2NOXA

Crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
261
structure length
261
Chain Sequence
RDMSYGDYLGLDQILSAQHPLSPDHNEMLFIVQHQTTELWMKLMLHELRAARDGVKSDQLQPAFKMLARVSRIMDQLVQAWNVLATMTPPEYSAMRPYLGASSGFQSYQYREIEFILGNKNAAMLRPHAHRPEHLELVETALHTPSMYDEAIRLMARRGFQIDPEVVERDWTQPTQYNASVEAAWLEVYRNPSAHWELYELGEKFVDLEDAFRQWRFRHVTTVERVIGFKRGTGGTEGVSYLRRMLDVVLFPELWKLRTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Crystal structure and mechanism of tryptophan 2,3-dioxygenase, a heme enzyme involved in tryptophan catabolism and in quinolinate biosynthesis.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 105
structure length 261
sequence length 261
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2noxA00
2NW9A 4HKAA 2V7KA 5EK3A 2NOXA 2V7LA 2X68A 4U72A 2V7JA 2NW7A 4U74A 2X67A 2D0UA 1ZEEA 2D0TA 2X66A 5EK4A 3BK9A 5ETWA 5EK2A 2NWBA 2V7MA 4PK5A 4PW8A 4PK6A 2NW8A 1YW0A 2V7IA 3E08A
chains in the Genus database with same CATH superfamily
2WM9A 3PUGA 2PJQA 3ZN0B 5LXTE 2E9XA 3SS1A 3ONLC 4KMCA 5FL1A 3JCFA 4X65T 4CXWA 2VURA 4YHHT 5HEUA 5FKYA 5GONE 2IHR1 3ZJ2A 3C4WA 3RI5A 3O4XE 2LSKA 1Y01A 3RH3A 4KHPT 2CE7A 4H9SE 2JMKA 2D5UA 2E9XD 4EAHA 5LGTB 3MK7C 2NW9A 2Y48B 2IUBA 4QH4A 4BA9A 3AEEA 1G73A 4DBQA 1T98A 3TKLB 4QXHB 2J47A 5L47A 5L3GB 5BR8T 3FZLB 4QX8B 3LSVA 4U2YA 3ZT6A 5CA1E 4EEDA 3Q9DA 3M3ZB 3PDYA 3C4XA 2GK9A 3FBZA 4QHOA 2K24A 5ABEA 5JH7E 2XQ9A 2VL0A 5IWAT 3PJAA 2CXDA 2R6GF 2XQ8A 5AQUB 4DR5T 5E0OA 3AE4A 3VHLA 2HH7A 2BS4A 4UF0A 4KI0F 1R8IA 2E5LT 5FY0A 2CMRA 2I6HA 2ZLYA 3HKDE 4JI1T 4AQFA 2VKJA 4IE5A 4IL4A 2NOXA 2RPAA 4JI8T 5AQLB 3EDVA 2W0GA 5HEOA 1JNZA 4KUMB 3CX6B 4DV1T 5LHIB 2FJEA 3CVRA 4ZZBA 3I0OA 2EHOA 2UUCT 2LLYA 3P50A 5LMNT 4HFIA 4EGWA 4DBRA 3C64A 3UUNA 3LBXA 4F6RC 1Z8UA 1NAFA 3SFEA 4U72A 3Q5DA 5L2LA 3NRXA 3P8CD 3DP7A 1IZNB 5KX5E 3IEEA 5FXVA 3AECA 5HCJA 4AKLA 3ZMVB 4HWCA 1WLXA 4DNDA 2DCFA 1HNWT 2LOSA 1SHZC 2LSYA 2VKHA 2W67A 4DR2T 3WAKA 4DV7T 5DQWA 1FJGT 3ZYMA 4B3TT 5LP6E 4I0UA 2XQ3A 3M65A 3SOLA 2XPKA 1YKHB 3PJAJ 2D0TA 4UIGA 2FBWA 4ZI3C 4A5XA 3E0ZA 2LEHA 4GKKT 4QH5A 3ZSTA 2ACXA 3AA1B 1XWMA 4TWDA 5HXRA 2DL1A 4CI1B 3EI0A 4IDZA 2M6BA 4ZXLA 4OYKA 2X66A 2BVLA 3N2GE 1ZP0A 2CXFA 4O4LE 1UK5A 4HFEA 2FJAA 3L3PA 5JR9B 4Q25A 4EIWA 2K9AA 5LNKA 3PURA 5AQOB 2I59A 1CUNA 1MIVA 2V6XA 4DR1T 1HNZT 1W0AA 4IIJE 2VB6A 3LK2B 2WU2A 3ZSSA 4LF6T 4TV9E 4WNKA 1CHUA 4JI7T 4ZEYA 2J1DG 4AKHA 2KLQA 2V8SV 4BJMA 3OTOT 2BS3A 2JIWA 3AEGA 2CHNA 2MPKA 2LSGA 5A1LA 1IBKT 1QSDA 3J7Yq 3CWZB 4AKGA 2CBIA 4GKJT 1OEDB 5H6RB 5LBQB 5AQQB 4F8HA 4AISA 3ETUA 2ZM0A 3UU6A 3HKEE 5IUXA 3AXJA 3SWHA 3I0QA 5AQSB 3ONXA 3UTKA 3CKDA 1IJ6A 4EOZB 1LVFA 3QK6A 5JTGA 3BQLA 4V1Av 2BBJA 2A9UA 1MMAA 1FEWA 4PJMA 2NTXA 3EUHA 3P4QA 4HFBA 4CQIA 2ODUA 1FMWA 4XZCA 2DLRA 3PUQA 2LRLA 3AE1A 3PUZF 4I50E 5LGUB 2X68A 3N9OA 4PJJA 4EXTA 1W9RA 4ERRA 5HAXA 4UEMA 2HN2A 2V6YB 4ZI2C 4NPPA 4JI0T 2XSAA 3FZKB 4ILAA 4IE4A 1XDPA 2CLYB 3GN5A 3KBTA 4TX5A 4AKRB 5AQIB 2H89A 3NZQA 2WBLA 4LFBT 5LHGB 2LHNA 4X5TA 3IBPA 3ZYLA 2XQYA 4EEBA 2WQYA 5FXZA 4H63H 1D1AA 2PBIA 1ZV4X 4MLKA 2VWAA 3FHNA 4PFOA 3UUBA 3ZMSB 4ZI3D 3N9PA 1FIOA 4DO0A 3N9NA 4NIQA 4AQFC 4DR7T 4WW0A 3ANWB 2LSIA 4U33A 2XQ7A 1G8XA 5ETWA 3VRBA 3PU3A 4I55E 5DABA 1OEDE 1VCTA 4EYUA 4PK6A 2AE9A 3E08A 1LRZA 2EHOC 2X0YA 1QUUA 4A98A 2JQHA 2WU5A 4A56A 2L9QA 2L3LA 3NKZA 2CEAA 4ILCA 4DV6T 2W62A 4ANJA 3QUJA 1KF6A 3QC9A 2XM1A 3LFMA 5L3BB 2UUAT 2A3DA 1B7TA 3I1AA 3OPCA 2X0HA 4JUYA 4TN7B 3F2EA 2LM2A 4G2AA 3CIRA 4CN4A 4YT0A 3EVYA 1HF8A 1IBLT 1V9DA 4P09A 2JQQA 1WR6A 2N1GA 2XAGB 2BG9B 5LG3A 2J62A 2XAJB 3RIFA 2WS3A 1KEYA 4H63V 1YD8G 2PG8A 4ZS2A 4QX7B 3P7IA 3PV0F 2AXDS 3MACA 3WAJA 3J9X1 1LVKA 4YSXA 5FXWA 4X20E 4LF5T 1MIWA 4QKNA 5ABGA 2RP4A 3GMIA 1XDOA 3OBVE 4N78D 5HYAA 1WCRA 5J0ZA 3AVSA 4L5GA 2KSRA 3C50A 4IHJE 1HS7A 2C5JA 5JRCA 2C0SA 3RX6A 4UR9A 1ZOYA 1UCUA 4CXYA 5LBMA 4P1NA 4JI5T 4WZXA 4DV4T 5AQGB 2I0MA 3K1SA 3LK3B 1WR0A 4G63A 2KT9A 4XBFB 4ZZCA 4HWIB 2CA5A 3ZMZB 2ES0A 2Q9QA 5HXSA 3HA4A 4X1KE 3RYFE 3ZMUB 1WRDA 5JDNA 1EZ3A 5FVLA 4DR6T 2WZHA 5LHHB 4TV8E 5LJNA 2UXXB 4E7ZA 2WB5A 5AQFB 2LRKA 2Y8DA 3AAIA 4ZI2D 1D0XA 5JQGE 4OX9T 1SE7A 2UXBT 1YKEB 3LK42 5HCMA 2IW5B 5FYMA 2UUBT 4ZOLE 3S4UA 3Q2MA 5IHYA 4X1IE 2YDRA 4DMVA 4JI6T 2V5DA 3ZT5A 4PK5A 3UUMA 3CQXC 1Z0PA 4KP3C 3N9MA 1HTJF 1Y64B 2W61A 3C51A 4FI5A 4MBQA 1I94T 2HHHT 1XZYA 