2NNXA

Crystal structure of the h46r, h48q double mutant of human [cu-zn] superoxide dismutase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVQEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disease-associated mutations at copper ligand histidine residues of superoxide dismutase 1 diminish the binding of copper and compromise dimer stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2nnxA00
3KBFA 3GZOA 3HFFA 2C9VA 3GZQA 4A7TA 1JK9A 3T5WA 1BA9A 2AQNA 2GBTA 3HW7A 3KBEA 1PZSA 1HL5A 2WZ5A 4MCMA 4A7QA 1TO5A 3LTVA 3HOGA 1SPDA 1N18A 1BZOA 2WYZA 3K91A 4FF9A 2C9UA 2Q2LA 4BCYA 1OZTG 4A7GF 2AQTA 3L9YA 1F1DA 2XJLA 2VR6A 2C9SA 2Z7YA 1XTLA 4A7GA 5KBMA 1XSOA 2K4WA 2LU5A 2AF2A 1IBFA 1OAJA 2AQSA 2ZKYA 2AQPA 1XTMA 1SRDA 2R27A 1E9QB 2WWNA 1MFMA 1YSOA 1DSWA 4A7UA 4U4IA 1OALA 1OEZW 2GBUA 1UXLA 2AEOA 1E9OA 1PTZA 2WYTA 1HL4A 2XJKA 1F18A 4N3UA 1E9QA 3KH3A 2ZKWA 4OH2A 3L9EA 3CQQA 3MNDA 1SXNA 1Z9NA 3CQPA 1YAZA 1E9PA 2APSA 2ZKXA 2SODB 2WZ6A 3RE0A 1SXCA 1P1VA 1AZVA 2ZOWA 5KBLA 3ECVA 2GBVA 1IB5A 1B4LA 1JK9B 1OZUA 4OJAA 1L3NA 1YAIA 1SXAA 1U3NA 3H2PA 5KBKA 1Z9PA 3F7KA 1COBA 3MKGA 3CE1A 2NNXA 3PU7A 3QQDA 1TO4A 1SOSA 2E46A 1DO5A 1IBDA 1SDYA 3ECWA 1IBHA 3KM1A 1FUNA 1SXBA 1IBBA 3QQDB 1ESOA 1CB4A 1QUPA 2WWOA 3KH4A 3GTTA 4L05A 1N19A 1SXZA 2Z7WA 3GTVA 1F1GA 2JCWA 5CU9A 1EQWA 3H2QA 2V0AA 3SODB 1B4TA 2E47A 2WKOA 1JCVA 2AQRA 1PU0A 4BCZA 1F1AA 1UXMA 4BD4A 1KMGA 2WKOF 2Z7ZA 4MCNA 3ECUA 3GZPA 1E9OB 4B3EA 1RK7A 4A7SA 1EJ8A 2JLPA 1SDAB 1S4IA 4N3TA 1Q0EA 3F7LA 2VR8A 4A7VA 1E9PB 2Z7UA 3KM2A 1SXSA 1CBJA 2WZ0A 2VR7A 3GQFA 2AQQA 3S0PA
chains in the Genus database with same CATH superfamily
4QRRB 1E5AA 5DEJA 1GA2A 2FGZA 2X09A 3JTSA 2NW2A 3K2IA 4B9JA 5B7MA 2DB8A 3NCXA 4AQEB 2IALB 3CLEH 3DHPA 3WHXA 1ZD6A 4M7ZB 3TBYA 3VYOA 2IH3A 1VGEL 1SY6L 5DHXB 1GC1L 4AVJA 4DETA 4K3HA 1UD4A 2WLZA 2CWRA 3WD5L 3O9WB 3FB5B 3CSPA 3TEXA 1MFDH 2K0RA 4JO8A 1MFEL 3EGXB 4WENB 1B0GB 5AEAA 2VMDA 4NFDA 2YGQA 4LRNL 3QFGA 4KDTC 1X9LA 4LCYA 1UJTA 4XVTL 1GW6A 3WN5A 4M6ML 3VG9B 4JFHE 4PGJA 2YD5A 4KO5A 3EFFB 4UNIA 9PCYA 4MAYD 1Z1WA 1RJLB 3L17A 2DBLL 3ETBJ 4N2NA 4MB1A 1KCSH 3BSGA 4DGVL 3QRFM 3AADB 1LWHA 4FFTA 3UGXA 1AZCA 1OD9A 3BX7C 4XBPB 3HR6A 1VFBB 5I1IH 2UY6B 4JFDE 2JIXA 1PZAA 2C7FA 5JOPD 3PGDB 2Q8BL 3JWOL 2MTPA 4RRPA 2P7TA 2WTPA 1GGCH 4GAAA 1IE5A 4FYSA 1N2RA 2IALA 4UMSA 1T5WA 3UMTA 1KIRA 1RH8A 3J8F7 4OQTL 1QHQA 1NBQA 2IH3B 3B83A 4Y9FA 3REWA 5D5MF 1SOSA 3SKNB 4JFYB 3D87B 1P6WA 5ESQA 2F7OA 1U6AL 4U0RC 4X4MA 4WW2A 5DS8B 4FQXC 5T1DH 3V0WH 4HX1A 1A3LL 1WA1X 4HPYL 4RQQB 3OGCA 1TZIA 1T5XB 2R2EA 5EA0H 1JMZA 2KZ1B 3LY6A 5GS1A 4Z95L 2W92A 2WKOA 2XY2A 4AEIL 3VMNA 5EU3A 4LMQE 3X12A 5IEKB 4AQZA 4LOUD 1IKFH 1PSKL 3IMVA 3WIFA 1T1XB 2QTVA 1U4EA 4IKIA 5E7FA 3W57A 2EDXA 4ZUVA 3PL6C 4KC3B 4PP1D 1NGZA 2WXJA 5JQHC 1MHHB 2FL5A 4KX8A 2QPDB 4IOIA 1C8QA 5EEUA 3RNQB 5J11C 1GS7A 1NCIA 2A6JA 2VOTA 3ABZA 3NCBB 2YPLA 4N8CL 3SHSA 4DOHB 1M3IA 3OZ9L 4PLJD 1L9NA 4X8XA 1ZGLM 3FHEA 2ZCLH 3FOLA 2EDBA 2Z35B 3EJCA 2Y7SA 3PY9A 1AH1A 1O7VA 3HRZB 2AJZA 4TUJA 3FUFA 3OLEA 5DD3H 1P1ZB 4MJ6B 1I9JL 1WD8A 1A6AB 3OJDA 2AEQH 4I9XA 3OHMB 4X5LA 5DD5L 4Z9KB 3MJ8A 2ZT9C 5D5MB 1ZS8B 1I1AC 2JKLA 3V6OE 5A40E 3K5SA 1MCRA 5MERB 4A67A 2DEXX 5HHPA 3LMJH 5E9DD 5TDNA 3V0WL 2AHIA 4XX5A 1AZUA 2BOCB 2E6PA 3MRGB 2FJGA 1TEFA 4Z7VA 4YZWA 3WN5C 2DD8H 3K1DA 3X12B 5IEKA 3GI9H 1CG9B 3KCWA 3QZMA 1NDGB 4M61A 4J5VA 4AEIH 1T3FA 1T1XA 3K2MC 1HNGA 3X3GL 4FFWC 3ULUE 4IBVA 4DP2X 1MLBA 2UZXB 5D7SH 3GZKA 4P06A 4DHLA 1JP5A 2PNDA 2MQ0A 4YXLH 3OF6D 4BZ2L 5E95B 1Z0NA 5CINL 5E6IB 3P9WB 3BCDA 4RBPK 4Q97A 5I1KH 5A2AA 2YUWA 5I8CA 1ES0B 3BZEB 2CO6A 2BIIA 2ID5A 4PGBA 5JQ6H 1GOHA 1W72L 1QNZH 1BPLB 2WBXA 4NSKB 3LQMA 4N4YB 1FNLA 4M1GL 5I1GH 4LKXA 4PRIE 1MFBL 2Y72A 5SWSD 3GKWH 4LPXA 2WLLB 3QCUH 4TNEA 1Z9PA 5I8EA 3WEMA 4HLEA 1CF8H 3ARBD 2G9KA 4IJ3C 4DGIL 4EI5C 1A6TA 5HGGS 2F61A 3SE3C 1OCZB 3H9ZA 5ACLA 5HHPB 5E1GA 5CLTA 2X4NB 4PHXA 4F8OA 3L5WA 4TSBH 4PD4J 4AV4A 2WUBL 5IBTH 3LN4A 4AWJC 2X38A 5KG9B 3IEAA 3PUUA 1HE7A 4NPJA 3ZXAC 2ZX6A 4FQ1L 3AB0B 4HGWB 1QWHA 3AM8A 4ZTEA 4Y9CA 4MSWB 2VZSA 3IE4A 2DMCA 4QWWC 5TQ0H 3RHWF 5SV4A 4ICXA 8FABA 3MSPA 1NFIB 5I9QB 3TP4A 1OSZB 3ULAB 43C9A 4AY0A 4G8EA 4KQ3L 1P0SE 4ZDHB 2X87A 2GJPA 3CXHJ 2EYTB 4PJGE 4PB0L 5CINH 3ZDZE 3ZDYB 4Q9QH 4MD4A 3CFDB 3CN0A 1TZ8A 3W56A 4L23A 5AALA 1OGTB 2GKIA 3FSOA 2WZPD 1HKLH 1ZWIA 5ANMB 3KJ4B 1CDIA 4PTUA 5EOCJ 4ZT1A 3U2JA 2WTRA 3DMMA 3OB0H 4L8CA 4AEEA 1M71A 2XWTB 3ABGA 5I1GL 2YKLH 1I85C 5J6GB 4LCUB 1AI1H 1QFUL 3QQ9C 3S35X 5I19H 3CXHK 3MC0A 4FG6C 3I6KB 1K8IA 3ES6A 3CPLB 3NJLA 3RWDA 3LZFH 2A6IB 1T22B 4D0CB 1YEKH 3DV4B 1P4LA 2CHZA 2KDGA 1D5BB 1W0YT 5EU5A 1LEIB 1XF4B 1GZPB 4HKJA 4N1HB 2ZSWB 4WW1A 2HTLD 2MOVA 4FI6A 4RWHA 3REVB 3NA9L 2BNUB 4AYFB 2RTTA 5DT1L 3B9KA 2KMWA 1CLZH 4LQ1A 1S9KC 4Z78A 4P5TC 4Y9EA 4YZFE 4NFBA 5DHDA 3EBGA 1E8YA 4YSTA 1NCWH 1E9OA 3ZYJA 3GB7A 1UVQB 3FQNA 1NC2D 1ZIBA 4AQAB 1FNEA 3DX0A 1QSFA 3MGAA 1TPXB 5HVHC 3PQYA 4G6KL 4YSCA 5D8JL 4JCLA 1E3XA 4CSTA 3S37H 1OCCB 4C56D 3KPSE 5I0ZA 3MRCB 1AZVA 1FYTB 1CXIA 