2NPPC

Structure of the protein phosphatase 2a holoenzyme
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
308
structure length
308
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
publication title Structure of the protein phosphatase 2A holoenzyme
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 102
structure length 308
sequence length 308
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2nppC00
1II7A 4WWLA 3H69A 1XZWA 3KBPA 1WARA 4J6OA 3IVEA 5C1VA 4G9JA 4F0ZA 5B8IA 1S3MA 2WDFA 4TUIA 2JOGA 4FBWA 4LACC 3E7AA 3PSOA 3HVQA 1HPUA 1AUIA 2BCDA 3N5UA 1U32A 3AV0A 1KBPA 5J28A 2NXFA 5JPEA 1WAO1 3DSDA 4ZX2A 4H2GA 4LU9A 1S8EA 2Z1AA 1T70A 4TUGA 3RL5A 2WDEA 2USHA 4O4KA 4V0WA 4NZVA 3THOB 3AUZA 1MF8A 2AHDA 4V0XA 1G5BA 1V73A 4FCXA 3QFNA 2P6BA 3H63A 2IAEC 4DT2A 4LTYA 5EQVA 4Q7FA 4H1SA 1USHA 3T1IA 2QFRA 1OIDA 4KKZA 5DNYA 3H60A 3CK2A 3P71C 1IT6A 4HD0A 3H61A 3H68A 5IOHA 2WDDA 4MP0A 4XPNA 1NNWA 4H2BA 1JK7A 3EGHA 1TCOA 4O43A 4UT3B 3TGHA 4UWQA 1Z2XA 4YKEA 2KKNA 4JA9A 1OI8A 3EGGA 2Z06A 4DHLA 2NYMC 3K7WC 4KBPA 2WDCA 1S95A 5HPEA 1UTEA 1W24A 2CV9A 3DSCA 3IVDA 3QFMA 3IB7A 4M0VA 2BDXA 3ICFA 3V4YA 1M63A 3C9FA 2XMOA 3GVEA 1OIEA 1HO5A 2YVTA 2QFPA 2Z72A 2Q8UA 3RL3A 4FBQA 4ORCA 1QHWA 4V0VA 3RQZA 3RL4A 5F3WA 1T71A 2GJUA 3H67A 4MOYA 4I5LC 5JPFA 4ZVZA 3C5WC 3QFKA 1XM7A 2NYLC 5GTUA 4JA7A 3H66A 4H2FA 2QJCA 1S3NA 1SU1A 4O24A 2O8GA 1Z2WA 1FJMA 3THNA 4UT2A 2O8AA 3FGAC 3LL8A 4MOVA 5INBA 4UT3A 4ORAA 3JYFA 4OR9A 2R17A 1S70A 4O5GA 4FBKA 3DW8C 4H1YP 1HP1A 4DSYA 2ZBMA 4IL1A 2BQ8X 3QG5C 3ZU0A 4B2OA 2HYPA 3H64A 3E7BA 2HYOA 3K7VC 4ORBA 1QFCA 3ZTVA 2DFJA 4H2IA 2IE4C 1UF3A 2HY1A 2IE3C 3QFOA 4IYPC 2NPPC 3PSNA 3IB8A 3H62B 2A22A 1S3LA 4I5NC 5JJTA
chains in the Genus database with same CATH superfamily
1II7A 4WWLA 3H69A 1XZWA 3KBPA 1WARA 4J6OA 3IVEA 5C1VA 4G9JA 4F0ZA 5B8IA 1S3MA 2WDFA 4TUIA 2JOGA 4FBWA 4LACC 3E7AA 2YEQA 3PSOA 3HVQA 1HPUA 1AUIA 2BCDA 3N5UA 1U32A 3AV0A 1KBPA 5J28A 2NXFA 5JPEA 1WAO1 3DSDA 4ZX2A 4H2GA 4LU9A 1S8EA 2Z1AA 1T70A 4TUGA 3RL5A 2WDEA 2USHA 4O4KA 4V0WA 4NZVA 2DXLA 3THOB 3AUZA 1MF8A 2AHDA 4V0XA 1G5BA 1V73A 