4DR3T 5EK3A 3VRAA 2W00A 1KK7A 3CMLA 1YXRA 1W09A 3KV9A 5JDLA 1U5PA 3CK6A 2W4XA 3ZLIA 2X9HA 4ZI7E 2JRKA 2E5VA 2BG9E 3PUXF 2BDEA 2XQAA 2X0LB 4AKIA 3GA8A 3UFEA 5LYJE 2DWGA 2JMHA 2EHOD 2D0UA 2XZEA 5HXEA 4JYAT 2YINA 1HFAA 3AA7B 1WFDA 5M4YA 4X62T 5LOVE 3UFGA 5LG4A 1M7KA 1XMOT 2IIUA 3AE3A 4I43B 4PK4A 2XY8B 3AAEB 5AQHB 1UX5A 3KDSE 3N9QA 4LFCT 3ZKRA 2RA1A 5HEJA 4UV9B 2K48A 3RYHE 2VVSA 3K3QC 4U7IA 3ESLA 1VRBA 4X64T 3A5XA 4M1PA 2WDVA 5EK4A 4IT4A 3HR0A 5AQJB 3RC3A 2NWBA 2JQ9A 3L09A 4UELA 2WMOA 3RKOA 5KXJA 3UQ4A 3ZT7A 4TNWA 4FJOA 2QVAA 4H9RC 2NR4A 1X79A 5JR9C 4B6XA 4KX6A 3R84B 4Z90A 5HXCA 4UVAB 2K5BB 2BZBA 5AFUL 2A72A 4JEHB 2WSSV 2H7OA 3KV4A 2WCAA 5DJQC 2KWHA 4B3MT 5AQKB 1VOMA 3VKHA 3QB5K 3VKGA 4QH1A 4Z8XA 2J4GA 4LMKA 5LB7B 4EB6E 2B76A 3FBLA 3RYCE 3UULA 3P4PA 3UU3A 4HWFA 5KMGP 5ABFB 1FMVA 3VU7H 3AE7A 4PFPA 5F8PA 2CM0A 3RLFF 4NUUA 4YJ3E 5L3FB 4OK0A 3K3OA 3CQCB 3RF1A 1D1BA 4TZ4C 4PAGA 3F31A 4IE7A 3P4WA 5TAOA 3AEFA 4HWDA 5CB4E 2CHOA 4GOUA 4IREA 5JREA 1XMQT 2ZM2A 5FNVE 2OLTA 3FZFB 3RPUA 2E9XB 1NENA 3VR8A 2FJDA 2BBHA 1MMGA 2DI4A 4U31A 2KNDA 5F5WA 2WP9A 3AE6A 3RIUC 4GK5E 3CQGB 4ILBA 4DUZT 3MXZA 1OXZA 4OFZA 5L3DB 5ABHA 2VVNA 3H3AA 4YLHA 3R6NA 2IC9A 3ZJ1A 4BAYB 2LKHA 4IL9A 2ODVA 2UU9T 1T72A 1W0BA 1KFYA 2WDRA 3UU5A 4ASKA 4K0KT 2YK0A 4CZZB 3AEAA 4YHJA 4KBMB 2V7MA 4P0AA 4ISTA 2UXDT 1N32T 1IBMT 4BJNA 2XQ5A 4WBNE 2XHEB 2W66A 3KVAA 2YOEA 3AB3B 4JI2T 1IJ5A 4DV0T 2HN1A 3RRWA 2LM9A 2Q9QC 2HPJA 3ETVA 3EHZA 2N2NA 5H6QB 2CXLA 4NUVA 4C91A 3DJBA 5AQPB 2IMLA 4U7YA 2CBJA 3RKGA 3D0TA 2KWIB 3A7MA 2VASA 4O4IE 4JI4T 5FXXA 2VL8A 2VK9A 4IDOA 2L8KA 3VR9A 4TNVA 5J2TE 2JPFA 2LSJA 1MIYA 5JDFA 4UF0B 3RYIE 3P4SA 3AE8A 3QB5A 3JC6C 2FUPA 5JR9A 1HCIA 2PFVA 4O2AE 2DWKA 4UVCB 3O9XA 3O1JA 1WYCA 1DU2A 3TLWA 3L39A 4YTPA 3IHRA 2EHOB 5FY1A 2XAHB 4PJLA 1QLBA 3RIAA 4YSZA 2YU1A 2WWUA 4HWHA 2D9DA 3ZCJA 3LBXB 4ILUA 3PUWF 4ZHQE 3H3MA 2W63A 3RHWA 4JI3T 2YEVC 3AA0B 4DUYT 1S35A 2CCQA 2QRXA 3K8PC 4TWFA 4DIDB 1XNQT 2X67A 4COFA 4KHZF 3UU8A 2CPTA 1LKXA 2H3RA 5HWXA 1OEDA 4IE0A 2UXNB 3MKDA 2BKPA 3MJXA 5CFBA 2XUEA 2N9DA 1BR2A 1MMNA 2FJBA 3BK9A 2E8IA 2H88A 3RIUA 4O2BE 4JLEA 4WYVA 2WZIA 3KV6A 5L4EA 3PE0A 2X9XA 2V7JA 2BG9C 4X66T 2QA7A 2XAQB 1N33T 1ZEEA 3ONJA 4B3ST 3RRCA 5JDQA 5ADXL 4L9IA 3AEDA 2IC6A 2LT3A 3MZKB 3HI2A 4HTEA 4H9QC 1H7CA 4ISSA 4UXNB 5C3JA 2QGSA 3NRYA 2NP9A 3PUAA 3LDQB 1SA0E 5CGMA 4U2ZA 2KXPB 3EABA 3X1DA 4P0BA 2WWVA 3A8YC 5CA0E 5JDGA 4E7SA 4YJ2E 2NW8A 2VQFT 2C5KT 2CWYA 3LG7A 3U3IA 3ZMTB 3KVBA 3TLVA 3U78A 5FVKA 3PUSA 2V6YA 5AQRB 5LCYA 2LHRA 1KNZA 4PNIA 2OV9A 1HX8A 3BQKA 5JDMA 3T8OA 1SUMB 3FXEB 4IDNA 4O4JE 2WDQA 1UURA 2F4VT 2G0UA 4Z91A 2B1EA 4TUYE 3PUVF 2MTQA 4OYJA 1NWMX 2BKNA 1IAPA 3V5SA 3N5LA 1YW0A 4HKAA 4EZ4A 2Q9QD 3ZCIA 3LJCA 3AA6B 2NW7A 4CN6A 3AE2A 3AXJB 1HG2A 1YQ4A 5FMNA 4HFVA 3TLSA 3QOFA 3ZC1A 1N34T 3ANWA 3NBXX 4JEUB 1YQ3A 5DQVA 5HXHA 4AXPA 5KDMC 3JC6D 3V5UA 3RQWA 3HKBE 1M62A 2XQ4A 2ZMAA 3KBUA 1BR1A 4ADZA 2LKGA 3KFWX 5IYZE 4YXDA 2JJ9A 3PTRB 2SPCA 1D1CA 3ZN1B 1KNPA 4JV5T 3L8RA 3FB2A 5JVDE 4H9OC 3WI3A 3N2KE 2JQKA 4U74A 1S94A 2XTLA 2YU2A 1VCSA 3UU4A 2QYWA 1J1JA 4YFSA 3NVOA 4I4TE 4LF4T 2MBGA 3MA9A 1ZHCA 5FY7A 4LF9T 1HG5A 5J1GA 4LF7T 2XJ7A 4LF8T 2CRBA 3W15B 5FL0A 4O8SA 3HL6A 3GN5B 4EZHA 4HFHA 2BG9A 2M67A 5HEGA 5LMUT 2W2UA 2YKSA 5L3EB 4DR4T 3IA3A 2XSBA 1D0YA 2VKDA 3CX7B 4EV6A 2KZ7B 4MHCA 2IDOB 3I9WA 4HEAA 5LA6E 1N36T 3GWHA 2LE8A 1J5ET 3CPZA 2XASB 4OHFA 2KINB 2WMNA 4GIWA 4WBOA 4LMJA 5JDHA 3FXDB 4HN9A 2WAUA 3P4RA 3ZEFB 3AVRA 4YTMA 1J5WA 5CJ5A 3C98B 1AJ3A 5J2UE 3N2OA 2V1DB 2V7LA 4UV8B 2IAKA 3UQ7A 3T1HT 3AAAB 2YDSA 2ACZA 4DV3T 3B5MA 3ZC0A 2MYSA 1ZKEA 4UVBB 2OA5A 3RGLA 1BR0A 3RC8A 4LMLA 4TWHA 2DHRA 4GK0E 3UUXB 2X9WA 5AQVB 2C5IT 2UXCT 4X1YE 3B13A 3NZPA 3I9YA 2D2SA 2XAFB 4CI3B 4PW8A 3C4ZA 4NXMT 3NWIA 4IDPA 1HX1B 1L0VA 4NXNT 1OEDC 2BVMA 3UT5E 4YTNA 5LGNB 2CWOA 1MNDA 4HGAA 3RQUA 1D0ZA 3OJAA 3OVUA 4XAXB 3F57A 3FZHB 3T1YT 3AEBA 4YY3T 4C90A 2LOPA 3AE5A 4IDQA 4HFDA 2E9XC 4B3RT 2LJLA 3Q5XA 5FP3A 1BR4A 4YSYA 3TLTA 4GYRA 4ZS3A 5EK2A 2VQET 4DMWA 3EAMA 3JAFA 1T7SA 4H9NC 2V26A 4GYSA 3ZPOA 5LJMA 2DNXA 3N9LA 4MFRA 1XNRT 4DV5T 5JRCB 3ABVA 3QNUA 3CX8B 1WYBA 4JBWF 3TLUA 2BS2A 4CXXA 3OYZA 1E7PA 2BKOA 4MALA 4AI6A 1GQEA 2H7VC 3K3NA 3OKQA 4AQYT 4PJNA 2NTYA 5C8YE 2Q9QB 3AE9A 1JNRA 3IF8B 1US7B 3O1HA 1HR0T 3EDUA 2X9YA 3KV5A 2E2AA 1MMDA 2CLYC 1KNRA 1X9BA 2XQ6A 2P9BA 3O1IA 4IGUA 4AIUA 4HFCA 2K3WA 4J2CA 5F3JA 4QWNB 2PTFA 4A97A 3Q5EA 4U3CA 5C2TA 3B57A 2V5CA 2ZM8A 5HWYA 2XM2A 4CN1A 2M6IA 1O3XA 4K0UA 3ZYKA 2MOZA 4DVDA 1HNXT 3JADA 2KMFA 4DV2T 4CI2B 3G06A 4O4HE 4IE6A 1UUSA 4QXCB 1T8BA 2Y6XA 1MNEA 2Z6EA 3BQIA 3PU8A 3SRZA 1UGOA 5AQMB 4HE8A 3H37A 3SFDA 5EZYE 1UX4A 1I6ZA 5AQNB 3HKCE 3PUYF 4EYYR 1E2AA 1U4QA 3KINB 5ABFA 3E22E 2YN6A 1E1HB 3Q5WA 4AQGA 3DTOA 4L0RA 5AQTB 2V7KA 1OWAA 2VKOA 2X51A 2YDQA 3FZMB 4QXBB 4LFAT 1NEKA 3JAEA 2HPLA 3OYXA 2MAWA 2ZM6T 2A2FX 5L3CB 2WY2A 5L4HA 5HEHA 4H9PC 5BMVE 2V7IA
