2NPLX

Nmr structure of card d2 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
b'GSSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus and Adenovirus Receptor
publication title Solution structure of the coxsackievirus and adenovirus receptor domain 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nplX00
4JAMA 3OX8B 3TO4B 4R4FL 1HSBA 3S34H 1CXIA 1T1XB 5HHOD 2JJWA 5B4MC 1IQDA 3MXVL 5EBMA 1DZBA 3LDBC 1RZJH 1N0LA 2X4SA 4MZ3A 4NM4H 1KUMA 3C8KA 3UYOD 1HHHB 3RZCA 4S1SH 5D2LB 5C08A 4YEEA 5F9JB 1JGEB 3UBXA 1SEBB 4YXHL 1FLRL 2R9HC 4BELD 2LU3A 3RU8L 5DLMH 3KHOA 4UDUA 5CEZD 1A6VL 3JUYA 1ZHLA 3F7YA 4PG2C 4FQ2L 2ESVD 1XMWA 3VRJA 5JXED 2EC9T 5J9PA 3T0DA 5F7UA 1WEJH 1Y6MR 5TFSH 2VKXA 4UT7L 4UMGA 4TUKL 1MVUB 1EEUA 1JI2A 3L5XL 4TVPD 4WV1B 3V5KA 1CF8H 4U6XB 3BGAA 5DDHA 1DBAH 3UO1H 2BHUA 4PJ8D 2BHZA 1G9NC 1I85C 4ELKA 3VG9B 3CFDB 4KMQA 3X3FL 1JYXA 1RUML 2YD2A 4LARH 3DI3B 1XH3B 3MLVL 2V5SA 1INDL 5KS9F 1ZA3B 4P2QA 3CX2A 4LLVB 2R1WA 2V2TA 1QBLL 2V5YA 3QUZB 3MGAA 2W07A 1JMZA 4QOKB 3WD5L 5FYLD 3QG7H 5DUBA 3Q0HA 1BGXH 1I1FA 3BD5A 4XHJD 4PJ9B 3D85B 4O2FA 4N90D 4AENB 4KROD 1N59B 5IR1A 4NWUH 1DSFL 4LKXB 4WEBL 5IFJB 3EO9H 3BMVA 4PGZA 3ULVF 3ZHKA 3FT3A 1CD1A 4LDLB 1CR9H 3RVWC 2WNGA 4U3CA 4Y1AD 1CD8A 4H20H 2OMBA 2WZPD 1ZA6B 1EK3A 2UWEE 4YHML 4NQVA 2B4CL 5JIKA 2YEZA 1UQSB 4JZOA 1K8IA 5EO1A 4P3CL 4GSDH 4Y2OA 4KKCC 5I0DA 5CD5D 1LGVA 5TQ0H 4P23C 5CZVH 3U0PB 1M4KA 4OD3L 3B4NA 1ZGLB 5D1QD 5INDB 2XWBA 4D0DB 1Y0LB 4DUXA 1U0QA 1CXHA 5GSVA 1X3DA 3LKOB 1BLNB 4IM8A 4O2CA 3DSFL 4L3AA 1QLFB 4GW1B 1EEZB 1AQDA 1YEFH 3MRIB 3I02A 1KLFA 1LQSR 4U1SA 1EAPB 3ARUA 5BJTB 1K6QH 3KPQA 3P3YA 5EB9A 2OQJA 4PGDB 1VSCA 3S96B 3NAAH 1DLHA 3EJZC 4NP4L 3FQXB 4QY8B 4HUVB 3Q5YA 1T4KB 2J4WH 4GJTB 1U8LB 3TBTA 3AREC 1CG9A 4LLUB 3PHSA 2HH0H 3ARWA 3BP4B 2APVA 4X0KA 1YEJH 3DLQR 4TQEH 1QLRA 5C9JA 1XF5A 3TCLB 1XR8A 1CGWA 2VITB 4GLRI 4ODBD 2AV7A 3HZYB 3QDJE 5AG8A 1P9MA 2GJZB 4WI8A 2IFFH 4HJJL 1CXEA 4AEFA 5J06A 4PUBL 3V6OE 1UCBH 1KFAL 4KKAD 4LCWA 3VRLF 4GRLD 1KF9B 1Z5LA 3OKYA 1QFOA 3WIIL 4G6JL 3LQAH 4XZUB 1PZ5A 2JJSC 2W0KA 4IOIB 5C0BD 1FNSH 4XT1C 1R24A 1ITCA 4UZGA 3V5HB 2E9IA 4BFGA 4YGVB 4ZFOA 4LHUB 4C4KO 1BFSA 1EX0A 3L6FB 4ETQA 5AD0B 2DQDH 4GLRH 3QULB 4WCYH 4APQD 4V1DD 4YK4C 5ISZE 5IWLA 1S9WA 3O6LL 5EZJB 2BHYA 4CBPA 1OW0A 2MCPL 4D0CB 4YE4L 5HHMB 4LHJB 2LVCA 5I18L 3BXNB 5DHXB 3ZYJA 1AGCA 3U7WL 5ABDE 4YWGL 1VGEH 3GSUB 4JCMA 1RK0B 3RJDA 1IGJB 3BE1L 4J8RA 3D18B 2AXGB 5EN2B 1MCWW 2WLYA 4YXHH 1AHWA 4OI7A 3OKNB 2VLMD 3DVNB 5D96B 1A3LH 4OD2A 3SO5A 2F58L 2KH2B 4HV8A 4MA3A 3MRBA 4WI7A 4FXKA 1J0YA 4NO5A 2CQVA 4RMRA 3EYVA 5HGDB 5DJDA 4FQ2H 3FN9A 3FOLA 3D5OF 3DTXA 4Y16B 3U36A 3UPRB 4UT7H 4WWKA 3L5XH 4HKXB 5E56A 2XPGA 5EC2A 2X9XA 1A4KB 1XIWC 3FQWA 5GGSA 4XC1L 2IH1A 1BQSA 4PRID 4JY6A 5JQ6L 2FX7L 2H2SD 3X3FH 1KELH 1KPRB 3UBXG 1VKXA 4KGLA 4M1DH 4XWOD 1INDH 5JR1H 4D9QD 3O3BB 2ZJSL 5EH1A 2F8OA 1QBLH 3MJ8B 1DVFB 3LH2L 4Z76A 1SJHB 2ICWJ 1A4JB 2ENYA 2JCCB 1HNFA 4UI2A 1MSPA 3FQTB 1I7ZB 2P7TA 4PJXE 5T3ZD 1BFOA 2XT1B 4I18C 3BOVA 2WBJD 5CJQL 5ANME 4MXQC 4WEBH 3QIWC 4K2UL 5DJXA 3QXVA 4HCRA 4ODWB 3GUTA 3R1GL 1D9KB 3S36X 1CFSA 3PWPA 2VLRD 5F3BA 4GAGL 1JP5A 1EFQA 1U6AH 2GY7B 4N8CL 1B0GB 1QYGL 2BXYA 2LTQC 4F7CA 3DHJA 5B8CC 4YHMH 1UB5A 3QFJA 1JPST 2B4CH 3VH8B 5E8DH 2W59A 1JZ5A 3T77B 4BA8A 3OR6B 2ZSVB 4ZUWA 4P3CH 3RZWA 2WBKA 3RVVD 1SJEA 4PP2A 1FYTB 2PYEE 4OD3H 2PO6A 1U8MB 1H3GA 3ILQC 1GRWA 5IM7B 1U8KA 1B4RA 5I73B 3TO2A 2HVJA 3PL6C 2NY3C 3JV4A 3O8XC 4Q7DA 3HN3A 2YA1A 2NY4C 2E8YA 4DKFL 2PTTA 1QA9B 3D25B 5GGRA 3SCMB 3UTTD 5TGBA 4OZHA 4M61A 2X4NB 4XCYB 4TOYH 5HYJD 3QIUA 5IF0B 4ZFFB 4YHYC 1F4YH 2DMCA 3BIKA 3RWGB 3O2DA 2YRLA 5EU6D 4PTTA 3MLYL 3V2AR 4LCIL 3R06B 3WNKA 5LGKA 4PP1D 5HHNA 3SDCB 4NP4H 1DN2A 5IB3A 3VFOA 3GSRB 4HG4K 4OB5L 2G9HB 3QCUH 4D8PA 1IEAB 2UY6A 1GH7A 1NFDA 2DYPA 4Z7VB 3PHOA 1OWRM 4HJJH 1HQRB 5DJ2B 1KFAH 5F9AC 4ELMB 5CS7A 4RGND 4LEOA 4AMKH 5A2FA 1XGYL 2GHWB 3WIIH 4HAGA 5A1AA 3WXWL 3U9UA 1P7QD 4G6JH 5HGHA 1OT2A 4KZEH 4LVOC 5T1DL 1NMCC 1X5HA 4JQXA 1BEYL 4GG8B 4GKNB 1CDCA 5ENWB 3MLPA 5J12B 4X6DA 1UWGL 5DJAA 2I9LA 4D0BA 1TPXB 1M6OB 1D5XB 2C3VB 2V5TA 2A83A 3SKJL 4ZD3L 5DI8A 3QEGL 1JVKA 1BVLA 3HZKB 1H3PL 3O6LH 4LLMA 4L4VA 3QI9A 2MCPH 4NZJA 4R8WL 3ZDYE 1UH3A 1O7VA 3RWDA 1NC4A 4YWGH 1ZHKB 3PHQA 32C2A 4M93B 3W5MA 5JXEC 4RZCA 4OCNC 5MHSD 1BD2A 4TN9A 3B9KA 3MROA 1HK6A 3MREB 3VXTA 3DMMB 3FB6B 1VACA 1AXSB 5EUOE 2BVPB 4X6FA 3C6LB 4PJ8C 4R96A 1DQDH 2CXKA 4L8DA 3SO3C 4PGCB 4IRJA 1TCRA 2R4RL 1DBKL 2VLKD 1GVIA 5KS9B 4M7LL 5GGVY 2QR0B 1HWGB 4HIHB 2AK4A 3GSXB 4H1LH 5EO0A 3Q3GB 2WW8A 2DMKA 2DLFH 4HWEL 4HK0A 4IDJH 4Y4KA 2ATPB 3O4LE 2LQRA 3LS4L 1GCFA 2ZCLL 4PJIA 2HN7B 4WDIB 5AUMA 3MRPA 4MNQD 3C60D 7CGTA 1YZZA 4XHJC 2H3NA 5JQ6H 5L88H 2FX7H 4KROC 3L3IA 4QNPF 3KPNA 3UTSE 3BGMA 1VEOA 3G6JF 43CAB 1JZ4A 1ED3B 1U92A 1F45A 4RX4A 4QO1A 5DD5L 5M95B 1VESA 3ILPB 5DEFB 4EI5A 4UQ3B 2JB6B 4NO0A 4JY4A 1UH2A 1LO2H 3M45A 4QLRA 3U7AA 3BIAX 4OF7A 1FG2B 5C70A 1N2RB 2NY5C 1B90A 5CD5C 4XMLL 4K2UH 5IMOA 2F9BT 1FNGA 4PJAA 4UT6H 