4FCXA 3QFNA 3FLOA 2P6BA 3H63A 2IAEC 3E0JA 4DT2A 4LTYA 5EQVA 4Q7FA 4H1SA 1USHA 3T1IA 2QFRA 1OIDA 4KKZA 5DNYA 3H60A 3CK2A 3P71C 1IT6A 4HD0A 3H61A 3H68A 5IOHA 2WDDA 4MP0A 4XPNA 1NNWA 4H2BA 1JK7A 3EGHA 1TCOA 4O43A 4UT3B 3TGHA 4UWQA 1Z2XA 4YKEA 2KKNA 4JA9A 1OI8A 3EGGA 2Z06A 4DHLA 2NYMC 3K7WC 4KBPA 2WDCA 1S95A 5HPEA 1UTEA 1W24A 2CV9A 3DSCA 3IVDA 3QFMA 3IB7A 4M0VA 2BDXA 3ICFA 2ZOAA 1M63A 3C9FA 2XMOA 3V4YA 3GVEA 1OIEA 1HO5A 2YVTA 2QFPA 2Z72A 2Q8UA 2ZO9B 4FBQA 4ORCA 1QHWA 4V0VA 3RL3A 3RQZA 3RL4A 5F3WA 1T71A 2GJUA 3H67A 4MOYA 4I5LC 3D03A 5JPFA 4ZVZA 3C5WC 3QFKA 1XM7A 2NYLC 5GTUA 4JA7A 3H66A 4H2FA 2QJCA 1S3NA 1SU1A 4O24A 2O8GA 1Z2WA 1FJMA 3THNA 4UT2A 2O8AA 3FGAC 3LL8A 4MOVA 5INBA 4UT3A 4ORAA 3JYFA 4OR9A 2R17A 1S70A 4O5GA 4FBKA 3DW8C 4H1YP 1HP1A 4DSYA 2ZBMA 4IL1A 2BQ8X 3QG5C 3ZU0A 4B2OA 2HYPA 3H64A 3E7BA 2HYOA 3K7VC 4ORBA 1QFCA 3ZTVA 2DFJA 4H2IA 2IE4C 1UF3A 2HY1A 2IE3C 3QFOA 4IYPC 2NPPC 2DXNA 3PSNA 3IB8A 3H62B 2A22A 1S3LA 4I5NC 5JJTA
chains in the Genus database with same CATH topology
1II7A 4WWLA 3H69A 1XZWA 3KBPA 1WARA 4J6OA 3IVEA 5C1VA 4G9JA 4F0ZA 5B8IA 1S3MA 2WDFA 4TUIA 2JOGA 4FBWA 4LACC 3E7AA 2YEQA 3PSOA 3HVQA 1HPUA 1AUIA 2BCDA 3N5UA 1U32A 3AV0A 1KBPA 5J28A 2NXFA 5JPEA 1WAO1 3DSDA 4ZX2A 4H2GA 4LU9A 1S8EA 2Z1AA 1T70A 4TUGA 3RL5A 2WDEA 2USHA 4O4KA 4V0WA 4NZVA 2DXLA 3THOB 3AUZA 1MF8A 2AHDA 4V0XA 1G5BA 1V73A 4FCXA 3QFNA 3FLOA 2P6BA 3H63A 2IAEC 3E0JA 4DT2A 4LTYA 5EQVA 4Q7FA 4H1SA 1USHA 3T1IA 2QFRA 1OIDA 4KKZA 5DNYA 3H60A 3CK2A 3P71C 1IT6A 4HD0A 3H61A 3H68A 5IOHA 2WDDA 4MP0A 4XPNA 1NNWA 4H2BA 1JK7A 3EGHA 1TCOA 4O43A 4UT3B 3TGHA 4UWQA 1Z2XA 4YKEA 2KKNA 4JA9A 1OI8A 3EGGA 2Z06A 4DHLA 2NYMC 3K7WC 4KBPA 2WDCA 1S95A 5HPEA 1UTEA 1W24A 2CV9A 3DSCA 3IVDA 3QFMA 3IB7A 4M0VA 2BDXA 3ICFA 2ZOAA 1M63A 3C9FA 2XMOA 3V4YA 3GVEA 1OIEA 1HO5A 2YVTA 2QFPA 2Z72A 2Q8UA 2ZO9B 4FBQA 4ORCA 1QHWA 4V0VA 3RL3A 3RQZA 3RL4A 5F3WA 1T71A 2GJUA 3H67A 4MOYA 4I5LC 3D03A 5JPFA 4ZVZA 3C5WC 3QFKA 1XM7A 2NYLC 5GTUA 4JA7A 3H66A 4H2FA 2QJCA 1S3NA 1SU1A 4O24A 2O8GA 1Z2WA 1FJMA 3THNA 4UT2A 2O8AA 3FGAC 3LL8A 4MOVA 5INBA 4UT3A 4ORAA 3JYFA 4OR9A 