5IOPB 4OU3A 4ZPVA 2I9TB 4NQXA 1LO3L 4JY4A 2AXWA 1SYSA 5F6HI 4MAYA 2AXFA 1JWMB 1K4CB 3VE0B 1YY8B 4U1KB 1WICA 2X9XA 1AZZC 1KUMA 4M6NL 4X5PA 3VI3F 3O3UN 5BW7C 1RK0A 1YG9A 3EGXA 3UBXA 1AIFA 1RL1A 5EZLA 1YEKL 3PWNA 4BSVB 3HBGA 5E8EB 5T1KD 4XNAA 3T8XB 2JXMB 3VXTB 3CU1A 2J56A 1KYDA 3UO1L 4GKZA 5IHHA 3EYUL 1OM3H 4K5OA 2NQ3A 5HTSA 2WKGA 5CJQL 4MXVF 2VDOL 2JF1A 5L2JA 3RVXC 4YXHL 3SY6A 2XPYA 2Q2EB 2VQ1A 5IQNA 4PMEA 1BZ9B 2CO3A 1IT9L 4G11A 1UKQA 5TE7L 2WNKA 3QEHB 3ULVF 2BS9A 2OMXA 4MA1C 1RZFL 4AC2A 5DWPA 2MTAA 3V10A 2HLFC 3QIBD 5FYLL 3X13A 2AJSL 4PJDE 4AIZB 5IJVA 3M46A 3MRCA 3RL1A 2D3LA 5TK2A 2X4PB 1R33A 4KO7A 5IROA 1CFTB 4L29A 1LQBC 4OCYH 4B9FA 1GOFA 3SKNA 3T65A 3UCQA 4OIIL 5AG9A 5E70A 3HZKB 3SDCB 4I2XA 1GS6X 4HT1L 3FUNA 5D93B 4XMKL 4Q56A 4NZDA 2CLZA 5HHNA 4AV5A 5C0FA 3BDYL 2VWEC 3IMBA 4U1GC 1L7IL 5EV7A 1YA5A 5FYKL 4OI8A 1BZOA 1DR9A 2WVVB 3BFOA 5D96B 3S8GB 3QZLA 4LCWD 4L2LA 4HJIA 1NFDE 3INOA 4YHKL 4BQ8A 1IBFA 3IDYB 1R24A 4NNXA 3II3A 4CJ1A 5FYJE 1NAKH 1AY1H 4GO9A 4G9FD 4DERA 1J0KA 3TPUA 3CVBA 4FFYL 1FGNH 5IMOA 2HTLC 4NRXA 1TJGL 4ZFFB 2JJWA 5AVQB 2CKBH 3GMMA 4A38A 4A2FA 1EIBA 3GUTA 1JGUL 5EIIA 4NJ9L 1G7LA 1G7IB 3IGFA 4Q9BA 4AQ8C 1AQDA 1DCEA 4LK4A 3QG7L 3HS0A 4HQQL 4LDEB 1J5OH 1PCSA 3QWOA 3VI4F 2EDRA 2I9TA 5I0WA 3OPZL 4Z1PA 4PRHE 2DDQL 5BV7B 5C0JB 5F9OH 1GZQB 1PG7L 1J1XL 4XMXA 4GY4A 1TJMA 4PJAE 1LXMA 3APMA 1BG1A 3BDYH 1IGTA 4N90E 4U05A 1HH9A 2WGXA 5CP3A 3I3EA 5DUMH 1ACYH 1IGJB 1EEZA 1JGDB 5KBNC 1LGVA 5F72S 4F5CA 1SOXA 4N6QA 5SWZD 5E1AA 5EMYA 1X7SA 4FYRA 3TIEB 2CRYA 2R56L 4JFFA 1H3UA 1UD3A 4GB9A 4S0SD 4YHKH 3DTUB 3ARQA 3FNKA 3AAZB 2PP7A 1K5NB 1WJ3A 1D6VH 3D0VB 3VI4E 3WNJA 4QXWA 3ZR5A 1F11A 3WHE1 2YPVH 4MZ2A 3WELA 3G6JB 3GYRA 1TJGH 5FGCB 2QEJA 5GRYA 4R7DA 3MRFB 3S36H 4BWTA 3HS0B 2IPTH 4XNUH 5DMYA 2R1WA 4N3TA 2ICCA 4CADB 4OVUA 3K72A 3AQXA 3CC5A 3O0RL 4WWNA 1FZMB 3QO1B 3BZEA 1CDYA 4EDXA 4O02B 3T0EE 5M95B 3ULVE 3IVKB 2PW2A 4DKDC 3MU3A 1FC2D 3HTLX 1MNUH 4HS8L 4X6CB 2CLVA 1KGJA 2AAVA 3T8XA 1RIHH 1MRCH 5DQJA 2QSVA 3GEWB 5IB2A 1EVTC 2AXGA 5E9AA 1MUJB 3U7YL 5I0XA 1UD2A 4JHBA 3V0AC 4M5YL 1OHQA 1T03H 3MNMA 4KK8C 1YPZB 4TNGA 5E8OA 4Y19B 5EC1B 5I28A 4BK5A 5LCVH 1ACYL 4Q8BA 3DGCR 1PS3A 4NKOA 2HJFA 2KS0A 4HHWA 3BPCA 5D1QA 1YY8A 4DJMA 5EU6D 3RX7A 1SEQH 1ASQA 3WKML 4YSAA 1LO4L 4JJOA 3N85H 2DTSA 2K6YA 2IBZX 1OK0A 4UV7L 3VFTA 3RVUD 2ORBH 2Y5TB 1D6VL 3HFMH 4FNPA 1FI8C 1VGKA 4GINA 4D0BA 4J2QA 4RISL 2CJ3A 4LRIA 2F54B 1KB3A 5E51A 5ICUA 3STZA 1CICC 2BY3A 4AQAA 2VUYA 2DYSB 2BNQA 1G7IA 2HTKD 5JW5A 4EN3C 2EADA 2ZKXA 4K4KA 2WZ6A 3QYNA 4TVPE 1HNYA 4YLQT 4WY7L 1XGQA 3NJKA 5K5YA 4PJHE 4HJ0D 4GQRA 1G0XA 3AY4A 3FU5A 4N2CA 4L0YA 5ACZB 1R3HB 2I07A 4ODHH 4AQ1A 1RIHL 1W72B 2XN1A 5L2KD 4NQDB 2X2YA 4HKJB 2GY7B 2ILLA 4HBCH 4P9HC 3UTPD 2PWGA 1FAIH 4GG6B 3CHPA 2KLTA 3R7RA 4ZFGL 1T03L 1V7MH 1HH9B 4R7VA 5GIRA 2VZ1A 1MLCA 2P8PB 4YFLF 1T22A 3ARSA 5D1QB 1IBDA 3L3GB 1EZUA 4XE0A 1ORSA 2D7PA 1T1YB 1ZT1B 3IKCA 3VG0L 4Y7OC 4LIQL 3MNWB 3KGUA 3WEAA 5K9KB 3U9UB 5FDWB 3ZJAA 5TPWL 4GXUN 3N85L 4RFOL 2H8PA 5CCGE 1T4WA 4JM2A 5E8DL 5IBLD 4I88A 5IROC 4MKMA 4YBQC 3LQZA 3W9DA 2QKIB 5E1QA 4RZCB 5I76A 2X6AA 1FFQA 3O2VH 3WTVA 2Y7QA 4WHTB 5JOFA 5MEPB 1FL3A 4RDBA 4L5FH 1G5AA 3QNXB 4TUKL 3EYSH 1R4XA 3GMQA 4TV3A 1JVLA 5GS2H 4NDMB 4Z7WB 1JZ8A 3QI9A 1H6TA 1D5XB 3ZDZB 4MXQD 5B38G 1T2XA 4YBLB 1U8QB 1MZYA 1TVBA 4NT6A 3HHMA 4QRAA 3TO4A 3M7OA 2PTUA 5D4HA 2OBGA 2JI2A 1SYSB 4NO5B 4U0QB 3I50L 4KKZA 3AFLA 4U2YA 4FMVA 4MJ4A 1E65A 3RGHA 3DRQB 3UDWA 1A7QL 4DF9A 1KBGH 4K3DH 3SYOA 4JRYE 2C3VA 2WLLA 4JFXA 3TNMB 2EUZA 4MJIA 5E94B 2D3VA 5G5DA 1V7ML 3QJUB 5JW3H 4G42B 3KLAB 1AS6A 4MNGA 4M8QA 4QR7A 3ZIYA 3MYJB 1NSNL 4NOBA 3Q6FA 1VFMA 2TRYA 5I74B 4BH8A 5IQMA 1S7SA 4E9LA 4E9RA 4IQHA 4KRNA 3C2AL 3QW9A 1A7NL 1ZLDA 4QEGA 3KR3H 1OK8A 2YEZA 1EJFA 2R69A 2WQUA 5CUSH 4C4KO 5DJ8A 1CR9L 1IM9A 5KJRH 5JIDA 1IM9D 1TOXA 5A6IA 2CLRB 2AEOA 2X3CA 1FZKA 5I8CB 1NCOA 3O2VL 3K2UL 1CDUA 1S7UA 4X8JB 4ZUSA 3TVMA 2LQRA 3VFSB 4C83A 1AC6A 2FTAA 2X9WA 1KCKA 4EN3B 3O4LA 1XCTA 1P9MA 3S5LG 2APSA 4U2ZA 3N42F 4LASL 4R7XA 1S6NA 3C5JB 1CPUA 1HN1A 4UOQA 3JWNC 3ZDWA 3PLYA 2FBJL 1MRFL 1J86A 2QR0B 3LCYA 3NDZE 1UG9A 3N40P 3DYMA 4OLUL 4WHYG 4E0RB 4IEFB 3GSUA 4PTUB 2FIRT 3BQUD 3B3IA 2Y06L 1CLYH 2FECL 3QUHA 5EWIL 3H2PA 1IC5L 1LE5B 4Y4HB 1A9BB 4E9TA 1TETL 2NXZC 4YFLI 3K4DA 3QXDB 4G80A 4MA7L 2Y36H 1LL1A 5CCHE 2CKBA 4QHKJ 4WO4B 4OKDA 4XOEA 5FCUH 1DO5A 4DP0X 4BQ6A 1XB6A 3DWTA 1NCAL 3GO1H 4U1IB 8FABB 3F7YA 1R5VB 4W6WB 2WC7A 4X5WB 2YJQA 5FV1L 1Q90A 3MLXL 3P1VA 3MRPA 2JTDA 2VLJE 1VZHA 4OJFL 3EBHA 4XXWC 3MRHA 1FFNB 5I5MA 1CXKA 4NLHA 3W5MA 4NZJA 3LZPA 5E5MB 2X4OA 2ZAGA 2P7TB 1Z0MA 4NCDA 2JLPA 4C4BA 3WIFB 4KXCA 4G83A 2FDBP 2OPCA 1NIFA 1USZA 5DVMA 2QFRA 3GDCA 4PJ8C 1D5IH 4RCAA 15C8H 1R3JA 2AEWA 1J48A 4X4XB 2FBJH 2HVJA 4UNVA 3IE9A 5HHOA 5BW7A 4ZW3A 3CFEB 1BFVL 1MVFA 2M2DA 1A6PA 4DKEL 2YGVA 4HBQA 5A16A 3OQRA 1CWVA 1L3WA 2MJWA 4KUCF 2OR9H 1W0WB 2C8NA 4JFYA 1EHAA 3E1F1 3SDYH 2R2EB 4W9KC 2H26A 5IW3A 4IKKA 2FSEA 4U6VH 5CHNB 3ET9F 3FN9A 1YEHL 3J27A 4B0MM 4UT7L 5E8EA 5EPMB 5T5NG 