2NPPC

Structure of the protein phosphatase 2a holoenzyme
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
308
structure length
308
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the protein phosphatase 2A holoenzyme
pubmed doi rcsb
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 102
structure length 308
sequence length 308
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nppC00
4NZVA 2O8GA 2WDCA 5JPEA 2BDXA 1OIDA 3IB7A 1SU1A 4FBWA 4DT2A 4JA9A 4UT2A 2P6BA 2QFRA 1FJMA 2KKNA 3HVQA 3RL4A 3CK2A 4WWLA 3H64A 3H68A 1UF3A 1AUIA 4KBPA 3QFKA 4F0ZA 5JPFA 4ZX2A 3EGHA 2GJUA 1OI8A 2NYMC 4DSYA 2WDEA 5C1VA 3AUZA 4YKEA 4O4KA 4UT3A 3C5WC 3EGGA 3QFOA 4XPNA 3H63A 2R17A 3IVDA 4FBQA 1OIEA 4O5GA 2XMOA 3T1IA 1IT6A 5J28A 1T70A 3QFMA 4FCXA 2IE3C 3TGHA 4B2OA 3C9FA 4TUIA 3LL8A 2BCDA 3PSOA 1KBPA 2JOGA 1II7A 4G9JA 5INBA 2O8AA 4DHLA 2Q8UA 1QFCA 2YVTA 4ORCA 4UWQA 3DSDA 1WARA 3KBPA 3AV0A 4ORAA 2QJCA 2HY1A 3DW8C 5DNYA 4HD0A 2Z72A 2USHA 1G5BA 4IL1A 4UT3B 4H1SA 4H2IA 4MP0A 3RL5A 4ZVZA 2DFJA 3QG5C 1HP1A 3IVEA 3PSNA 3GVEA 4LTYA 3K7WC 1S8EA 2Z1AA 4LACC 3H62B 1UTEA 1HPUA 2NPPC 3E7AA 5EQVA 1U32A 2QFPA 1T71A 4FBKA 4KKZA 4V0VA 5HPEA 1M63A 2WDDA 3ZTVA 1W24A 3ZU0A 1TCOA 4I5NC 4TUGA 2IE4C 1HO5A 1S70A 2Z06A 2WDFA 3IB8A 3H67A 4V0WA 1USHA 4Q7FA 1XM7A 2A22A 3THNA 3THOB 3DSCA 2HYPA 4MOVA 4O24A 3RL3A 4H2BA 4I5LC 5B8IA 2CV9A 1Z2XA 3N5UA 1S95A 4ORBA 2BQ8X 4V0XA 3FGAC 1NNWA 3ICFA 4M0VA 3H60A 3H61A 5JJTA 3RQZA 3H66A 5F3WA 1XZWA 1S3NA 1QHWA 2NXFA 3JYFA 4H2FA 5IOHA 5GTUA 4H1YP 4H2GA 1V73A 4IYPC 4O43A 2HYOA 3H69A 3E7BA 4MOYA 1S3LA 2ZBMA 2NYLC 1WAO1 3P71C 4LU9A 4OR9A 1Z2WA 2AHDA 3V4YA 1S3MA 2IAEC 3QFNA 1MF8A 4JA7A 1JK7A 4J6OA 3K7VC
chains in the Genus database with same CATH superfamily
4NZVA 2O8GA 2WDCA 5JPEA 2BDXA 1OIDA 3IB7A 1SU1A 4FBWA 4DT2A 4JA9A 4UT2A 2P6BA 2QFRA 1FJMA 2KKNA 3HVQA 3RL4A 3CK2A 4WWLA 2DXNA 3H64A 3H68A 1UF3A 1AUIA 4KBPA 3QFKA 4F0ZA 5JPFA 4ZX2A 3EGHA 2GJUA 1OI8A 2NYMC 4DSYA 2WDEA 5C1VA 3AUZA 4YKEA 4O4KA 4UT3A 3C5WC 3EGGA 3QFOA 4XPNA 3H63A 2R17A 3IVDA 4FBQA 1OIEA 4O5GA 2XMOA 3T1IA 1IT6A 5J28A 1T70A 3QFMA 