chains in the Genus database with same CATH topology
2WM9A 3ANWA 4ZI2C 3PUGA 2PJQA 3ZN0B 3KV4A 3NBXX 5LXTE 4IE4A 2E9XA 4JEUB 5DJQC 2KWHA 3SS1A 5HXHA 5DQVA 4KMCA 4AXPA 1VOMA 3VKHA 4CXWA 3VKGA 5KDMC 4Z8XA 2CLYB 3GN5A 3JC6D 5GONE 3V5UA 3KBTA 4TX5A 4EB6E 3FBLA 3HKBE 3ZJ2A 4AKRB 3C4WA 3RYCE 3UULA 3O4XE 2ZMAA 3KBUA 1BR1A 2LSKA 4ADZA 3NZQA 2WBLA 5KMGP 1FMVA 5LHGB 3VU7H 2LHNA 3KFWX 5IYZE 2JJ9A 4PFPA 5F8PA 2CM0A 3IBPA 3ZYLA 3RH3A 2XQYA 2CE7A 3PTRB 2SPCA 1D1CA 3ZN1B 4NUUA 4YJ3E 5L3FB 4H9SE 2JMKA 5FXZA 4H63H 1D1AA 2PBIA 4OK0A 3K3OA 3CQCB 1D1BA 2D5UA 4TZ4C 3FB2A 1ZV4X 5JVDE 4PAGA 3F31A 4H9OC 4IE7A 3WI3A 2E9XD 3N2KE 4MLKA 2VWAA 3FHNA 4PFOA 4EAHA 5TAOA 5LGTB 4U74A 3MK7C 3ZMSB 5CB4E 2NW9A 4GOUA 4ZI3D 1S94A 2XTLA 3N9PA 2Y48B 1FIOA 2YU2A 4DO0A 5JREA 3N9NA 4YFSA 2ZM2A 4AQFC 4BA9A 5FNVE 4I4TE 4WW0A 1G73A 3ANWB 2LSIA 2MBGA 4DBQA 3RPUA 3MA9A 1G8XA 5ETWA 2E9XB 1T98A 3PU3A 3TKLB 1ZHCA 4I55E 5DABA 5FY7A 4QXHB 1MMGA 1HG5A 5J1GA 2DI4A 4EYUA 2KNDA 4PK6A 3W15B 5L3GB 4O8SA 3E08A 1LRZA 4QX8B 2EHOC 4GK5E 3CQGB 3HL6A 3GN5B 4EZHA 1QUUA 3MXZA 1OXZA 4OFZA 5L3DB 5CA1E 2M67A 3H3AA 4YLHA 3Q9DA 3PDYA 4A56A 3C4XA 3R6NA 2IC9A 2GK9A 5L3EB 3FBZA 2L9QA 2L3LA 2K24A 4QHOA 5JH7E 3ZJ1A 4BAYB 1D0YA 2CXDA 2VKDA 2CEAA 3CX7B 2ODVA 2KZ7B 4MHCA 3I9WA 4HEAA 5LA6E 2W62A 3GWHA 4ANJA 2LE8A 5E0OA 3VHLA 3QUJA 3CPZA 3QC9A 4ASKA 2HH7A 2XASB 4OHFA 3LFMA 5L3BB 2KINB 2WMNA 4UF0A 4GIWA 2YK0A 4CZZB 4YHJA 5FY0A 2CMRA 4WBOA 2A3DA 4KBMB 2V7MA 1B7TA 3I1AA 4P0AA 4ISTA 5JDHA 3FXDB 4HN9A 2WAUA 2ZLYA 3ZEFB 4JUYA 3HKDE 3AVRA 4TN7B 3F2EA 4BJNA 3C98B 4AQFA 4WBNE 2XHEB 2VKJA 4G2AA 1AJ3A 5J2UE 4IE5A 3N2OA 2V1DB 2NOXA 3EVYA 1HF8A 3KVAA 2V7LA 1V9DA 4UV8B 2IAKA 3AB3B 3EDVA 4P09A 2W0GA 2JQQA 3AAAB 1WR6A 2N1GA 1IJ5A 4KUMB 3CX6B 2XAGB 3RRWA 2LM9A 2Q9QC 5LHIB 2HPJA 3ETVA 3CVRA 2N2NA 2XAJB 3I0OA 5H6QB 2EHOA 3ZC0A 2CXLA 4NUVA 2MYSA 4H63V 4C91A 3DJBA 1ZKEA 1YD8G 2PG8A 4UVBB 2OA5A 4DBRA 3C64A 3UUNA 3RC8A 1BR0A 4ZS2A 4QX7B 3D0TA 3P7IA 2DHRA 2KWIB 4GK0E 3LBXA 3UUXB 2X9WA 4F6RC 2VASA 1NAFA 4O4IE 3MACA 2C5IT 4U72A 3WAJA 5FXXA 3J9X1 1LVKA 2VL8A 2VK9A 5FXWA 5L2LA 3NRXA 4X1YE 3B13A 3NZPA 2L8KA 3P8CD 5J2TE 2JPFA 4X20E 3I9YA 1MIWA 1MIYA 2LSJA 4QKNA 2RP4A 2D2SA 3DP7A 2XAFB 3GMIA 1IZNB 3OBVE 4N78D 4CI3B 5HYAA 5KX5E 5JDFA 4PW8A 3C4ZA 3IEEA 4UF0B 5FXVA 3AVSA 4L5GA 3RYIE 4AKLA 2BVMA 3UT5E 3ZMVB 1WLXA 3JC6C 3C50A 4DNDA 2DCFA 4IHJE 1HS7A 2C5JA 5JRCA 2C0SA 2LOSA 5LGNB 5JR9A 3RX6A 2CWOA 1SHZC 1MNDA 1UCUA 2LSYA 4CXYA 5LBMA 1HCIA 4HGAA 2PFVA 1D0ZA 2VKHA 3OJAA 3WAKA 4XAXB 3F57A 4O2AE 2DWKA 4UVCB 5DQWA 3O9XA 3O1JA 1WYCA 3LK3B 3ZYMA 4G63A 2KT9A 4XBFB 4C90A 5LP6E 2LOPA 3M65A 3SOLA 3IHRA 2CA5A 2EHOB 3ZMZB 1YKHB 5FY1A 2XAHB 2E9XC 4PJLA 2ES0A 2LJLA 2Q9QA 3Q5XA 5FP3A 3HA4A 4X1KE 1BR4A 2YU1A 3RYFE 2D0TA 5HXSA 2WWUA 3ZMUB 4UIGA 4ZI3C 3E0ZA 1WRDA 2LEHA 3LBXB 3ZCJA 5JDNA 1EZ3A 4ILUA 5LHHB 4TV8E 5LJNA 4GYRA 4ZHQE 4ZS3A 2ACXA 3AA1B 2W63A 5EK2A 2UXXB 4E7ZA 5HXRA 4DMWA 2YEVC 3AA0B 4CI1B 1S35A 2CCQA 4IDZA 4H9NC 3K8PC 2V26A 4GYSA 3ZPOA 2Y8DA 4OYKA 3AAIA 2X67A 4ZI2D 5LJMA 1D0XA 2DNXA 2X66A 2BVLA 3N2GE 5JQGE 3N9LA 2CXFA 4MFRA 4O4LE 5JRCB 1LKXA 2H3RA 3CX8B 3L3PA 5HWXA 5JR9B 1WYBA 1YKEB 3LK42 4IE0A 2UXNB 4EIWA 2K9AA 3MKDA 2IW5B 5LNKA 5FYMA 3PURA 2I59A 4ZOLE 1CUNA 4CXXA 3OYZA 3S4UA 3MJXA 3Q2MA 1MIVA 5IHYA 2XUEA 2N9DA 4X1IE 4MALA 4AI6A 1BR2A 1MMNA 2H7VC 4DMVA 4IIJE 3BK9A 2VB6A 3K3NA 2E8IA 3LK2B 3OKQA 4PK5A 4PJNA 3UUMA 3CQXC 1Z0PA 4KP3C 3N9MA 2NTYA 5C8YE 1HTJF 4TV9E 2Q9QB 1Y64B 4WNKA 4O2BE 2W61A 3C51A 4FI5A 4JLEA 4MBQA 3IF8B 1US7B 3O1HA 5EK3A 2J1DG 3KV6A 2KLQA 4AKHA 2W00A 3EDUA 1KK7A 2X9YA 3KV5A 4BJMA 3PE0A 2X9XA 1MMDA 3CMLA 2V7JA 2CLYC 2QA7A 2XAQB 1ZEEA 3KV9A 1U5PA 3RRCA 5JDLA 5JDQA 2LSGA 5ADXL 4L9IA 5A1LA 3ZLIA 2P9BA 2IC6A 2X9HA 