1JHLL 4GAGH 4EUPB 5D1QC 5E1AB 3I75B 4N8CH 5EU5A 5CHNA 4JVWA 5DJ0A 5KN5B 4K7PL 1GGBL 2D9QB 1PKQE 2AJUL 1TFHA 3IRZA 2H2PD 1LD9A 3JWDC 2BMKA 1TITA 3GBLA 2AXFB 2Y7QB 1I9RL 3BZFA 2QEJA 5EUKB 2VTFA 1U8OB 5E2TL 3VMPA 5FYLL 3DV4B 4YHZH 4K3DL 3PV6B 5C0IB 1DCLA 4RGMC 2FR4B 3MCKA 4PGEB 2GFBB 1VFBB 3IGAB 1LO0L 1F58H 4KC3B 4MXWL 1HNGA 4OZHF 1LO4L 1A7NL 3QDHA 4YZFE 4DKFH 3M1BB 2VDRL 3P9LA 1KEMH 2BFVL 3TN0B 1IM3B 2I25N 3I2CL 4QRTB 1FIGH 2YPLA 4O5LL 1UJ3A 4PV9B 5L6YH 1ZK9A 5C8JA 2CUHA 4YR6A 1GOHA 1XGRB 5I1EL 4KKAC 4GRLC 3RTQB 1H3TA 4FTVA 3AB0C 3LEXB 5D1XA 1WCBB 2XA3A 3AVEA 1A6ZA 1NFDF 1PG7H 4OB5H 4JPKL 4Z9KB 1DBMH 4J3WA 1B3JA 2FECI 1EEQA 2V7NB 4NJ9H 1FGVL 1CYGA 5EU4A 1V8HA 1IC4L 1BJ1H 4PJ5D 4RNRB 2VDLL 1MELA 4A6YB 4HJ0D 3NCCB 1MY5A 5E8OB 3MRLB 3VXMA 1XGYH 3MRKA 2Q8BL 1HSBB 3K2MC 1P69B 3WXWH 4FFWD 1OWWA 1CLYH 4JHWH 5JO5A 3WIFA 1IQDB 1GHFH 3TO4D 2EDKA 3DGGA 3C8KB 1AC6A 3RZCB 3LIZL 5CJ8A 1UWGH 5TF0A 2W38A 4GRWH 2IAND 3SKJH 4HKZB 2BCKB 2C26A 4ZD3H 5KW9L 4CKVX 4F3FA 5IVZA 5C92A 4EOWL 3UDWC 1L9NA 4HXAH 5D2NA 3TP4A 3H6JA 5ALBH 4YNYA 3V4UL 4HBCL 4R8WH 4H0HB 3F7YB 3PV7A 1UZ8B 2DN7A 1N5AA 4I9WD 4WVRA 3VRJB 3VXUA 5CEYA 3VWKA 3LPGA 3RWFB 2VWEE 1Y6NR 4PGJA 1U8HA 3G6DH 3LD8C 1P7HL 4U3HA 1ORQA 3L5IA 3V5KB 4KQ3H 5DJ6B 5C86A 12E8L 4HIIA 4ELKB 1MRFL 4HGMA 1QBML 5I71B 1K5NA 4P2RD 1FV1A 2EDDA 4NT6B 2H2SC 1QBAA 2DBJA 1DQLL 4HGWA 4GFTB 2WWMD 2AJSH 2R4RH 1DBKH 4XWOC 4M7LH 3E2HB 3PABA 1HCFX 5DUBB 4PRDA 4OUUB 3K8KA 3QUYA 4PJIF 3MBEA 2VQ1A 4X99A 1Q9OB 1F3JA 1OGTA 4HWEH 5F8QC 5IR1B 4QOKD 3BD3A 4PRAA 3BH9B 4DZBA 5E6ZA 3RAJL 1ZT4A 2W0FA 3IDYC 2Y23A 4CU8A 2WBJC 4NOBA 5IK3A 2FO1A 4C58B 3D85D 4Y5VA 3WO3B 4JJHA 3NIFF 1TJIL 4KXZI 4H26B 4HMCA 4NUJB 5EORL 1GZQB 5EZOL 5CLWA 1CXFA 1BZ7A 3PWLA 2F54D 2YEZB 4UILL 1UEMA 1YECL 1WTGT 2H32B 4CN4A 1K8IB 2P42B 3OXRA 4AYFA 2JK5B 4U2ZA 1CFBA 3GFUA 4MJIE 3O3DB 5C0GA 1T5XB 3NCMA 2GT9A 3GJFA 3RVVC 4C56A 2XWBB 1D5MA 4AT6A 5J13B 1P5UA 1UM5L 3B6SA 1JHLH 4XNQA 4BKLA 5DFTA 4KXZH 1G9ML 1YQ2A 4O2CB 4LSDA 1RJYA 5DQ9A 2CIIA 4JZJC 1AQDB 1GGBH 2B1AL 1KIRA 4HC1L 2BNRE 4NQCA 4UIKL 1TZGL 1VDGA 2AJUH 4TULH 1ES0B 2QKIA 2EH7L 4U1IB 4RQQA 4ZOBA 5B21A 5E2TH 4CU6A 4QYOB 1LP9A 2XACC 4WUUE 5BS0B 4JFEB 1F00I 4K3DH 1DLHB 2WIIA 5T3ZL 1KJVB 2FZ3A 1HZHL 4N0UA 4P5KB 1LO0H 4PP1C 4MXWH 3TBTB 3TZVA 2ZG3A 5DSCB 4B0MM 3WKNA 5IB2B 4LK4A 1G0YR 1LO4H 3QB7C 4JREB 1A7NH 4HG4J 4JFXB 2VDRH 3GMQA 1XF5B 3MRMA 3OL2A 2ED8A 1XR8B 3H7BA 3N06B 2AV7B 5GS2H 3FN0L 3I2CH 4WY7L 2ICWB 4O5LH 4LCWB 1EVTC 1N6UA 1Z5LB 4F8TA 1FZOB 3HPLA 3X13B 1I3RA 4HJGA 5AYUL 4RGNC 1I4FB 1PZ5B 3P4NA 4YFLF 5DD0L 4FQJL 5BRZE 1IM9B 4JPKH 3ZDXE 1FDLL 5H2BB 2C1OB 3DV6A 4P5TA 4ZFOB 2MQ3A 1FGVH 3SE9L 4ETQB 3MV8E 5L0QB 3H9SA 2EDEA 1BQUA 5AAMA 3VDCA 4AEIL 5FK9A 1S9VA 1A1NB 1R5WB 5DRNA 1S9WB 4LHUD 4ODSL 1HXYA 4JN1L 2Q8BH 5DC0A 1YJDC 5K9KA 3AU1A 5ESVA 5CBAB 1AGCB 2J8UA 1QFWM 3ARPA 1CQYA 3LIZH 4I0CC 25C8L 3VGAB 1AQKH 4J8RB 3QNYB 4MHHG 3U0WL 5KW9H 1HYRC 2GW5A 3PXJA 4Y5YB 5EIVA 1N6VA 4XBPB 3IKKA 4HEPG 4EOWH 2CKBL 4OD2B 4YX2H 4MA3B 5TDOA 3MRBB 4FXKB 3IT8D 3GMPA 4NO5B 3V4UH 3FT4A 3EYVB 4HBCH 2B5IB 5DJDB 3NPSB 3FOLB 1KCKA 4JRYB 1I9EA 3DVGA 3A6CL 2J8HA 2AEIT 1P6FA 3WUZA 1TVDA 2VL4A 3J7HA 3KS0J 5GGSB 3TPKA 12E8H 4NQDB 4QHUA 4Y16D 2IH1B 3MLTA 5JMRA 5JZ7D 4JY6B 1MRFH 3BEVA 4X6CA 2VKWA 1QBMH 4UTBH 1VKXB 1UM6L 4U7SA 1PYWA 3C60C 4OT1L 5FKPB 4PB0L 3IXAA 4HKBA 3G6JB 2X4UA 3VFSA 1DUZA 1T0MA 3DRTB 1RUAH 2EH8L 3EAKA 1BFOB 4ZS7H 4L8CA 1L7TL 3BIBX 3CFKB 1A2YA 3O4OB 4UT9L 4ENED 4OGYL 3RAJH 4JKMA 2O5YH 3M07A 2EDYA 3LRHA 5C0CA 1S7QA 2XWJA 4XH2B 3L7FA 1CFSB 3PWPB 5F3BB 1E28A 1TJIH 3G6AB 2P46B 5EORH 1JPSL 1MCCA 2FJFA 4MQSB 2D31B 3G5ZA 2FCBA 3QFJB 3LS5L 2AEWA 2QHLA 2J5LB 1QG3A 1HH6A 2KZWA 4PS4H 3BVNB 4CJ0A 3DSNA 4ZYKA 4HMDA 4C4KT 1Q94A 3SBWC 1SJEB 4PP2B 3N9GL 1XR9A 2DQEL 2VXSL 2H2PC 1P1ZB 1LO5A 2CJUH 4DKDC 3IETA 3TO2B 2HVJB 5IHLB 3JTTA 1FYTD 1UM5H 5CIPB 3JV4B 1G9MH 3OKOB 3QDGA 1KIUA 1PGRB 2XKUA 2Z31A 2AW2A 3RWJA 4P9MH 2PTTB 1CE1L 3FZUD 4EIGB 4HC1H 5TGBB 4OZHB 4M61B 1TZGH 1BAFH 5C0EB 4HS6A 4MWFA 3BIKB 3OBAA 2EH7H 2DWEA 1LNUA 3OAYK 1KYOK 3SCMD 1MVFA 1BHGA 1EO5A 3EFFA 5IOPB 5HHNB 3TBVA 1PLGL 2DWDA 5JPMA 4M4PA 1RUPL 5CZKA 5IB3B 3VFOB 3ARDC 1Z9SA 2ICEB 1HHJB 1U58A 1S7WA 5I8OL 3SDCD 4D8PB 1NFDB 3ZL4L 1O5DT 5HHQB 3BHBB 3PHOB 3FHAA 4CDHA 4HK3N 1EHXA 2DM2A 2XKSA 3T0EB 1KCSL 1MLBA 4KK5D 4ZUVB 4X6BA 3ZHDA 3B9VA 1NAMA 3TESA 3OAZH 4HJ0C 5FV2A 3U9UB 2GK2A 5AYUH 4U6HA 2FSEA 4QRSA 2B0SL 5BVPL 4WNQB 3O3UN 3VFTA 5DD0H 4FFWC 3GBML 2VLJA 3PP4L 4P4KD 5BO1L 1W72L 1FDLH 2A9ML 3TO4C 2VJXA 5DJAB 4WEMB 2K1MA 4QRRE 3SE9H 2A83B 1HWHB 1BVLB 1TMCB 2OSLB 4G6ML 4GUPA 1ZEAH 3M8OL 4MB5A 5HDOA 4ODSH 3HC3L 4LLMB 3OAUL 1MHEA 3QHZL 4L4VB 1HHKA 4G8IA 4P4RB 3K46A 5EOTA 5F7KC 2GJ6A 2HTLD 1NC2A 3O9WD 3LAFA 3RWDB 1NC4B 3KGRA 3ARZA 4X5XA 3MTRA 25C8H 4RZCB 1NBYB 4RDQG 4J4PA 4WFFE 3ORJA 4LOUD 5EU7E 1BD2B 3U0WH 2DTSA 3VXTB 1DBBL 1VACB 3SDXF 2QADB 2CKBH 2IADB 2IBZY 3OKDB 1PVHA 4R96B 4YHLL 5T1LB 3QH3A 4LAQL 3HMWL 1MAKA 4C57C 2KKQA 3DMMD 4TSBL 1TCRB 4ZS6D 4WV1C 1J05A 3MODL 