4FCXA 2IE3C 3TGHA 4B2OA 3C9FA 4TUIA 3LL8A 2BCDA 3PSOA 1KBPA 2JOGA 1II7A 4G9JA 5INBA 2O8AA 4DHLA 2Q8UA 1QFCA 2YVTA 4ORCA 4UWQA 3DSDA 1WARA 3KBPA 3AV0A 4ORAA 2QJCA 2HY1A 3DW8C 5DNYA 4HD0A 2Z72A 2USHA 1G5BA 4IL1A 4UT3B 4H1SA 4H2IA 2YEQA 4MP0A 3RL5A 4ZVZA 2DFJA 3QG5C 1HP1A 3IVEA 3PSNA 3GVEA 4LTYA 3K7WC 1S8EA 2Z1AA 4LACC 3H62B 1UTEA 1HPUA 2NPPC 3E7AA 5EQVA 1U32A 2QFPA 1T71A 4FBKA 4KKZA 4V0VA 5HPEA 1M63A 2WDDA 3ZTVA 1W24A 3ZU0A 1TCOA 4I5NC 4TUGA 2IE4C 1HO5A 1S70A 2Z06A 2WDFA 3IB8A 2ZOAA 3H67A 1USHA 4Q7FA 4V0WA 1XM7A 2A22A 3THNA 3THOB 3DSCA 2HYPA 4MOVA 2DXLA 4O24A 3RL3A 4H2BA 2ZO9B 4I5LC 5B8IA 2CV9A 1Z2XA 3N5UA 1S95A 4ORBA 2BQ8X 4V0XA 3FGAC 1NNWA 3D03A 3ICFA 4M0VA 3H60A 3H61A 5JJTA 3RQZA 3H66A 5F3WA 1XZWA 1S3NA 1QHWA 2NXFA 3JYFA 4H2FA 5IOHA 5GTUA 4H1YP 4H2GA 1V73A 4IYPC 4O43A 2HYOA 3H69A 3E7BA 4MOYA 1S3LA 2ZBMA 2NYLC 1WAO1 3P71C 4LU9A 4OR9A 3FLOA 1Z2WA 2AHDA 3E0JA 1S3MA 3V4YA 2IAEC 3QFNA 1MF8A 4JA7A 1JK7A 4J6OA 3K7VC
chains in the Genus database with same CATH topology
4NZVA 2O8GA 2WDCA 5JPEA 2BDXA 1OIDA 3IB7A 1SU1A 4FBWA 4DT2A 4JA9A 4UT2A 2P6BA 2QFRA 1FJMA 2KKNA 3HVQA 3RL4A 3CK2A 4WWLA 2DXNA 3H64A 3H68A 1UF3A 1AUIA 4KBPA 3QFKA 4F0ZA 5JPFA 4ZX2A 3EGHA 2GJUA 1OI8A 2NYMC 4DSYA 2WDEA 5C1VA 3AUZA 4YKEA 4O4KA 4UT3A 3C5WC 3EGGA 3QFOA 4XPNA 3H63A 2R17A 3IVDA 4FBQA 1OIEA 4O5GA 2XMOA 3T1IA 1IT6A 5J28A 1T70A 3QFMA 4FCXA 2IE3C 3TGHA 4B2OA 3C9FA 4TUIA 3LL8A 2BCDA 3PSOA 1KBPA 2JOGA 1II7A 4G9JA 5INBA 2O8AA 4DHLA 2Q8UA 1QFCA 2YVTA 4ORCA 4UWQA 3DSDA 1WARA 3KBPA 3AV0A 4ORAA 2QJCA 2HY1A 3DW8C 5DNYA 4HD0A 2Z72A 2USHA 1G5BA 4IL1A 4UT3B 4H1SA 4H2IA 2YEQA 4MP0A 3RL5A 4ZVZA 2DFJA 3QG5C 1HP1A 3IVEA 3PSNA 3GVEA 4LTYA 3K7WC 1S8EA 2Z1AA 4LACC 3H62B 1UTEA 1HPUA 2NPPC 3E7AA 5EQVA 1U32A 2QFPA 1T71A 4FBKA 4KKZA 4V0VA 5HPEA 1M63A 2WDDA 3ZTVA 1W24A 3ZU0A 1TCOA 4I5NC 4TUGA 2IE4C 1HO5A 1S70A 2Z06A 2WDFA 3IB8A 2ZOAA 3H67A 1USHA 4Q7FA 4V0WA 1XM7A 2A22A 3THNA 3THOB 3DSCA 2HYPA 4MOVA 2DXLA 4O24A 3RL3A 4H2BA 2ZO9B 4I5LC 5B8IA 2CV9A 1Z2XA 3N5UA 1S95A 4ORBA 2BQ8X 4V0XA 3FGAC 1NNWA 3D03A 3ICFA 4M0VA 3H60A 3H61A 5JJTA 3RQZA 3H66A 5F3WA 