2NPSD

Crystal structure of the early endosomal snare complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
63
structure length
63
Chain Sequence
DEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Vesicle-associated membrane protein 4
total genus 27
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsD00
2YMYA 3HTKB 4OH8B 1HVVA 4WY4C 4W80A 1N7SB 2M8RA 1SFCA 2HFED 1URQA 3RL0B 1N7SA 1GL2D 3B5NA 5CCGA 4JF7A 1NHLA 1N7SD 3RL0D 5CCHD 3PP5A 2N1TD 1L4AB 1L4AC 2WZ7A 3KYQA 1KILC 3RL0C 2N1TC 5CCHC 2PP6A 5KJ7C 1GL2C 3TSIA 3RK2D 1JTHA 3HD7A 2H8PD 4WY4D 1URQD 2KOGA 4WY4B 1L4AD 3M0DC 1L4AA 2NPSD 3VOPA 4N78E 4W7YA 1XTGB 1URQB 5CCHA 1GL2B 3B5NB 1SFCB 5KJ7A 1GL2A 2HG5D 3RK2C 2NPSC 5KJ7D 1SFCD 2XDJA 3HD7C 2N1TB 4WY4A 1KILB 1T3JA 1SFCC 2NPSB 3HD7D 3RK2B 1URQC 1N7SC 3RK3D 1JTHB 3P8CE 3B5NC 5CCGC 3HD7B 3B5ND 5CCGD 3RK3C 1KILA 4W7ZA 2NPSA 2N1TA 4LGDE 3RK3B 1KILD
chains in the Genus database with same CATH superfamily
3C9IA 1T2KC 2YMYA 3HTKB 1RF1C 3A0HH 2LXBA 1CI6B 2FFDB 1K04A 2KLVA 3IF4A 3L73E 1SQBG 3CCMP 2ZVOB 3A7OA 1LP1A 5AVSB 3CD6P 1LWUC 1CW5A 5H2FH 2HFED 4JPZB 3FXEA 4AYCA 2KZJA 1NTMD 4C7NA 5AVRB 4DT0A 1BGYJ 3H1IJ 2XU6A 1FZCC 3B5NA 5AVVB 1R5SA 1BE3D 3D6ZA 1DX7A 3N4XA 3H25A 2ZT9B 1NHLA 1NYHA 4ZMDA 2FYUD 3OAKA 4RJTA 1EDKA 1YI2P 4Y99B 1NTMJ 3RL0D 3SWYA 3H1KG 4PD4I 3H1ID 2XZRA 2WSEH 2WTYA 3EWKA 1LTSC 1SS1A 1IO4A 1DEBA 3F89A 2HODA 2WZ7A 3P8MC 4H44D 3BCCG 2FYUJ 3B8EB 3HE5B 1HTLC 3KYQA 3PTZA 1T8ZA 4GKGA 1KYOD 5KAFE 3TNUA 2LKMA 1BGYE 1J1DB 4JYBA 1MV8A 1NTZG 2HPCA 2B88A 2WSCJ 3L36A 4GT1A 4BWNA 1RQUA 3CI9A 2KLUA 1GL2C 1JUNA 4IFMA 1DD3A 1KB9H 1SP4A 1LTJA 1M1JB 2QJPC 3EQ2A 1QVGO 2QM8A 1HWTC 3BCCE 1P84E 3H1HJ 3HD7A 1LJ2A 1ZXGA 2KXPB 2POHA 5AVYB 2JR8A 2XNDH 1N2DC 2R3CA 1SQXD 3L74D 3CWBG 5BVZA 