3O1IA 4IGUA 4ZI7E 2LT3A 3MZKB 3HI2A 4J2CA 2JRKA 1QSDA 4HTEA 4H9QC 1H7CA 5F3JA 4QWNB 3J7Yq 3CWZB 4ISSA 2BDEA 2QGSA 3NRYA 3PUAA 2NP9A 4UXNB 4AKGA 2X0LB 1SA0E 2KXPB 4AKIA 3GA8A 3UFEA 5LYJE 2DWGA 5H6RB 2JMHA 2EHOD 5LBQB 2D0UA 3B57A 2ZM8A 4P0BA 5HWYA 1O3XA 4K0UA 5HXEA 5CA0E 3ZYKA 2MOZA 3ETUA 5JDGA 2YINA 1HFAA 4DVDA 4E7SA 4YJ2E 2ZM0A 3AA7B 2NW8A 3HKEE 2KMFA 5M4YA 5LOVE 5LG4A 4CI2B 3SWHA 2C5KT 3I0QA 4O4HE 4IE6A 4I43B 2CWYA 3LG7A 4PK4A 3U3IA 3ZMTB 3KVBA 2Y6XA 3AAEB 3ONXA 1UX5A 4QXCB 3U78A 3KDSE 3UTKA 1MNEA 3PUSA 2Z6EA 3CKDA 3N9QA 1IJ6A 2RA1A 4EOZB 5LCYA 1LVFA 3QK6A 3BQIA 2LHRA 1KNZA 4PNIA 3BQLA 4UV9B 3PU8A 2K48A 3RYHE 4V1Av 3SRZA 1MMAA 1FEWA 4PJMA 3K3QC 1HX8A 4HE8A 3BQKA 3H37A 5JDMA 3ESLA 1VRBA 3T8OA 5EZYE 2NTXA 1UX4A 3FXEB 3HKCE 3A5XA 4M1PA 3EUHA 4O4JE 4EYYR 5EK4A 2G0UA 2B1EA 3HR0A 3RC3A 4TUYE 2NWBA 4CQIA 1U4QA 2ODUA 2MTQA 4OYJA 3KINB 1NWMX 3E22E 3L09A 4UELA 1FMWA 4XZCA 2WMOA 1E1HB 2DLRA 3PUQA 3Q5WA 3RKOA 1IAPA 3V5SA 4AQGA 3N5LA 1YW0A 3DTOA 4L0RA 4HKAA 4EZ4A 2V7KA 2Q9QD 3ZCIA 4I50E 5LGUB 3LJCA 4FJOA 1OWAA 2VKOA 2X68A 2X51A 3AA6B 4QXBB 4H9RC 2NW7A 1X79A 5JR9C 3N9OA 4PJJA 1HG2A 2HPLA 4EXTA 3OYXA 4B6XA 2A2FX 3R84B 5L3CB 5FMNA 5HXCA 4UVAB 5HAXA 4HFVA 2K5BB 4ERRA 2BZBA 4UEMA 5AFUL 4H9PC 2A72A 4JEHB 3ZC1A 5BMVE 2V7IA 2WSSV 2H7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW9 A;  4HKA A;  2V7K A;  5EK3 A;  2NOX A;  2V7L A;  2X68 A;  4U72 A;  2V7J A;  2NW7 A;  4U74 A;  2X67 A;  2D0U A;  1ZEE A;  2D0T A;  2X66 A;  5EK4 A;  3BK9 A;  5ETW A;  5EK2 A;  2NWB A;  2V7M A;  4PK5 A;  4PW8 A;  4PK6 A;  2NW8 A;  1YW0 A;  2V7I A;  3E08 A; 
#chains in the Genus database with same CATH topology
 2WM9 A;  3PUG A;  2PJQ A;  3ZN0 B;  5LXT E;  2E9X A;  3SS1 A;  3ONL C;  4KMC A;  5FL1 A;  3JCF A;  4X65 T;  4CXW A;  2VUR A;  4YHH T;  5HEU A;  5FKY A;  5GON E;  2IHR 1;  3ZJ2 A;  3C4W A;  3RI5 A;  3O4X E;  2LSK A;  1Y01 A;  3RH3 A;  4KHP T;  2CE7 A;  4H9S E;  2JMK A;  2D5U A;  2E9X D;  4EAH A;  5LGT B;  3MK7 C;  2NW9 A;  2Y48 B;  2IUB A;  4QH4 A;  4BA9 A;  3AEE A;  1G73 A;  4DBQ A;  1T98 A;  3TKL B;  4QXH B;  2J47 A;  5L47 A;  5L3G B;  5BR8 T;  3FZL B;  4QX8 B;  3LSV A;  4U2Y A;  3ZT6 A;  5CA1 E;  4EED A;  3Q9D A;  3M3Z B;  3PDY A;  3C4X A;  2GK9 A;  3FBZ A;  4QHO A;  2K24 A;  5ABE A;  5JH7 E;  2XQ9 A;  2VL0 A;  5IWA T;  3PJA A;  2CXD A;  2R6G F;  2XQ8 A;  5AQU B;  4DR5 T;  5E0O A;  3AE4 A;  3VHL A;  2HH7 A;  2BS4 A;  4UF0 A;  4KI0 F;  1R8I A;  2E5L T;  5FY0 A;  2CMR A;  2I6H A;  2ZLY A;  3HKD E;  4JI1 T;  4AQF A;  2VKJ A;  4IE5 A;  4IL4 A;  2NOX A;  2RPA A;  4JI8 T;  5AQL B;  3EDV A;  2W0G A;  5HEO A;  1JNZ A;  4KUM B;  3CX6 B;  4DV1 T;  5LHI B;  2FJE A;  3CVR A;  4ZZB A;  3I0O A;  2EHO A;  2UUC T;  2LLY A;  3P50 A;  5LMN T;  4HFI A;  4EGW A;  4DBR A;  3C64 A;  3UUN A;  3LBX A;  4F6R C;  1Z8U A;  1NAF A;  3SFE A;  4U72 A;  3Q5D A;  5L2L A;  3NRX A;  3P8C D;  3DP7 A;  1IZN B;  5KX5 E;  3IEE A;  5FXV A;  3AEC A;  5HCJ A;  4AKL A;  3ZMV B;  4HWC A;  1WLX A;  4DND A;  2DCF A;  1HNW T;  2LOS A;  1SHZ C;  2LSY A;  2VKH A;  2W67 A;  4DR2 T;  3WAK A;  4DV7 T;  5DQW A;  1FJG T;  3ZYM A;  4B3T T;  5LP6 E;  4I0U A;  2XQ3 A;  3M65 A;  3SOL A;  2XPK A;  1YKH B;  3PJA J;  2D0T A;  4UIG A;  2FBW A;  4ZI3 C;  4A5X A;  3E0Z A;  2LEH A;  4GKK T;  4QH5 A;  3ZST A;  2ACX A;  3AA1 B;  1XWM A;  4TWD A;  5HXR A;  2DL1 A;  4CI1 B;  3EI0 A;  4IDZ A;  2M6B A;  4ZXL A;  4OYK A;  2X66 A;  2BVL A;  3N2G E;  1ZP0 A;  2CXF A;  4O4L E;  1UK5 A;  4HFE A;  2FJA A;  3L3P A;  5JR9 B;  4Q25 A;  4EIW A;  2K9A A;  5LNK A;  3PUR A;  5AQO B;  2I59 A;  1CUN A;  1MIV A;  2V6X A;  4DR1 T;  1HNZ T;  1W0A A;  4IIJ E;  2VB6 A;  3LK2 B;  2WU2 A;  3ZSS A;  4LF6 T;  4TV9 E;  4WNK A;  1CHU A;  4JI7 T;  4ZEY A;  2J1D G;  4AKH A;  2KLQ A;  2V8S V;  4BJM A;  3OTO T;  2BS3 A;  2JIW A;  3AEG A;  2CHN A;  2MPK A;  2LSG A;  5A1L A;  1IBK T;  1QSD A;  3J7Y q;  3CWZ B;  4AKG A;  2CBI A;  4GKJ T;  1OED B;  5H6R B;  5LBQ B;  5AQQ B;  4F8H A;  4AIS A;  3ETU A;  2ZM0 A;  3UU6 A;  3HKE E;  5IUX A;  3AXJ A;  3SWH A;  3I0Q A;  5AQS B;  3ONX A;  3UTK A;  3CKD A;  1IJ6 A;  4EOZ B;  1LVF A;  3QK6 A;  5JTG A;  3BQL A;  4V1A v;  2BBJ A;  2A9U A;  1MMA A;  1FEW A;  4PJM A;  2NTX A;  3EUH A;  3P4Q A;  4HFB A;  4CQI A;  2ODU A;  1FMW A;  4XZC A;  