1XZWA 1S3NA 1QHWA 2NXFA 3JYFA 4H2FA 5IOHA 5GTUA 4H1YP 4H2GA 1V73A 4IYPC 4O43A 2HYOA 3H69A 3E7BA 4MOYA 1S3LA 2ZBMA 2NYLC 1WAO1 3P71C 4LU9A 4OR9A 3FLOA 1Z2WA 2AHDA 3E0JA 1S3MA 3V4YA 2IAEC 3QFNA 1MF8A 4JA7A 1JK7A 4J6OA 3K7VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NZV A;  2O8G A;  2WDC A;  5JPE A;  2BDX A;  1OID A;  3IB7 A;  1SU1 A;  4FBW A;  4DT2 A;  4JA9 A;  4UT2 A;  2P6B A;  2QFR A;  1FJM A;  2KKN A;  3HVQ A;  3RL4 A;  3CK2 A;  4WWL A;  3H64 A;  3H68 A;  1UF3 A;  1AUI A;  4KBP A;  3QFK A;  4F0Z A;  5JPF A;  4ZX2 A;  3EGH A;  2GJU A;  1OI8 A;  2NYM C;  4DSY A;  2WDE A;  5C1V A;  3AUZ A;  4YKE A;  4O4K A;  4UT3 A;  3C5W C;  3EGG A;  3QFO A;  4XPN A;  3H63 A;  2R17 A;  3IVD A;  4FBQ A;  1OIE A;  4O5G A;  2XMO A;  3T1I A;  1IT6 A;  5J28 A;  1T70 A;  3QFM A;  4FCX A;  2IE3 C;  3TGH A;  4B2O A;  3C9F A;  4TUI A;  3LL8 A;  2BCD A;  3PSO A;  1KBP A;  2JOG A;  1II7 A;  4G9J A;  5INB A;  2O8A A;  4DHL A;  2Q8U A;  1QFC A;  2YVT A;  4ORC A;  4UWQ A;  3DSD A;  1WAR A;  3KBP A;  3AV0 A;  4ORA A;  2QJC A;  2HY1 A;  3DW8 C;  5DNY A;  4HD0 A;  2Z72 A;  2USH A;  1G5B A;  4IL1 A;  4UT3 B;  4H1S A;  4H2I A;  4MP0 A;  3RL5 A;  4ZVZ A;  2DFJ A;  3QG5 C;  1HP1 A;  3IVE A;  3PSN A;  3GVE A;  4LTY A;  3K7W C;  1S8E A;  2Z1A A;  4LAC C;  3H62 B;  1UTE A;  1HPU A;  2NPP C;  3E7A A;  5EQV A;  1U32 A;  2QFP A;  1T71 A;  4FBK A;  4KKZ A;  4V0V A;  5HPE A;  1M63 A;  2WDD A;  3ZTV A;  1W24 A;  3ZU0 A;  1TCO A;  4I5N C;  4TUG A;  2IE4 C;  1HO5 A;  1S70 A;  2Z06 A;  2WDF A;  3IB8 A;  3H67 A;  4V0W A;  1USH A;  4Q7F A;  1XM7 A;  2A22 A;  3THN A;  3THO B;  3DSC A;  2HYP A;  4MOV A;  4O24 A;  3RL3 A;  4H2B A;  4I5L C;  5B8I A;  2CV9 A;  1Z2X A;  3N5U A;  1S95 A;  4ORB A;  2BQ8 X;  4V0X A;  3FGA C;  1NNW A;  3ICF A;  4M0V A;  3H60 A;  3H61 A;  5JJT A;  3RQZ A;  3H66 A;  5F3W A;  1XZW A;  1S3N A;  1QHW A;  2NXF A;  3JYF A;  4H2F A;  5IOH A;  5GTU A;  4H1Y P;  4H2G A;  1V73 A;  4IYP C;  4O43 A;  2HYO A;  3H69 A;  3E7B A;  4MOY A;  1S3L A;  2ZBM A;  2NYL C;  1WAO 1;  3P71 C;  4LU9 A;  4OR9 A;  1Z2W A;  2AHD A;  3V4Y A;  1S3M A;  2IAE C;  3QFN A;  1MF8 A;  4JA7 A;  1JK7 A;  4J6O A;  3K7V C; 
