NRXB 4X7FC 1ZA3B 4HAKA 1A5FL 3HMXL 1NGWA 5FAAA 3LDBB 3GSQB 5IZ7A 3CUPA 4M5YL 4NKMA 4FX5A 1BLNB 4IOSD 2VRAA 1TQVA 2WGXA 1ZTXL 3NH7L 4J8RB 3V0VA 4ODTL 4UTAA 4ZFZB 4BFFA 5HPMA 4FTVA 1X3DA 1NCAL 3ZL2A 4HJUA 3AB0B 3ZL4L 1I7RB 3OJVC 2VAAA 4O51A 1PLCA 2WQRA 4EI5C 1IAOB 3BN3B 3OLDA 1MFDL 4XBGA 3LB6D 4WZ9A 4OV5A 1BV8A 2ZONA 2H1XA 4HKZA 3I9PA 3KJ4B 1QMUA 2DDQL 3HI6H 1RV6X 1X5LA 4U6XA 2PWFA 1EAOA 1M7XA 1ORSB 1V8HA 3FPXA 4G3YL 1ETZB 1LEIB 1LEGA 2Y06H 4XGZA 2UVEA 4EI6A 1U6AL 4HP5A 2DKSA 1B0RA 3RP1A 3W81A 5IMOA 3Q1SL 3BE1H 2YGPA 3P11H 4FQ1L 1IEAB 3WBDA 5HI4D 4GO9A 2BNUB 4X5RA 1ZA6A 4Q6KA 1MEXL 4HG4K 3ESOA 3AT9A 4JE4B 1FYHB 2YUZA 4HS6B 4M6NL 4I0KA 2DD8H 3LZLA 4NUMA 5D7LD 2B08A 4BRJA 3ULVF 3H7BA 3V0IA 4MJ6B 3K71B 1MI5A 5H2BA 1GGCL 1YYML 3D4YA 1SNRA 3L4WA 2QSCL 2JVUA 1GGYA 2DJ4A 3HVDA 1AGFB 1Z9OA 4N2FA 3L16A 3P4MB 3JT2A 5EBWB 3SQBB 3LIZH 1HOEA 1UWFA 3FHQA 5H37H 1SYSB 3FBQA 3BFOA 4D9LH 4ZW5A 4BFIB 4NCC1 3S2AA 1LNUB 4NDMB 3AXLB 5I17A 5ANMA 1AJ7H 5DD5L 3TESA 5C09D 4XP4L 5DXWA 1BWMA 2FO4B 4U6YA 4IRZH 4JKNA 4Z3EA 1RUPL 2DIAA 3BVUA 4RISL 1ZT4A 3QDJA 5E8PB 4G70B 3II3A 4MB4A 2DICA 4DQOH 3VTMA 4YSUA 4I77L 3ARXA 4K7PH 1VACB 2DIJA 3UBXI 4JRXD 2PUQT 2YO3A 5FC9A 3HZ3A 1UGKA 5K59E 4ZMWA 2GBVA 1N8OE 1T1ZB 1SLXA 4KJPD 1VHPA 1GH7A 3MREB 3VJ6B 2KQNA 4HV8B 1CICA 2KQMA 3QDMB 3TCXA 3FB7A 4K2UL 4PWIA 3FB7B 1G7QB 3QG7L 4IRSD 2AK1L 4ANVA 4GG6B 4M5TA 4CN6A 4OIFA 1YEKH 1IGCL 2Z7UA 1J0YA 3WO4C 3AZUA 1PVHA 1LK3H 2IV9A 1JS4A 3H4HA 5DHDA 2RFXA 3C9NA 1MIML 1A7PH 3FCSA 3D8MA 2ZCKH 2NY7H 2YKLL 4BKTC 2XQBH 2ADGA 4UIMB 5IQ7L 5F7FA 1ZEAL 3VRIA 1BX2B 2F8IA 3QUXB 4N2OA 5TDNB 4HETA 2BVUA 1CXHA 5FV1L 4OUUA 4O2CA 2X4NB 2F68X 1QSFE 2KYIA 3FO1B 4YBLB 5KSBA 4J6RH 2JI2A 3C87A 1N6UA 