2DLR A;  3PUQ A;  2LRL A;  3AE1 A;  3PUZ F;  4I50 E;  5LGU B;  2X68 A;  3N9O A;  4PJJ A;  4EXT A;  1W9R A;  4ERR A;  5HAX A;  4UEM A;  2HN2 A;  2V6Y B;  4ZI2 C;  4NPP A;  4JI0 T;  2XSA A;  3FZK B;  4ILA A;  4IE4 A;  1XDP A;  2CLY B;  3GN5 A;  3KBT A;  4TX5 A;  4AKR B;  5AQI B;  2H89 A;  3NZQ A;  2WBL A;  4LFB T;  5LHG B;  2LHN A;  4X5T A;  3IBP A;  3ZYL A;  2XQY A;  4EEB A;  2WQY A;  5FXZ A;  4H63 H;  1D1A A;  2PBI A;  1ZV4 X;  4MLK A;  2VWA A;  3FHN A;  4PFO A;  3UUB A;  3ZMS B;  4ZI3 D;  3N9P A;  1FIO A;  4DO0 A;  3N9N A;  4NIQ A;  4AQF C;  4DR7 T;  4WW0 A;  3ANW B;  2LSI A;  4U33 A;  2XQ7 A;  1G8X A;  5ETW A;  3VRB A;  3PU3 A;  4I55 E;  5DAB A;  1OED E;  1VCT A;  4EYU A;  4PK6 A;  2AE9 A;  3E08 A;  1LRZ A;  2EHO C;  2X0Y A;  1QUU A;  4A98 A;  2JQH A;  2WU5 A;  4A56 A;  2L9Q A;  2L3L A;  3NKZ A;  2CEA A;  4ILC A;  4DV6 T;  2W62 A;  4ANJ A;  3QUJ A;  1KF6 A;  3QC9 A;  2XM1 A;  3LFM A;  5L3B B;  2UUA T;  2A3D A;  1B7T A;  3I1A A;  3OPC A;  2X0H A;  4JUY A;  4TN7 B;  3F2E A;  2LM2 A;  4G2A A;  3CIR A;  4CN4 A;  4YT0 A;  3EVY A;  1HF8 A;  1IBL T;  1V9D A;  4P09 A;  2JQQ A;  1WR6 A;  2N1G A;  2XAG B;  2BG9 B;  5LG3 A;  2J62 A;  2XAJ B;  3RIF A;  2WS3 A;  1KEY A;  4H63 V;  1YD8 G;  2PG8 A;  4ZS2 A;  4QX7 B;  3P7I A;  3PV0 F;  2AXD S;  3MAC A;  3WAJ A;  3J9X 1;  1LVK A;  4YSX A;  5FXW A;  4X20 E;  4LF5 T;  1MIW A;  4QKN A;  5ABG A;  2RP4 A;  3GMI A;  1XDO A;  3OBV E;  4N78 D;  5HYA A;  1WCR A;  5J0Z A;  3AVS A;  4L5G A;  2KSR A;  3C50 A;  4IHJ E;  1HS7 A;  2C5J A;  5JRC A;  2C0S A;  3RX6 A;  4UR9 A;  1ZOY A;  1UCU A;  4CXY A;  5LBM A;  4P1N A;  4JI5 T;  4WZX A;  4DV4 T;  5AQG B;  2I0M A;  3K1S A;  3LK3 B;  1WR0 A;  4G63 A;  2KT9 A;  4XBF B;  4ZZC A;  4HWI B;  2CA5 A;  3ZMZ B;  2ES0 A;  2Q9Q A;  5HXS A;  3HA4 A;  4X1K E;  3RYF E;  3ZMU B;  1WRD A;  5JDN A;  1EZ3 A;  5FVL A;  4DR6 T;  2WZH A;  5LHH B;  4TV8 E;  5LJN A;  2UXX B;  4E7Z A;  2WB5 A;  5AQF B;  2LRK A;  2Y8D A;  3AAI A;  4ZI2 D;  1D0X A;  5JQG E;  4OX9 T;  1SE7 A;  2UXB T;  1YKE B;  3LK4 2;  5HCM A;  2IW5 B;  5FYM A;  2UUB T;  4ZOL E;  3S4U A;  3Q2M A;  5IHY A;  4X1I E;  2YDR A;  4DMV A;  4JI6 T;  2V5D A;  3ZT5 A;  4PK5 A;  3UUM A;  3CQX C;  1Z0P A;  4KP3 C;  3N9M A;  1HTJ F;  1Y64 B;  2W61 A;  3C51 A;  4FI5 A;  4MBQ A;  1I94 T;  2HHH T;  1XZY A;  4DR3 T;  5EK3 A;  3VRA A;  2W00 A;  1KK7 A;  3CML A;  1YXR A;  1W09 A;  3KV9 A;  5JDL A;  1U5P A;  3CK6 A;  2W4X A;  3ZLI A;  2X9H A;  4ZI7 E;  2JRK A;  2E5V A;  2BG9 E;  3PUX F;  2BDE A;  2XQA A;  2X0L B;  4AKI A;  3GA8 A;  3UFE A;  5LYJ E;  2DWG A;  2JMH A;  2EHO D;  2D0U A;  2XZE A;  5HXE A;  4JYA T;  2YIN A;  1HFA A;  3AA7 B;  1WFD A;  5M4Y A;  4X62 T;  5LOV E;  3UFG A;  5LG4 A;  1M7K A;  1XMO T;  2IIU A;  3AE3 A;  4I43 B;  4PK4 A;  2XY8 B;  3AAE B;  5AQH B;  1UX5 A;  3KDS E;  3N9Q A;  4LFC T;  3ZKR A;  2RA1 A;  5HEJ A;  4UV9 B;  2K48 A;  3RYH E;  2VVS A;  3K3Q C;  4U7I A;  3ESL A;  1VRB A;  4X64 T;  3A5X A;  4M1P A;  2WDV A;  5EK4 A;  4IT4 A;  3HR0 A;  5AQJ B;  3RC3 A;  2NWB A;  2JQ9 A;  3L09 A;  4UEL A;  2WMO A;  3RKO A;  5KXJ A;  3UQ4 A;  3ZT7 A;  4TNW A;  4FJO A;  2QVA A;  4H9R C;  2NR4 A;  1X79 A;  5JR9 C;  4B6X A;  4KX6 A;  3R84 B;  4Z90 A;  5HXC A;  4UVA B;  2K5B B;  2BZB A;  5AFU L;  2A72 A;  4JEH B;  2WSS V;  2H7O A;  3KV4 A;  2WCA A;  5DJQ C;  2KWH A;  4B3M T;  5AQK B;  1VOM A;  3VKH A;  3QB5 K;  3VKG A;  4QH1 A;  4Z8X A;  2J4G A;  4LMK A;  5LB7 B;  4EB6 E;  2B76 A;  3FBL A;  3RYC E;  3UUL A;  3P4P A;  3UU3 A;  4HWF A;  5KMG P;  5ABF B;  1FMV A;  3VU7 H;  3AE7 A;  4PFP A;  5F8P A;  2CM0 A;  3RLF F;  4NUU A;  4YJ3 E;  5L3F B;  4OK0 A;  3K3O A;  3CQC B;  3RF1 A;  1D1B A;  4TZ4 C;  4PAG A;  3F31 A;  4IE7 A;  3P4W A;  5TAO A;  3AEF A;  4HWD A;  5CB4 E;  2CHO A;  4GOU A;  4IRE A;  5JRE A;  1XMQ T;  2ZM2 A;  5FNV E;  2OLT A;  3FZF B;  3RPU A;  2E9X B;  1NEN A;  3VR8 A;  2FJD A;  2BBH A;  1MMG A;  2DI4 A;  4U31 A;  2KND A;  5F5W A;  2WP9 A;  3AE6 A;  3RIU C;  4GK5 E;  3CQG B;  4ILB A;  4DUZ T;  3MXZ A;  1OXZ A;  4OFZ A;  5L3D B;  5ABH A;  2VVN A;  3H3A A;  4YLH A;  3R6N A;  2IC9 A;  3ZJ1 A;  4BAY B;  2LKH A;  4IL9 A;  2ODV A;  2UU9 T;  1T72 A;  1W0B A;  1KFY A;  2WDR A;  3UU5 A;  4ASK A;  4K0K T;  2YK0 A;  4CZZ B;  3AEA A;  4YHJ A;  4KBM