5BQ7A 2OK0H 4XCFL 1O9WA 2VAJA 5JW4R 5CO1A 4R90L 1HI6B 2NY3B 4GIOA 3BFWA 5ISZE 2COVD 2XZQL 4U1LB 3T8VA 4NBZB 1Q9WB 2M26A 1FFNA 4AGNA 5F7MC 4J3OG 4QHUA 3A4EA 4QT5B 3GT6A 4NT6B 2H47C 2AV1B 1FG9C 5IW1A 4KFZC 4IOIB 4OCXL 3WE1A 1OWRM 2BC4A 1UWGL 2LHAA 4BE6A 5FGRA 4DQOH 1DBJL 4RRPG 5CSZB 3LHPH 1I1AB 5TDOA 4AMKL 5DD6A 5KSAA 1WGOA 1TZHB 4C59B 4HU2A 1GTNA 1JYNA 2YEVB 3D50A 3SBWA 1MIML 4ZTPL 4JQVA 4OM1L 3NJVA 3WKYA 3PNWA 3KDMA 1G4MA 1ZANH 4F58H 3ARGC 4XNMB 3DOSA 1N4XL 1P84K 3AG4B 1ZLSL 1L7TL 1AG0A 1EUTA 5ENWB 2E7DA 3MAWA 4U33A 3HE6B 2QBWA 4ZSOA 2EIZB 4K9EC 5DA0B 2KI6A 3O2DL 1QA9B 4G9DB 3T2QA 3ZLQC 4PJIE 4OD1H 4DVRH 4P3CL 4QHKI 5DJ0A 4GI8A 4XP6H 1RUMH 4N8CH 5HYJB 1SQ2N 3WIIL 4L3ED 3ASWA 3DK2A 1E5BA 2DV6A 5BRZE 1QLEB 3QSKB 3JV4A 2WKOF 4LVOB 4N0UA 1WTLA 1KYAA 2D7QA 1ZA6B 2VAAA 5KSBA 4B7LA 1F6AB 1R3HA 1DZ0A 3LPGA 4I18A 2PLTA 4NPKA 5I6LA 3OGOE 4ODXB 1SFDA 2VH5L 5KVFH 3L2NA 3DVGB 1BW8A 4BZ2A 1E3ZA 5I30L 3P3SA 3SPCA 2FLMA 2IH8A 2XETA 1EH9A 4AGMA 1SLVA 3MRRB 4OZFG 3OAZH 3LMJL 2AEIT 4LHUD 1RUPH 2NY5H 2WXKA 4XBPA 2AQQA 4NI6A 2DEWX 4XCYA 5F8RC 3GMPB 1PVHA 1HHGB 2OJZH 2GK2A 2OX5A 3BWAA 3H9SB 2Q3ZA 4OQTA 3IXAA 2ESVB 2K7PA 4Y4FA 1SBBA 3AB0C 3LEXB 4DK6A 2BO0A 4Q74A 3D3VE 4OGAC 5AAMC 5JORB 2WNXA 2WZ5A 2BSDA 3FO9B 3FB5A 3RP1A 3CZNA 3PL6B 2CHXA 2IFFH 4X4KA 1EV2E 4JKLA 4NWTL 1A1MB 1K4DB 4FA8A 4Q52A 1UFUA 2VRKA 2X4TA 4DGYH 1YZZA 2ZWLT 2YGPA 2KH2B 1P9MC 5IMOB 1XF5A 3BUTA 4YWGL 3L9EA 3VVVA 1J12A 4FLOA 4U1LA 4KGJA 1F4YL 1YNLH 1QLRA 4CKVX 1UM6H 3B2MA 4D8PB 3O3EB 2QADC 4HUUA 3HC3H 1NGXB 2P5WB 3LS5L 5F1IB 3HMWH 1X5JA 4QXGL 1M9WA 5HPMA 1P4IH 2NCMA 4JKNA 4HS6B 4HIPA 3QA3A 3KPMA 3GMNB 3BISA 3LB6C 1CF8L 1A7RH 4WVRA 4HC1A 2IG2H 3GS7A 1OW0A 1XCWA 2ICWB 5DC4B 4AUJA 4O00A 1AR1B 3QXAA 2K3HA 3FUMA 4JG0L 5I30H 2P5EE 2H2SD 4N26A 2PTTB 2OQJA 3F85A 3B2UD 2H4EA 2WUBH 4X6DA 3L3KB 4H40A 3VXUA 1YYCA 5FHAH 3UC0H 5D4JA 3UP1A 3UTSB 2XRAL 2X4QB 5DZJA 5GZOC 4ISVA 3CHQA 4PWGA 4HOMA 2PR9A 2EE6A 4O51A 1MW0A 2ZOKB 3POCA 4PLOB 2A1WL 4JDEB 3TZVA 2NNXA 2J1WA 4MQXC 4D94A 3REWB 5JXAH 4Y2LA 1ZXKA 1AACA 3TJEL 5ICXA 3O3AA 3CH8A 3N43B 3VGEA 1XXFC 3KM1A 5AW0B 1OCWH 3OSKA 1IBBA 1CXHA 1MWAB 5AYTA 2VMJA 4XGZA 4XMLH 4U1IA 2EICA 3V2AR 4BUGA 3T0WA 5L2KE 3DI3B 1DJHA 1UJ3A 5EOTA 3O6ML 2EIKB 3S35H 1JPFA 4MNHA 1UM6L 2TRHA 3MRDA 4APQD 2BCKA 5IUCA 3X3FH 2BP0B 4HWZA 4FS0A 3WG7B 1LK2A 1GZHC 1R75A 3MRLB 1I85A 3L3DB 3SPHA 3QRGH 1NBYB 3W0WD 1KJ2H 2NTFA 4X7TB 2FRGP 4PP1C 4DP7X 2FL5B 5E4EB 1HCFX 1EO7A 1DBMH 3CFCL 4Y4HA 5KS9F 5EEXA 3KM2A 1RK0B 4ZMXA 3C60A 4HUWA 3T6ZA 3WO3B 1IQDB 1MUJA 2HUEA 1LE9A 4OM0H 3QJTB 4BQ9A 3P4NA 4WHCA 4WSGA 1X5LA 2XRAH 1I1YB 5T1MA 3V95A 1ORQB 2GUYA 3U4KA 1JZIA 5LJYH 2FJFA 2I7OA 3SDXB 1UACH 4KK5D 4PRAB 1TCRA 2P9RA 3BP6A 4UT9H 5I82A 2VLRA 4AX3A 1YEDB 2VXTL 4JFVA 3QG6B 3WXWH 5F9AC 3D0LA 3MA9L 4A7GF 4JL2A 4JY6A 3CSYA 1H15A 3PFUA 1OCWL 1BP3B 4HXAL 1E8ZA 3PAVA 1IVTA 1P7QB 3RDJA 4ALAC 3DO7B 3DXAD 1F90L 1IAMA 1KLUA 1S5HB 4G6MH 1YYML 3I9IA 4MJ2A 1W15A 2OI9B 3S35L 3FUHA 5DZPA 4N0YL 1BF5A 5E5RB 1TJHH 2WVUA 2XFXB 4ODVH 1JYVA 3V52L 4MBOA 1JPTL 2DQJL 2NTFB 3JZYA 4GAYB 4X7TA 1UCTA 1WCQA 1SYVB 4HYTB 1T0NA 1QLFB 3SYQA 1B90A 3C5SB 1J8HB 3KYNB 5B7FA 1XB8A 3ATFA 5GJSL 4AEFA 3UZVA 2FLBT 2OLDA 4MLSA 2BSEA 2XZAL 1QRNE 2VLRE 5HHXH 1T2QL 5JW4N 4M1DH 5T1MB 1RULH 4LHQB 3D08A 1GJIA 3FU8A 3FTVA 4KBPA 2QQKL 2B59B 1H0DB 3FHQA 4OVVA 5CKAA 1A6WH 5CP7A 5HDBE 2FYYA 2WVSA 3BWUF 4JVWA 1NWPA 3TF7C 5F7EH 1CO1A 5EIQA 4NQEA 1OLZA 4JGUA 1S7QB 3F12B 4PJ5A 4IBTA 5FCSH 3UDWC 3VI4B 4PJDF 2VXTH 1QRND 1TMQA 3GMLA 3IAQA 5EU6B 3T6VA 3TYFA 4YC2C 4A04A 3BKJH 4DK3A 5C0RL 2YD2A 3RTQC 3LPPA 5IESH 3SCMB 3HMXH 3FRUA 3FTUA 2L0DA 3RTQD 4GG8B 3K6DA 1RU9H 4FQLH 4Z7UB 5F1SA 1OGAB 1TQUA 3GSNH 2DKMA 5AB0A 2JE8A 2FZ3B 4LVNB 3ESNA 1YPZF 3RL2A 3B2PA 2BP3A 2HSIA 3QHZL 4NN7B 4P57B 1J8HA 2CHWA 2NPLX 2RR3A 3KYNA 4ENED 3RAJL 1INQB 5CN1A 1RZPA 4LPTA 4DEUA 3RVTC 2M83A 2EDOA 4DKFL 5EFIA 2AABH 4BWWA 5I71B 3UEZA 4GQ9L 5EN2A 3TCLB 1CXLA 5C6PB 2R59A 2WLIB 3GZOA 3JWNE 4PJGF 3SDDD 3U0TA 1THCA 1MFCH 1H9VA 4ZS7L 3MRKB 4FNSA 1KJVB 2OQJB 4MCMA 4Z6AT 5L7XH 3IJHA 1QBBA 4J2XA 5DJCA 2QHRL 1NGQL 5D2NA 5F9WC 3B9VA 3U46A 3SZKC 3ZU8A 1NBCA 3MRMA 3WEOA 5IVNA 4R84A 5TFSH 1FL6A 3BQVA 5DTFA 5C0RH 3DK0A 4M3JA 4QPEA 3QG7H 3BW9B 3RWGA 3GXNA 2Q8BH 3T09A 2XYBA 3BQUC 3T0ED 4JFZL 1WAAA 3LRSA 3ABLB 4OZHF 5HXMA 4XBEL 3TT1L 3SPVA 2JXMA 2NMSA 1F00I 5I2IA 1DE4A 3RZCD 3OVUB 1Z9LA 5FYLE 5GGQH 3MNZA 1BZ9A 1BD2B 4LNVA 1IQDA 2DL2A 1XL6A 3MLZH 4YDIL 4IK6A 1N7MH 2XDHA 5T1DL 2AANA 4XB7A 3ZY7A 2R9HC 2AXFB 4C57C 4K3JH 5D2LA 5T1KA 3ZE2E 2F15A 4K8RH 3GLAA 2FUTA 3BXNA 4WHYH 1WAPA 4XP1L 2W1NA 4Z95H 5FS5A 1BOGB 2PCFA 3HZYB 4FJ6A 1G7QB 4OI7A 3V4UL 2HFEA 3ML8A 4WO4C 4JFEE 4HHGA 5E08H 3VACA 3FCTA 3FT2B 3PRZA 3LDBB 1WRFA 2C4FT 3US0A 2WBJC 1EFXD 1Y6KR 3NUKA 5MHSD 1UQSA 4WNJA 3LKSA 1AGCB 3OAUL 1DVFC 2RFXA 5L2JB 4JRXE 2A9AA 2IQ9L 3BI9X 1A1OB 3I6LE 1LD9B 3OZ9H 5HDBF 4HG4K 4OJYA 2P24A 5DJ6B 2F54D 1U41A 1EMTH 2PYED 4XAKD 2V2XB 4YDLB 1IKOP 5BV7C 1XF1A 4CA4A 4XBEH 3TT1H 1VFAB 2XWXA 3CDFA 3SDDB 3IF1A 4F7CA 1RSYA 