2AK4A 1DSWA 3NJNA 2FJHB 1AP2A 5GS2D 4GAGH 3RJDA 5ERWA 3EOBB 2D03H 4YDJB 3Q8CA 4E9TA 2BINA 4NZUL 2YSSB 3BYYA 5EEXA 5FA4B 5JDSB 1RJYA 1U3YA 3IF1B 2Q20A 4LVHC 2AKRB 4G8IB 5TE6L 1I1AC 5A3ID 2NNAA 4K5LA 3ZTCC 2X4SA 3IDMB 3SQOH 4JO3H 1SJVA 3S48A 4RGMC 3T3MB 2P3YA 2H2PD 4PJDB 1Q0XH 2K9UA 2QTEA 4TQPA 3GMRB 4YO0B 4M6OL 5CNHA 2GEQA 3C8KB 3QH3A 4PJ8A 2BP0B 3BAWA 5K5YA 2ITCB 4L4VA 3EYQD 2XA8H 2AXGA 2JCWA 3P69A 2OMUA 5EBGA 3ME0A 3P2TA 1R0AH 3ARSA 2A6IB 3IN0A 2XBTA 1L6PA 3O6FB 4ZUTB 4F58H 2WV3A 3APNA 3X3GL 1F8TH 2WXMA 3C6LD 4M4RB 1OVZA 3VFOB 3O3BA 1PD6A 3MLRH 3MBWA 4LKXB 1OT4A 5F3BB 5JW4M 4N4YB 4JY4B 4X6FB 3EFOB 4O02L 1GS7A 3BX7C 5DZAA 5CBAB 1KCSL 5DFVD 4GQZA 1KZYA 1TLMA 5GRUH 3QJXA 5CU5A 2QPFA 3SPHA 4KK9D 4DOHE 4EVNA 4EVNB 2WBXA 4GKSA 1MFDH 1TNMA 3GRWH 1QEXA 4L4VD 1YEGH 3FJTA 4GKZB 4P46A 1I9RL 5K9JL 4UNTA 2W0LA 2IOOA 3OGCB 1B3JA 4JZOA 4XN5A 3TO4B 5JPNC 3SGKA 5CF3A 1EGJA 5E51A 2YXWA 4HLZG 3TBYB 5I1LA 3I6LD 4AIZB 1HINH 2ZX7A 4RISH 4P07A 4APXA 4FLHA 2WLJA 4ONGH 4TOYL 5ACZA 5HY9B 1AOZA 1WJ3A 4NEHB 4H8UA 1K5WA 1I9IL 1KXQE 3WFDH 2QQKH 3FFCB 5J89A 3NCCB 5FHBL 4Y4FC 3AS0A 1ZIBA 3QORB 3UO1L 5ESQA 3V0FA 4ZAKC 5HDRA 2BNQE 2BSED 2O26U 3GF8A 3OXRB 1FGNL 3CSTA 4K2UH 5MP6L 4JVUA 1O6VA 1VIWA 4HCGA 4N2DA 4OFKA 5ADPH 1XH2A 3VM7A 3VXTB 4Z3FA 1MRCL 3FUFA 1S5HB 3H7LA 2EIEA 4LCVA 2PYED 2QFRA 4KZDL 3NMEA 2IADB 4JPVH 2XWBB 3RGVB 2Y2TA 3CHOA 4JFFB 2YHGA 4OB5L 4GS7B 3S4SG 4QF1B 3IS1X 3MLTA 2NX5A 2P24A 1YEWA 4OCNC 1NOFA 3QIWA 3D09A 5E2TH 5DO8A 3TN0A 3DSFH 1CDUA 2YQGA 3HZMB 4BDVA 1EERB 4F9PC 3GLZA 3KYKH 3O6KH 2GJRA 3ELQA 2HRHA 4LE8A 1CYGA 4X99B 1CR9L 4O2CB 2P5EE 4AYDC 1HQRA 1SHMA 4I13B 5K1VA 2WXQA 1E8XA 5C0GB 4I48A 4F15B 5LXGH 1MFBL 1KLUB 2G2PA 1Q90A 3US1A 5HBBA 