3T3MF 1AR1D 4WU5A 2VIRB 4LEXH 2WWMC 5EO0B 3A6CH 2XTJB 4RFEA 2KPNA 4EVNB 1SMAA 2R2CA 4QCIA 1TQBB 4Y4KB 5DZLA 3AM8A 3S35X 5FEBA 2Y06L 1M7XA 2C4FU 4PJIB 2OX5A 5AUMB 3MRPB 3ZT7A 2GIYA 4I3GA 1QKZL 2H3NB 2BY2A 4U4BA 3P4OB 1RURH 3L3IB 3G5XA 4NC1C 4Y19E 3R8BB 4DKAA 3BGMB 1UM6H 3NH7L 3MNZA 1JN6A 4PB0H 5EG6C 1R3KA 9CGTA 3QRGH 5F7HA 3ULVD 4UINL 4NO0B 4JY4B 2EH8H 1AY1L 3GSQA 1FAIH 1L7TH 4WW1B 3THML 3HC4L 4UT9H 3SE4A 4OGYH 4ESKA 1FBIL 5IMOB 2EIDA 1DLFH 1FNGB 3GI9L 3QNXB 2YHGA 2E6JA 1X4YA 3QDMA 1JPSH 3MV7A 4K3HA 3ZE0F 1J0IA 4JZNA 2HFGH 3LHPL 4PJCA 5DJ0B 4BH8A 3LS5H 1EBPA 3NIGF 4MJ6A 3OXSB 2DQCL 1YN7A 3SQOL 5KSAB 3KPSA 4M7KL 4NSKA 1I7RB 2BMKB 2E27H 2X5PA 2VE6A 3E0GA 3MFFA 3MJ9L 1MJJA 1T7ZA 3L3JA 3N9GH 3GBNL 4HFWB 3V6FB 2DQEH 2VXSH 4KDTC 4OFKA 2VZTA 1YMME 3HTLX 3ET9F 3I3DA 5DR5L 4YFEA 4FQIL 3EGSA 2AERT 3RDTD 4LSQH 3V0AC 4JRXE 4PG2A 2N4IA 1GGUA 4QGTA 3Q6FA 4MVBD 2HAZA 3QUKA 3SHSA 2R56H 3E3QE 3GM0A 3P0GB 4IMLA 3DRQB 3OQ3B 3V9FA 3D39E 1U8NB 5FGCB 2ICCA 1IKNC 4LGSB 1TTFA 3RPKA 3PGCB 4XB8A 3BZEA 2FIKA 5C8JB 1ADQL 4PJEA 1MCOL 4YR6B 4BK5A 3U83A 5F7DA 3NCYS 3TN0D 2EE2A 4B53A 3O11B 1UKTA 2IMNA 1PLGH 3DXAA 3TBSA 1W0WB 1A6ZB 1GYAA 5GS1C 4PRPE 4CU7A 5I8OH 1LO3L 1T66D 5DA0B 3RTQD 2P8LA 3ZL4H 3O6KL 1GL4B 3RNQB 3TA3B 1KCSH 2OM5A 4G8GA 4HBQA 3LKPA 3BEWB 3MRQA 5F1NB 4XNZC 4RFNB 5CINL 1I7TA 5L2KB 4LAJH 3IDMA 3WIFB 4Q6YA 2B0SH 3RVUD 5BVPH 2W65B 4FQCL 3GBMH 3DGGB 4S0SD 2ZCKL 4Z7WA 5C9KA 5BO1H 3ARRA 5E5UB 2A9MH 3I50L 1I75A 3O2VL 3VD7A 1N3NA 4XNXH 1F11B 4NNYA 4UOW0 3K8MA 4NQSB 4JFYA 3WIHA 5IVZB 4HS3B 2NXYC 3RZCD 4G6MH 3M8OH 1GGTA 1NFIA 3JWNC 2RJMA 3HC3H 3OAUH 1FL6B 3QHZH 5CLTA 3WN5B 1J12A 3VXPB 3BWUC 4YNYB 3SJVE 1YPZA 2Q76A 1A8JH 1N5AB 3VXUB 3STZA 3U4EA 1A6AB 2EYSA 3VWKB 3ZSSA 3FB8A 3CH8A 4MS8D 2E7BA 4QT5A 5FO7B 1GGCL 4ODVL 2R1XA 4GAYB 1IAII 4FQ1H 1NDGA 5D6DC 5AEAA 2HWZL 2Z0BA 1DBBH 2IPKB 5K93A 4XVUD 3U9PL 4Y16C 3C9NA 4YHLH 5JZ7C 3LV3A 5D7JA 4LAQH 2OS7A 4NWTH 1N8ZB 3BESR 2AJVH 3AREA 3NN8A 4G6KL 3MODH 1XZ0A 2UVFA 1JBJA 4HULB 4LU5L 5C71A 1T1YA 2FBJL 3QUYB 4PRNA 3QJHA 5C07E 3MRFB 2N7AA 4X99B 1OGTB 1OAYL 3U82B 4E9LA 5JDJA 1RV6X 2GITA 5IB5B 5JHDA 3X14A 4PRAB 4DZBB 5MENE 4M02A 1QKZH 3CFCL 1ZT4B 3BKML 5IK3B 4IOSD 1B2WL 4NQUA 3C09C 4ENEC 1H8NA 4Y5VB 4Y2DB 4F15C 2JJSA 1F6FB 3X12A 4OTXH 2V5RA 5CWSA 4UB0L 5D7LE 2NW3B 2GQHA 4QHMA 2AJYL 5HGBA 4E41E 1AY1H 3N1GC 5CP3A 3THMH 3HC4H 2UY7A 1P84K 5DJZA 2GT9B 3GJFB 3MRCA 2RCSL 1F6LL 2ZP0T 1KJMB 1D5MB 4WRLA 4AT6B 1KB9K 3GI9H 1OP3K 3B6SB 4G9FE 1RVFH 1NSNH 3T4AA 4MD0B 1U2CA 2PF6A 3GJEA 3STLA 5ETUA 3KDMA 2AEQL 1I8LC 1RJYB 3LHPH 2CIIB 3S9DB 5FKAB 3AGVA 3FO0L 4HUUB 1KIRB 3R4DA 2IG2L 4WI3A 2DQCH 1L0YA 3SQOH 3UYPA 3VE0A 3PQYA 3DYMA 3FZUC 4RQQB 5KSUA 3MJ9H 4S1QL 4UNVA 4LGRB 3GBNH 3MLUL 4FZEL 3CMGA 3VXSA 4TPRL 1SMOA 4FXGA 1KYOJ 5DR5H 5HYEA 4CADA 4DWHA 3H9ZA 3SCMC 2FZ3B 2Y9RT 1X5XA 5BS0D 4JFED 4JG1L 4L3ED 2I27N 3JTSA 1DEEB 1I8MA 3MRMB 1OD7A 3IJYA 2OJZH 4FQXB 1LEIA 1XIWA 3SDCC 5I1LB 4PJEF 4X5WB 3U4AA 1T7YA 1ADQH 3HPLB 2DKSA 2H26A 1MCOH 2X4PB 4KK5C 1I3RB 4HJGB 1BFVL 1M71A 4ZNEA 4G43A 4JQVC 2QSVA 3P4NB 2NX5A 3FRUA 3HG1E 1AD0A 4NZUL 2EDOA 1YNTA 1PKOA 1LO3H 4X8XA 5C0AA 4M1GL 4Z7UF 4LLQB 4P5TB 3Q5TA 4I18A 4P4KC 3O6KH 4M8QB 3H9SB 1IM9D 1BOYA 5I1JL 4S1RL 3HFML 5FK9B 1S9VB 1V3KA 5DHVA 2H6PA 3QCTL 5CINH 1MIMH 3AU1B 5DD1L 3S3PA 5HVGB 5ESVB 5J12C 3HNTL 2OL3A 2CO6B 3BMWA 2OMNA 3CX5K 3EYUL 1UWEH 1MCNA 1CLOH 2G75A 2XIDA 4HFUL 5AWNH 5KVEH 5B8CA 3DETC 1YUHA 3JVGC 4FQCH 4UU9A 2ZCKH 3O9WC 3FO9B 2H45A 3I50H 3KLAA 5GS0D 1X44A 2WANA 3OJMB 3SEPA 2G5BA 3H3BC 5A43C 1KCUL 4JDZB 4LOUC 1NH6A 3V7AG 1YPZF 3PL6A 1LHZA 3SDXB 4NM8L 4IIQC 3O8XA 4G8FA 1HCVA 1Q9LA 2G2RA 2XRAL 2J3SA 3DMMC 4ZS6C 4P9HC 3DVGB 3ZLQC 4K07A 3T1FB 1AR1C 5A2IH 4JFFB 4CNIA 1C5BH 3OB0K 4ODVH 3S98A 4PJFA 1Y6KR 2HVKA 4GG6E 1JPGA 4MD4B 4K9EC 2LVEA 2HWZH 4JRYD 1XCTB 3C5SA 3BEVB 1KGCE 3U9PH 4BUHA 1PYWB 1S7XA 1KXTB 1WF5A 5IT2L 4NQDD 5JW4N 3IXAB 3VFSB 1NAKL 3KWWA 2K7PA 2NZIA 5GRYA 3UJIL 4LU5H 2FBJH 4XBEL 5CD3B 4XPTH 2A6DA 2NY1B 2Z93A 4L4TB 1OAYH 2YA2A 1QZ1A 3FFCA 4FS0A 4MNGE 4L8CB 1A2YB 3ULVC 3INUH 2A73A 3UJTL 5BZDB 2UVEA 3E6HB 5KOVC 3CFCH 1WK0A 3BKMH 1H8OA 5IESL 3SE8L 3WMSA 1B2WH 5C0CB 5LCVL 5DQJA 3TYFB 1E28B 1J11A 2C1PA 3BZDA 4OQ1A 3BH8B 4XNMA 1HXMA 4PJBA 1T0PB 2FJFB 3IDXL 5HHOA 1RULH 1AGDA 3PJSB 3G5ZB 4WHYH 4UB0H 4PBVC 3EW3B 5HJ3B 3QQNA 3CDYA 3PWPD 4BSWB 4JEGB 2VAAA 1MCKA 1HH6B 3MRJA 4F7EA 4BQ6A 1MI5E 2HG5A 2LU4A 1Q94B 5F88A 1C12A 4P9HL 3QFJD 1JWSB 1XR9B 2AAVA 2FJHB 1CK0L 2YSSB 3LSOB 3EJJX 5JTWA 3CJJA 2PW2A 3C8DA 1TQCB 4K9EL 2HTKD 3JTTB 3RGHA 2UWEF 3P2TA 5HBBA 1KNOA 3QDGB 1C16A 5FYKH 1M7IA 4O58L 3RDTC 2AEQH 1T21A 4TUJB 2VXVL 5KSBA 4OF0A 2ESVA 4K7PX 5JXEA 1JGLL 3FO0H 2IG2H 4MVBC 2P5WE 3ARFD 2A0LD 3NFPA 2BVOA 5JA9A 4S1QH 2DWEB 3MLUH 2AKRA 4PJ8A 4TPRH 1CFNB 1QEWA 3ULVL 2DWDB 5JPMB 3TN0C 2X9YA 1IEBB 5IB1A 4IBLT 4JG1H 1A64A 1X5ZA 4N1EA 4HT1L 1BIIB 5IJVB 5I8CA 3ZT6A 1I1YB 1ZGLM 4HIJA 1F4XH 2EC8A 1V3MA 4I13B 5HVHB 1W8NA 1A1MB 3HCVA 1T66C 3RTQC 1MLBB 3M17A 5L7XL 3LKQA 2RIKA 1UYWL 1BFVH 3T0ED 