3VMZA 3AE4C 1NTKJ 4D6TG 1EXJA 2HPCB 2AEMA 3EFFK 1LT9B 2IZ0A 2R5BA 3AEGC 5AW1B 3S4RA 1DIPA 3Q3DA 1QGKB 1OWAA 4PJ0H 5L8RJ 1XTCC 1IJDB 4RKUJ 4BRYA 5B66H 1Y8AA 5E79H 3H1JE 2ZYGA 1N8RQ 4WY4B 3HE5A 2IBZG 2YMKA 4XE5B 4C46A 3BRTB 3C1LA 2C0XA 1YYCA 3CCEP 1GD2E 2W90A 2OYIB 1Y47A 3A5TA 1PP9J 2E5TA 1NAFA 3R4YA 2H7HA 1YITP 1SQBE 1U7JA 3L72G 2E43A 4N6JA 2YKQA 3JCUH 1GDTA 2Y0EA 4C7NB 3MHVA 3H1KJ 2PGDA 1NTKE 1SFCB 3EFGA 4L75A 1KYOI 3AEAC 3RBXA 3SFDC 3A3YB 1ZLLA 3AE8C 4L73A 2QEXP 2E76B 2HG5D 3Q5SA 3ABVC 1EDLA 2LR2A 3BCCJ 3H1HE 4WVZA 1L0LK 4GOEA 2OYIA 2E74B 4EIJA 3L74G 1JEKA 3IAOA 1IFPA 4IL6X 2W6JH 1S5LH 5KAIE 4KT0J 4H44B 3H1LD 1U57A 5AW8B 5KLVE 2HR3A 2FFDC 3L70G 1SQVK 4Y99C 1KILE 1RE4A 1H0TA 3L75G 2OGUA 4PD4E 5KKZB 4WY4A 1BSHA 1T3JA 5CHXA 2O1KA 2IBZD 1T6AA 4ASVA 1SFCC 2Q1KA 2NPSB 5GTHE 3G9RA 2WSCH 2E76C 1KN7A 3AE1C 1D7MA 3H1KE 1LWUB 3RK3D 1BCCG 2IFMA 1YJNP 1N73C 2RKLA 1L0NK 1LNQA 2Y0CA 1EXIA 1HH0A 2V7QH 3MIWA 2B89A 4I7ZC 3V6IA 5GTIH 1GW4A 1S3JA 2ZJSE 1CZQA 3H1IE 1M1KQ 1P84I 1KD1Q 1X8YA 2WMMA 3CWBD 5AVWB 1KB9I 1KILA 3TGUJ 3H1LG 1PP9G 3L35A 2O3JA 4GODA 3VTPC 3L70D 4PD4D 5BU8B 1H0TB 3IR9A 1SQVG 4U3FG 1KILD 1WRGA 2ZAEB 3L73J 3RK3B 3G6EP 4OWFA 3CX5H 1KQGB 3CCJP 1GU4A 1JY2O 1IK9A 2AXCA 2E75C 3KPEA 3OW2O 1YTZT 3PHLA 1WMKA 1NTZD 1OMIA 2J5UA 3CLQA 1HVVA 1OXZA 1VQNP 1JY3O 2FKWB 3Q1MA 2WSFH 2M8RA 1HF9A 2G8YA 3JC22 5APQA 1OVUA 2K9JB 1EZVG 3SFEC 3WUUA 5CBOA 5TISH 1JM0A 3TK1A 3RL0B 5KLVK 1X9VA 4U7JA 1N7SA 3U59A 1GL2D 1EC5A 5CJ4A 3LW5H 1AFOA 4JF7A 4LC1A 2PFXA 2V4HA 1WT6A 1E5WA 1SQXG 4WB4A 2P58A 1NTMK 1N7SD 3CCRP 3LIDA 3AE3C 2WSEJ 3BATA 2KP8A 5CCHD 1RF1B 2OYHB 2N1TD 2CPBA 2Y0DA 2RH0A 2P1JA 1J1EB 1PP9D 2OTLP 1NTME 1X22A 1L4AC 5GTHH 5M1BA 5AW3B 1L0NJ 5APXA 1PGQA 1OW7A 5DJTB 5KTBA 1PPJE 4JBZA 3CCQP 3RL0C 4BRYB 