1JGUL 2J2ZA 1IE5A 4G8GB 4BSWA 5FOBB 1H3XA 1HH9B 2J73A 2VDMH 4H88L 2IADA 4UTAH 5DWUL 4MD5A 4PJIA 2VLJE 5I6XC 5DRNB 3WDJA 2VDQL 4ZQKA 1KENL 1S7QA 4FHKA 1R3KB 1IAIL 2R7EB 4PRHD 3LD8B 3O6ML 2OXGA 1GSKA 4HUMB 5BS0A 3CFMA 1F45A 3U25A 3VFVB 4MS8D 1HAUA 1M7DB 1GY2A 2BNRB 3A4FA 1S7WB 1PMYA 3AQZA 4I0PD 4PU2A 4NCDA 4AK2A 1J05B 1QBLH 1ZS8A 3QDGD 4W9JC 2ZXBA 1X5GA 1I7ZB 2O4EA 3F58H 3L8QA 3D34A 1RUQL 1VERA 4LLYA 3BH8B 4NZFA 1BG9A 4OZHA 1DVTA 3QPQD 5E99L 4B9KC 1EDYA 1UM4L 1HU8A 2EYTA 5GS0D 3IDGB 1HS6A 3RGBA 1CLOL 4UOJA 5DR5L 5CHNA 5EOQH 3WJLC 3G3LA 2YGNA 5EU7E 1WITA 2X2UA 5HI4C 4NCC2 2C3WA 3BAEH 2JE8A 3QQDA 3R7QA 3TWCL 2H26A 3NIGE 3O11B 3VRLF 3POCA 3ETBF 5FFGA 2JKXA 2Y5EA 4H1LG 5KTEL 3D39A 1PNDA 4MGXA 1A21A 5EH1A 5FM5M 2CO6B 3HHSB 1QATA 1RD6A 1Y07A 5AZUA 3DUUB 4XN7A 1TUPA 5DYFA 3DO7A 1MPAH 1G1KA 4JM0A 4XI5D 1FV1A 3VXUB 3QBTB 1QTSA 2CUHA 3QFDB 3OPUA 4D7PA 3CVHA 1BAWA 4KXZH 3FQTA 3K6FA 4JG1H 4AL8C 3SYQA 1WG3A 3M7FB 5LCVH 3UTQB 1DLHA 3N42F 1JXKA 4QHKI 1U42A 5C0AE 4WWPA 4DH2A 5DZVA 3HR5B 4GIPD 3EJCA 3UG5A 5JORB 4KI5C 4KKCC 4L9DA 2CGYA 5FECA 1E43A 3HC0B 4NBYB 4Y19E 1SEQL 5AW0B 1BJMA 2MIZA 3QZOA 1EWHA 4PRHB 4KZEL 1A1MB 5JW4N 5LBVA 3ZZSA 4H26B 2FJGA 5DUBA 1SQ2N 1OP3H 5CGBA 4NQTA 1DQIA 1ZPUA 2Z64C 5TTRA 4U1MB 4KAQH 2VDMB 2WWOA 1JZJA 1SM3L 4OD3H 4IBWA 4MJ5A 4AI7A 3CZLA 5ICZA 1FFPB 1IQWL 1XSIA 3UABA 3T4AB 2MH4A 5EO0A 4JY5H 3T4AA 2XU9A 4XAKD 4AKOA 3QXAA 2EIZB 2WLLB 1R75A 4MJIB 5E5UB 3TA3B 3TYFA 1X4XA 3BPCA 3CFQA 4J2XA 2EDYA 4KI1A 2W07B 4ZNEA 3NEXA 4LEBA 3HG4A 4M3JA 1S78C 1G7IA 2E5EA 5FX3A 2NSMA 3GNMH 2VR4A 1BGXH 3U36B 2COQA 4QO1A 1C08A 1L9MA 4B0MB 1B4TA 1ZA6B 5FOBA 4PGBB 4KK5C 4GB9A 5BVPL 1RUAL 5JYMA 4RAVA 5CJQL 1IGTA 4Y9CA 2B3IA 1SXBA 3CH1B 4XPGH 