4F20A 3C5ZD 4ZOAA 1E4XI 5JUEL 5EF0A 3UYPA 1GC1H 3E6FA 2H0JA 2ZX5A 1S4IA 4YHZL 4OFIA 1EGJL 2H1XA 2OR8A 2DQCH 4KJPC 3BAJA 3HZVB 3QDJA 4LKCB 4IU3B 2G60H 1C08A 3AG2B 5DVKA 4XP1H 2X7LA 4TULH 1CDHA 5IFJA 1NKGA 4R9HA 3QEQD 2XXGA 1G7LB 1F58H 4PGDB 3PCYA 2J1XA 5KVEH 2ORBL 4MQSB 5FO7A 5BS0D 3QAZB 2YK1H 2XKUA 4FFZL 4QHMB 2I27N 1RFDH 3RWCB 4FLRA 4U1NA 1TTGA 3V8OA 2O61A 5IB3A 4DGVH 4TF4A 4BSJA 2Z91A 4FABL 4Q58C 3GS4A 5KVFE 1E6OL 3M86A 4LEBA 2NR6D 4JPWH 1FAKT 2IWKA 1W8NA 3RWIA 1XD0A 4K07A 3ZT5A 4AH2A 3L13A 5MEOA 2YD7A 5IW1B 3UAJC 3AU1B 3WNOA 4Y5XB 4TN9A 4UOZA 1G7MB 1CE6A 3KYKH 2A5UA 1S7WB 2DIEA 1QKZL 4OCLC 1J7VR 3MCLL 4RFNC 2NUPB 1MWAH 3B7RL 1AR1C 4F7PA 5F3BA 4YPGA 1KGIA 1L9QA 1OGAE 3NJFA 1QSVA 1HX0A 1P4BH 1HXMB 3QFDA 4FFVC 5AAWA 4OV6F 3MOAL 1A8ZA 4LIQH 2ZTBA 2H0FA 4B97A 1CS6A 1WS8A 5C09A 3ZSTA 4P2QE 4LQFH 3QDGB 1YY9D 3QJHA 1OTSC 1GHFL 5D1QE 1JWUB 3ABMB 4QOKA 1COBA 2WWKO 4DIXA 1DJXA 1ZT4B 1CT8B 2R2BA 2YK1L 2EH7H 3IM1A 1T83A 1EXHA 3WDJA 1ZHKB 3IJEA 1Z9MA 2VC2H 4WEBL 1SZNA 2V9RA 1I3GH 1IAKA 4KQ4H 5DS8A 3FO2A 1IGMH 1UCBH 4OD3L 5EULV 4KMTL 4FNLH 4LSVL 2YRBA 4PUBL 2BOLA 3B7UX 4NAQA 5ITBH 3UTPE 2XTSA 2AC0A 2L7EA 2RH0A 4FZ8L 4H8VA 3VDBA 1Y18B 4YXKL 2V5SA 2AQRA 3OKMB 3L54A 4G9FB 3NJGA 2D3JA 2G0LA 3FQUB 3C6LC 4PCKA 2W9LA 4HIXH 3O4LB 1BZDA 5KVMC 1AXTL 1D7DA 4TVPL 2J6WA 4GBXC 4M9OA 7PCYA 1F2QA 1XVSA 4P46B 3IDXL 1HXMA 3PWPB 4OCMC 2V33A 2NY6D 3PWUA 3C5ZC 3ULUD 2VR8A 4G71B 1VADB 4C55A 1MWOA 1I82A 2D7OA 4R2GB 1K4CA 4QCIB 4WRLA 1QSEB 2B1AH 1FNFA 3BPOC 5EOCH 1BEYH 3T6XA 2X2UA 2Z35A 4D2NA 1NCWL 4GFXA 4KKBC 1JN6A 2W65B 2YMXH 4FZEH 1FJ1A 3NFPA 4Y4KA 5HD8D 5LWYH 3F7PC 4G8GE 4JKWA 4G8GA 4YBHA 5EU4A 1T6BX 3DSNA 1CD8A 3JT0A 4W9EC 2V2XA 3CFTA 4N9GA 2NDGA 5D8JH 5BQDA 1K2DB 1MAMH 1P7KB 2VLME 2WZPA 3RHWK 2W07B 4LNRB 4UZSA 4BFJA 4BJLA 1K72A 3VYNA 1KDJA 1MJUL 4X6CE 1KZYA 3TONA 4QYAA 4KI5C 5I1LB 3WJMB 1KXVC 1A6TB 5FR3A 2LTQB 4XCEA 1MRFH 2WO3B 3UYPB 5I18L 1LJMA 5HVGB 4B50A 2YQGA 2A4EA 1TNNA 4O5LL 3QCUL 4Y1SA 2Z6FA 1OGAD 1YDPB 3K2KA 1II4E 4X4XA 3T2PA 4C8XA 2R23B 1M9SA 1PLGH 4H8PA 4KY1H 1ZT7B 5GRXG 3KWVA 1IC4H 4PFEA 4U1JB 4ZUTB 4B96A 1BIHA 1H8OA 1ZLUH 3UO1H 5JDSB 3DVNB 3MLWL 4QD2E 4X7CC 1SXCA 1VKXA 5ID0B 5DMKA 5T1KB 3HI1A 2EVIA 1TFPA 2QVMA 1D9KD 4UDTA 4PJ8D 3IMTA 4AYSA 4YXHH 4JO2H 4JFSA 3QUYB 5IVZB 4FG2A 3CFDA 1TJIL 3QJSB 3TO4B 1QFWI 2VDLB 3QORD 4JDZB 3O6KL 4PJIB 4G2AA 1Z5LA 3MLXH 3IYLW 4KJWC 4TPRH 2AMGA 2AZUA 2VDMB 4WI0A 1DVFB 4XNYL 3WIHL 5JHBA 3DRQA 4LDCA 5HDQH 2NSQA 2IDFA 3ZTJG 2H9GB 3FB8B 4G8GD 4W9GC 4JM4L 4L3CA 2AMUA 4AGLA 5I66A 3E8VA 4OCYL 4G7YL 2V3DA 1ET7A 2VW4A 4RZCA 15C8L 5I76B 5ESAB 1CD9B 3KBPA 5ESVB 4GYBA 3CZEA 3D69A 4ANXA 1U8CB 3K8LA 2ZX8A 1FL3B 3KS0J 4W9DC 4KZEH 1XGUB 1NCHA 2BSCA 4PRHD 1HTYA 5L88L 1CYGA 1XZ0A 1OPGH 4LEOA 4X8GA 1KGWA 1U93A 1FPTH 1UC6A 1UD8A 1UT2A 2YWZA 3QRLA 4OGYH 3MTXA 2OR9L 5FECB 1IC4L 3SKJH 3DX7B 5A6LA 2NXYB 2O1AA 3PWPE 5B38A 4FTVE 4KUZL 2HRPH 5A2KH 2GT9B 3GUFA 1NCJA 1I3VA 2AJ3B 1RPKA 1R17A 2YD8A 3OKOA 4ZW5A 5J0BA 4FYQA 4TQ8A 5EG6C 3BKML 2J6EL 2J72A 4BXSV 2WXRA 2E74C 5DO2C 5JYMA 4YQXL 2DW5A 3LRKA 1CIUA 1L9OA 2IPKA 3UG4A 1ADQH 2QKSA 4U1NB 4QRTB 5HDQL 4ZPTA 5B4MC 5BXFB 1Q9LB 3FQ4A 3ARZA 3Q3GB 5EUOB 5B22A 4B5ZA 2VSCA 3VFUA 2DWDA 3AT8A 5JIQA 4L0PB 3GTNA 2XOTA 4TTDD 5CF3A 5IHWA 3CDZB 2OP4L 1RURH 1W16A 32C2A 4CGUB 4EIGB 3KLKA 4NGHH 4Z76A 5I0VA 2Q5BA 4QJ3B 3B37A 3QUXD 1OPGL 4YL4A 5BJTB 1QTYT 1Z9NA 2E76C 4X5WA 1WF5A 2FSDA 1J87A 4LCWE 4RX4A 5BRZB 1MZZA 4O02L 4TVSa 4D0BB 1EERB 5MENA 3QFJD 4KUZH 2HRPL 3MCYA 4KNTA 3OM3B 4WTWA 3ARDD 3E9TA 3O8XA 4Z0XB 1LE5A 5IQ9A 1IUZA 1R3KB 2K8QA 4UQDA 5HJGA 1BYNA 1A14L 3GSUB 2GI7A 2YPVL 1WDAA 2OL3L 1TVHB 4KI1A 1HU8A 5E5LA 2D7MA 1P5UC 3KG5A 5GZNC 1BEXA 3RJOA 4AVKA 2J6EH 3IN0A 4DTGH 3FTWA 4YQXH 5EF3A 1PJWA 1ID5I 2CA3A 2LLLA 5GS1B 5F3HB 3LRGA 3U1QA 1KGCE 2Y23A 1ZLVH 2H1PL 3I02B 4IM8A 1HXYB 4I3RL 1XBDA 3R0MA 3QH3B 2FAUA 1UOKA 1SXZA 2XPGB 2CBTA 3LS4H 3FOMB 1I7ZB 4ZZFA 4DUXA 1TQTA 2XV6B 3DX8A 5FA4A 1HFUA 3ZE2B 1DN2A 1DUZB 5FHBL 4DK5A 1L9SA 4N68A 2VDNH 4FHBD 5LUMA 4M00A 2NY2B 4IDJL 1WEJL 1RZGA 2H32B 3RX9A 3HI6L 4MCYA 2XQBL 3BP7A 3KPRA 1NAMA 1T0PB 4H0GA 4UT6L 2Q0ZX 1SBSL 4HIIA 2YLHA 1LWJA 2OULB 2WXLA 3VWKD 1KBBA 5I9QC 3WAJA 3DO4A 5KVDE 3EYFA 2YXFA 4L37A 1U3ZA 4FFYH 1FGNL 5HGHA 4AXWA 1RY7B 1Q72L 4NIKB 1BA9A 2IADA 3B6SA 1AYRA 1Q1JL 3RVVD 3PP4L 2DM7A 1N6UA 3C09C 4QXGH 2YQ3A 5BPPA 1RUQH 1CIDA 3LX9A 4PIBA 4EOWH 3Q48A 1DUYB 5J3HC 2ZPKH 3VQ1C 1MOEA 1D5ZB 4JPVH 2A6KA 1QPKA 5IMLB 5JHAA 3ARFC 2C9PA 2UY7B 4JQVC 3SGEH 4P5SA 4WTZG 1Z5HA 4E68A 1EZVY 1YEDA 4RGNE 3U7AA 5KOVC 4BZ1L 5DUJA 1R5WB 1VHPA 2IV8A 4K73A 2V5TA 3VFOA 4XCCL 2CO7B 4JO4L 3VM7A 4XOBA 2Y7QB 4WHTA 5JOFB 4HKBB 3IJYB 4LL1A 2OCFD 3L3DA 4U1GB 4ZFFA 3IRPX 1RLBA 3JBG7 4F8LA 1T21A 4HEPG 1B0WA 4UM9B 3CK0H 3FCSB 3TS8A 1IV8A 1L5GA 3WNPA 3ZL1A 4JFWA 1Y07A 3WFHA 5BV7H 4L1BA 3I9GL 1T5KA 1AR2A 2A77L 4GRWH 3VGAB 3W39A 2ADJB 3V5DA 3E2HB 3BZ5A 3O4OB 4H5SA 1EANA 4YN3A 3EJQA 2NZIA 2EINB 2JMRA 3M1BA 1IX2A 4O2CB 2Y7LA 3C5SA 3RNKB 3MJGX 1U8JB 1TVHA 2F7IA 2HMID 4RMQA 4KXDA 1F8TL 1HE8A 