#chains in the Genus database with same CATH topology
 4NZV A;  2O8G A;  2WDC A;  5JPE A;  2BDX A;  1OID A;  3IB7 A;  1SU1 A;  4FBW A;  4DT2 A;  4JA9 A;  4UT2 A;  2P6B A;  2QFR A;  1FJM A;  2KKN A;  3HVQ A;  3RL4 A;  3CK2 A;  4WWL A;  2DXN A;  3H64 A;  3H68 A;  1UF3 A;  1AUI A;  4KBP A;  3QFK A;  4F0Z A;  5JPF A;  4ZX2 A;  3EGH A;  2GJU A;  1OI8 A;  2NYM C;  4DSY A;  2WDE A;  5C1V A;  3AUZ A;  4YKE A;  4O4K A;  4UT3 A;  3C5W C;  3EGG A;  3QFO A;  4XPN A;  3H63 A;  2R17 A;  3IVD A;  4FBQ A;  1OIE A;  4O5G A;  2XMO A;  3T1I A;  1IT6 A;  5J28 A;  1T70 A;  3QFM A;  4FCX A;  2IE3 C;  3TGH A;  4B2O A;  3C9F A;  4TUI A;  3LL8 A;  2BCD A;  3PSO A;  1KBP A;  2JOG A;  1II7 A;  4G9J A;  5INB A;  2O8A A;  4DHL A;  2Q8U A;  1QFC A;  2YVT A;  4ORC A;  4UWQ A;  3DSD A;  1WAR A;  3KBP A;  3AV0 A;  4ORA A;  2QJC A;  2HY1 A;  3DW8 C;  5DNY A;  4HD0 A;  2Z72 A;  2USH A;  1G5B A;  4IL1 A;  4UT3 B;  4H1S A;  4H2I A;  2YEQ A;  4MP0 A;  3RL5 A;  4ZVZ A;  2DFJ A;  3QG5 C;  1HP1 A;  3IVE A;  3PSN A;  3GVE A;  4LTY A;  3K7W C;  1S8E A;  2Z1A A;  4LAC C;  3H62 B;  1UTE A;  1HPU A;  2NPP C;  3E7A A;  5EQV A;  1U32 A;  2QFP A;  1T71 A;  4FBK A;  4KKZ A;  4V0V A;  5HPE A;  1M63 A;  2WDD A;  3ZTV A;  1W24 A;  3ZU0 A;  1TCO A;  4I5N C;  4TUG A;  2IE4 C;  1HO5 A;  1S70 A;  2Z06 A;  2WDF A;  3IB8 A;  2ZOA A;  3H67 A;  1USH A;  4Q7F A;  4V0W A;  1XM7 A;  2A22 A;  3THN A;  3THO B;  3DSC A;  2HYP A;  4MOV A;  2DXL A;  4O24 A;  3RL3 A;  4H2B A;  2ZO9 B;  4I5L C;  5B8I A;  2CV9 A;  1Z2X A;  3N5U A;  1S95 A;  4ORB A;  2BQ8 X;  4V0X A;  3FGA C;  1NNW A;  3D03 A;  3ICF A;  4M0V A;  3H60 A;  3H61 A;  5JJT A;  3RQZ A;  3H66 A;  5F3W A;  1XZW A;  1S3N A;  1QHW A;  2NXF A;  3JYF A;  4H2F A;  5IOH A;  5GTU A;  4H1Y P;  4H2G A;  1V73 A;  4IYP C;  4O43 A;  2HYO A;  3H69 A;  3E7B A;  4MOY A;  1S3L A;  2ZBM A;  2NYL C;  1WAO 1;  3P71 C;  4LU9 A;  4OR9 A;  3FLO A;  1Z2W A;  2AHD A;  3E0J A;  1S3M A;  3V4Y A;  2IAE C;  3QFN A;  1MF8 A;  4JA7 A;  1JK7 A;  4J6O A;  3K7V C; 