4LSSL 4U6HB 2FSEB 1NCUA 1GSMA 4OFIA 4Y1AA 3GSNA 3VFTB 1Q9KA 4NZUH 5KOMC 3SKOA 3V4PH 1HINL 3FCTA 4KI5D 3RVUC 1CS6A 1H3VA 4M1GH 4MSWA 4PRIE 3DURA 3IDGA 4LNRA 5FAAA 2EEAA 5FA4A 5IB4A 4UV7L 4Z77A 4S1RH 4BFBD 3HFMH 1FHGA 1OLLA 1HOCA 5L2JB 1QFUL 3A0OA 3QCTH 1MHEB 2A1WL 3RZCC 5DD1H 4G8IB 1UACL 5D1QA 3HNTH 1OQOA 5D4QA 1IAOA 2P49B 3EYUH 5GRJH 1NC2B 1JYNA 4HFUH 5F3HA 2WK2A 4NC2B 4YAQA 1JGDA 3B9DA 4L4VD 4X5XB 4OGAD 1GGIL 2Z4QA 2NMSA 1MFDH 2B1HL 4JGJA 1A6PA 1RK1A 4MS8C 2F53E 2N7BA 1NGXA 4XBGA 4XPAL 4OUOA 1NGWB 1KCUH 2KBGA 5MEPA 1U8IB 3VFMA 4AQ1B 4M4RA 3VDBA 5AZ2L 4NM8H 4XVUC 1SHMA 4KVNL 1J05B 4OCSL 1MH5A 5HHVH 3D3VD 2XRAH 5T1LD 5GRUL 4WJ5A 5CFHA 4Y88A 3CSYA 2CDFA 5I71C 1FSKB 4JJ5A 4QCIB 3QR2A 4A6YL 1MCIA 2XTJD 5HI3D 4G80A 3E2HC 4GRLA 5ERWA 3W0WA 3BRFA 2C7UB 4GMSL 4R0LB 1NUFA 3L5WA 2CLZA 3F5WA 1NAKH 4PGBB 1R3KB 1MCJA 1ERNA 3BP5A 4YEFA 1UWXH 3Q1SL 5I1HH 1U91B 5EU6E 3S4SB 5C0BA 3WFCL 4BQBA 4XBEH 1SJXA 4RX4D 1ZLSL 3UAJD 5IW6B 2NZ9D 5KTEL 4YPGB 4D9RD 2W92A 4MAUL 4LMQE 4AIOA 4NO0D 5BQ7A 4M43L 2YMXL 1P84J 4K55A 3SE8H 2DQHL 1CDGA 4V1DA 4PJBF 3QDMB 3UTPD 1REIA 3KPRE 4OLWH 4BZ1L 3IJSA 1K9TA 3IDXH 4JZNB 1IAMA 3MV9B 4BSVB 4PJXF 4AG4L 2AQ2A 4NQEE 4D3CH 1YN7B 3OG4B 4OI9A 2R15A 4QRPD 3KPSB 3KXFB 2V17H 1P2CA 3KYNA 4RGNE 1BQLL 3KR3L 4NSKB 1N64L 2X1QA 4R4BA 5J13C 5SX5H 2VE6B 3MFFB 2X41A 4P9HH 1PQZA 3L3JB 2XTLA 5E00A 3UDWA 1CK0H 4DCQB 1TZHA 1ZT7A 4UNUA 5KSAD 1RIVL 1EGJA 1FFOA 1JI1A 5I16B 4KJWD 3RVXD 1NJ9A 1Q0XL 5KSBF 3ARGD 3ZE1E 3Q6FB 4ZQKA 5EA0L 4O58H 4F9LC 3C08L 4UIMA 4LF3A 5C0FA 2LV4A 4IMLB 4Q0XL 5CP7B 5J7CC 5KANG 1H5BC 1ND0A 2ADIA 3W81A 3ARVA 2BOCB 1YMHA 2EIZA 3OZ9L 4L1DA 5EZLA 2YD3A 3EYFA 2FIKB 2CGRL 4PJEB 4MXVE 4HHAA 5F7DB 5IVXE 4XMKL 3ULVH 3K74B 1KTKE 3DXAB 3ZE2E 4HC1A 3TBSB 3W39A 1XF4B 3QPQD 3CSPA 2P8LB 2WMPA 1KJ2A 5HPMA 5F7MC 3RWHB 1ZMYA 3CU1A 2X1OA 3KVQA 4U1JA 2ZOKA 4R3SA 4GMTL 5F21B 1NGZA 5F9OH 2DI8A 4Z7UB 2PETA 5L7XH 1JZ2A 3LKPB 2WBJA 3QDAA 4HWNA 1HI6B 4KUCD 1AGEB 5ACZA 3P11L 1DE4A 1UYWH 2C3XA 3OKEA 1INQB 3TA3D 4LSSH 1IGIH 4BZ2L 2VLRA 5L0QC 3CX5J 2Z35B 1CTNA 5L2KD 2V9QA 1XF3A 4XCEA 1MCBA 2ZNWA 1N3NB 4L9LC 5CBEA 4I2XE 1FN4B 4UV7H 5GQBA 5A2JH 4LPCA 5GS0C 5DFVD 4O2EA 5JLZA 1CBVL 1TVBB 2P8PA 1SQ2N 4DKEH 1FFPA 1FL5A 1UACH 4UTAH 4HKJB 3IU3A 1CT8A 1YPZB 4LFHD 2EE3A 4JN2A 3U4EB 3BW9A 4Y5YC 1TIUA 3FB8B 4JO1L 1GGIH 2J6EH 2J12B 3KJ4C 2B1HH 4MJ5A 1G7PB 2WWKO 1NDGB 3UTTA 4QTIH 5J0BA 5HYJA 5E08H 1BX2A 2B5IC 4XPAH 4WTWA 3NPSC 2F19L 1YN6B 3LV3B 5D7JB 5SV4A 3RWCB 1FL3A 2D3VA 4LDEB 4KVNH 3AREB 4YPJA 4JFPA 1A9EB 4OCSH 3UBXI 3MJGX 4ZFOL 4ORZC 5GRUH 5ICXA 1J8HE 3QJHB 3V0WL 5GGUB 4LIQL 2YD7A 3PWVA 5EIIA 3VFVA 4PBWD 2GITB 1JNLL 3X14B 5FHAH 4CVWA 4CMMA 3RL2A 4XRCA 1MAJA 3KYKL 1OAQL 1M05B 1AGFA 3ESVF 4U6VL 5GS0L 5HGGS 1P7QA 3X12B 1BZ9B 3VJ6A 1KOAA 3O4OC 5DJCA 3CCHA 2MMXA 1WC7A 4Y2DD 3Q1SH 4QHMB 3WUWB 3WFCH 4BFIA 1X7QA 4OCRL 3K7UA 1D3CA 5KTEH 2PYFA 2M2DA 4HWUA 5DJZB 3RVTD 4MAUH 1PY9A 5FO8A 3MRCB 4Z7NE 4M43H 2YMXH 4DN3L 3OF6D 2DQHH 5LXGL 4X9HA 2VDKL 5CJBA 3WV0A 3T4AB 3BZ4B 3MZTA 5F89B 3STLB 1ZSDB 2HTKC 3KDMB 5C2BL 2EKSA 2UWEB 4PYGA 5GJTH 4AG4H 3VFUA 4WIQA 4PJ5E 5C0ND 3D1MC 3ZTNL 8FABA 1PW3A 3VE0B 5JOFA 3L3DA 3KR3H 1XGQB 3VXRE 3ARFC 3CDGA 1E4WH 4PR5A 3QEQE 3NOIA 3VXSB 1BREA 4FXGB 3JV6A 1MWAB 1RIVH 2ARWA 3IDNB 2H1PL 1Q0XH 1CE6A 2C9AA 4QHLA 4POYA 1EJOH 1FCCA 4TVSa 5EA0H 3C08H 3F12B 2VLKA 4Q0XH 1I8MB 1T0NA 3QQ4A 1U8PA 1IFHL 1XIWB 1YY8A 4PREB 5D2LE 1UZ6E 1QRKA 3QUMB 2VABA 1YEDB 3OZ9H 5GZOD 1CGUA 2ADJB 4ODHH 4HCRL 1F42A 4MNQA 4FQXD 4OFYD 3C60A 2YC1B 3CUPA 1QUNA 3EYOA 4XMKH 4I9WE 1M71B 4Q2ZA 3EDKA 1NLDL 4G43B 4N1HB 3FRUB 4U0QB 4YZFF 2A6JA 4OKVA 4LSRL 3T0EC 5D7SH 5HI4D 2VZ1A 4JFDE 4YDVA 2NXZB 2H32H 5D7IA 5C0AB 4Q9QL 3BP6A 2A74A 1YEKH 4KZDL 2AQ1A 4RISL 1GOFA 4DOHB 4KI5C 4GMTH 5HVFB 1WWCA 2HJFB 4QXTA 1AD9B 4HK3J 1WBYA 3TNNB 2VYRE 2DM4A 2H6PB 1YEHL 3P11H 4RBPK 3GB7A 3LKSB 5F6IB 3GSVA 3RIFK 3N0PB 5LGJA 1Z6JT 2OL3B 4TTGA 4I0KA 2G75B 4F57L 4N9OB 1AI1H 1J87A 1OM3L 4UU9B 1MUJA 1ZE3C 1H0DA 1M7DA 3B3IB 1FLTX 3WL9A 3O2DL 2Q6WA 3SBWA 3BRGC 4KHXL 3UZVB 1QOKA 1E27B 2G5BB 4R26L 1KPUA 3CVIL 4Y4FA 4OQTA 5ISZB 3QO0A 1CBVH 2FYYA 2XFXB 4UDTA 3GHEL 3EO1A 1W72A 2W9DL 2P44B 2NY3B 4DGIH 3LEYL 4Z5RA 5DT1H 1FNHA 2G2RB 3MRRB 5I1DB 1RD6A 4F7TB 4QXUL 1T6WA 2NY0B 5BOPA 1F3RB 2BSSB 5DVOA 4P46B 4PJFB 3MYJA 4FA8A 1WWAX 1S9YA 3HRPA 4P5MA 4EI6B 5IMLA 3C5SB 5CMAA 2RHEA 4JFFD 2F19H 2VL5A 1S7XB 1S7RB 3C6SB 5DQDH 2WINA 2NY7L 2XTJC 5HI3C 4IRSD 4FFZL 1TQBC 4OZIA 4JM2D 2HLAA 3ARDA 1QSEA 5H8DA 3KWWB 2O26U 2Y1VA 5F7LB 4OCYH 3TBYA 3CFIC 1EO7A 1NKRA 3V0WH 4LIQH 3FFCB 1A1OB 1JNLH 4QWWD 2AI0L 3F8UB 3UAJC 1XGTA 1NCBL 2NZ9C 5ADOL 1UT9A 3HMXA 4L4TD 2NY1D 2OR8A 2E7CA 1OAQH 2BOBA 4G3YL 5GS0H 2YD9A 4OLVH 4XNMB 1HXMB 4PJBB 4G5ZH 4NCC1 5HHOB 4NRYA 2W0PA 1AGDB 5C0CD 1AKJD 4QGYA 5B22A 3O6ML 3OX8A 3TO4A 4X98A 3MRJB 4M62H 4PJXB 4XAWH 3K2UH 4OCRH 1T1XA 4XVSH 3MRDB 5GIRB 5F88B 2D0FA 3PGFH 2IANA 1KJ3L 4Z78B 1BJMA 2J2ZA 3GIZH 1QR4A 5FYJL 3WBDA 5C6WH 5E2WL 5H37G 1EVUA 4DN3H 2IFGA 2PW2B 1UB6B 3SQBA 4QHNB 3HLAA 5F9JA 