1RHHA 3FZUC 4XPAL 3RURA 1QFWL 4ERSL 3US9A 3HRZC 4YNYA 3ARFD 1LM8V 1MFVA 4FXTA 4W70A 3DHUA 5ICYA 1I1AD 3WXVL 5TE6H 3P73B 2HJLA 2DWYA 3ZDZF 4AIOA 2EXWC 1TZOA 3IETA 3EJZD 4HDIB 3VD3A 3MODL 3QQ4A 1CFQB 1I1FA 1ZHBB 2W9DH 4P2QD 2YPLE 3PAYA 3VXPB 1MFAL 5F88A 2MCG1 3SGKC 5FK9B 4HHAB 4DCQA 4PJHB 5HI4C 1WA2X 2XN9A 4K3DL 5J4MA 3U7YH 1QEWA 3ULUH 4HJUA 2C9QA 1N8ZA 3MCG1 4UF7C 5DWUL 3ABKB 5TD4A 3QEHA 3V9CA 4PJ5D 3EBIA 5JW3L 3ZGHA 1GYVA 4MCZA 2HAZA 4N2DA 5F6IC 1Q0EA 4FKHA 2NRDA 4JZJB 4XMWA 1NIBA 2Q1EA 4Z3JA 3ESMA 1R3LB 1DDHA 4HXAH 4M29A 4NN5C 4V1DD 3FRPA 4UV7H 1AHWB 1YEJH 1KLFA 2CA4A 2BNRD 4FG0A 5EU6A 1FZJB 5DQJB 5DHYB 3NJHA 2NQDA 3CDGB 1F8TH 1IILE 4XPAH 5L6YL 5J8OA 2CXKA 4X50A 2VDKB 3P9LA 1TJHL 5ITFA 2B8OT 1V7NH 5EUKB 5C7XL 3UBXB 3PHQA 5TE6L 2X42A 3QJXA 2AK4B 1VEPA 3FQWB 4QTIL 5DUBA 1KPRB 3RVWD 1YEIH 3VI3A 4KPHH 3IJHB 1A21A 4X9BA 4RDQF 4KRLB 4OLUH 4J3WA 1JFQH 4U7SA 4PJ7A 1EAOA 3U9WA 3C6LA 2ZOTA 4IRJD 2JSFA 4DAGH 1P7HL 1W0VA 25C8L 2DIAA 4A2HA 6FABL 2YKKA 5ESVA 1BJ8A 1FAIL 5HYIA 1Z66A 5DWUH 2ESVE 2IAND 3ME0B 3IFPB 3K80A 4NO3A 3X11A 1RZ8B 3JT2A 3QUKA 3LAFA 5F7EL 1SHWA 4LGPB 1MHPL 4XWGH 4TTDC 4PJFE 4RDQG 5D9SA 1N5YL 1XH1A 3HHSB 3UTSA 3CH1A 1ZPUA 4XN7A 1D2OA 2ZXQA 4N2HA 1F4XL 2A38A 2XBDA 4IHOA 1C8PA 5D7LD 3QAQA 3GRGA 4XNZB 5E8DH 2YZ8A 3NEXA 4CKQA 4YE4L 1S7XA 3DRTA 3FN0H 4XHJD 2OM5A 2NQCA 5HDLA 4EI5A 1RERA 2JK5A 3BQUB 1YLBB 4UQ3A 4ALAL 2CIKA 1CYXA 1ORQA 3CHOA 3VB8A 2BIPA 2BNRA 1WV7T 2CSPA 2FH6A 3QHZH 3BYYA 2WLNA 3QRBA 3LZNA 3FB6A 2KT6A 2PXYD 1ESOA 5FC9A 3HE6A 4ZD3L 3D12B 2W0FA 3QI9D 1FE8H 4UUJA 1NAMH 5CWSB 4DZ8B 2PPCA 4ZSOE 1UB6A 2HLAB 3FC8A 3PQYE 3RLSA 4DKAA 1HCVA 9CGTA 2ZE0A 1NMCC 5IVXF 2OV0A 4ES8A 2Y1AA 3WV0A 4NUMA 4PGEB 2F54E 2MCMA 3OC5A 5DVNA 4WSKA 5D6CA 4UQ9A 3NSCA 5CD3A 1NSNH 5FYLD 3EDEA 1YN7B 3EUUA 4NRYA 1NGQH 1JPSL 4R90H 5C0CB 1PKQE 1G6RL 1MCSA 3J2PA 2HT4D 4L4TB 2H1LM 3GGWA 5E2TH 4NKMA 3RWEB 3WLWD 4NPYB 4Y1TA 1Z9SB 3WLWC 5BMFH 5J57B 4GXFA 3U83A 1I9IL 1VDGA 4J8RA 4DUVA 4YDLC 4QO1B 3FU7A 4NQQA 1P5VB 1QSED 2WLMA 1N6QH 5IB4A 4NP4L 1S7RB 3HOGA 3G08A 3MJ8B 2HLFD 1CL7I 1E4WH 4GUPA 3N50A 5CLZA 5FA4B 1ND0B 3N42B 4X6FA 1N7ML 3QG6A 2BP8A 4PJBB 3HA0A 4QTFA 3L9YA 3B5HA 2WWKT 5IFAL 5KBMA 2F9BT 4FDWA 2M8XA 5DEGB 3ELAT 2X05A 3T0AA 3QCTH 3QDME 4I18C 4X0KA 4P3DA 4TTGA 3ARXA 1QZNA 2XWRA 4FQPA 2B15A 5AUMA 3IKKA 4GRMB 5DD0L 4NQEE 4MA7H 3W81A 3B7YA 1UADC 2F0CA 1DQDL 1KCSL 4ZUVB 3CMGA 3R19A 4NQCD 2VL4A 5C08D 4P3CH 3VXRD 4U6XA 4W9HC 1U3HB 2BW5A 2JKNA 1SOQA 4XH2A 3UTTA 1T4KA 5JPNC 2FHBA 2BSTB 1GYAA 2A9ML 1N3NB 3FO9A 3UGUA 2UX6A 1T80A 4WWOA 4DN3L 5IWLA 4WW2B 4D0DB 4RNRA 3QQDA 4MQ7A 4F27A 3ALWA 2YEZB 1J05A 3CCHB 1BWMA 2R39A 4LCWB 3U1PA 3NCJL 2V9UA 2YA2A 4D3CL 4R5XA 1GY1A 4A63A 2ZP0T 1MDTA 1K3IA 1UVQA 2IWGA 1EGJH 2WWOA 2NY6C 2D0HA 1S7WA 2CJSA 2WQRA 1IC7L 5DO8A 1FG2B 1I9RH 2VQTA 3II1A 5JHLH 2ATPA 2OSYA 2G60L 2G30A 3BO8A 3AU1A 4KJYB 4LLDA 4ABVA 5DHVB 2GIYA 4HALA 2HG5A 4BD4A 1U58A 5D2LE 3LH9A 3PGCA 4E41E 2EO7A 5CEZL 1ZLWH 3ZDYF 2F08A 5D6CB 5CD3B 5C2UB 5HVFB 3QXAB 3FFCB 1HS6A 1YEHH 1YJDC 1NDMB 1WIPA 2N7BA 4Y2DC 4MB5A 3Q01A 1PFCA 4YDZA 1VENA 1YMHB 4JFOA 4YBQD 4XXCA 5C0EA 3DURB 5LXGL 1M6OA 4JB9H 5F93C 3E1ZA 5FA3B 1EJ6A 4CC4A 2GI0A 3LZOA 3HR5A 1QBAA 5IK3B 3VWJC 5KYXA 4TXVB 4KK9C 2AEQL 3CUPA 3HCVA 2GJ6B 3ARDB 3EYQC 2JB5L 2FWSA 2MSPA 1INDH 1N26A 4I3SH 5DD5H 2H26B 4GXUM 1QR1B 1ZRUA 2Q2LA 3IBOA 3MRPB 4GUCA 3DRTB 3DPBA 4EZMA 2LLGA 1IFGA 1X44A 5LHDA 1WZ1H 4RGMB 4XNMA 4PM1A 3KDPB 4PJ9A 5DHMC 3SOBL 1U8OB 4F33A 3LNHA 4GOSA 4MCZB 4QGYA 1I9RL 1PKQB 3RIFK 2V8LA 4HCRL 3GI9L 2H32H 4NI3A 3IMWA 4D9QD 1UH4A 1UH2A 2O6DA 4M93C 4S2SA 1RCYA 1OGPA 1B0GA 2C9AA 3RVVC 5KBDA 4QT5A 4DPCX 4MNQB 5JXAL 3ME0A 3L7EA 2EIJB 2QKIA 3HBPA 1ED3A 2AV1A 3CN3A 3NESA 4LCYB 2LV4A 3RIFF 3NEEA 1D2PA 1N59A 4EO5A 2GJJA 3LD8C 4DZBB 5IR1B 4KI5E 3P0YH 2VC2L 1W8EA 2VLMD 4HULB 4UTBA 1CI5A 4DVRL 4ESKA 3WCYA 3X14A 1IGML 1UCBL 5AVXB 2N7AA 2BCMA 3BP5B 2HX7A 4W9IC 1CQYA 1WWCA 1IGIL 2XC8A 2AK4A 4JB9L 3X3FL 4ZMPA 1Z2KA 4WKXA 3UG5A 4YXKH 3VI3B 5AZEL 1HHIA 1PLAA 3RWJB 4CVZA 4LHUG 4B9YA 4HA1A 4YHYB 5D1ZB 3TEZA 3CCHA 4PWIA 2R1YB 2RACA 5KVFL 1RZKH 2XWBB 2N0MA 4XN4A 5DZNA 4G9DA 1XMEB 2YAPA 1QA9A 3SGJC 5H35B 4TSBL 4I9WD 5C0BD 4GSUA 2QADD 2Z91B 1I8MB 2X1QA 3L3JB 4GRWE 3D2UA 4JUSA 3VRJB 1XGPB 4LCCC 2W0FB 5AOLA 4AM0A 4TL4A 4DH2A 2FGWH 4GW5B 3KNBB 4JZOB 4GG6E 3EJYD 1F4WH 3QIUA 1OB1A 4AV0A 3VVWA 2ZXBA 2IDCA 3ECBA 2CD0A 5E2VL 4NUQA 4G6FB 5E5MA 2YUZA 3ILPB 4GW1B 4PB0H 1MRDL 3MRJA 5L4IA 5G4MA 2WM0A 3BQUA 1MAML 5JXED 1ETB1 4D0DA 3PV6A 2CRZA 2JCCA 4JFPB 5EZOH 1Y1DA 1XQ4A 2NY7L 1DVFD 3C8KA 1YNLL 3QNFA 4GEJA 5DZ9A 3HPJB 2HPTA 1A64A 3VWKC 2YKLL 2Q76A 1AQ8A 4WWKA 5E6SB 5I8OL 5DC2A 4P07A 3Q6FB 3VGBA 2QZ5A 1QAWA 3HNTL 5AOZA 4HF5L 1KCRH 1U9KA 4OLVL 5K1VA 5LO7A 1UENA 4POUB 4U6TA 3G08B 2K9FB 1YNTA 1WCBA 3S34L 3ZT6A 2FHFA 3BPCB 5E9DA 1I8IA 1PIGA 5IF0A 4HCGA 4UB0L 2GAZA 4Z7OF 3DA0A 1GMIA 4ZYKB 4C54A 5HGAB 4M3HA 3VXNB 1UFGA 4JZJC 4OF5A 4BV1A 4U3HA 1PDKB 3Q7JA 3NCWA 4GAFB 2OSXA 2X6BA 4FQXD 1RZIB 1PZ5B 3BGMA 3M17B 1QEWB 4LL9A 4FG4A 3AS0A 3MNDA 