2R17A 1S70A 4O5GA 4FBKA 3DW8C 4H1YP 1HP1A 4DSYA 2ZBMA 4IL1A 2BQ8X 3QG5C 3ZU0A 4B2OA 2HYPA 3H64A 3E7BA 2HYOA 3K7VC 4ORBA 1QFCA 3ZTVA 2DFJA 4H2IA 2IE4C 1UF3A 2HY1A 2IE3C 3QFOA 4IYPC 2NPPC 2DXNA 3PSNA 3IB8A 3H62B 2A22A 1S3LA 4I5NC 5JJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1II7 A;  4WWL A;  3H69 A;  1XZW A;  3KBP A;  1WAR A;  4J6O A;  3IVE A;  5C1V A;  4G9J A;  4F0Z A;  5B8I A;  1S3M A;  2WDF A;  4TUI A;  2JOG A;  4FBW A;  4LAC C;  3E7A A;  3PSO A;  3HVQ A;  1HPU A;  1AUI A;  2BCD A;  3N5U A;  1U32 A;  3AV0 A;  1KBP A;  5J28 A;  2NXF A;  5JPE A;  1WAO 1;  3DSD A;  4ZX2 A;  4H2G A;  4LU9 A;  1S8E A;  2Z1A A;  1T70 A;  4TUG A;  3RL5 A;  2WDE A;  2USH A;  4O4K A;  4V0W A;  4NZV A;  3THO B;  3AUZ A;  1MF8 A;  2AHD A;  4V0X A;  1G5B A;  1V73 A;  4FCX A;  3QFN A;  2P6B A;  3H63 A;  2IAE C;  4DT2 A;  4LTY A;  5EQV A;  4Q7F A;  4H1S A;  1USH A;  3T1I A;  2QFR A;  1OID A;  4KKZ A;  5DNY A;  3H60 A;  3CK2 A;  3P71 C;  1IT6 A;  4HD0 A;  3H61 A;  3H68 A;  5IOH A;  2WDD A;  4MP0 A;  4XPN A;  1NNW A;  4H2B A;  1JK7 A;  3EGH A;  1TCO A;  4O43 A;  4UT3 B;  3TGH A;  4UWQ A;  1Z2X A;  4YKE A;  2KKN A;  4JA9 A;  1OI8 A;  3EGG A;  2Z06 A;  4DHL A;  2NYM C;  3K7W C;  4KBP A;  2WDC A;  1S95 A;  5HPE A;  1UTE A;  1W24 A;  2CV9 A;  3DSC A;  3IVD A;  3QFM A;  3IB7 A;  4M0V A;  2BDX A;  3ICF A;  3V4Y A;  1M63 A;  3C9F A;  2XMO A;  3GVE A;  1OIE A;  1HO5 A;  2YVT A;  2QFP A;  2Z72 A;  2Q8U A;  3RL3 A;  4FBQ A;  4ORC A;  1QHW A;  4V0V A;  3RQZ A;  3RL4 A;  5F3W A;  1T71 A;  2GJU A;  3H67 A;  4MOY A;  4I5L C;  5JPF A;  4ZVZ A;  3C5W C;  3QFK A;  1XM7 A;  2NYL C;  5GTU A;  4JA7 A;  3H66 A;  4H2F A;  2QJC A;  1S3N A;  1SU1 A;  4O24 A;  2O8G A;  1Z2W A;  1FJM A;  3THN A;  4UT2 A;  2O8A A;  3FGA C;  3LL8 A;  4MOV A;  5INB A;  4UT3 A;  4ORA A;  3JYF A;  4OR9 A;  2R17 A;  1S70 A;  4O5G A;  4FBK A;  3DW8 C;  4H1Y P;  1HP1 A;  4DSY A;  2ZBM A;  4IL1 A;  2BQ8 X;  3QG5 C;  3ZU0 A;  4B2O A;  2HYP A;  3H64 A;  3E7B A;  2HYO A;  3K7V C;  4ORB A;  1QFC A;  3ZTV A;  2DFJ A;  4H2I A;  2IE4 C;  1UF3 A;  2HY1 A;  2IE3 C;  3QFO A;  4IYP C;  2NPP C;  3PSN A;  3IB8 A;  3H62 B;  2A22 A;  1S3L A;  4I5N C;  5JJT A; 