1JGEA 5LXGH 3FAXA 3GZKA 3RNKA 1NGPL 1INEL 5KSAC 4XCCL 1SEBA 1C16B 4OZGF 4KJWC 5C2BH 3RVXC 1FH5H 1T21B 5DYOA 5KSBB 3ARGC 1HE7A 3ZTNH 4FMKA 4R4ND 1C5CH 5MERA 1RZ7L 3ALPA 5FUOL 5JMOC 2AKRB 4OCWH 1DFBL 2BRQA 1OAKL 4JKKA 4MA7L 4P2RA 4WV1A 1WAAE 5HHME 2OCFD 3MNVB 3ZKXC 3QP3A 5KJRL 4KQ4L 2CSPA 4I1NB 3MFGB 4HIJB 1OTTD 1XH3A 4G6AD 3RPIB 1OTUD 3BYTA 4ZNCD 5SWSA 1IFHH 3QPQC 3SGJC 1ZA3A 1OGAE 4LLDA 2GAZB 3N1MC 3U6RB 3DO7B 2ZG1A 3M17B 3EOAB 4CL7A 5I1GL 2BNQA 3LRSB 3LKQB 1T22B 2YUZA 4HCRH 4KROB 4QOKA 4LPVA 3IDIA 4OIAA 4YFDB 2OXHA 5GISL 1DQJB 3GMRB 3CC5B 4UV4H 1NLDH 1N59A 5EZIL 4MLSA 5C09E 4Y1AB 3GSNB 1JRHI 4LSRH 3TA3C 1Q9KB 4S10A 1Z0MA 3D9AL 1F02I 3FCTB 5IKCA 3RP1A 3D6GA 4Y8DC 5FYKE 4MSWB 2FO4B 1ADQA 3NPZB 2F54A 3IDGB 3S36H 4LNRB 1SY6A 5FA4B 5IB4B 3CZFB 1ZA6A 3NFNA 1MFAH 2Q7NA 5IGXH 4AM0B 4S2SA 3N1QC 1HOCB 1OVZA 1YEHH 1UQSA 4J3VA 1G0XA 2PCPB 1G7HB 5DFVC 5D1QB 5CCKL 4X4ZA 4TSCL 1T1WB 2EDNA 3PDGA 2HRPL 4JFOB 5F3HB 4F57H 3UMTA 3U0PA 2DB8A 3NCYP 1ZGLA 1U36A 2Z4QB 1Y0LA 3O2DH 1NC2D 4P57A 1RK1B 4KHXH 3WN5C 4KJYA 1D6EA 4XP6L 3IVKB 1NGXB 4G9DA 4KDTA 4UAOB 5IBUG 5T3XH 4R26H 1QLFA 3EHBD 5BV7C 5MEPB 1AXIB 4RGMB 3GHEH 2W9DH 1EXUB 4DFIA 3LEYH 1EAPA 2ZUQB 4RFOL 5SWZB 3MLZL 2CDFB 2XY1A 1IKNA 2AK1L 3ZYZA 3LOWA 5BXFB 2IQAA 3NACL 5I66B 1EZVX 2VH5L 1T4KA 3WJJA 1RJZB 4HWBL 4OJFL 1JNJA 1J1XL 1X5YA 3BP4A 4U33A 5GGVL 4PFEA 1AJ7H 3BYYA 1JTOA 3W0WB 4OZIF 3ROLB 3X17A 2VITA 3HZYA 5HI5D 2GI7A 3HRZB 3F5WB 2FRGP 2ZUUA 5GS1A 1GJIA 4B5EA 4OIBA 4ZUTA 3KNBB 2ZKHH 3HB3D 2BSED 3WHE1 2X4RB 5C0BB 3BP7B 3IFLH 5GRWA 5DTFB 3NIDE 4Y5VC 4Y2DC 2QQLL 3O4LB 4Y0GA 1U8JB 4I48A 3HS0B 3V4VH 4IOIA 2AI0H 2W91A 3VFPB 1NCBH 5BQ7B 4V1DB 4K71C 3RVTC 3DI2B 2ITCA 4ZDHB 2XZCL 4KPHH 4EXPX 4G3YH 5D7KD 2FDBP 3IJSB 2GKIA 4J3UA 5E2UL 5AD0A 5I75C 2JELL 5A3ID 3PF2A 3O6MH 1ZLUK 5EZJA 4P0DA 5F9WB 1CIDA 4R90L 2XYCA 5HPOA 3SKMA 5FOJA 1XFPA 2VLLB 4R4BB 4Z7VE 2VSDA 3BXNA 3MV9D 1ZHNA 5C0NC 2VC2L 1NCCL 3CH1A 4M6OL 5FYJH 1ZT7B 2Y07L 5E2WH 2CK0L 3KXFD 1FFOB 1IGJA 2R9HD 1NJ9B 3SDYL 1NGPH 1XGUB 1INEH 3HKFA 2YN5A 4XCCH 4ZQKB 2YXMA 1WCQA 5FCSH 3OKNA 3JWOC 2QHRL 4LF3B 4UIMB 5C0FB 3MUHL 5E5MB 3VWJD 5IMKA 1RZ7H 5D6DA 2EIZB 3T65A 3ULUD 5HGDA 3MOAL 5EZLB 3T0BA 1DFBH 5KAQF 4Y16A 3CMOL 5GZOC 2M1KA 1OAKH 3ZKQD 4HKXA 1IT9L 2FGZA 4MA7H 4FQXC 2CH8A 4JFQB 5KVFH 1A7OH 4X7SL 4ZTPL 4KQ4H 3P30L 4NO2A 3VFNB 3MV11 1KPRA 5JOPE 5I0ZA 3DXAD 1KJ2B 4O4YH 5HPMB 5CGMA 5HI4C 2I5YH 2ZOKB 4GXUN 2X09A 3DUSA 1NGZB 3GHBL 1NEUA 4MZ2A 4QHKI 3IDUA 3O3BA 5I1GH 3IDYB 4XHQA 3QEUA 3MJ8A 4U1KB 3HUJE 4NO3A 2CLVB 1A4JA 2D0HA 2JCCA 3RUGE 1K4DA 1DE4B 2XN9E 1TZIA 3FQTA 3CU7A 1I7ZA 4MNHA 3OPZL 1U3JA 5EZIH 2VLRB 5DJYB 5ICYB 5F1SA 5KS9E 1ODAA 4C54A 3O0RL 4XCEB 1VFUA 5KAQG 1IJ9A 5CBEB 2K9UA 4WUKL 2WUCL 5L8JB 5GSRA 3VG0H 1B0GA 1QPXA 2ZUWA 5IFHL 5TPWL 4KTDH 3MSPA 3W2DL 1KCRL 3VH8A 2VAJA 2GTWA 3J8F7 3OR6A 2ZSVA 2AV1A 2XY2A 5CCKH 4ZOCA 4W4NA 1JTPA 4TSCH 1KTLA 3RY4A 3TT3L 1FYTA 1I8LA 4JN2B 2ITDA 3BW9B 2WBWB 1AO7E 4YIQB 3VW3L 4XPFL 5IM7A 1TNMA 5F97E 3BPOB 4LQ1A 2R39A 4IOFD 5HYJB 1A6WL 3BJLA 5BVJB 2EDRA 1Y18B 5TE7L 4KKBD 4DGVL 2F8XC 3CFJA 1OARL 1YC7A 2X4NA 4XCYA 4A2LA 4H8WC 1QNZL 3RWGA 4JFPB 1MY7A 1N4XL 1IC5H 4R7DB 4RFOH 4IRSC 3RGVB 5D7JD 4JM2C 3MLZH 3NMEA 1DANT 4GW4B 3ETBF 3PWVB 3SDCA 3NACH 2QLVB 3K4ZA 2VH5H 4NGHL 3QXUA 4HUXB 4CMMB 1ACYL 3H0TA 4OJFH 1G7QA 1J1XH 1CFVH 3MRGB 4XPGL 1IEAA 5GGVH 4QWWC 2RFXA 2NY1C 3GGWB 4KAQL 2QQKH 3RL1B 1HQRA 5TH2A 1FP5A 5DJCB 3CCHB 4ELMA 2MTPA 3MJ6A 3QHTC 1WC7B 3RIFF 5IIEB 2R4SL 5CUSL 4P4KA 2OJEB 2Q86B 4BFIB 5I8EA 2QQLH 1MOEA 2FLRT 4G6FB 2PYFB 5CKGA 4I8DA 1LK2B 4DQOL 3ME0A 2GJJA 1IAIM 2HJKA 2XZCH 1M6OA 2C3VA 2ZWLT 4OM0L 3SGDI 4CMHC 1IGFL 5ID0B 3SY0B 5E2UH 1JE6A 3JVGA 1YEGL 2EKSB 4DGYL 3O9WA 1QPPA 3HZKA 4H8WL 3VFUB 4OZGB 2CIKB 4N5UA 2BY3A 4R90H 1TQCC 3L3DB 3X11A 4WHTB 2BVQB 1E6JL 1E4XL 2CUMA 4PJGA 3CDGB 4MJIB 2VC2H 4PR5B 4R4NC 4YDIL 4M6OH 3DX9B 1VEMA 1IKFH 2Y07H 3MQIA 4BJLA 1FYHB 4IIQA 1CQKA 3SDYH 3VXQA 4GW5A 2VXUH 1CE6B 3SGDH 3VXSD 2R0ZL 4HIEB 3DMMA 4YXKL 2DM7A 4FMFA 3FB6A 4EDXB 1KPVA 1AXSA 1LEKA 2VLKB 1UADC 3AMLA 3QQ4B 3O2WL 1DQQA 2BNRB 5C08E 2R2BB 4ZXBA 3LN9A 1OTTC 4G6AC 1OTUC 4OBRA 3MOAH 1F8TL 2WWKT 4OZFA 2VXTL 2QR0A 1CGXA 2FEEL 1NANH 4LP4A 4WUUB 3GSXA 5E99L 2BNUB 3SKUD 3CMOH 1L9MA 3EYOB 5IEKB 3Q3GA 1IT9H 4C83B 2CXGA 2CK2A 4KRLB 5HVHC 1BZQK 1QR1B 2DQFB 2HN7A 2A6JB 2VR4A 4X7SH 1MJUH 1Z0NA 4YDVB 1FO0A 3OWEA 3P30H 4LPYA 5IBUB 4R6UA 3BP6B 1OCWL 1BJ1J 1ED3A 3K3QA 2JIXD 1ZAGA 3GHBH 3RY5A 3G5VB 4G7VL 3GJFH 2NXZD 3OAZK 4GO6B 1EPFA 1JWMB 5C0AD 2YRPA 1CXKA 1VENA 1VA9A 2EC9U 2O5XL 3QDJD 1NLBL 3MOBL 1R3HA 3OPZH 4XP5L 4P2QE 2X1XR 3GMOA 5BRZB 1H0DB 4NN5B 1M7DB 1FFNA 4NPYB 1GZPA 3O0RH 1MJ7H 4EUPA 4M00A 2BRRL 2VXQL 3MV8B 4LPUA 3I75A 5J3HD 3K81A 5IFHH 4Y4FB 3EBAA 3W2DH 3MLRL 1KCRH 3KS0H 4HAFA 1MCSA 3EO1B 1W72B 1CFTA 2AP2A 3HI6L 4HLZG 3WNOA 5IG7A 4Z5RB 3EHBC 4R7NA 5I1IL 4GXUM 2APBA 2Y7QA 3RDTA 4Y5XC 5ISZD 1I8IB 3TV3H 1MFEL 1SBSL 3DV4A 4ZUUB 3CXDL 4EBQL 3VW3H 4XPFH 3PV6A 2Y36L 4FXLA 3F6IA 2X4QB 2GFBA 1S9YB 5F8RC 5IMLB 1A6WH 