1EBAA 2ZKMX 2NZ9D 4PJDA 3BZFA 2ZSVA 4XE5B 3T4YB 2BVPB 2O93L 4OB5H 1O6SB 4CL7A 3F05A 4L4VE 4P9HH 3IFNH 3IU4H 1ZSHA 3GSNL 4KTDH 1RP9A 2NY4C 4CVWA 2H41A 3FO1A 5T3XE 4ODUB 5ABAA 4L0ZA 4NPYA 3KPOA 4FTVA 4UILL 3LXUX 4WTXA 1SF3A 1WSST 5J12C 2ZQKA 4MB4A 2XG4B 5FYJD 3D0AA 2ZUVA 3QQXA 3TJHC 4A55A 2J1YA 5E4AA 5SV3A 3UTTE 1S2EA 3QJFB 1DVZA 2J6EA 1OY3B 4ETYA 3QUXC 4XX1E 3MJ9H 4DKFH 4GG6A 1TKWA 4NQDE 3IFLL 4PJHA 4LVHB 4MDIB 3OKKA 3EYUH 1E6JH 1QYGH 4CW1A 4GXVH 4NZFA 2Z4TA 2PPAA 3WN5B 4ZUWB 4X98B 1HWHB 1VJSA 3B9AA 3V4PB 3WENA 2A99A 2FJHA 3TV3H 2VXUH 1RJLA 4AJYV 3CD4A 4JBSA 2HWZH 4I13B 4ORZC 5CEXA 3KLHD 4OZIA 1HC1A 4PJAB 3TBSA 3W82A 3PWLB 5CMAB 3ZMEA 1F56A 3STLA 5LAXB 3BYTA 1O7DC 2XNAA 4UU9A 3RPIA 3T4YA 5CBEB 1GAFH 5TFSL 3X11B 3TBTB 3AREA 3IGAB 2H6OA 1BLNB 4AMXA 2VITB 1O5PA 2X44D 3D18A 5FDYA 2MCPH 4LHJB 1NPJA 5H37G 4O02A 1R34A 1BZQK 4PRHA 2CBPA 4PP2A 4N5EC 5EBLB 4NERA 5AAMA 5EHFA 3N1FC 3P77A 3N41F 3Q8AA 5GGQL 1I1YA 2F53D 4AQEA 3MREB 1YNKH 4NGHL 2BWQA 2MWCA 5IUSA 4P23A 2X6VA 1NLDL 1JPTH 5F9JB 3EFDL 1EVUA 1AGBA 5CN3A 4U0RB 5FYKH 1J0ZA 3GBNL 4PRIA 4K3GA 2GVYA 2GEEA 2XJLA 2VR6A 3EDDA 4BGDA 1XTLA 1AGEB 3UTQB 2MMXA 4HGKC 5IIEB 3WFBH 2ICES 4M1DL 3O6LL 2ICEA 1XO8A 4MCYB 3X17A 4ZFOB 2IOMA 2UUDH 3OMNB 4NKDB 3IXTA 4OLYH 3TLRA 1XSIA 1R0AL 4FA6A 1WBXA 5B8CC 4QOKE 1OP5K 3FL7A 2E5EA 4BDVA 1OWWA 3ORJA 1ZIAA 4ZQKA 2PYFB 4N8VB 4R4FH 4WI5A 3VAEA 1WGVA 2B5IB 2EYRB 1KWGA 4JY4B 2HYMA 1AO7B 2CDFB 2F68X 4D9RE 1RK1A 1S9WA 4AW7A 3HUJB 1FO0H 3CSBA 1J5CA 2I60L 4X5XA 1RUAH 3CVDA 3QORC 1JK8B 3RVWC 2VZOA 3KMDA 3QIWB 2BRQA 2H1PH 1SJXA 1EXUB 2NZ9C 4JFDA 4P59H 1VZIA 4NHUA 2IJ0C 4LLWA 1N5AB 5SWSB 2EEBA 4PJIA 2AKRA 4WU5B 4RX4D 3DUUB 1XMWA 3TN0D 1NLDH 2D2OA 1NPUA 2DQIH 2X4RB 2VDNL 1RJZA 2VLJB 3MI6A 4YHZH 5E8OB 3N1GC 1ORSB 3JWDC 4NC2B 1FCCA 5D6DC 2GTZB 4W1TA 4TULL 1SN5A 3F5WB 4UM9D 1WAEA 4MAUL 4YX2L 3WFBL 3PHSA 5CU9A 1IEAA 4HP5A 3KXFD 5DD1H 4L9DA 2G3NA 5DA4A 3HE7A 1HYSD 1F6LL 4JG1L 1UXSA 3WEXB 1UXMA 5ALCL 1QLRB 4RMBA 5I1EH 1OT1A 1EO8L 5F88B 4R97B 2PPDA 4QHPA 4NKIH 1SJEA 3K6OA 2I5YH 1NPNA 2OMNA 4P4RB 1CU4H 1NMBH 2W60A 3LKOA 3F58L 4C56B 5B3SB 5ILTH 3V4VB 1ZLWK 4EOWL 1HZLA 1B3IA 2A74B 2HX9A 4K23L 4YNYB 4M62L 5KVGE 3N40F 4OSUL 5EFIB 2DH2A 1EFXB 1L6ZA 4G1EA 3FUKA 3KHQA 4W4OC 4B41A 4HWEL 2X4PA 1U95A 3MLTA 4NC1E 4LP8A 2BFGA 2IPKB 2WKLA 2LVEA 1H9DA 4CSSA 2Q76B 1WK0A 2XN0A 1PZSA 3U2IA 3A6BH 1QSEA 3EH4B 1SJMA 3DDFA 4P9ML 5GS2D 3BE1H 1U3HD 2DM3A 2DQIL 4M7JL 3HB3B 2DN7A 3ROOB 3TTYA 2FQGA 2ENSA 3GXDA 5C0FB 2L3BA 3PWVA 1ZE3H 4OAWA 3FH5A 3LEVL 2L7JA 1TQCC 4JN1H 3ZKMC 1H8SA 5EU7E 3IDIA 2IGTA 3S3JA 3V8CA 4F7MA 4B95C 4H0HB 4P2OB 2DWDB 5FLUA 3ZRSA 1KFGA 4L1SA 4XWOD 2ADGB 5JW4M 1SM3L 5ID1A 3KNBA 4JZOA 5BVJB 2YBRB 1SJHB 1WZAA 3ARGA 4XCNB 3FAWA 5MI0B 4OH2A 3RDTB 3KXFA 1MIEL 3AITA 3CQQA 1OHZA 3AC0A 3KXFE 5FYJU 4EAEA 5BVPH 3BKYH 4FTDA 4X6DB 4X98A 1JXJA 1Y6NR 4BA8A 5KSAC 3K6IA 3F58H 5ILTL 5ITBL 4WY7H 5KVDL 4AYGA 5FOBA 2JLLA 5AYUH 3MODH 4M4RB 1IIKA 1KGYE 2XYCA 1IMHC 1BMGA 4FQXA 1WBZB 3LKRB 5IKCB 3TIDB 1M56B 3N0PB 1RIUH 4LPWA 2I9LA 3SKUD 5INDA 3GRBA 4KX7A 2F8VA 4K9JA 2H3NB 2J8UA 4RMTA 3IDMB 3T1FA 1OF2A 4J6RL 4JVUA 4TVPH 4KHTL 2WMPB 3PXHA 1QSEE 1WO2A 3A6BL 3D9AL 1G7JA 1QD0A 3VFRB 1OVZA 3WO4C 4F24A 4HKZB 4CC4C 1OSYA 1FG2A 1HIMH 2BRRL 4PR5A 2IC2A 1OSEA 4HUNB 5CZVL 4UMGA 2DQCL 1JNNL 4JL1A 4H1LG 4HWBH 5CZXC 4R7LA 2PW1A 5JIPA 3D25B 4G1MB 2X41A 3EYQD 2V0AA 1DSFH 3OWEA 3BJ91 3VM5A 3FUDA 2VXVH 1ADWA 3BESR 2YJLA 2EYSB 5E6ZA 2IBGA 4BK4A 2WBJD 1X5AA 1PKOA 2XZCL 2OW6A 3PHAA 4ACPA 3VXSB 4YHNB 1RFDL 4AMWA 2Y3AA 1MREL 5DRWB 4FABH 5F96L 3LNIA 1A02N 1MI5A 2DBJA 3KCPB 3M45A 4GRLC 3ZW3A 1QRNB 4K7FB 4D9QE 1P4UA 3G9VA 3NOIA 4JHWH 3V7MA 1OL0A 3KVDD 3X1FA 3BRFA 3WFDL 3VD2A 1YEIL 1E7UA 4JHVA 2Q3XA 5DQ9B 2OXGA 3DOHA 5AYUL 3A67H 3CHXA 4GQQA 5TDPB 2AJUL 4G8AC 4GS7C 2C9VA 2IV9A 3TBVA 4L5FE 3WJLC 3B9KC 5C97A 3FU6A 1KBGL 2DTML 5TGBB 3QHFH 1HSAB 1DBAL 5IY5B 4NJAH 3PXLA 4Z3GA 3S2CA 5C08E 4OFPA 2OMBA 5TF1H 3T0EC 5C3LD 1D7FA 2E7BA 2UWEB 3MFFA 3MV9D 1YC8A 2OTUB 2XPZA 5D1QD 4YOKA 3VRLE 1GJWA 3FT3B 1RAMA 2XWDA 2TSBA 1Z32X 1OKEA 4B53A 5A7EA 1YNTF 4NUGH 3WLBB 1U8MB 1DVXA 5CUSL 2X4NA 1RZKC 1ULVA 5L2KB 1HVXA 4WI8A 4DPBX 1GRWA 4G6AD 4BZ2H 4S11A 2TAAA 1G7MA 1C7TA 2Z0BA 1AGFB 1E27A 3DXAB 3K2UH 4LDLB 3WJJC 3RI5K 4L8DB 4QNPE 2UYLA 3IPBA 4JM4H 5JR1H 1FVCB 4UANA 1XBRA 3L4ZA 3WYRA 3RE0A 4I85A 3BAIA 4HU8A 3WS6A 2K78A 1NFIA 5DURD 4ZTOL 4WO4D 3S5LB 4RESB 3QR1A 1MY7A 1GW0A 1XAKA 2DRUA 2H6PB 2IQAA 2VXQL 2Q87A 3BEWA 1JF1A 5BRQA 1N70A 4XI5C 3GKWL 1MH5A 5AKTA 1PBYA 5L88H 4JFHD 4PJCB 2G2PA 3BAWA 3H7LA 4FXGA 4XBGA 1AE6L 2HFEB 3QUYD 3DETC 4DGIH 2VISB 4L3EB 4AQ1C 3IK2A 2V9TA 4HC1L 3UTTB 4Y8AA 2A73A 1NM9A 1UZ6F 4R3SA 2O6FA 4K55A 5L8JB 3IDXH 3PHOA 4PMFA 3ASOB 5DVPA 5C7ZA 1W9XA 2PETA 4EZJA 1RUKL 3D8MA 4UTAH 3DGDA 3QE5A 3VXMA 1RZ7H 2R29L 2ZUWA 1FO0A 2UZYA 1FL5B 3MFGB 3O4OC 2W0PA 1VERA 1NKOA 3KLSA 3ZE0B 5F7HA 4P5MB 3SQBA 3PABB 4UZUA 4JG5A 4ZDHA 1JZ4A 4Y1AB 1CXFA 4NUJA 3PWVB 4OAWB 4L3EE 2OMVA 3RJDA 1HXKA 4KQ3H 1I9IH 2QVTA 4Q9QL 2EEFA 3QK0A 2EEXA 1ITCA 4Q2ZA 