1SQQJ 2N1TC 3MUDC 1QEXA 1SQXE 2IFNA 5CCHC 3SWKA 2BEQD 4UB6E 1LT9A 2PP6A 2IZ1A 3RBZA 1LTGC 1DEEG 1YQ4C 1Q82Q 3CL3D 1EZVE 3RK2D 4WBAA 3O6QA 1ZRTD 4JQ0D 1KMIZ 1SQQD 3TYYA 3K5BA 1FOSF 3CX5D 3L71G 1FZAA 2I1JA 1FZGA 1KB9D 1ZOYC 1BCCJ 1YQ3C 3MD0A 1PV3A 1R5LA 4TLFA 2NRGA 3P8CD 1VQ6P 5B66E 1JCCA 2I1KA 2Q3IA 3A0HE 1QX8A 3GG2A 3MGNA 3AEDC 1P84H 2A45I 3SSUA 4YXWH 3M0DC 2BCCG 4A7PA 3Q5RA 3BASA 3H1HD 2O01N 1M7LA 1SVFA 3S9OA 2K3RA 5AW9B 1JY3N 2NPSD 1RHZB 1M57D 2WPSA 1NU1D 3MP7B 1FS0E 3PLNA 5CMZA 5APVA 2D2CD 3GHGA 3CC4P 3GLMA 2J58A 4MN4C 1NTMG 2B87B 2FYZA 2QE7H 1VL2A 3CCUP 1GK4A 1YHQP 1NWQA 1GL2B 2PAJA 1IFDA 2YXRB 3B5NB 2Y9YA 5KJ7A 3LIEA 1PPJD 3CCVP 1JY2P 1NTZK 1M1JC 1BDDA 2QJPB 2W8ZA 3KZIH 3V2PA 5KAFH 1FOSE 1CI6A 3R2PA 3D70A 1MFTA 4YPCA 5KJ7D 3OJAB 2NZ2A 2ZT9D 3H6PA 3G71P 1Q90D 2Y9ZA 2XDJA 1S5LX 1NTZJ 3G3ZA 3H1IG 3L75E 1W2BO 4BXLA 3NTNA 4LLHA 4UB8E 1HJ0A 1U7MA 4H13C 2YNYA 3M91A 1KILB 2E74D 2M3BA 2YKPA 3H32A 3AE9C 2A06D 3FGAD 1NVOA 2AXTE 2R44A 2K1AA 2YO3A 3HUSA 3TF5A 3H1JD 1JTHB 1SLQA 3P8CE 1VQ9P 1ZW0A 2H89C 3B5NC 5AW0B 1YTZI 2GUVA 3AE5C 4ASWA 4D6TJ 3ZDMA 3HE4B 1LT1A 3H1LE 1K05A 2KSJA 1RF0A 1SQQG 2R32A 2C9NY 5AVZB 1YIJP 1Q86Q 3HE4A 1YJ9P 3CC7P 3PH0A 2N9YB 3TNUB 1L0ND 2AEFA 4D6TD 5CCGD 1TU3F 4L76A 1LTIC 4IL6H 1K73Q 3CMAP 4HYTB 1A02J 1VQ7P 2KNCA 3S1KA 4W7ZA 1IK7A 1SQPJ 2QIWA 2KS1B 4KJMA 2ZFCA 4QMAA 4EDFA 2NPSA 2QA4P 2K9YA 5AW4B 3USSA 1KFNA 2JEEA 3IFMA 1OW6A 3L71J 1PGPA 4IFFA 3ITKA 2ITAA 1JMBA 2HODB 1IFJA 2W6BA 1KFMA 1NTKG 2OYHA 2BCCD 1SQVE 4U3FE 3B4SA 4OH8B 4GOFA 2KK7A 3F5HA 3L72E 1M8OB 3VP9A 5K5GB 1FAVA 2JP3A 1N7SB 4K3AA 3L4FA 3M06A 1SQPE 2FYNB 1CSBA 1L0LG 3GF3A 2GUSA 2BCCJ 4OGQD 1URQA 3L70J 5DJUB 2R5DA 2WPQA 4Y28J 4L74A 5APUA 4DOJA 1LP1B 5CCGA 1IZNB 5KLIB 1DH3A 1BSNA 1S4XA 1SQPK 3L74E 4XFJA 