5FYKD 4LCUB 4QDGA 4ES9A 4YXKL 1E4JA 3AG1B 4UBDD 2VDNB 1JNJA 4CMMA 4NKDA 4I5BA 4NZJA 2OTWA 4KK9C 4X42A 2RHEA 3WJMA 5F93C 4OBRA 3KLHC 3LQZB 2Z8RA 4NWUH 4N0UE 4QTHA 1TQCC 2OR8A 3IDIA 3EGDA 5INCA 5AZ2H 4P9MH 1ITBB 5KBKA 3BPNC 3PJLA 4LQFH 5E6YA 3LB6C 2GCYB 2WPGA 4OCRH 1ZXQA 4APQC 3BKJH 3Q5YA 3B7SA 3SQRA 4L2YA 4LNVA 3DOSA 4IGBB 3VWKC 5EU5A 5CBEB 3NAAL 4FZ8H 1KIRB 4HIJA 5C70A 3IJYB 4OVVA 4QHNA 5CCKL 1UWYA 2ATKB 4AM0Q 3MUGA 5T1LD 3QIUA 2AV1A 3G5ZB 4LCUA 3RDTD 4BZ1L 4PJIF 3DX7A 4JGUA 3O3EB 1U30A 3SPGA 5IIEB 4OFIA 5KSBE 1PCSA 4RWYH 5DUMH 1ZY9A 3N40P 3HIZA 3JWNH 2VIRB 4QHUA 4BHUI 3RGVC 4QIRA 1XGRB 4AMKL 2BFGA 2Q10A 4S0HA 1OAYH 1G6RB 3NJIA 1B6UA 5L9DL 3QQXA 3BVWA 4MCZB 1AXTL 3ZGIA 1SZNA 5KN5A 4R7LA 1HJBC 3O41A 5TDPA 1XGZA 1MPAL 1HILB 3US0A 3FQTB 4JN2B 1WBXA 4N8VB 2B39A 3HG2A 4Y9FA 1H3PH 4N0RA 4UTBL 4D0DA 1CU4H 2YEZB 4K5NA 2C3VA 2OR9L 3LNFA 2JKJA 1NGYA 2R0WH 4M1DH 1S9YA 1DVFB 4Z7VA 5F7LB 1ILSA 4LRIC 2Z0BA 2XVKA 2OSXA 1RZGA 4KVCH 3AXHA 4PRDA 2W59A 1Q0EA 4K5MA 3SDAB 4JRYA 1ZEAH 3G04A 5IF0B 1I3VA 4G11A 3GJEA 2X6CA 4QHMA 5FS5A 4K3EL 5FEBA 4GIOA 1RJZA 3VXRE 4G9FB 4G82A 1RJZB 3ARBA 3EIFA 1IAKA 3CUPB 1ULVA 4NKMB 1ROCA 5E2WH 3WIIL 3GMLB 2OMYB 1G9ML 4R2GB 3BW9A 2FYYA 1ZK9A 4KKCD 1FP5A 4Z7QB 1QHOA 4Y2DC 3KYMA 5KZCB 3TF4A 1DFBL 1U8NA 3BH8A 2IAMA 1V27A 1C5CL 2AXGB 1IGIL 5D2NB 3EJQA 4ODXA 4OV5B 2V17H 2NQ3A 1MDTA 1OE3A 2HFGL 1MIEL 2HUEA 2QGDA 3ISWA 3NJJA 4GXVH 4N1CA 4F9LA 4JO2L 4HUWB 4R4ND 3TYGL 4G9DB 3GMQB 4HS3B 4XXDB 1IRAY 2AQSA 2UYLA 3MRMA 4C56D 4Z7QE 2XBDA 1EK3A 3CC5B 1PL3A 2GVYA 3NQKA 3APDA 3W9EB 3EYOB 4S1RL 1U9KA 4KKNA 2A9NL 5DD6B 4PRPE 4A67A 5E8NA 5F7DA 3II1A 2Q76B 4XNAA 4HWBL 2HRPH 1N8ZA 4MB3A 2HG5A 4OJDH 2IALA 4NRYB 4ZX5A 2QLYA 1NGZB 4QRSA 4EE2A 