5CMAB 3W5NA 4XCFL 2ZUVA 2NY0D 2R0KL 3MXWL 3UP1A 3M1BA 2OYPA 4P46D 2WINB 4IDLA 4DGVH 4J6RH 1OARH 3TN0A 1IM3A 1K4CB 3N1PC 1QNZH 4OZIB 2HLAB 3ARDB 1QSEB 3DVFA 3LCYA 3K1KC 2X40A 4LVEA 3VH8G 5HI5C 5KZCB 4KRPB 3HB3C 1CGSL 3FN3A 3HZMA 5HY9B 3LEXA 1WCBA 2BSRA 3QFDA 4R0LC 4NGHH 1ACYH 4X9IA 1T83C 2CMRL 1B6DA 5DK3A 2D2OA 2HT3D 3S5LB 5H35A 3DX6B 4CW1A 5FF6A 2V7NA 2BOBB 3BFOA 4LPWA 5HDQH 3JZ7A 4KAQH 3BKYL 4RNRA 1BWMA 4A6YA 1JHKH 4X6EA 1NL0L 2EDFA 4HSQA 5E8OA 3CVHA 2XQYG 3MRLA 4X98B 2R4SH 3BGFB 3PP3K 5A3IC 1JUFB 2VDOH 2X89A 5CILL 5AZEL 5TF1L 2IANB 4MA8H 4XCNA 4HUNB 4LCWE 1MHCB 1I9JH 3HLAB 1T20B 3RNKB 4OM0H 1IGFH 4HKZA 4U6TA 2BCKA 2XKNA 3L95B 4FNLH 4Q74A 5DYOB 2DQTL 2GUOA 5C7XL 4J3XA 3VGHA 3V7MA 4JO4L 4H8WH 4PJGF 5FV1L 4DJMA 2APTA 5MERB 2O5ZL 2EECA 3EYSH 3VWJC 2F5BL 1E6JH 1WZ1L 1UZ8A 1LDPL 4YDIH 3WSQH 4KRMB 3LMJH 1RAMA 4M3JA 3ULUC 1JHTB 3RWFA 1E4KC 4YDLB 2I26N 4P2RB 3S35L 3I6LE 2HT4D 3I85A 5DJ6A 4KVCL 3MUY1 2R0ZH 4YXKH 3K4AA 2HT2D 3DUHA 1EDQA 1JWUB 2BVEA 4PRHA 2RQ8A 3O2WH 4NT6A 5SWSB 1IQWH 4LLDB 2O61A 2FX9L 3UZEA 2BNQB 2DLEA 5DGQA 5LBSL 4JPIA 3IDIB 5F71A 4OUUA 1X5JA 3F7QA 1Q9OA 4X7CC 1R0AH 3IDJA 3U0TB 2APXA 3BH9A 2AXJA 4YLQT 1PD6A 5IKCB 3AS3A 1KN2L 3QT2A 5K9JH 3NTCH 1OCWH 1K3IA 2F54B 1FORL 2Q7YB 1JV5B 4NUJA 4AEHL 4H26A 4LQFH 4KJPD 1GZQA 3G04B 2DRUA 4G7VH 4ETYA 3NFNB 4S2SB 4N0CD 4OSUL 3SN6N 4DVRL 4L8SC 2J88L 2H32A 2YPKA 1NLBH 3MOBH 5C2UB 2JK5A 4MDJB 4OZFG 5E6ID 3O3DA 1T5XA 2DLGA 5ALCH 15C8L 4X80L 5J6HA 4H5SA 1FZJB 2AABL 1G9NL 4P57B 4QRRB 3LPWA 1OP5H 4KJYB 2BRRH 4XAKE 1D6EB 1CD9B 1J10A 1SM3L 4G9DB 3WO4C 4KDVA 3KPMA 4IOFC 4JG0L 4MB3A 3MLRH 2P4AB 5I76A 3TC9A 1TJHH 1WBXA 3NVQA 5IHZA 3HI6H 2YXFA 2X7LA 5DK0B 1JCKA 3PWPE 4KKBC 1ES0A 3WFBL 4U1IA 4F9LA 3B5GA 4QYOA 1YYLL 1MFEH 1AGBB 4GRMA 1SBSH 4IHOB 5BS0A 4JFEA 1H5BA 3GK8L 3QFJE 1J1PL 4L3EA 4EBQH 2IQAB 1X4XA 4RAVB 1KJVA 5D7JC 4P5KA 5SWZD 1NAMH 5DSCA 4F58L 5IB2A 1S5HB 3MXWH 4JFXA 4YHIA 4KGJA 2R29L 2A6KB 4EUPG 5IFAH 1VERA 5GS1B 3VXNA 4ZUTB 4KU1A 2ICWA 1ZTXH 3WFDL 3WFEH 3W0WD 3TLRA 4HUWB 1FZOA 1IAKA 3X13A 4POUB 3BKJL 1C1EL 4GG6F 3T3PE 1YEEH 1CGSH 1I4FA 4OZHE 3WIHL 3VD4A 4LGPB 4I48B 1ZHBA 1ZLWH 1EH9A 1IVLA 1VEPA 4XNZB 4NCDA 2CMRH 1IM9A 5GGQL 2EICA 3LY6A 4Y19B 5H2BA 1F90L 2C1OA 2ITCB 3O4LD 2ENSA 5T3XE 1LMKA 3V8CA 1PBYA 3BKYH 5DZOA 4RWYL 4YBHA 1QO3B 3A67L 3KPTA 1NL0H 1A1NA 1R5WA 3UTSD 5AAWA 5GGTL 4R4FH 3HA0A 3T09A 4CGTA 3SKMB 5MP6L 4L9LA 1NFDE 2VQUA 5CBAA 1ZHNB 3PNWA 5CILH 2NXYB 3MXVH 3CH1B 4MQXD 4XPBL 5D5MA 5BZWA 4AEEA 4OLEA 3RHWK 1HQ4A 1T5WB 4XP1L 5I1KL 3QNYA 3TIDA 1G1CA 1FLRH 2RR3A 2IPUK 5FA3B 3S37X 4Y5YA 4XBPA 3WS6C 5C7XH 4JO4H 5IMKB 1KLGB 1ZKAA 1VCAA 3RU8H 4X6DE 6FABL 3AAZA 3TH3T 2O5ZH 3T65B 1A6VH 3QWOA 3OMZA 1WZ1H 4X7TB 3FT2B 3TM6A 4RCAA 4PIRF 4JY5L 1YMMB 4JRYA 4I77L 5JW5A 4MD5B 4TUKH 3S35H 4L4VE 1VFAA 3BRDA 1NGQL 1U41A 3OGCA 5EWIL 4P2CG 4NQDA 4OV6F 4NO2B 1XF2A 1RUMH 5FKPA 3MLVH 3D39B 5I2IB 3GRWA 4ALAL 3DUSB 1RFDL 4GQPH 1D5ZA 5FDYA 3KG5A 5EOCJ 2FX9H 3G6JA 1KULA 4NFDA 3QEUB 3WFHA 1BD2E 4NO3B 4XXDB 4JGMA 2NW2A 5DA4A 3DRTA 3GNML 3WD5H 2VISA 3C09B 4M1CD 1K4DB 2NXZC 5F1IB 1TZIB 1WBZB 3KLSA 1I7UA 5F7WC 2DJ4A 4F15B 5FYJE 4PLOB 4MNHB 2XXMB 5IBTL 3ALWA 3CFKA 4LKCB 1D7FA 1DSFH 4U1GB 3VGBA 3HAEA 4OIIL 3V6OC 4PRPB 2AK4E 1KN2H 4Z95L 4XH2A 5F6IC 5JORB 1N7ML 4AEHH 3G6AA 4P3DB 4DW2L 3JSSA 4HZLA 3TT1L 5GSRB 4PJIE 1MWAL 2Q20A 2D31A 4OSUH 1A7RL 3GSOB 5J3HC 4DVRH 2GTWB 5IW3A 3K4DA 1MF2L 2J88H 3N1FC 3MMEA 2AV1B 3BVNA 3R0NA 1KTLB 3IS1X 1J1OL 3MA7A 5HYQB 1T2XA 2ITDB 1P1ZA 4U3XA 4NDMB 4FRWA 5FM5M 3QUML 5F93C 2AABH 3QXTA 1G9NH 1A14L 5CIPA 3ARFA 4XX1G 2DQGL 4OLZL 1SM3H 3OKOA 3DSFH 1OY3B 4O9HL 2A9NL 4WI2A 4HDIA 5F1OB 3QSKB 3CFJB 3LQZA 2NY0C 4PJAE 2IAMB 5C0EA 2Y5TA 3SJVB 1EBAA 4P46C 3WFBH 1WFOA 1OAZL 3WNPA 3LKNB 5FOBA 5T5NF 1HN1A 1YYLH 4LCCB 3GK8H 4DVBA 3F7VB 4CUCA 5IOPA 3RX8A 4YGAB 5I17A 3RGVD 1JK8B 3H0TB 1G7QB 5D71L 2ICEA 1HHJA 4F58H 1A02N 4OF3A 1BVZA 1OT1A 3C5ZD 1RPQA 2OL3L 2OP4L 3B2VL 2RFXB 5HHQA 1C8PA 3BHBA 3QISA 3T2NL 4MAYB 2QSTA 2V2WB 2HT3C 1HHIB 1UXSA 4JFHE 1H15B 1FVEA 4FFYL 3T0EA 4PUBH 5TH2B 2DF3A 3WFDH 4ZUVA 2VOTA 1FG9C 3BKJH 4P4KB 3HI5L 5I8EB 1NCAL 1WTLA 5DD3L 1ZVSB 3OKMB 1DL7L 3WIHH 4LCUA 4WNQA 1JYVA 2YPLE 5MENB 1WQVT 5GGQH 4U1MB 2Z9TA 2VQTA 1F90H 2HJKB 4G6FD 4J12A 4ZO7A 1UH4A 4K3JL 4FTVE 1EHNA 3A67H 2OSLA 3O9WB 5D7LB 1G7LA 5GGTH 1JF1B 2EDXA 3VFRB 5DRWB 4YHNB 5MP6H 3X11B 3FOMA 4P4RA 5D5MF 4TRPL 4YE4H 4WI9A 5I18H 4PJGB 4XPBH 4M7JL 4HPOL 3U7WH 1ZLVH 4QRQA 5ILTL 5JPNA 3VXME 4IIQB 1G7IA 1NBYA 3BE1H 3AXLA 4MJID 1WWBX 1QFWL 1TVHB 2UZYB 2EDWA 4GW5B 4XP1H 3VXQB 5F7FA 3WDIA 4U0RB 3L3KB 1KPVB 1LEKB 2HT4C 2IADA 4OLUL 3BUYA 5E6YA 3OKDA 2NY2B 2PR4L 3D3VA 1DQQB 2F58H 5T1LA 2HT2C 2HLFD 6FABH 4ZXBB 5DVKA 1I1AB 2EXWD 4OZFB 3OKLB 2VIRA 4FQHA 3MC0A 4P49A 4JY5H 2BNRD 5FFLA 5MEQB 1Q8MA 4I77H 3AFLA 1Z9MA 4ZODA 4EVNA 5D2NE 3ZE1F 3CPLA 5JNYB 1NGQH 2BSTB 5EWIH 4XC1H 4WUUD 2V2XB 1FO0B 3P4OA 3BN9D 2LE9A 4QKXB 3VXUE 4N9GA 4L8BA 2UYLA 5CP3H 1WV7T 3U46A 2EEDA 5FUCE 1O7SA 1RFDH 2NTFB 4MXVF 1NMAL 1MPAL 2ZJSH 4PG9B 3LH2H 