2KI7B 1JOCA 2QJKC 2QVAA 1VF5B 1JCDA 2E76D 3LW5J 3NFQA 1P84D 4PV1D 4DZOA 2C9LY 3FWNA 2YXQB 2PRRA 3HRNA 1GTWA 2YKOA 1FE6A 3CWBE 3M9HA 1UIIA 2E75D 2ZXXA 1VQKP 1NU1J 1H88A 2BASA 2AXTH 1SQVD 4U3FD 1ZP0C 1GK6A 2LXCB 2ZYDA 3CXHD 1JB0J 4HB1A 4M3LA 2JWAA 1AVOA 1M56D 1HUCA 5B5EE 2KS1A 4OVNF 1BDCA 3KZIE 3AE7C 3L70E 1KQFB 2FYNC 1FC2C 1RE3A 2IDBA 1OIPA 1MKMA 1W5CE 2KUBA 1NTZE 2ZXEB 3H1JG 3L72D 1X79B 3E1IA 3L75J 4KHXA 4PD4H 4RO0A 1L0LE 3MZWB 3TSIA 1RF1A 1SQXK 2OYIC 1SQPG 4B86A 1PL5A 2WVRA 5KAIH 5AW2B 1LWUA 2Z5HA 3V2QA 3HUSB 4TT3H 1ZR4A 1E79H 1EDIA 1OZHA 3L73G 1KYOH 1BE3G 1BE3E 4CPGA 1AQ5A 1NH4A 1RE4C 1ZN5A 2XNXA 3NXSA 3Q5PA 1USEA 1NOHA 1FZCA 3RK3E 3CC2P 1PGJA 1VF5D 3W67A 3U1CA 2BEZF 1MZ9A 3JCUE 3VN0A 4RESB 3CXHE 2MJZA 3UIAA 1KV4A 1Q7YQ 2IX7C 1IC2A 2A45G 4HJGH 2KZIA 2W6AA 1N73A 1KZUB 2IYOA 2K88A 2WITA 3VOPA 5GTIE 3GMAA 4N78E 2P10A 1JY2N 2FXMA 3CX5E 4W7YA 3TDKA 4D6TE 1G1IA 4JYCA 2FYUK 4H0LD 2M5AA 1L0LD 4K35A 1NU1K 4NPFX 5AW6B 3PJSK 2Q9IA 1GL2A 3GF7A 4DJGA 1QVFO 3QH9A 2FYUG 2K9JA 2OYOA 2D2CC 3L71D 3T97A 1LTJC 3O8ZA 3D71A 3GHGB 1K8AQ 1N73B 1VQ4P 4I7ZB 2RN0A 4R4MA 1L0LJ 2B9BA 2H88C 1LGHB 2P2UA 1KB9E 1OW8A 2CPSA 1BGYG 2CK3H 2R3SA 3HD7C 3HTKA 4UB6H 2KSEA 5AVQB 4AQRD 2N1TB 2FFDA 5AW5B 5TJHA 2QJKB 3KHUA 1R8EA 3L37A 2E42A 3JSVC 2WSSH 3VMYA 3N7NA 1T3UA 3CX5I 3IN6A 1L0NE 1SQBD 3FXDA 1Y9BA 1JMMA 2KNCB 1ZR2A 1W2EA 5APTA 5AW7B 5KLIC 1N7SC 2GA1A 1X0TA 3CWBJ 1HBWA 1G2CB 1HJBA 2P67A 1FZBA 3PRJA 2KB7P 3M9QA 3TGUD 3V2RA 1A02F 2HYNA 3HD7B 2QM7A 3WU2E 1UIXA 1G2CA 5AVXB 3L73D 1JO5A 1LTJB 2V7QJ 3O6QB 4XA4A 2AEJA 3E7KA 2OTJP 1GZLA 1OVVA 4H0LB 2JJLA 1VDFA 2P7JA 4N78D 2L5GB 2L91A 1S9KD 3AEEC 2N9BA 1ZMEC 1VQMP 1BGYD 2N1TA 4I2LC 1YBKA 3L72J 2E75B 3P32A 3FX0A 3L75D 3G4SP 1LT9C 1BE3J 2J59M 1YJWP 4GDOA 1FDMA 3QWOC 