#chains in the Genus database with same CATH topology
 1II7 A;  4WWL A;  3H69 A;  1XZW A;  3KBP A;  1WAR A;  4J6O A;  3IVE A;  5C1V A;  4G9J A;  4F0Z A;  5B8I A;  1S3M A;  2WDF A;  4TUI A;  2JOG A;  4FBW A;  4LAC C;  3E7A A;  2YEQ A;  3PSO A;  3HVQ A;  1HPU A;  1AUI A;  2BCD A;  3N5U A;  1U32 A;  3AV0 A;  1KBP A;  5J28 A;  2NXF A;  5JPE A;  1WAO 1;  3DSD A;  4ZX2 A;  4H2G A;  4LU9 A;  1S8E A;  2Z1A A;  1T70 A;  4TUG A;  3RL5 A;  2WDE A;  2USH A;  4O4K A;  4V0W A;  4NZV A;  2DXL A;  3THO B;  3AUZ A;  1MF8 A;  2AHD A;  4V0X A;  1G5B A;  1V73 A;  4FCX A;  3QFN A;  3FLO A;  2P6B A;  3H63 A;  2IAE C;  3E0J A;  4DT2 A;  4LTY A;  5EQV A;  4Q7F A;  4H1S A;  1USH A;  3T1I A;  2QFR A;  1OID A;  4KKZ A;  5DNY A;  3H60 A;  3CK2 A;  3P71 C;  1IT6 A;  4HD0 A;  3H61 A;  3H68 A;  5IOH A;  2WDD A;  4MP0 A;  4XPN A;  1NNW A;  4H2B A;  1JK7 A;  3EGH A;  1TCO A;  4O43 A;  4UT3 B;  3TGH A;  4UWQ A;  1Z2X A;  4YKE A;  2KKN A;  4JA9 A;  1OI8 A;  3EGG A;  2Z06 A;  4DHL A;  2NYM C;  3K7W C;  4KBP A;  2WDC A;  1S95 A;  5HPE A;  1UTE A;  1W24 A;  2CV9 A;  3DSC A;  3IVD A;  3QFM A;  3IB7 A;  4M0V A;  2BDX A;  3ICF A;  2ZOA A;  1M63 A;  3C9F A;  2XMO A;  3V4Y A;  3GVE A;  1OIE A;  1HO5 A;  2YVT A;  2QFP A;  2Z72 A;  2Q8U A;  2ZO9 B;  4FBQ A;  4ORC A;  1QHW A;  4V0V A;  3RL3 A;  3RQZ A;  3RL4 A;  5F3W A;  1T71 A;  2GJU A;  3H67 A;  4MOY A;  4I5L C;  3D03 A;  5JPF A;  4ZVZ A;  3C5W C;  3QFK A;  1XM7 A;  2NYL C;  5GTU A;  4JA7 A;  3H66 A;  4H2F A;  2QJC A;  1S3N A;  1SU1 A;  4O24 A;  2O8G A;  1Z2W A;  1FJM A;  3THN A;  4UT2 A;  2O8A A;  3FGA C;  3LL8 A;  4MOV A;  5INB A;  4UT3 A;  4ORA A;  3JYF A;  4OR9 A;  2R17 A;  1S70 A;  4O5G A;  4FBK A;  3DW8 C;  4H1Y P;  1HP1 A;  4DSY A;  2ZBM A;  4IL1 A;  2BQ8 X;  3QG5 C;  3ZU0 A;  4B2O A;  2HYP A;  3H64 A;  3E7B A;  2HYO A;  3K7V C;  4ORB A;  1QFC A;  3ZTV A;  2DFJ A;  4H2I A;  2IE4 C;  1UF3 A;  2HY1 A;  2IE3 C;  3QFO A;  4IYP C;  2NPP C;  2DXN A;  3PSN A;  3IB8 A;  3H62 B;  2A22 A;  1S3L A;  4I5N C;  5JJT A; 