5BS0A 1N6QL 2KUTA 1JHLH 2HG5B 2MNWA 5GISH 1GOGA 5F8QC 2JQAA 4D9LL 1JWUA 5HYSG 1E4WL 3BD5A 1S5IH 4HZLB 1X6LA 2ODHA 3FRPG 4NYLB 2E9IA 3FFCA 2OP4H 3LKNB 5I6KA 4I0PB 2AJXH 1RZ8A 2CGRL 2VR3A 1AI1L 3CLWA 3NAAH 3GSVA 3O9WC 4O5LH 1GMEA 1ZHNB 2OJEA 2OSLA 1OAUL 4HD9A 3RWHA 5C07B 1X9QA 3KPQB 1BDYA 2ATPB 4P5TA 4ELMA 5KW9H 3E0GA 2NY4D 2P47B 3CU7A 5DK2A 5SWZB 2IIJA 3ZE1B 1JFHA 2UWEA 3MFFB 4JAMA 2UWEE 1KPRA 3V4PH 2V8MA 3C12A 2J21A 3V5HA 1LO5B 2Y5QA 5I5RA 2B4CC 3BPOB 1TTFA 4JO2L 3OB0K 1FF5A 1TNMA 2F53E 2OL3H 4X9GA 1VFOA 5IMKB 1OCOB 2JH2A 3JSSA 4F2ME 4BUQA 2JVUA 3VH8G 2HCZX 1P6FA 3FB7B 2OKMA 2G2RA 2HFFA 4JQIH 3QUMB 3IF1B 2FYVA 4Z3FA 3VXOB 1G0YR 3PJNA 2ZG1A 1YEEH 5FWQA 4Q6IC 3NPSC 4TL5A 3F2LA 5DI8B 1YECL 3NCYS 1NCBL 2YD3A 4D9LH 4E5XB 4GSRA 4AZUA 3RGVB 2O5XL 3HLAA 3ZUNC 2N59A 4N2BA 4EN3A 4Y5XC 1URIA 1ZTXH 3DBXB 2BOBA 1HZKA 2CIKB 4FQXB 2VDNB 3EH2A 2VIRB 4OKVB 3OKEA 1PYWA 4MRCA 1QPPA 3B4NA 4PJFF 1X9UA 4YSUA 3EGDA 2B77A 3CLFH 2BHUA 4FN0A 3LKQB 1ZLSH 4CBPA 2WN2A 3ARBA 3V4VH 1MQKH 4FADA 4I1RA 1QI5A 3F7YB 1BVNP 2ATKA 3SDAC 1BOYA 3V5HB 1A3RH 3FH7A 1J10A 4JFQA 5HJ3A 2VZUA 5MEQB 4QO1A 1ZXQA 2Z8RA 4BFFA 5IGXL 3ULUC 4XAWH 5B1BB 1AGFA 1E27B 5I6MA 1QBLH 4WTZA 4DN4L 5L4MA 4GBXD 3T0XA 3WIIH 1MHCA 2EDKA 3O11A 1XX9C 3QZPA 4ZS6C 1CICB 5HYQB 2V2TB 2P3YA 4NRYB 3RRQA 2LU4A 4PGEA 2AJSH 3LRLA 4N2MA 4LBEA 4H44C 3MLRL 3C6SB 1TQVA 2YSSB 4P57A 2P80D 4PPTA 5JO5A 3OPUA 3B2XA 2H3NA 2ZP8A 3T1FB 1YECH 1H8LA 5D2NC 4BZ1H 4HUVB 3V6OC 3QXUA 3M1CA 3SOBH 4XCCH 4X6DE 4OCSH 3SSGA 2ARJB 1RV6X 3EJRA 4IDLA 4MWFA 4UTBL 1WAAE 3SE8L 2OYMA 3VXUE 4AEHH 4EUPA 3GS0A 1A4BA 3TBVB 5L4JA 1TTBA 3QO0B 1V55B 3IWVA 2FE0A 2AQNA 3NPZB 3CK0L 1P5VA 3IJ8A 2X0WA 1AXSA 3L1OH 4P23D 5K69A 4GRWB 2HX8A 3QIWD 5KN5A 3V4VL 1JMXA 3T2NH 3KPRD 3KYAA 3TBYB 2VERA 4O2EB 4HJTA 2XIIA 4NNYB 5DF0A 4MQTB 4NWTH 2WQVA 1ZK5A 4X9FA 2AK1H 3ZKXB 2R4RL 1IJ9A 3LPFA 3KLAA 4MNGB 2XV0A 1KXTB 3HJ0A 1FH2A 5KYYB 3VXRA 5K1NA 3QFJE 1SEBA 1DEEB 4J3OH 3VFVB 4E36A 3MR9B 1BQHG 1PZ3A 1YMMB 4U4IA 4XN2A 4Z23A 4W81A 2VCOA 4XVOA 2GYSA 4QHNB 4V1DE 3RFRA 4OCRL 3MBED 3LQAH 2XICA 1T1WA 3VWJB 1JXFA 2CPUA 4DTGL 3VFMA 2NUTB 2ENPA 4MD0B 1SLWA 1GGIH 2CCVA 3GBML 4NO3B 2VDKH 1RZKL 4MTMA 4UDUA 2CNZA 4G6FD 2R0ZL 5IJCC 1B88A 5C0GA 2WJ5A 4WWID 2Y22A 2ZOOA 3H3KA 2RCSH 3BZFB 3EW3B 1RZGB 2H32A 3TZVB 3UACA 4LSTH 5I15L 3DPDA 4GKSB 3HG1B 4K7PH 4KK8D 5KYWB 1FYTE 1JPST 3S3BB 2BSSA 1KTKE 4FMFA 4MLIA 3P9LB 3ZZQA 5AD0B 1BOGA 4XPBL 4F37K 2GTZA 3UZEA 3QB7C 3ZDXB 4UM8A 5CLWA 3LKSB 5PCYA 2R1XA 5J7CC 3VXNA 4DEWA 4J12A 1J0YA 2BIOA 3AXIA 4LAJH 4W6XB 5FF6B 1MCEA 1FUNA 4NXKA 4HLZG 1FLRL 1ZAGA 2MFNA 3HE7B 4HCRA 2ZXAA 1M57B 4EBQH 5HGAA 2R4SH 4XMLL 4XNZC 3H85A 4L4VD 4U4BA 3HZ3A 3CVHA 4ZI8A 1U3HC 4Z7IA 4OZHA 1BVLB 3O6MH 4QRPA 2ZXCA 3OL2A 2WINB 1GC1C 1PJ9A 5DLLA 2GC7C 3MV8B 2NUTA 1V54B 4LLVA 3IDJA 1V7NL 2JIXB 3S36L 2ZWKA 2C5DC 3GZPA 5ELIA 3QRGL 1S9XB 4AZ8A 4LPUA 4QTIH 3SE6A 1E43A 4G8FA 5AW6B 2YPKB 1LP9F 4JRXA 2AVGA 3QDMB 4Q6IA 2IAMB 2F8IA 3ERXA 4X6CF 5F0PB 1IFRA 1TVBB 3DNKA 2AZAA 2X1WL 4UB0H 4PJ9D 4F57L 25C8H 2BX5A 1BZEA 3H0TA 1FH5L 4R6UA 4TVUA 5IFHL 5C71A 3TH4T 1BG9A 2A83A 1JK9A 5DRZA 1ET8A 3RUGA 1IRAY 3GSXB 3R1GH 1Z5YD 2D2CC 1LYQA 1QUNA 4HUMB 3EH3B 2CCWA 4Z7WE 5LN4A 1CGXA 4MMYA 5DJCB 5D1XA 3I9GH 5AW5B 3SOTA 2G5UA 1SEQL 3H53A 4P04A 4NKOB 2HRLA 3MA9H 5BXFA 4JO1H 4YHOH 4LSUH 2GW5A 2DQMA 3F83A 1K6QL 3AQYA 2J5LB 4QAWA 1O0VA 1DFXA 2R4SL 4BFNA 3P69A 4N8UA 2IGLA 1CI3M 4CSZA 3MV8A 3W37A 1DYZA 5IHZB 1J1OH 1RP8A 3QR2A 1OGAA 5CGYC 5DO2D 2FK9A 4N0YH 4MDJA 4S1RH 1TZGH 1ACXA 1JSYA 1XXDC 3KH3A 3MBWB 3KD4A 3ZPDA 1MCHA 2H2PD 1L5GB 3O3EA 1MNNA 5EU6E 2ZD0A 4WNQA 1Z9OA 3FYIB 1P1VA 5FB8B 1LO0L 2XA3A 4KAQL 3V0JA 4XN1A 5I1AA 1D9KA 1S9YB 2DI9A 4ODHL 3K6NA 5I26A 5F9DC 1OP9A 3MROB 2YOCA 3KPQA 4XR8C 1IB5A 3C5ZB 2AI0H 2OMWB 3MA7A 1YAIA 4Y8DC 5LNDA 1E6JL 1QYGL 2D31B 5JPMB 5IFHH 4N85A 5H4ZA 5FOJA 3LH8A 4GJTB 4IHBA 3OXSA 5F7BA 3TV3L 4F9PA 5DMIH 3V4LA 3TESA 3LKQA 1KXQE 1TO4A 4HPHA 1T04B 3MR9A 2DMGA 1ETZA 3AMLA 1AD9B 5AOIA 1KEGL 4NZTH 4G72B 1D7BA 1IBHA 4MAYC 4I77L 4NQVB 1TLMA 1B2YA 2RQ8A 3LVTA 3UAFA 3NJIA 2LFGA 4ZQKB 5HHME 5DVOA 3FCGA 4HGWA 4ENEC 3P4OA 4ZUUA 1QACA 1G4RA 2WCSA 4OIBA 3IXTB 1NCDL 5AVVB 5E2UH 5HI5C 2DYRB 1MWAA 3FSZA 1TPXC 3PXJA 2FD6L 3KGTA 3H9YA 3ECUA 4JRYA 2X3BA 2NNAB 3FSAA 3FT4B 4S1RL 3QEQA 2ZSWA 4TUKH 4XPFH 1OP5H 1BFSA 1ZLUK 5KYYA 4LF3B 3RVXD 1QWNA 3JV4B 1U8LB 2VDLL 4J6IA 2E27L 5HGBB 5KAQG 1U91A 4H8QA 4PCYA 4AJ0A 5JPNA 1MCDA 1NAMB 3QEUB 4WHDA 5GGRY 4YR6A 4HSCX 5DJXB 3EF4A 5T3XL 4MBRA 5T1LD 4X7SH 1BECA 1HHHB 3QCTL 2ERJC 2FJFB 3C6EA 4GQ9H 3SDXA 3N2JA 4KRMB 5EBMB 4Y1AD 3AWFA 4ELKA 2XWJA 3KJ6H 4LFHG 1L0YA 3DXAE 4LSQH 5FYKE 3T0EB 4AL8L 1KB9K 1PYWB 3QUYC 4ZS7H 4XMPH 5IOPA 2NXYC 3BJLA 2JKTM 1SMDA 4IRSD 1CFNA 3L95A 1UYWH 2KBGA 4IRSA 4L8BB 4H1LB 7CGTA 1D6EB 3VRIB 5GSRA 4GKSA 1MAKA 2DMBA 2JKRM 1I8IB 5KWYC 5FYJL 1CBVH 1DFBH 2Z7YA 4Y2OA 1V8HA 1F4XH 5B1KA 1UUNA 2I60H 2NZ1A 3EOTL 4MNQD 4R8WL 5DR5H 5EZLB 4P4KD 4I1PA 2JNZA 5LB1A 3KEDA 3GC3A 3MLUL 2X4TB 4JN2A 5FUCC 4AKQA 4DN3H 4EUPH 3TT3L 5KSBB 1PKQA 3KBHE 