5AVUB 1Q81Q 2H43A 3CXHI 2WWWA 3L71E 1QL1A 3P7KA 4YTPC 1S1CX 1ZV8A 4WY4C 5KLVD 2QSIA 4W80A 1PIXA 3WU2H 2W83C 5E79E 3I5CA 5KLVG 1SFCA 1Z56A 2XKMA 4HH2A 2QRXA 4IOIH 2M5AB 2QJYC 4EI2A 3TGUE 2Q5UA 1EZVI 2K37A 1NKNA 3D6YA 1SQQE 4H0LC 4IL6E 2Q6QA 3KQGA 1H8AA 2Q3EA 5KKZC 3CMEP 1OVRA 1S2EA 1HGVA 1DD4A 1NU1E 4OGQB 3PP5A 3M0DA 1T2KD 1L4AB 2JKVA 1OFCX 3WUVA 1N7LA 1FZEA 4IFDK 2E74C 1QLED 3CPWO 1LTTC 2E5YA 3GW6A 3M0AA 1S5LE 1KILC 1USDA 4H44C 2HLOA 4PV1B 2A06G 2WPRA 2YIUC 3GHGC 3L74J 3CCSP 2OTKE 1NTKD 1VF5C 2Z5IA 1OX3A 2IPPA 3VP8A 3A0BH 2BCCE 2G3AA 1SQQK 1BCCD 5KJ7C 4YXDC 4UB8H 1M1JA 1NKZB 1GU5A 1J2JB 3NMDA 4OGQC 3TGUG 5TISE 5APYA 1PPJG 1Q2NA 2WQYC 3VMAA 1JTHA 4NPDA 1SQVJ 1SQBK 4U3FJ 1RH5B 3U1AA 1VQPP 1EDJA 4WWIA 2IBZI 1GMJA 1HGZA 2H8PD 3SWFA 2KYVA 3V4WA 1IFNA 4WY4D 1URQD 3W68A 1VQLP 4NPEA 1GW3A 1AJYA 2KOGA 2O01J 1SQBJ 1JNMA 5CJ0A 2SPZA 1KC8Q 4H13D 2WT7A 3MTUE 3H32B 1PP9E 5H2FE 1M90Q 1KQSO 1AVYA 1L4AD 3BCCD 3HUSC 3I56P 1PZQA 2YO2A 1FDOA 3V2NA 3T97B 1L4AA 3AE6C 1NO4A 3H1LJ 3WUTA 2WSFJ 2A06E 2QG4A 3B71A 4N3YB 4ZKUA 1RF0C 1XTGB 2M0BA 2W27A 3KXDA 1S72P 2Q7CA 2XV5A 1URQB 3II6A 3MUDA 1ZRTE 2RMZA 5CCHA 4EOTA 4AUWA 1EZVD 1KYOE 1S9KE 1FDIA 1KORA 4HKZH 4EYYQ 2YIUB 2I8DA 2JWDA 3RK2C 1L0NG 2M3EA 2B87A 4Z1MH 2NPSC 1MFZA 2KIKA 1KTMA 1NTKK 2OARA 3AEFC 1EQ7A 1AQTA 1SFCD 2O1JA 4I6MC 3BRVB 4ZKPA 2OYHC 3I55P 1KQLA 2JDIH 1J1DC 1RY3A 1FU1A 2VRSA 2ZVNB 2C0WA 3KDPB 1J1EC 2FY8A 5EFWB 5B5EH 2D2CB 5KLVJ 2WT7B 3Q2YA 1VPCA 3AECC 1SQXJ 3AE2C 2WPVB 1K9MQ 1FZFA 3A0BE 5APSA 5AVTB 3V4QA 4H13B 1LTAC 2FXPA 1FZCB 1MUUA 1FJPA 2Z4EA 2ZT9C 1H89A 2FYUE 1FJKA 3H1HG 3HD7D 4GIFA 4I1LA 2OQQA 4PV1C 1URQC 3AEBC 3RK2B 3VYIA 3BVHA 1NU1G 3OA7A 4R4LA 5CCGC 1QL2A 1RQVA 2GM4A 1VQ5P 2QJYB 1FBMA 1NAYA 1SQPD 1JY3P 1LTBC 3E1RA 3RGUA 2ZYAA 1VQ8P 