B;  2V7M A;  4P0A A;  4IST A;  2UXD T;  1N32 T;  1IBM T;  4BJN A;  2XQ5 A;  4WBN E;  2XHE B;  2W66 A;  3KVA A;  2YOE A;  3AB3 B;  4JI2 T;  1IJ5 A;  4DV0 T;  2HN1 A;  3RRW A;  2LM9 A;  2Q9Q C;  2HPJ A;  3ETV A;  3EHZ A;  2N2N A;  5H6Q B;  2CXL A;  4NUV A;  4C91 A;  3DJB A;  5AQP B;  2IML A;  4U7Y A;  2CBJ A;  3RKG A;  3D0T A;  2KWI B;  3A7M A;  2VAS A;  4O4I E;  4JI4 T;  5FXX A;  2VL8 A;  2VK9 A;  4IDO A;  2L8K A;  3VR9 A;  4TNV A;  5J2T E;  2JPF A;  2LSJ A;  1MIY A;  5JDF A;  4UF0 B;  3RYI E;  3P4S A;  3AE8 A;  3QB5 A;  3JC6 C;  2FUP A;  5JR9 A;  1HCI A;  2PFV A;  4O2A E;  2DWK A;  4UVC B;  3O9X A;  3O1J A;  1WYC A;  1DU2 A;  3TLW A;  3L39 A;  4YTP A;  3IHR A;  2EHO B;  5FY1 A;  2XAH B;  4PJL A;  1QLB A;  3RIA A;  4YSZ A;  2YU1 A;  2WWU A;  4HWH A;  2D9D A;  3ZCJ A;  3LBX B;  4ILU A;  3PUW F;  4ZHQ E;  3H3M A;  2W63 A;  3RHW A;  4JI3 T;  2YEV C;  3AA0 B;  4DUY T;  1S35 A;  2CCQ A;  2QRX A;  3K8P C;  4TWF A;  4DID B;  1XNQ T;  2X67 A;  4COF A;  4KHZ F;  3UU8 A;  2CPT A;  1LKX A;  2H3R A;  5HWX A;  1OED A;  4IE0 A;  2UXN B;  3MKD A;  2BKP A;  3MJX A;  5CFB A;  2XUE A;  2N9D A;  1BR2 A;  1MMN A;  2FJB A;  3BK9 A;  2E8I A;  2H88 A;  3RIU A;  4O2B E;  4JLE A;  4WYV A;  2WZI A;  3KV6 A;  5L4E A;  3PE0 A;  2X9X A;  2V7J A;  2BG9 C;  4X66 T;  2QA7 A;  2XAQ B;  1N33 T;  1ZEE A;  3ONJ A;  4B3S T;  3RRC A;  5JDQ A;  5ADX L;  4L9I A;  3AED A;  2IC6 A;  2LT3 A;  3MZK B;  3HI2 A;  4HTE A;  4H9Q C;  1H7C A;  4ISS A;  4UXN B;  5C3J A;  2QGS A;  3NRY A;  2NP9 A;  3PUA A;  3LDQ B;  1SA0 E;  5CGM A;  4U2Z A;  2KXP B;  3EAB A;  3X1D A;  4P0B A;  2WWV A;  3A8Y C;  5CA0 E;  5JDG A;  4E7S A;  4YJ2 E;  2NW8 A;  2VQF T;  2C5K T;  2CWY A;  3LG7 A;  3U3I A;  3ZMT B;  3KVB A;  3TLV A;  3U78 A;  5FVK A;  3PUS A;  2V6Y A;  5AQR B;  5LCY A;  2LHR A;  1KNZ A;  4PNI A;  2OV9 A;  1HX8 A;  3BQK A;  5JDM A;  3T8O A;  1SUM B;  3FXE B;  4IDN A;  4O4J E;  2WDQ A;  1UUR A;  2F4V T;  2G0U A;  4Z91 A;  2B1E A;  4TUY E;  3PUV F;  2MTQ A;  4OYJ A;  1NWM X;  2BKN A;  1IAP A;  3V5S A;  3N5L A;  1YW0 A;  4HKA A;  4EZ4 A;  2Q9Q D;  3ZCI A;  3LJC A;  3AA6 B;  2NW7 A;  4CN6 A;  3AE2 A;  3AXJ B;  1HG2 A;  1YQ4 A;  5FMN A;  4HFV A;  3TLS A;  3QOF A;  3ZC1 A;  1N34 T;  3ANW A;  3NBX X;  4JEU B;  1YQ3 A;  5DQV A;  5HXH A;  4AXP A;  5KDM C;  3JC6 D;  3V5U A;  3RQW A;  3HKB E;  1M62 A;  2XQ4 A;  2ZMA A;  3KBU A;  1BR1 A;  4ADZ A;  2LKG A;  3KFW X;  5IYZ E;  4YXD A;  2JJ9 A;  3PTR B;  2SPC A;  1D1C A;  3ZN1 B;  1KNP A;  4JV5 T;  3L8R A;  3FB2 A;  5JVD E;  4H9O C;  3WI3 A;  3N2K E;  2JQK A;  4U74 A;  1S94 A;  2XTL A;  2YU2 A;  1VCS A;  3UU4 A;  2QYW A;  1J1J A;  4YFS A;  3NVO A;  4I4T E;  4LF4 T;  2MBG A;  3MA9 A;  1ZHC A;  5FY7 A;  4LF9 T;  1HG5 A;  5J1G A;  4LF7 T;  2XJ7 A;  4LF8 T;  2CRB A;  3W15 B;  5FL0 A;  4O8S A;  3HL6 A;  3GN5 B;  4EZH A;  4HFH A;  2BG9 A;  2M67 A;  5HEG A;  5LMU T;  2W2U A;  2YKS A;  5L3E B;  4DR4 T;  3IA3 A;  2XSB A;  1D0Y A;  2VKD A;  3CX7 B;  4EV6 A;  2KZ7 B;  4MHC A;  2IDO B;  3I9W A;  4HEA A;  5LA6 E;  1N36 T;  3GWH A;  2LE8 A;  1J5E T;  3CPZ A;  2XAS B;  4OHF A;  2KIN B;  2WMN A;  4GIW A;  4WBO A;  4LMJ A;  5JDH A;  3FXD B;  4HN9 A;  2WAU A;  3P4R A;  3ZEF B;  3AVR A;  4YTM A;  1J5W A;  5CJ5 A;  3C98 B;  1AJ3 A;  5J2U E;  3N2O A;  2V1D B;  2V7L A;  4UV8 B;  2IAK A;  3UQ7 A;  3T1H T;  3AAA B;  2YDS A;  2ACZ A;  4DV3 T;  3B5M A;  3ZC0 A;  2MYS A;  1ZKE A;  4UVB B;  2OA5 A;  3RGL A;  1BR0 A;  3RC8 A;  4LML A;  4TWH A;  2DHR A;  4GK0 E;  3UUX B;  2X9W A;  5AQV B;  2C5I T;  2UXC T;  4X1Y E;  3B13 A;  3NZP A;  3I9Y A;  2D2S A;  2XAF B;  4CI3 B;  4PW8 A;  3C4Z A;  4NXM T;  3NWI A;  4IDP A;  1HX1 B;  1L0V A;  4NXN T;  1OED C;  2BVM A;  3UT5 E;  4YTN A;  5LGN B;  2CWO A;  1MND A;  4HGA A;  3RQU A;  1D0Z A;  3OJA A;  3OVU A;  4XAX B;  3F57 A;  3FZH B;  3T1Y T;  3AEB A;  4YY3 T;  4C90 A;  2LOP A;  3AE5 A;  4IDQ A;  4HFD A;  2E9X C;  4B3R T;  2LJL A;  3Q5X A;  5FP3 A;  1BR4 A;  4YSY A;  3TLT A;  4GYR A;  4ZS3 A;  5EK2 A;  2VQE T;  4DMW A;  3EAM A;  3JAF A;  1T7S A;  4H9N C;  2V26 A;  4GYS A;  3ZPO A;  5LJM A;  2DNX A;  3N9L A;  4MFR A;  1XNR T;  4DV5 T;  5JRC B;  3ABV A;  3QNU A;  3CX8 B;  1WYB A;  4JBW F;  3TLU A;  2BS2 A;  4CXX A;  3OYZ A;  1E7P A;  2BKO A;  4MAL A;  4AI6 A;  