3GNMH 4KJPC 5I15L 4WFGE 5HDBE 3NBNA 3ZE2F 1EZVY 4N0CC 2F15A 1R3HB 5CEZL 4K3EL 2YD1A 5CJQH 4WW1A 5IBTH 1XAUA 3GMOB 3HG1B 1KTDB 4OIIH 1FPTL 5E6IC 1FFNB 4V2BA 4KFZC 1GZPB 4RMWA 1FZKB 5FDWA 1ONQB 3QNXA 3QUXC 3R1GH 4TVPL 2OBGA 1N7MH 4DW2H 4QRPA 5BRZD 3TT1H 3EDEA 1QYGH 3VI3E 2C5DC 3WKML 2EYRA 2BDNL 1A7RH 5B3NA 3OXSA 2VN7A 1CFTB 1MF2H 1T03L 1BM3L 2XOTA 3MV8D 5IG7B 5KSAA 4R7NB 1I7RA 1J1OH 3RDTB 4Y4FD 3V6FA 4HFWA 3ARGA 4UOJA 3QWQB 2I07B 2JKXA 4UAOC 2GEEA 5DHYA 1L7IL 4Z18A 1X5GA 2PW1B 3NCBB 1CGTA 1LEGA 3HAEG 4HS8L 4K8RD 1L0XA 2ZUQC 1S8DB 4O9HH 1QACA 2A9NH 4GKOA 2YOCA 1UENA 3DRQA 3F58L 3D0LA 5D93B 4C56E 1U8NA 3GSNL 3PGCA 5B3JF 1N0XL 4NKQB 4I5BA 3MLYH 3KLHD 1OAZH 4BQ8A 5DMIL 2FX8L 4LCIH 1Z9LA 1JNHA 35C8L 3TWCL 3SGJA 5D6CB 3MR9B 3O11A 3ARDD 1IGYA 1QSED 3HZMB 1P4LB 4NQCE 2NY5L 1TLKA 2BSRB 2ZSWA 1W0WA 3QFDB 3C2AL 4GG6B 5DHVH 5KZCD 3MNWB 3NGBC 5D71H 3GEWB 3ZZ1A 3RQ3A 4KRPD 5H35B 1LP9E 5ID1A 5CKAA 4CW1B 5FF6B 2OL3H 1WWWX 5FYKU 3T2NH 4PPTA 2N1KA 4TSAL 4U1LA 3RNQA 3TA3A 3K8LA 4N0UE 4MB4A 4LASL 1AH1A 3BEWA 4X6EB 2DDQL 5F1NA 4KI5F 2MPAL 4HWBA 4KV5F 3CVHB 4HXBL 3JWDL 4Y89A 2MKLC 3CLEL 1OF2A 3HI5H 2GY5A 5L2KA 1NCAH 3QQ9D 1KCLA 2JTDA 4M7ZB 1DL7H 4MNGB 2DJSA 5T1DH 2W65A 4I4WB 5FGRA 4XCNB 1U3HB 3P4LA 4NKOB 1BEYH 2KZ1B 4M03A 1G1YA 4MQXC 1AE6L 5F9WC 4W6YB 4CJ1A 1F11A 4K3JH 3QEGH 2XKNB 4NQSA 3MV01 2P5EA 3KHQA 4HS3A 2GUOB 1CICB 5DZNA 4PJDA 3U1SL 1H3PH 1FL6A 2QL1A 3WN5A 3EIFA 3VXPA 4FQLL 1MI5B 4Z7NF 4J3SA 4F80A 3H9SE 3ARBB 1A6AA 4M7JH 5CJOL 4WENB 5ILTH 1IRAY 4RAUA 4G42B 5J8OA 5FO7A 2QTEA 4JM4L 5LWYL 4GAYA 5F7NC 3HI1B 3B5HA 3V6ZA 2IPKA 2J8UE 5HDLA 2NY6C 2PR4H 4PRHB 4I3SL 4YJZL 2O61B 1N8ZA 3BO8A 5C3LD 4Y7MA 1CL7L 4OCLC 1F3DJ 4PD4K 4JPIB 5SWSD 1CGVA 4FFVD 1QBBA 3MRFA 3MUZ1 2BNQD 4M1CC 3IDJB 3BKCL 3LS4H 5E8PA 5IB5A 2ZCLH 4BSJA 3REVA 5LQBL 4W70A 1UZ6F 1J7VR 1FNEA 4GKSB 1RY7B 2APFA 3T3ME 4HZAA 2FD6L 4Y2DA 2XWTB 2XA8L 5ESAB 3HE7B 5I8KL 1NMAH 3PIQA 1MPAH 5DD5H 3IAQA 1EGJL 2XQBL 5JHLL 5I15H 2NW3A 4R9HA 2OK0L 4X6CE 1HSAB 2YPKB 3L9RB 1IC1A 4HW6A 3OF6A 3I6GA 4OCXL 5CEZH 1EHLL 3R8QA 4K3EH 3ZKND 4PJHA 1I9IL 4XMLH 3RHWF 5J6HB 1FPTH 4H5SB 1KJMA 4XI5D 1RIHL 3UYRL 4TVPH 1PEWA 4ISVB 4MD0A 4K3GA 1ITBB 4OI8A 3KPMB 5FCUL 3WKMH 5ITBL 3VRIB 3WDJA 5C0RL 2X4TA 5FKAA 4K7PH 4QRRD 5I76B 4HUUA 4LSPL 2FL5A 4BK4A 1WBXB 5IHZB 5C0CE 1UEYA 2X7LB 3C8HA 1I9RH 3BPOC 4YC2B 2RBLA 5CAYB 1KJ2L 4GRMB 5FYLH 4NN6C 1H5BB 3KYOA 4JE4B 2VZUA 1L7IH 4L3EB 3BT2L 4DFHA 1T7VA 2LAGB 2F53B 3EOBB 5MEOB 2LABA 5DUPL 5I30L 2B2XL 5ICZB 1F4HA 3RGVC 4YHIB 1OTSD 3F58H 1DEEA 2BFVH 4FQXA 4OFYA 3C87A 4WFFD 2VWEC 2ZZUT 3GSNH 3C5ZC 5I1LA 4N0RA 1N0XH 2IPUG 3VXNB 4X5WA 3QDGE 3L5HA 2FX8H 3OHXB 1IAKB 2X4PA 4JDTL 1OP3H 5GXBB 5I1EH 35C8H 2A2QT 3TWCH 2M26A 3E6FB 1KTRL 2X4OB 2NY5H 1ZHBB 3C2AH 5DFWH 1SYVB 5I74B 4KUCF 2J7LA 2ILLA 3UC0L 5INCA 3U7YL 4ZO9A 2X05A 3W82A 3MRNA 4LLQA 1LVEA 1QVOB 3P73B 4M8QA 1IC4H 4TSAH 4KTEL 2E7MA 2VDLH 4Y19D 2DDQH 1QSFA 5HVWA 3JWDH 2Y4SA 3KAAA 3TNMB 4ONHB 4Q6IC 4L9LB 1LE9A 3PNWB 2DL2A 4NBZB 3SGEH 2AXHA 3L3GB 2CRZA 5D5MB 5BZWB 1R5VA 3V8OA 4IEFB 2O93L 4LSTL 1TXKA 4ONFL 1W8OA 3FO9A 1AE6H 3QHFL 4GOSA 2NXYD 1HQ4B 1WICA 3TIDB 4PJDF 2ORBL 3KPRB 1BQHB 3T2PA 1WIOA 2VLJE 1SEQL 1P4BL 4JDZA 3U1SH 1BJ8A 3KJ4B 3O45B 1ETZB 1S7SA 4WO4B 1YYML 3SDXA 3AAZB 2D7MA 5DC9B 1T2JA 1QHOA 3QQ3B 3QWOB 4FQLH 1Q9WA 1TTGA 4EIZC 3VD3A 3ZSTA 3BPCB 1MCFA 2HLFC 2GYSA 5FO9B 3L1OL 2P8MB 43C9B 5CJOH 4KUZL 2EXWC 5JW5B 5FECB 3T1FA 4M9PA 1BBJB 4PB9L 4JFFA 1RUQL 3EKCA 4WFHE 3GMMA 5LWYH 1VFAB 5I1AB 4NJAL 3S34L 3OGCB 4MD4A 2GJ6E 4IRSA 1YMMD 1XCTA 4JM2A 1HILA 1NBQA 1XF2B 1T3FB 5T1KD 2R2HB 2V6HA 1J9CT 4JRXD 3BN9C 1DQLH 4CN6A 1D5ZB 3KPPB 3GSWB 4LFHG 3WFHB 2KL6A 1CL7H 1YJDL 2NW2B 2VISB 3D39D 3ROOB 3CXHK 1B0RB 1I7UB 4NNPL 1WAAF 3W9EA 5CD3A 2IQ9L 4L4TA 1FVDA 1DBJL 2AJZA 3H3PL 1B6UA 2XNAB 5BZDA 4AIZB 5LQBH 3HAEB 3E6HA 2Z8RA 2W9LA 1MRDL 2XZAL 2AJ3B 4DUWA 3F7RA 3WNMA 1AKJA 5TFSL 3TYFA 1A3RL 1BFTA 2XA8H 3BH8A 4HZLB 2XI9A 5EZOH 3MA9L 4PRPD 3UO1L 1EGJH 2JLLA 3PJSA 2XQBH 4N0FB 5JHLH 2BJML 5HJ3A 4UILH 4A2MA 2OK0H 4BSWA 4PJHF 1YECH 3MRHB 3OB0H 4HGKC 4NN5C 3MMEB 1S9XB 1C5DA 4NYLB 1T7XA 1EHLH 3MA7B 1XCQB 1I9IH 1JWSA 2FJHA 3LSOA 2YSSA 1QRNA 1AFVL 2D7TL 1BVKA 1I3GL 4Y4FC 4Z7QE 3O6FD 1F97A 3ARFB 4XVTL 5F96L 1BGXL 2ADGB 2YWZA 1WZLA 4HDIB 3EZ8A 5FCUH 4TUJA 3VMNA 5ITBH 5C0RH 8CGTA 2B1AH 4K8RC 4LSPH 3LQZB 4UIKH 3BWAB 2ADFL 2DJUA 2R23B 2Y5TB 1KEGL 3QDME 3MV7E 5HGAA 4F7MB 5FOBB 1KJ2H 5LJYH 4PJCE 4DVBB 2IAMD 1CFNA 3L3HA 3SJVD 1JL8A 2AEPL 3KLHC 1B0WA 3BT2H 5T3ZH 5I17B 1UCTA 5E95B 2DS4A 4WGVB 1HZHH 3KPSE 5B39B 4GSDL 1IEBA 2HFFA 1G84A 1BPVA 5DUPH 5I30H 3EDFA 1BIIA 1Q38A 2B2XH 5IJVA 3TH4T 3KLDA 1I1YA 3GMLA 3LQAC 2E7HA 2HFTA 4KRPC 1A1MA 3VU2A 4L1HA 1UXSB 1FVEB 4ZSOB 3FN0H 4WHCA 4WY7H 4I0PB 1OL0A 3CZJA 4JKLA 3IXTA 2V5MA 4YHPB 4JDTH 3PGDB 4MAYD 2IEPA 2X42A 1YEFL 1MJ8L 5GRVK 4LCUB 4DN4L 1TNNA 2FHFA 2PN5A 2UUDK 4OQTL 4MX7B 5GRZA 4FQJH 3QQ9C 1JGUL 3UC0H 3U7YH 1K6QL 2F5AL 4PJEE 4LMQI 5SX4H 3IS0X 2EKJA 4PJ7A 3BGFC 5CGYD 2BC4B 3DXAE 5MEND 4KTEH 4K8RL 1N26A 2XXCB 