2DW3A 3WMM0 5CBNA 1NGMB 4DCKA 1IFMA 2A45H 3CXHH 4C7RA 3FWLA 3B5ND 1L2PA 3RK3C 3CCLP 2FXOA 3H1JJ 3M9BA 4PJ0E 3H1KD 3V5BA 2IBZE 3RL0g 3VMXA 3C8VA 5APWA 1VQOP 1AV1A 2IYPA 1N86A 2JO1A 1IFIA 2O01H 4LGDE 1NJIQ 5BU5A 2UWJE 1BCCE 2FBWC 1PFIA 5C39A 1G1JA 2MKVA 3A2AA 4O9BA 1RE3C 1PGOA 1AA0A 4ZNCA
chains in the Genus database with same CATH topology
3C9IA 1T2KC 2YMYA 3HTKB 1RF1C 2FFDB 1CI6B 2KLVA 3A7OA 5AVSB 1CW5A 1LWUC 2HFED 4AYCA 4C7NA 5AVRB 2XU6A 1FZCC 3B5NA 5AVVB 1DX7A 3N4XA 1NHLA 3OAKA 4Y99B 3RL0D 3SWYA 2XZRA 2WSEH 2WTYA 1LTSC 1IO4A 1DEBA 2HODA 2WZ7A 3P8MC 3HE5B 3B8EB 3KYQA 1HTLC 1T8ZA 4GKGA 3TNUA 2LKMA 1J1DB 4JYBA 1MV8A 2HPCA 3L36A 4GT1A 3CI9A 1GL2C 1JUNA 4IFMA 1SP4A 1LTJA 1M1JB 3EQ2A 1HWTC 2QM8A 3HD7A 5AVYB 2POHA 2FFDC 5BVZA 1N2DC 2R3CA 3U1CA 1RF1B 3VMZA 2HPCB 5AW1B 1LT9B 2R5BA 1OWAA 1XTCC 1IJDB 4WY4B 3HE5A 4XE5B 4C46A 3BRTB 2C0XA 1YYCA 1GD2E 2OYIB 1NAFA 2H7HA 2E43A 4N6JA 2YKQA 1GDTA 4C7NB 1SFCB 3EFGA 1GTWA 3A3YB 1ZLLA 2HG5D 1L0LK 2OYIA 4EIJA 5AW8B 1SQVK 4Y99C 1RE4A 4WY4A 1T3JA 5CHXA 2O1KA 1SFCC 2NPSB 2WSCH 1LWUB 3RK3D 2IFMA 1N73C 1L0NK 1HH0A 3MIWA 1GW4A 1CZQA 1X8YA 5AVWB 1KILA 3L35A 3VTPC 5BU8B 3IR9A 3RK3B 1KILD 1WRGA 1GU4A 3KPEA 1IK9A 1JY2O 1YTZT 3CLQA 1HVVA 1OXZA 1JY3O 2FKWB 2WSFH 2M8RA 5APQA 3TK1A 3RL0B 5KLVK 1X9VA 3U59A 1N7SA 5CJ4A 1GL2D 1AFOA 3LW5H 4JF7A 4LC1A 4WB4A 1WT6A 1E5WA 1NTMK 1N7SD 3LIDA 5CCHD 2KP8A 2OYHB 2N1TD 2CPBA 2P1JA 1J1EB 1L4AC 5AW3B 5APXA 5KTBA 3RL0C 2N1TC 2IFNA 5CCHC 1LT9A 2PP6A 1LTGC 3CL3D 3RK2D 4WBAA 3TYYA 1FOSF 1FZAA 2I1JA 1FZGA 3MD0A 3P8CD 1JCCA 2I1KA 2Q3IA 3MGNA 2A45I 3M0DC 3BASA 1M7LA 1SVFA 5AW9B 1JY3N 2NPSD 2WPSA 5CMZA 5APVA 3GHGA 2J58A 2FYZA 1NWQA 1GK4A 1GL2B 2PAJA 1IFDA 3B5NB 5KJ7A 3LIEA 1JY2P 1NTZK 1M1JC 3V2PA 1FOSE 1CI6A 3R2PA 5KJ7D 3OJAB 3H6PA 