1GQE A;  2H7V C;  3K3N A;  3OKQ A;  4AQY T;  4PJN A;  2NTY A;  5C8Y E;  2Q9Q B;  3AE9 A;  1JNR A;  3IF8 B;  1US7 B;  3O1H A;  1HR0 T;  3EDU A;  2X9Y A;  3KV5 A;  2E2A A;  1MMD A;  2CLY C;  1KNR A;  1X9B A;  2XQ6 A;  2P9B A;  3O1I A;  4IGU A;  4AIU A;  4HFC A;  2K3W A;  4J2C A;  5F3J A;  4QWN B;  2PTF A;  4A97 A;  3Q5E A;  4U3C A;  5C2T A;  3B57 A;  2V5C A;  2ZM8 A;  5HWY A;  2XM2 A;  4CN1 A;  2M6I A;  1O3X A;  4K0U A;  3ZYK A;  2MOZ A;  4DVD A;  1HNX T;  3JAD A;  2KMF A;  4DV2 T;  4CI2 B;  3G06 A;  4O4H E;  4IE6 A;  1UUS A;  4QXC B;  1T8B A;  2Y6X A;  1MNE A;  2Z6E A;  3BQI A;  3PU8 A;  3SRZ A;  1UGO A;  5AQM B;  4HE8 A;  3H37 A;  3SFD A;  5EZY E;  1UX4 A;  1I6Z A;  5AQN B;  3HKC E;  3PUY F;  4EYY R;  1E2A A;  1U4Q A;  3KIN B;  5ABF A;  3E22 E;  2YN6 A;  1E1H B;  3Q5W A;  4AQG A;  3DTO A;  4L0R A;  5AQT B;  2V7K A;  1OWA A;  2VKO A;  2X51 A;  2YDQ A;  3FZM B;  4QXB B;  4LFA T;  1NEK A;  3JAE A;  2HPL A;  3OYX A;  2MAW A;  2ZM6 T;  2A2F X;  5L3C B;  2WY2 A;  5L4H A;  5HEH A;  4H9P C;  5BMV E;  2V7I A; 
#chains in the Genus database with same CATH homology
 2WM9 A;  3ANW A;  4ZI2 C;  3PUG A;  2PJQ A;  3ZN0 B;  3KV4 A;  3NBX X;  5LXT E;  4IE4 A;  2E9X A;  4JEU B;  5DJQ C;  2KWH A;  3SS1 A;  5HXH A;  5DQV A;  4KMC A;  4AXP A;  1VOM A;  3VKH A;  4CXW A;  3VKG A;  5KDM C;  4Z8X A;  2CLY B;  3GN5 A;  3JC6 D;  5GON E;  3V5U A;  3KBT A;  4TX5 A;  4EB6 E;  3FBL A;  3HKB E;  3ZJ2 A;  4AKR B;  3C4W A;  3RYC E;  3UUL A;  3O4X E;  2ZMA A;  3KBU A;  1BR1 A;  2LSK A;  4ADZ A;  3NZQ A;  2WBL A;  5KMG P;  1FMV A;  5LHG B;  3VU7 H;  2LHN A;  3KFW X;  5IYZ E;  2JJ9 A;  4PFP A;  5F8P A;  2CM0 A;  3IBP A;  3ZYL A;  3RH3 A;  2XQY A;  2CE7 A;  3PTR B;  2SPC A;  1D1C A;  3ZN1 B;  4NUU A;  4YJ3 E;  5L3F B;  4H9S E;  2JMK A;  5FXZ A;  4H63 H;  1D1A A;  2PBI A;  4OK0 A;  3K3O A;  3CQC B;  1D1B A;  2D5U A;  4TZ4 C;  3FB2 A;  1ZV4 X;  5JVD E;  4PAG A;  3F31 A;  4H9O C;  4IE7 A;  3WI3 A;  2E9X D;  3N2K E;  4MLK A;  2VWA A;  3FHN A;  4PFO A;  4EAH A;  5TAO A;  5LGT B;  4U74 A;  3MK7 C;  3ZMS B;  5CB4 E;  2NW9 A;  4GOU A;  4ZI3 D;  1S94 A;  2XTL A;  3N9P A;  2Y48 B;  1FIO A;  2YU2 A;  4DO0 A;  5JRE A;  3N9N A;  4YFS A;  2ZM2 A;  4AQF C;  4BA9 A;  5FNV E;  4I4T E;  4WW0 A;  1G73 A;  3ANW B;  2LSI A;  2MBG A;  4DBQ A;  3RPU A;  3MA9 A;  1G8X A;  5ETW A;  2E9X B;  1T98 A;  3PU3 A;  3TKL B;  1ZHC A;  4I55 E;  5DAB A;  5FY7 A;  4QXH B;  1MMG A;  1HG5 A;  5J1G A;  2DI4 A;  4EYU A;  2KND A;  4PK6 A;  3W15 B;  5L3G B;  4O8S A;  3E08 A;  1LRZ A;  4QX8 B;  2EHO C;  4GK5 E;  3CQG B;  3HL6 A;  3GN5 B;  4EZH A;  1QUU A;  3MXZ A;  1OXZ A;  4OFZ A;  5L3D B;  5CA1 E;  2M67 A;  3H3A A;  4YLH A;  3Q9D A;  3PDY A;  4A56 A;  3C4X A;  3R6N A;  2IC9 A;  2GK9 A;  5L3E B;  3FBZ A;  2L9Q A;  2L3L A;  2K24 A;  4QHO A;  5JH7 E;  3ZJ1 A;  4BAY B;  1D0Y A;  2CXD A;  2VKD A;  2CEA A;  3CX7 B;  2ODV A;  2KZ7 B;  4MHC A;  3I9W A;  4HEA A;  5LA6 E;  2W62 A;  3GWH A;  4ANJ A;  2LE8 A;  5E0O A;  3VHL A;  3QUJ A;  3CPZ A;  3QC9 A;  4ASK A;  2HH7 A;  2XAS B;  4OHF A;  3LFM A;  5L3B B;  2KIN B;  2WMN A;  4UF0 A;  4GIW A;  2YK0 A;  4CZZ B;  4YHJ A;  5FY0 A;  2CMR A;  4WBO A;  2A3D A;  4KBM B;  2V7M A;  1B7T A;  3I1A A;  4P0A A;  4IST A;  5JDH A;  3FXD B;  4HN9 A;  2WAU A;  2ZLY A;  3ZEF B;  4JUY A;  3HKD E;  3AVR A;  4TN7 B;  3F2E A;  4BJN A;  3C98 B;  4AQF A;  4WBN E;  2XHE B;  2VKJ A;  4G2A A;  1AJ3 A;  5J2U E;  4IE5 A;  3N2O A;  2V1D B;  2NOX A;  3EVY A;  1HF8 A;  3KVA A;  2V7L A;  1V9D A;  4UV8 B;  2IAK A;  3AB3 B;  3EDV A;  4P09 A;  2W0G A;  2JQQ A;  3AAA B;  1WR6 A;  2N1G A;  1IJ5 A;  4KUM B;  3CX6 B;  2XAG B;  3RRW A;  2LM9 A;  2Q9Q C;  5LHI B;  2HPJ A;  3ETV A;  3CVR A;  2N2N A;  2XAJ B;  3I0O A;  5H6Q B;  2EHO A;  3ZC0 A;  2CXL A;  4NUV A;  2MYS A;  4H63 V;  4C91 A;  3DJB A;  1ZKE A;  1YD8 G;  2PG8 A;  4UVB B;  2OA5 A;  4DBR A;  3C64 A;  3UUN A;  3RC8 A;  1BR0 A;  4ZS2 A;  4QX7 B;  3D0T A;  3P7I A;  2DHR A;  2KWI B;  4GK0 E;  3LBX A;  3UUX B;  2X9W A;  4F6R C;  2VAS A;  1NAF A;  4O4I E;  3MAC A;  2C5I T;  4U72 A;  3WAJ A;  5FXX A;  3J9X 1;  1LVK A;  2VL8 A;  2VK9 A;  5FXW A;  5L2L A;  3NRX A;  4X1Y E;  3B13 A;  3NZP A;  2L8K A;  3P8C D;  5J2T E;  2JPF A;  4X20 E;  3I9Y A;  1MIW A;  1MIY A;  2LSJ A;  4QKN A;  