4AEIH 4PY7B 1UFUA 1G7LB 5L2JA 3NIDF 3OKKA 4JN1H 4MMZC 1RZFL 3DETD 3FOMB 3V7AE 2VO5A 4N8VB 4X5LA 3FB7B 2IH3B 5D7LD 4G8GE 3DOSA 3ARYA 1UCBL 1RJCA 2EDTA 4QRQB 4LSTH 5JPNB 4E41D 2B7DT 1FFRA 1G7IB 2Z8SA 2Z92A 3AXLB 3ES6A 2MQCA 2YS4A 1KV3A 4Y5XA 4XP4L 4JANB 2ORBH 1TENA 3LQAL 1ZWIA 5K9OB 4P99A 3NCFB 1NGWA 5H37H 3B43A 3BUYB 1SEQH 4Z7WE 5IVOA 5IP4A 4UBDD 3D3VB 1SBBA 1U8IA 4G9FD 2EYTA 4NQXB 1YYMH 3DIFA 4YDLC 3RY6C 2Q8AL 4X4MA 4EXKA 3HE6C 3VXRB 3HMXL 3D87B 2DQDL 5TDNB 2NY2D 4FQHB 3BISA 3QEQB 5T33L 3L1OH 4PD4J 4KUZH 4ZXBD 4D2NA 4PB9H 1RUQH 1HKFA 1I1AD 5CSBA 3CPLB 4JM2F 4FFVC 1CI5A 4NJAH 1UXWB 3MO1B 1YPZE 1T7WA 3P9MA 4V2CB 4N9GB 4L8BB 2UYLB 2BXZA 4OT1H 3U46B 5IEHA 1VGEL 2DTML 2D03L 2OTUB 4OZ4B 4E42B 2C7UA 4R0LA 4X4YB 4NRZB 2R1YA 3QXDA 1T83A 5EBLA 3PXHA 1YJDH 4PGBA 1U93A 1E4JA 2D7QA 2HYMA 1U91A 3S4SA 3CLFL 4NNPH 4F2MA 1A3LL 2IQ9H 2YK1L 5IW6A 1DBJH 4YPGA 3H3PH 2B4CC 3MCG1 3IB4A 3SPVB 3ZKNC 4JFDB 1MRDH 2XZAH 5GPRA 5FDWB 1J88A 4O51A 3HUJF 1A3RH 1RZIA 3H9HB 4QRPB 4XI5C 3HG1D 3RUGF 5JHDE 3MA9H 3IF1B 1VFOA 2EYRB 3MV9A 4BSVA 1RMFL 5C0JA 5IVNA 4J2XA 2BJMH 5C0DB 5E4EB 1KELL 3KXFA 4M1DL 2BVTA 5JR1L 3HZVB 1BF8A 3D2UD 1DEDA 3ARGB 4XGZB 2J8OA 4DCQA 1AFVH 1V3LA 2D7TH 2XG4A 5DHYB 1I3GH 4ODUB 4ORGB 5ESQA 3VWJA 5I16A 3Q5OA 3QEHB 3OTTA 5F96H 4XVTH 1Q1JL 1LEGB 4P3WA 3IFOB 1HEZA 3UTZB 1DDHB 3DROA 5L8KB 1E4KA 3D0LB 5CP7A 1CE1H 3AC0A 3B2UD 4GBXB 2VB5A 2ADFH 2BOCA 1KEGH 1OTSC 3P4MB 3ZKXB 4I5BB 3FL7A 4O00A 1U6AL 5GS2D 3WJJC 2YBRA 1E6OL 5EU7C 1JNHB 1SY6L 3LVEA 3T0VA 2AEPH 1IGYB 2IBZX 5E8DL 5FGBC 3HR5A 1RUPH 4PY8I 5DXWA 2ZSWB 3PQYE 2E7LA 1XF4A 4XNUL 4LNVA 3ULSA 4ZOEA 1AIFB 5ID1B 4DEPC 2FWOB 3VXSE 5L9DL 3SDDB 5D1ZD 3RWHA 5GGSY 4U7KA 4Z7UA 4U1LB 1KGCD 2EIBA 4PTUB 4OBSA 1HI6A 1AGEA 1OF2B 3MLSL 3LN5B 2VN4A 1INQA 1MJ8H 1EEYB 3WYRA 4DN4H 1IE5A 4TOYL 5IHUL 1CD0A 1SYSA 4OQTH 1F4YL 2ED7A 3PP4H 2Z35A 1JGUH 4PJ7F 4L8SA 1W72H 2F5AH 2X89D 2CR6A 2DD8L 2D7OA 4WW2F 5DEGB 4ZNEE 1U3HD 3WE6B 1FN4A 1K8DB 2P5EB 4K8RH 2NX5E 2UZXB 5C6TL 3ZDZF 4PJDB 1TVBA 2M8XA 4X7EC 3QCUL 3VGFA 2PTVA 5C0AE 2AGJL 1RZFH 4HKJA 3TH2T 2FJGB 3GO1L 1RIUL 4N5EC 5DRXB 4DOHE 1CICD 2YD4A 5A40E 5KSVA 3FRPA 5BV7B 4KI1A 4RAUB 2MOVA 5DMKA 5DURD 2EEBA 4AMKL 1MI5D 5GGTA 1XGPB 4KMTL 5JIIA 1G7PA 3ARBD 5I6XC 1B4JL 4XP4H 3K0WA 4KZEL 3V6ZB 4RSVA 1YN6A 5DC4B 5JW3L 5IQ9B 3IJHB 3RWCA 5LGHL 3HMWH 3BO8B 4TSBH 1J0HA 2Q8AH 3QG6B 1A9EA 3HMXH 5E9DB 5GGRY 4PRHD 5ITFB 5T33H 2P5WD 2ARJA 3LN4A 2P24B 3WNLA 1QFHA 3WDHA 3E3QC 5GGUA 2IPTL 3WEXA 3CXHJ 2Y06H 2CUIA 5E8PB 3DVIA 3REVB 2HKHL 4GRWE 2WM0A 3PWNB 4YBQC 1AP2A 1FNEB 3BPLB 1TETL 3FO2A 1M05A 4PV8A 3NH7H 2DTMH 2D03H 3DWTA 5E70A 1OGAB 4BYHA 3CFBB 1S9KC 4PJFE 3PIQB 2YUXA 1BZ9A 5T5FL 2BERA 4U1GC 2AJXL 2FGWL 3F65A 4K71B 2CRYA 1FVCB 5E8EB 4UINH 5DJ8B 2DLHA 3CLFH 2YUVA 1KCVL 3HE7D 3WUWA 3I6GB 2FATL 5I75B 2YK1H 1DQDL 4WFEE 4PJHB 5C09B 5DF0A 3DO3A 1DR9A 1FBIH 1KG0B 4NZDA 3O3EB 3RWIB 4LSUL 4U2YA 3GIVB 4BH7B 1U3ZA 3BZ4A 2DLFL 4IDJL 4G7YL 3FFCE 5F89A 1ZSDA 3O6FC 2GTZA 2D7NA 2UWEA 3G9AB 1RMFH 2X4TB 4HF5L 2FL5B 5L88L 4M7KH 4HX1B 3JV5A 1XGQA 3SOBL 1GPOL 1U42A 3WS6A 4PJBE 4N1CA 5HHOE 3S4SG 5FM5O 1FZMA 3KYOB 1MWAA 3H42L 4NUGL 2E6PA 4FQIH 3IDNA 3ULUF 3PWJA 1LO2L 1MHHB 2IAMC 3BDBA 1Q1JH 4FQQB 3UXFA 3HNVL 3F12A 4LCCC 3C5JA 1MQKL 3ELAT 4PREA 2F53D 3DUUB 4UT6L 3QUMA 5TDPA 3P0YL 1YEDA 2ADJA 1A21A 1E6OH 5CEZE 4P2OB 1VPOL 2YC1A 5KSBE 1SY6H 2ESVE 2HRLA 1C08B 3D69B 1WUNT 1ZT1B 3VI4E 4MAYC 1CDJA 5FYJU 2JIXA 3T04D 4TVPE 4XNUH 5INCB 5JA8B 3MRNB 2X70A 5L9DH 4YHZL 4NRXB 2Y6SD 3QDJA 1JF5A 2HJFA 4QF1B 1AD9A 3V6OA 1F58L 5EU3B 3FONB 5CGYC 4XNYL 2XG5A 3TNNA 1QSFB 4KDWA 1I1RA 5E24E 3LKSA 5FUZL 3MLSH 3SKNB 1LE9B 2EIEA 5B38A 1KEML 5FYLE 3MBXL 2Z8VC 4M6NL 2A6IB 5IHUH 1MRCL 1Z3GL 1FIGL 1R5VB 4NKMB 4N90E 4OFPA 5F6HI 5L6YL 2YZ8A 3B3IA 3O2VH 2DD8H 3NZ8B 3OGOE 5H94B 3VDAA 1KSRA 1E27A 2V7HB 3T0AA 4Y1AE 5C6TH 4NNXA 5JXAL 1PG7L 5ISZA 1DBML 1S7SB 4JDVA 2XFXA 2AGJH 3KPRD 1Q9WB 4NJ9L 3GO1H 4UBDC 1RIUH 2H9GA 4TUOB 1NGYB 3MRRA 5I1DA 4F7TA 1G7MB 4KK6D 1X4ZA 4NQED 4U0RC 4WO4D 4YO0A 3IU4L 1BP3B 2NY2C 2FEDD 3QXAB 3GMMB 1GGCH 4KMTH 2BSSA 4ZAKC 2IBBA 4P46A 4ZXBC 1B4JH 4EI6A 1CLYL 4IRSB 4JHWL 4BM7A 1I1AC 4JM2B 1HILB 4RBPH 1GHFL 1TTUA 1U2HA 2ARJQ 3T8XB 5JW3H 1S7RA 3C6SA 5LGHH 5D9SA 1MREL 5K9QG 2FECL 4M3KB 4G6KH 4S1DD 3WNNA 4JO3L 2A77L 5EOQL 2HJLA 1CZ8L 3W9EB 4B50A 4L3CA 1FVDB 2IPTH 4HXAL 4LRIC 2AJZB 4PLJD 4LBEB 1A1OA 4PRBA 3FRPG 1OLZA 2DLTA 3BJ91 5ALBL 3FQNB 2HKHH 5EBGA 1EUUA 3GJFK 4FG6D 5SWZE 3Q6GL 3TVMD 1PFCA 1AKJB 1TETH 3HHRB 3TFKD 3G6DL 1HKLL 1A6UL 2C3WA 4KQ3L 4RIRB 2GSIB 5T5FH 4BFEA 3HUJB 1EA9C 3TBWB 2AJXH 2FGWH 2HA1A 3I3BA 3RUGB 2XN9B 2AJYH 2VDNL 3JXAA 1KCVH 4CMHB 2BX5A 3W0WE 1C5DB 2FATH 4PJXA 3RWEA 3MGOA 3MRDA 3OJDB 5GIRA 1V3JA 5ANMA 3GKZA 1G7JA 4Z78A 2AJSL 1QRNB 1BVKB 2RCSH 5J1AA 1UB6A 3MUGB 4QHNA 5CJXC 5C0BE 4LSUH 4LP5A 4U1NB 3T4YB 3ECBA 3NCEB 4X7FC 4G7YH 5J89A 2DQUL 4JRWA 1KB5A 4M8VA 3KPOB 4HF5H 2I60L 2YZ1A 3Q48A 4V1DE 3LKRB 2Q1EA 2EDBA 1X5KA 1FO0L 3B2UC 3SOBH 4LVNB 4GKZB 5HGAB 1GPOH 3GMNB 4X8JB 2PYEA 4FZEH 4U1HB