2XDJA 3G3ZA 3NTNA 4LLHA 2YNYA 3M91A 1KILB 2M3BA 2YKPA 3H32A 2YO3A 3HUSA 1JTHB 1SLQA 3P8CE 3B5NC 5AW0B 1YTZI 2GUVA 3HE4B 2KSJA 1RF0A 2C9NY 2R32A 5AVZB 3HE4A 3TNUB 5CCGD 1FDMA 1A02J 1LTIC 4HYTB 4W7ZA 2ZFCA 2NPSA 5AW4B 1KFNA 2JEEA 3IFMA 4IFFA 2OYHA 2W6BA 2HODB 1IFJA 1KFMA 4OH8B 3VP9A 1FAVA 1N7SB 3L4FA 3M06A 1CSBA 2GUSA 1URQA 2R5DA 2WPQA 5APUA 4DOJA 1DH3A 5CCGA 1SQPK 1JOCA 3NFQA 1JCDA 4DZOA 2C9LY 3HRNA 2YKOA 3M9HA 1H88A 2BASA 1GK6A 4M3LA 1HUCA 1RE3A 2ZXEB 4KHXA 1X79B 3E1IA 3TSIA 1RF1A 1SQXK 2OYIC 4B86A 5AW2B 1LWUA 2Z5HA 3V2QA 3HUSB 1ZR4A 1AQ5A 1NH4A 1RE4C 1ZN5A 2XNXA 3NXSA 1NOHA 1FZCA 1MZ9A 3VN0A 4RESB 3UIAA 2MJZA 2IX7C 1IC2A 2A45G 2W6AA 1N73A 1KZUB 2WITA 3VOPA 4N78E 1JY2N 2FXMA 4W7YA 1G1IA 4JYCA 2FYUK 1NU1K 5AW6B 2Q9IA 1GL2A 1N73B 3T97A 1LTJC 3O8ZA 3GHGB 2P2UA 3BATA 1LGHB 3HD7C 4AUWA 2CPSA 4AQRD 3HTKA 5AVQB 2FFDA 2N1TB 5AW5B 3L37A 2E42A 3VMYA 3N7NA 1T3UA 1JMMA 1ZR2A 1W2EA 5APTA 5AW7B 1N7SC 1HBWA 1G2CB 1HJBA 2P67A 1FZBA 2KB7P 3M9QA 3V2RA 1A02F 2HYNA 3HD7B 2QM7A 1G2CA 5AVXB 1JO5A 1LTJB 4XA4A 1GZLA 2JJLA 1VDFA 2P7JA 4N78D 2L5GB 1S9KD 2N9BA 2N1TA 4I2LC 3P32A 1LT9C 2J59M 5AVUB 2H43A 2WWWA 1QL1A 3P7KA 1ZV8A 4WY4C 4W80A 3I5CA 1SFCA 1Z56A 2XKMA 4HH2A 2Q5UA 1NKNA 3KQGA 1H8AA 1HGVA 3PP5A 3M0DA 1T2KD 1L4AB 1N7LA 1FZEA 4IFDK 1LTTC 3M0AA 1KILC 2HLOA 2WPRA 3GHGC 2Z5IA 2IPPA 3VP8A 1SQQK 5KJ7C 1M1JA 1NKZB 1GU5A 1J2JB 3NMDA 5APYA 1JTHA 1SQBK 3U1AA 2H8PD 1HGZA 3SWFA 2KYVA 3V4WA 1IFNA 4WY4D 1URQD 1GW3A 2KOGA 1JNMA 5CJ0A 2WT7A 3MTUE 3H32B 1L4AD 3HUSC 2YO2A 3V2NA 1L4AA 1NO4A 4N3YB 4ZKUA 1RF0C 1XTGB 2W27A 2Q7CA 2XV5A 1URQB 3II6A 3MUDA 5CCHA 4EOTA 1S9KE 3RK2C 2NPSC 1MFZA 1NTKK 2OARA 1EQ7A 1SFCD 2O1JA 4I6MC 4ZKPA 3BRVB 2OYHC 1KQLA 3KDPB 1J1DC 1RY3A 1FU1A 2VRSA 3A5TA 2C0WA 1J1EC 2WT7B 1VPCA 1FZFA 5APSA 