2RP4 A;  2D2S A;  3DP7 A;  2XAF B;  3GMI A;  1IZN B;  3OBV E;  4N78 D;  4CI3 B;  5HYA A;  5KX5 E;  5JDF A;  4PW8 A;  3C4Z A;  3IEE A;  4UF0 B;  5FXV A;  3AVS A;  4L5G A;  3RYI E;  4AKL A;  2BVM A;  3UT5 E;  3ZMV B;  1WLX A;  3JC6 C;  3C50 A;  4DND A;  2DCF A;  4IHJ E;  1HS7 A;  2C5J A;  5JRC A;  2C0S A;  2LOS A;  5LGN B;  5JR9 A;  3RX6 A;  2CWO A;  1SHZ C;  1MND A;  1UCU A;  2LSY A;  4CXY A;  5LBM A;  1HCI A;  4HGA A;  2PFV A;  1D0Z A;  2VKH A;  3OJA A;  3WAK A;  4XAX B;  3F57 A;  4O2A E;  2DWK A;  4UVC B;  5DQW A;  3O9X A;  3O1J A;  1WYC A;  3LK3 B;  3ZYM A;  4G63 A;  2KT9 A;  4XBF B;  4C90 A;  5LP6 E;  2LOP A;  3M65 A;  3SOL A;  3IHR A;  2CA5 A;  2EHO B;  3ZMZ B;  1YKH B;  5FY1 A;  2XAH B;  2E9X C;  4PJL A;  2ES0 A;  2LJL A;  2Q9Q A;  3Q5X A;  5FP3 A;  3HA4 A;  4X1K E;  1BR4 A;  2YU1 A;  3RYF E;  2D0T A;  5HXS A;  2WWU A;  3ZMU B;  4UIG A;  4ZI3 C;  3E0Z A;  1WRD A;  2LEH A;  3LBX B;  3ZCJ A;  5JDN A;  1EZ3 A;  4ILU A;  5LHH B;  4TV8 E;  5LJN A;  4GYR A;  4ZHQ E;  4ZS3 A;  2ACX A;  3AA1 B;  2W63 A;  5EK2 A;  2UXX B;  4E7Z A;  5HXR A;  4DMW A;  2YEV C;  3AA0 B;  4CI1 B;  1S35 A;  2CCQ A;  4IDZ A;  4H9N C;  3K8P C;  2V26 A;  4GYS A;  3ZPO A;  2Y8D A;  4OYK A;  3AAI A;  2X67 A;  4ZI2 D;  5LJM A;  1D0X A;  2DNX A;  2X66 A;  2BVL A;  3N2G E;  5JQG E;  3N9L A;  2CXF A;  4MFR A;  4O4L E;  5JRC B;  1LKX A;  2H3R A;  3CX8 B;  3L3P A;  5HWX A;  5JR9 B;  1WYB A;  1YKE B;  3LK4 2;  4IE0 A;  2UXN B;  4EIW A;  2K9A A;  3MKD A;  2IW5 B;  5LNK A;  5FYM A;  3PUR A;  2I59 A;  4ZOL E;  1CUN A;  4CXX A;  3OYZ A;  3S4U A;  3MJX A;  3Q2M A;  1MIV A;  5IHY A;  2XUE A;  2N9D A;  4X1I E;  4MAL A;  4AI6 A;  1BR2 A;  1MMN A;  2H7V C;  4DMV A;  4IIJ E;  3BK9 A;  2VB6 A;  3K3N A;  2E8I A;  3LK2 B;  3OKQ A;  4PK5 A;  4PJN A;  3UUM A;  3CQX C;  1Z0P A;  4KP3 C;  3N9M A;  2NTY A;  5C8Y E;  1HTJ F;  4TV9 E;  2Q9Q B;  1Y64 B;  4WNK A;  4O2B E;  2W61 A;  3C51 A;  4FI5 A;  4JLE A;  4MBQ A;  3IF8 B;  1US7 B;  3O1H A;  5EK3 A;  2J1D G;  3KV6 A;  2KLQ A;  4AKH A;  2W00 A;  3EDU A;  1KK7 A;  2X9Y A;  3KV5 A;  4BJM A;  3PE0 A;  2X9X A;  1MMD A;  3CML A;  2V7J A;  2CLY C;  2QA7 A;  2XAQ B;  1ZEE A;  3KV9 A;  1U5P A;  3RRC A;  5JDL A;  5JDQ A;  2LSG A;  5ADX L;  4L9I A;  5A1L A;  3ZLI A;  2P9B A;  2IC6 A;  2X9H A;  3O1I A;  4IGU A;  4ZI7 E;  2LT3 A;  3MZK B;  3HI2 A;  4J2C A;  2JRK A;  1QSD A;  4HTE A;  4H9Q C;  1H7C A;  5F3J A;  4QWN B;  3J7Y q;  3CWZ B;  4ISS A;  2BDE A;  2QGS A;  3NRY A;  3PUA A;  2NP9 A;  4UXN B;  4AKG A;  2X0L B;  1SA0 E;  2KXP B;  4AKI A;  3GA8 A;  3UFE A;  5LYJ E;  2DWG A;  5H6R B;  2JMH A;  2EHO D;  5LBQ B;  2D0U A;  3B57 A;  2ZM8 A;  4P0B A;  5HWY A;  1O3X A;  4K0U A;  5HXE A;  5CA0 E;  3ZYK A;  2MOZ A;  3ETU A;  5JDG A;  2YIN A;  1HFA A;  4DVD A;  4E7S A;  4YJ2 E;  2ZM0 A;  3AA7 B;  2NW8 A;  3HKE E;  2KMF A;  5M4Y A;  5LOV E;  5LG4 A;  4CI2 B;  3SWH A;  2C5K T;  3I0Q A;  4O4H E;  4IE6 A;  4I43 B;  2CWY A;  3LG7 A;  4PK4 A;  3U3I A;  3ZMT B;  3KVB A;  2Y6X A;  3AAE B;  3ONX A;  1UX5 A;  4QXC B;  3U78 A;  3KDS E;  3UTK A;  1MNE A;  3PUS A;  2Z6E A;  3CKD A;  3N9Q A;  1IJ6 A;  2RA1 A;  4EOZ B;  5LCY A;  1LVF A;  3QK6 A;  3BQI A;  2LHR A;  1KNZ A;  4PNI A;  3BQL A;  4UV9 B;  3PU8 A;  2K48 A;  3RYH E;  4V1A v;  3SRZ A;  1MMA A;  1FEW A;  4PJM A;  3K3Q C;  1HX8 A;  4HE8 A;  3BQK A;  3H37 A;  5JDM A;  3ESL A;  1VRB A;  3T8O A;  5EZY E;  2NTX A;  1UX4 A;  3FXE B;  3HKC E;  3A5X A;  4M1P A;  3EUH A;  4O4J E;  4EYY R;  5EK4 A;  2G0U A;  2B1E A;  3HR0 A;  3RC3 A;  4TUY E;  2NWB A;  4CQI A;  1U4Q A;  2ODU A;  2MTQ A;  4OYJ A;  3KIN B;  1NWM X;  3E22 E;  3L09 A;  4UEL A;  1FMW A;  4XZC A;  2WMO A;  1E1H B;  2DLR A;  3PUQ A;  3Q5W A;  3RKO A;  1IAP A;  3V5S A;  4AQG A;  3N5L A;  1YW0 A;  3DTO A;  4L0R A;  4HKA A;  4EZ4 A;  2V7K A;  2Q9Q D;  3ZCI A;  4I50 E;  5LGU B;  3LJC A;  4FJO A;  1OWA A;  2VKO A;  2X68 A;  2X51 A;  3AA6 B;  4QXB B;  4H9R C;  2NW7 A;  1X79 A;  5JR9 C;  3N9O A;  4PJJ A;  1HG2 A;  2HPL A;  4EXT A;  3OYX A;  4B6X A;  2A2F X;  3R84 B;  5L3C B;  5FMN A;  5HXC A;  4UVA B;  5HAX A;  4HFV A;  2K5B B;  4ERR A;  2BZB A;  4UEM A;  5AFU L;  4H9P C;  2A72 A;  4JEH B;  3ZC1 A;  5BMV E;  2V7I A;  2WSS V;  2H7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...