#chains in the Genus database with same CATH homology
 1II7 A;  4WWL A;  3H69 A;  1XZW A;  3KBP A;  1WAR A;  4J6O A;  3IVE A;  5C1V A;  4G9J A;  4F0Z A;  5B8I A;  1S3M A;  2WDF A;  4TUI A;  2JOG A;  4FBW A;  4LAC C;  3E7A A;  2YEQ A;  3PSO A;  3HVQ A;  1HPU A;  1AUI A;  2BCD A;  3N5U A;  1U32 A;  3AV0 A;  1KBP A;  5J28 A;  2NXF A;  5JPE A;  1WAO 1;  3DSD A;  4ZX2 A;  4H2G A;  4LU9 A;  1S8E A;  2Z1A A;  1T70 A;  4TUG A;  3RL5 A;  2WDE A;  2USH A;  4O4K A;  4V0W A;  4NZV A;  2DXL A;  3THO B;  3AUZ A;  1MF8 A;  2AHD A;  4V0X A;  1G5B A;  1V73 A;  4FCX A;  3QFN A;  3FLO A;  2P6B A;  3H63 A;  2IAE C;  3E0J A;  4DT2 A;  4LTY A;  5EQV A;  4Q7F A;  4H1S A;  1USH A;  3T1I A;  2QFR A;  1OID A;  4KKZ A;  5DNY A;  3H60 A;  3CK2 A;  3P71 C;  1IT6 A;  4HD0 A;  3H61 A;  3H68 A;  5IOH A;  2WDD A;  4MP0 A;  4XPN A;  1NNW A;  4H2B A;  1JK7 A;  3EGH A;  1TCO A;  4O43 A;  4UT3 B;  3TGH A;  4UWQ A;  1Z2X A;  4YKE A;  2KKN A;  4JA9 A;  1OI8 A;  3EGG A;  2Z06 A;  4DHL A;  2NYM C;  3K7W C;  4KBP A;  2WDC A;  1S95 A;  5HPE A;  1UTE A;  1W24 A;  2CV9 A;  3DSC A;  3IVD A;  3QFM A;  3IB7 A;  4M0V A;  2BDX A;  3ICF A;  2ZOA A;  1M63 A;  3C9F A;  2XMO A;  3V4Y A;  3GVE A;  1OIE A;  1HO5 A;  2YVT A;  2QFP A;  2Z72 A;  2Q8U A;  2ZO9 B;  4FBQ A;  4ORC A;  1QHW A;  4V0V A;  3RL3 A;  3RQZ A;  3RL4 A;  5F3W A;  1T71 A;  2GJU A;  3H67 A;  4MOY A;  4I5L C;  3D03 A;  5JPF A;  4ZVZ A;  3C5W C;  3QFK A;  1XM7 A;  2NYL C;  5GTU A;  4JA7 A;  3H66 A;  4H2F A;  2QJC A;  1S3N A;  1SU1 A;  4O24 A;  2O8G A;  1Z2W A;  1FJM A;  3THN A;  4UT2 A;  2O8A A;  3FGA C;  3LL8 A;  4MOV A;  5INB A;  4UT3 A;  4ORA A;  3JYF A;  4OR9 A;  2R17 A;  1S70 A;  4O5G A;  4FBK A;  3DW8 C;  4H1Y P;  1HP1 A;  4DSY A;  2ZBM A;  4IL1 A;  2BQ8 X;  3QG5 C;  3ZU0 A;  4B2O A;  2HYP A;  3H64 A;  3E7B A;  2HYO A;  3K7V C;  4ORB A;  1QFC A;  3ZTV A;  2DFJ A;  4H2I A;  2IE4 C;  1UF3 A;  2HY1 A;  2IE3 C;  3QFO A;  4IYP C;  2NPP C;  2DXN A;  3PSN A;  3IB8 A;  3H62 B;  2A22 A;  1S3L A;  4I5N C;  5JJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...