1E40A 2G75A 1BXXA 1T1WB 1M3JA 3FT1A 3PFQA 4LAQL 1ECZA 1SUHA 3MLZL 2EABA 1KTBA 3KWXA 1YAZA 4MD0A 1VGEH 4G9FE 4MJHA 4U3CA 4YSRA 4Z0XA 1XIWB 4QF1B 3WY1A 5JQIB 4K3JL 4Y5VA 3RY6A 4QRUB 3TEWA 2R7EA 2ZUQB 3EH1A 4EPSA 1MELA 3FMGL 1NAML 2YPLB 3UCRA 4YX2H 2BNQE 2VUKA 4ODBD 1HKFA 2C1PA 1WFUA 2PWHA 2R0LH 3F3HA 4JRXB 1XD1A 5CEZH 1KB5H 1TXKA 4PRPD 4XMPL 1KNOA 1QO3A 1FZOA 2BNUA 1BBJB 2CO2A 2BZ7A 5I74C 1VACB 2V2WA 4L9LB 5EOQL 2UWEF 2AK4E 4AE0A 5MI0C 2IQ9H 5JHDE 1G6RH 1RJCA 2W95A 4X9YA 5EU3B 5A16B 4BK5C 1G87A 2FECI 3G9AB 4XPHL 1XF3B 3MO1A 1G1KA 4JAMB 3IAGC 3B5TA 4I3GA 4FA7B 3OR7A 1JF5A 4HUUB 3SY0B 3QBTB 3SODB 1PQZA 1WWAX 3Q06A 1TCMA 4PJBA 3KPTA 1DJIA 3ATDA 1A1NB 4G1MA 1HWGB 5TK4A 4P4KA 1AIZA 5E2WL 3KLDA 4PJ9C 1WZ1L 5JUEH 1IAOB 4CGTA 1OAXH 3T2LA 1KXVA 2VABB 1ZVSA 3U0WL 5FM5O 4X7EC 3U79A 1NFDA 3BIAX 3GQFA 4E42A 5CBAA 3EOYG 1UWXK 3CHRA 4NKMB 5AW2B 5IV2A 3W5NA 2CDGA 1AHMA 3IXAB 4DP5X 3C6LD 1S9VA 4JFEB 5D55A 3NTCH 1PSKH 4HK3J 5CJBA 3SDYL 4PVBA 5AB2A 3EF7A 4HS3A 2CALA 5IMLA 3QCVH 3QQ3A 4U6VL 5CCKH 3SKMA 4TNFA 5KBPA 1UB6B 2HLAA 4FF9A 2IDSA 4XCFH 2JELH 4O9HL 5LNEA 1OZTG 3KWUA 4CVXA 1WFIA 3B2UC 1V3MA 2AQTA 3ARBC 1R3IL 5D7LE 4BKLB 2HXAA 3L5WB 3PV7A 3D3VD 1IGIH 2P26A 1MLBB 2UZXA 3VCLB 3QISA 1S8DB 4ATTA 3RY6C 1N68A 3WY4A 4TQPA 4QUOA 4X0KB 4G43B 4OZHB 3C09B 1P6AB 4P49A 3ESVF 1J9SA 2VMCA 1HOCA 1BREA 4BFEA 4ZX4A 1URLA 3KYKL 3WLBA 1J5IA 4PB9L 4FXKB 4TUUA 1NCCL 3UL4A 2J44A 3DX9B 1X5MA 4YO0B 2Z34A 2CDEA 3P9MB 5LGJA 5D7JA 3QZNA 1HIML 2BRRH 3K71A 3FAXA 4ZMZA 1OTSD 4LOEA 2CK2A 4JW3A 2X10A 5GGUA 2J73A 3B5GA 3MUY1 4WO0A 3HG1E 5C07D 4TUOB 4U1SA 1Q0XH 1DHKA 1XF2A 4LLAA 2WPGA 4YK4C 3S96B 2VR9A 4G8IB 3SDCD 2VXVL 5E2VH 2FBRA 1NINA 3UAJA 3BD4A 2VGLM 1BBJA 1EFXA 2XZCH 2HH0H 5FKAB 1VCBC 2FR4B 5DJ6A 5C0CD 2Z9TA 3SJVA 3S5YA 1N10A 1C5CL 1HH6B 4HWNA 3K81A 3CXDH 4KQ4L 1FIGL 5EZOL 1HQRA 5EIVA 4KHXL 1YHPA 3GXFA 3QIWC 4ORGA 5CJOL 5JNYB 1INEH 1DQMH 4B3VA 4FZ8H 3A67L 1VEOA 5D7IE 4Y0GA 4PU2A 3PUCA 4P46A 2FB4L 4HIEA 1AJ7L 2EDMA 2OXHA 2VH5H 3P30H 2FWLB 1JRHH 3LPWA 4OJCA 3QNXA 4XH2B 4WAFA 2BPBA 4KNSA 4JM2F 1JZ6A 4XRCA 4LEEA 3F7VA 4M3KB 5I17B 2BWDA 5FGSA 3LZRA 4A7VA 4FI7A 5EZJA 4H20H 2YRZA 3GSRB 4LOUC 2B9BA 1QO3B 1X7TA 2EXTA 2WIIA 3BH9B 1W6LA 1TFHA 2GIMA 4J3VA 1M6UA 4QHMA 4PJFB 1LK3L 4BH7A 1ZA3A 3Q1SH 3P0GB 3QIUD 1Q0XL 1KCWA 5FA3A 5IB2B 4KJPD 1A66A 1U8HB 6CGTA 4B9CA 2I9LB 3SGEI 2V5RA 3IB4A 1IEHA 1BVKB 4KXBA 1HEZB 3QNZA 4JY5L 2EP6A 2ZYRA 4GUPB 1N0LA 2W5PA 4BINA 1M7UA 4XXCC 1IGYA 2MQCA 2OMVB 5D4IA 3CXDL 1SLUA 3VTAA 2YD1A 2IXQB 4UAOC 3JZ7A 5D5MA 1HAUA 3BD3A 3BZDA 3R06A 5INCA 3Q6GL 4R7DB 4OIAA 1FNGB 2EVJA 4PJ7E 3RDTA 3WUWG 1IAOA 1MCLA 5I18H 2MOGA 5I19L 5F3BB 5DS1A 5AZEH 3U7WH 1KN4H 4FQ2H 2F54A 4KXZI 3STZB 1A7RL 4KKCC 1PAZA 5BZWA 3H1ZA 1MCCA 1JRHL 1JNJA 3MJ9L 1MQ8A 3CSGA 4HSQA 4JM2B 4N87A 4AGOA 1CL7L 2C4XA 2X1OA 1XIWA 3IBEA 4MKTA 5BRZD 4BK8A 4UTAL 4WFHE 2P80A 3TN0C 5BS0E 3L5IA 4PGBB 4L4TA 3OKDA 4R5VA 1FFOA 1LK3H 5CD5D 4H5SB 3QIBC 1RIVH 3M1OA 4G8IA 3KPSB 3NJXA 5HYJD 2BOBB 2DQHL 3N1MC 5I1HH 2F8XC 1AKJB 4TPRL 4ZFQA 5KJ4A 3PWJB 1O75A 4LVOC 4E9VA 2F6AA 2PCXA 4WO4A 5FUOH 3QWQB 5FWRA 5IV2B 4GNKB 1JHTB 4JANA 2VLKB 3GSNB 2FNWA 4H1LA 3GMRA 1X6NA 2Y2TA 1A4KA 3MRIB 4XC1H 3DGGB 3HG2A 3WMQA 4G7YH 4NQUA 5GGSA 2H8PB 3N41B 2XIBA 1AKJD 3Q6GH 4FLQA 5I73B 6TAAA 5T3ZL 3WY2A 3KPSD 1L9PA 5JHLA 4K94H 2AJXL 1J18A 3VD1A 2ITDA 1U92A 1WC7B 1I7TB 3U6RA 3AGVA 2PYFA 4QRUA 1MI5B 2OXHB 3KCPA 3VFNA 5FIEA 5KJ7E 1KCRL 4OLVH 4N22A 4UQ2A 2KKQA 4P8QA 2D73A 1TQBC 4J23A 1EJ8A 5I24A 2IBZY 2D7NA 1ITBB 3ZKSD 4PW4A 2VXQA 3FXIC 2RALA 4FQQA 4JM2D 2JJVA 1D5MA 2FWOB 2J20A 1SXSA 3DSFL 5GRJH 5E0QA 4IU2A 3S36X 3AXLB 3BWZA 4Y9BA 3V4PL 4DP4X 1KLFB 3QUZD 4WCYL 3L7FB 4XPGL 4IKNA 2NXZD 4LL4A 4FULA 3L48A 3BKMH 4R4FL 1JV5A 1EDQA 1KTDB 3TPKA 3WU1A 4IOSD 3U4BH 3KYOB 3N9GL 4QRSB 1QSFE 3QDAA 1N18A 4U3SA 1OAZH 5BNXD 2HRGA 3LV3A 4G3YH 4AENA 2YSTA 4P9HL 1I4FA 4NAJA 3KL0A 1IGCH 3VJ6A 1NCBH 5CGBA 2ZOUA 4KKLD 4RFEA 1CUOA 3PHQB 1BZ7B 2XCMC 3WMPA 3UGEA 2F53A 3NCMA 4DFIA 3O6FA 1A2YA 4LB8A 2VL5A 4A6YB 5CILH 4K94L 1JZJA 1QBMH 4P5MA 4KZ0A 4OF3A 4QRRD 5F0MB 5HPOA 4E2OA 4P2OA 1A8JH 12E8L 2IH1B 3BAYA 1L7IH 4P2OD 3S37X 4LLUB 1D9KB 1H3XA 2B7DT 3R18A 5C9JB 1E9PA 3PJSA 3V4PA 1XH2A 1U36A 2SODB 2J12B 1S7VA 1A6ZB 5K33A 3VFMB 3L8QA 5D1XC 3L3OC 4UOW0 1YUHB 4BSWA 3G5WA 3M1BB 1XH3A 1E28B 4N0CD 1A14H 1QFOA 4U1KA 4XB3A 2B59A 1NC2A 1J88A 3MOBH 4FQIH 3HC0A 5BZXA 1PNCA 3VWKB 1N6VA 4OIFA 4LLQB 3U4BL 4MX7A 4PP2B 4BBWA 1I4FB 5AD0A 2UV3A 2C3GA 2B0SL 2ITEA 4M62H 2WB7A 4M02A 4A6YH 2HP4A 1RU9L 2C9XA 1J1XH 3EJJX 5FK9A 1T7ZA 4HKXA 5FO8B 2XTJD 2ZJSL 2F1AA 5F89A 1UEMA 1ZV5A 5CILL 4AIEA 2P5PA 4PJAA 4JN2B 3APCA 3NQKA 1WITA 2DQUH 4GKNA 5AKSA 2Y9RT 5FO9A 1NEZA 3UIZA 3VFGL 3BZ4A 2VN4A 4PS4H 4HJGB 1ZDSA 3HI6H 3AS3A 2NY6B 2PTTA 4LVHC 2CNYA 6PCYA 3BEVB 1R1CA 2WWMD 4AXWB 5HGHB 3LKRA 4EUPG 2A7BA 4WJG3 1OE3A 3QDHA 3WFCH 3ZDXE 1HHJA 1TLKA 3FHAA 3BRGC 4XBMA 4GP8B 4JDTL 1P5UB 2CRMA 4GKZB 5GS3A 1A65A 3BSHA 4M03A 2HJFB 3QIBA 3AY2A 1FNSL 1XGTA 4PGZA 3D3VB 3LQAL 5CWSA 1G6RA 4AE1A 5J6HB 1QLEL 3Q2WA