1R33A 4L8DB 2CO2A 2F5AL 2GAZB 2A9CA 2QKIC 5A1AA 1KCRL 3H3BC 4F5CE 4Q9RH 2JJWA 5HHXL 2F54E 4LB8A 4R7NB 4U6VH 4GW4B 1YECL 2DWYA 3KPPA 3DBXA 2QTVA 1NM4A 4JFOB 3KD4A 3T1FA 1ZK5A 4ZTOL 1TVBB 4Z7VE 4MJIA 3GJFA 2K0RA 2HWZL 3X3FH 5EEYA 3ZHDA 1LP9A 2BWDA 1FZJB 4AC2A 1P6WA 2YD9A 3GXPA 2CDGA 1YNKL 4X4MA 1E5BA 2EDLA 1IGMH 2Q3ZA 5BZZA 1DVSA 1ZHLB 3QNXA 3I02B 4OY9A 3T0DA 4KWUA 3VXQA 5AWNL 1Y18A 1T21B 1MQ8A 2HKHH 3IFLL 1VZHA 4M7LL 2G30A 2FX7L 5SX5H 3BZEB 5ICXA 1HH6B 2BO0A 1F3JB 1FBIH 3BDXA 3L3HA 4YDIH 2D9CA 4FYTA 4Z3TA 3W0WB 1HHKB 1N3NB 3CFCH 4YGVB 4OZGE 5I1EH 4HEPA 4FTVE 2NDFA 4G5AA 1CLZL 3MLYH 3BPOB 4ZMPA 3WEXA 2YUXA 5DSCB 2CHZA 1IC5H 2AXJA 4P2CG 1BOGB 5FGCE 1VACA 1CL7H 4CBPA 2R0LH 2WB1A 1RMFH 2YPVA 3BUDA 5F9WC 2HTLD 2K9FB 4B3EA 3VQ1C 1GC1L 1T5XA 3QO1A 4WW1B 5E0QA 3WY1A 5KBLA 5D1XC 1H8NA 1BQKA 1KJ2H 3EBHA 4RGOL 4C56E 3NJGA 1MRCH 2FYVA 3DGDA 3FU0A 4N5ED 3C60D 3S5LB 1YMMD 3C5ZD 3FTWA 4QRFA 4CSSA 4QRPD 5DWPA 5FDWA 2EUWA 2JK5B 4PGEB 4Z78A 1EEQA 3ESUF 2XC8A 3FT4B 2QADD 2HLAA 4QRRA 3KL0A 1XD1A 4APQA 2CKNA 4QTHB 2AP2A 3HNVH 1ILUA 1ZHKB 1AZBA 2APTA 3W2DL 4Z8FH 3JV6B 1GJWA 2R39A 4DESA 1SVBA 2DL9A 2LLNA 3GD1C 4GSUA 1THCA 3EGXB 3FYIB 4HHGA 2YZ8A 2DQEL 3PHAA 5IJKC 1TCRA 2E6JA 5FCSH 4ODSL 3NIFF 5FA3A 3GO1H 5LHDA 3VW3H 2E46A 1U3NA 1DQML 2AEIT 1TJGH 3MUUA 3WE6B 4OJFL 1KPRA 3LZQA 5GGSA 1V7NL 5HYQB 1SEBB 4J8QA 3JV4A 4WTXA 4L9LB 2ADIB 3OZ9L 1WBZB 2V2XA 3IAPA 1R3KA 1TZGH 2O6FA 3E0GA 1XGQA 1RJYB 3R0NA 4X7TB 3IK2A 3VFRA 3WUZA 3FAWA 1HN1A 5IW6A 5MEQA 2J43A 1HXMA 3SBWA 5IVXE 1FVEB 4G43B 1ORQB 3V6FA 2NXZB 3BEWA 4P5TA 3TL5A 3BEVA 5DT1H 1OARL 1SFDA 3PAVA 1E5CA 2KMWA 2N1TE 1UKQA 1YN7B 4W9LC 1DBMH 5KSBB 5H35B 3FO2A 2CCWA 1YMHB 3QQ3A 3HS9A 4O51B 1L7TH 4ZPTB 3BZ5A 