#chains in the Genus database with same CATH homology
 4NZV A;  2O8G A;  2WDC A;  5JPE A;  2BDX A;  1OID A;  3IB7 A;  1SU1 A;  4FBW A;  4DT2 A;  4JA9 A;  4UT2 A;  2P6B A;  2QFR A;  1FJM A;  2KKN A;  3HVQ A;  3RL4 A;  3CK2 A;  4WWL A;  2DXN A;  3H64 A;  3H68 A;  1UF3 A;  1AUI A;  4KBP A;  3QFK A;  4F0Z A;  5JPF A;  4ZX2 A;  3EGH A;  2GJU A;  1OI8 A;  2NYM C;  4DSY A;  2WDE A;  5C1V A;  3AUZ A;  4YKE A;  4O4K A;  4UT3 A;  3C5W C;  3EGG A;  3QFO A;  4XPN A;  3H63 A;  2R17 A;  3IVD A;  4FBQ A;  1OIE A;  4O5G A;  2XMO A;  3T1I A;  1IT6 A;  5J28 A;  1T70 A;  3QFM A;  4FCX A;  2IE3 C;  3TGH A;  4B2O A;  3C9F A;  4TUI A;  3LL8 A;  2BCD A;  3PSO A;  1KBP A;  2JOG A;  1II7 A;  4G9J A;  5INB A;  2O8A A;  4DHL A;  2Q8U A;  1QFC A;  2YVT A;  4ORC A;  4UWQ A;  3DSD A;  1WAR A;  3KBP A;  3AV0 A;  4ORA A;  2QJC A;  2HY1 A;  3DW8 C;  5DNY A;  4HD0 A;  2Z72 A;  2USH A;  1G5B A;  4IL1 A;  4UT3 B;  4H1S A;  4H2I A;  2YEQ A;  4MP0 A;  3RL5 A;  4ZVZ A;  2DFJ A;  3QG5 C;  1HP1 A;  3IVE A;  3PSN A;  3GVE A;  4LTY A;  3K7W C;  1S8E A;  2Z1A A;  4LAC C;  3H62 B;  1UTE A;  1HPU A;  2NPP C;  3E7A A;  5EQV A;  1U32 A;  2QFP A;  1T71 A;  4FBK A;  4KKZ A;  4V0V A;  5HPE A;  1M63 A;  2WDD A;  3ZTV A;  1W24 A;  3ZU0 A;  1TCO A;  4I5N C;  4TUG A;  2IE4 C;  1HO5 A;  1S70 A;  2Z06 A;  2WDF A;  3IB8 A;  2ZOA A;  3H67 A;  1USH A;  4Q7F A;  4V0W A;  1XM7 A;  2A22 A;  3THN A;  3THO B;  3DSC A;  2HYP A;  4MOV A;  2DXL A;  4O24 A;  3RL3 A;  4H2B A;  2ZO9 B;  4I5L C;  5B8I A;  2CV9 A;  1Z2X A;  3N5U A;  1S95 A;  4ORB A;  2BQ8 X;  4V0X A;  3FGA C;  1NNW A;  3D03 A;  3ICF A;  4M0V A;  3H60 A;  3H61 A;  5JJT A;  3RQZ A;  3H66 A;  5F3W A;  1XZW A;  1S3N A;  1QHW A;  2NXF A;  3JYF A;  4H2F A;  5IOH A;  5GTU A;  4H1Y P;  4H2G A;  1V73 A;  4IYP C;  4O43 A;  2HYO A;  3H69 A;  3E7B A;  4MOY A;  1S3L A;  2ZBM A;  2NYL C;  1WAO 1;  3P71 C;  4LU9 A;  4OR9 A;  3FLO A;  1Z2W A;  2AHD A;  3E0J A;  1S3M A;  3V4Y A;  2IAE C;  3QFN A;  1MF8 A;  4JA7 A;  1JK7 A;  4J6O A;  3K7V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...