2HT2C 4S1QL 3MODL 2HG0A 2PCFB 3K2MC 3IDGA 4HW6A 3DBXB 5KYWB 3CDGB 2W0PA 5I8OL 5CP3A 4K8RL 1KTLA 1EJOL 5KSUB 3HMXH 3OKEB 1B2YA 4KRPC 2OP4L 4UT7H 3V6OA 4YIQB 1AGBA 1CDCA 4J3VA 4ZMAT 3O6FC 1PD1A 5FO7A 1AD0B 3AQDA 3K1KC 4ELMB 1XH1A 1UXSA 1XGUB 3GS4A 3P4NB 1L9RA 4PJDA 2QDVA 2TRHA 3Q0HA 3MCKA 2EEFA 3RFZB 1NBVL 3BQUC 1UM4H 2BW5A 3MLVL 1NAKL 1FFOA 3BPOC 1TSRA 2ZSWA 1MFMA 2DQTL 2VERA 5E1QA 4K9EC 4Z7IA 3HB3D 1VB9A 4YSPA 3ZE1E 1FL5B 3U7AA 1X4ZA 3KPQA 4JLRA 2DWXA 5JUEL 3PWPB 2Q1EA 1XL4A 2W65A 2Q8BH 4OV6F 3OKYA 1ZSHA 2WZ5A 3VI3E 3WS6C 2OZNA 3MVSA 3QUHA 4NM4H 2AV7B 2NYYC 3LNEA 2VDPL 2ZUTA 1UM5L 4GMTH 2ZSVA 3QIWD 3G08A 3KXFD 3QARA 2LT9A 3NABL 1E6OH 2HT4C 3JWNC 3RWJB 4UT9H 4NN6B 4CW1A 4GKZA 1DQDL 3RDTC 4X6DA 3CFDA 4E9RA 1ACYH 3H1ZA 2Z31C 4W4OC 4H40A 3PLYA 5HHPB 1W72B 1D7BA 3LKNB 2JJUA 3MRCB 4UYPA 5DRZA 2ZX9A 5KS9A 2N59A 3H4FA 4HULB 5L4MA 2W95A 3FQRA 4EZJA 1G6RL 2PW1A 5IV2B 4XMZA 5DS8A 5F70A 3BDYL 2X7LA 1QFUL 1RVFL 1X4YA 3SZKC 1U8MA 4GI6A 4ZO8A 4Y16D 3FPYA 1ZLDA 1AIFB 3ZTJH 1AFVH 1EJFA 3A4AA 3BUBA 4R4BA 4RFNB 1X5XA 3PL6C 3TNMB 4UV7H 2J72A 5CSGA 5J1AB 4DO4A 3Q1EA 3C6SA 3P9WB 4Z7UA 3X1BA 3LS4L 3D51A 3QEGL 4BSVB 4PWJA 4X7CC 4XP6H 2AQTA 1NWPA 2JQMA 4MNHA 3O2VL 4NQEA 2UY6B 1AXSB 4I1RA 4XPFH 2XKUA 2E6PA 3FH5A 1GJIA 2EVFA 1R3LB 4W93A 2OYKA 3BVXA 2J2ZB 4AMWA 1IM9D 2WKOA 3G6JF 2BZDA 4PMFA 3UGEA 3FK3A 2HX7A 4U6HB 1BEXA 4K8RC 3S8GB 2BCKA 4XNUL 1FPTH 1HHJA 3EADA 4XNYH 4M8VA 4UT9A 4WI0B 5F88B 5BV7H 4RGND 4WI5A 3TNMA 4WWNA 5FCUL 2R23A 4FFYA 5EUOA 1QBML 1X5KA 4FNLL 4NQXA 2KLTA 1E3FA 1TF4A 3P30L 1DZ0A 3UJTH 1MLCB 1MLCA 4H5SB 2GCYA 3RVWC 5DGRA 2NZ9C 1AO7B 3CBKB 1HCZA 1HE7A 3LPOA 3L7FB 1T0PB 2JWYA 3HAEA 4WFED 4EDWH 3QDMA 3QXUA 3O3UN 2WXOA 5HDBB 4YHPB 3TP4A