5AVTB 3V4QA 1FZCB 1FJPA 1LTAC 1MUUA 2Z4EA 1H89A 3HD7D 1FJKA 4GIFA 4I1LA 3BVHA 3RK2B 1URQC 3VYIA 3OA7A 5CCGC 1QL2A 2GM4A 1FBMA 1JY3P 1LTBC 3WMM0 1IFMA 2A45H 4C7RA 3B5ND 3RK3C 3M9BA 3V5BA 3VMXA 5APWA 1N86A 1IFIA 2O01H 4LGDE 5BU5A 1PFIA 1G1JA 3A2AA 4O9BA 1RE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMY A;  3HTK B;  4OH8 B;  1HVV A;  4WY4 C;  4W80 A;  1N7S B;  2M8R A;  1SFC A;  2HFE D;  1URQ A;  3RL0 B;  1N7S A;  1GL2 D;  3B5N A;  5CCG A;  4JF7 A;  1NHL A;  1N7S D;  3RL0 D;  5CCH D;  3PP5 A;  2N1T D;  1L4A B;  1L4A C;  2WZ7 A;  3KYQ A;  1KIL C;  3RL0 C;  2N1T C;  5CCH C;  2PP6 A;  5KJ7 C;  1GL2 C;  3TSI A;  3RK2 D;  1JTH A;  3HD7 A;  2H8P D;  4WY4 D;  1URQ D;  2KOG A;  4WY4 B;  1L4A D;  3M0D C;  1L4A A;  2NPS D;  3VOP A;  4N78 E;  4W7Y A;  1XTG B;  1URQ B;  5CCH A;  1GL2 B;  3B5N B;  1SFC B;  5KJ7 A;  1GL2 A;  2HG5 D;  3RK2 C;  2NPS C;  5KJ7 D;  1SFC D;  2XDJ A;  3HD7 C;  2N1T B;  4WY4 A;  1KIL B;  1T3J A;  1SFC C;  2NPS B;  3HD7 D;  3RK2 B;  1URQ C;  1N7S C;  3RK3 D;  1JTH B;  3P8C E;  3B5N C;  5CCG C;  3HD7 B;  3B5N D;  5CCG D;  3RK3 C;  1KIL A;  4W7Z A;  2NPS A;  2N1T A;  4LGD E;  3RK3 B;  1KIL D; 
#chains in the Genus database with same CATH topology
 3C9I A;  1T2K C;  2YMY A;  3HTK B;  1RF1 C;  3A0H H;  2LXB A;  1CI6 B;  2FFD B;  1K04 A;  2KLV A;  3IF4 A;  3L73 E;  1SQB G;  3CCM P;  2ZVO B;  3A7O A;  1LP1 A;  5AVS B;  3CD6 P;  1LWU C;  1CW5 A;  5H2F H;  2HFE D;  4JPZ B;  3FXE A;  4AYC A;  2KZJ A;  1NTM D;  4C7N A;  5AVR B;  4DT0 A;  1BGY J;  3H1I J;  2XU6 A;  1FZC C;  3B5N A;  5AVV B;  1R5S A;  1BE3 D;  3D6Z A;  1DX7 A;  3N4X A;  3H25 A;  2ZT9 B;  1NHL A;  1NYH A;  4ZMD A;  2FYU D;  3OAK A;  4RJT A;  1EDK A;  1YI2 P;  4Y99 B;  1NTM J;  3RL0 D;  3SWY A;  3H1K G;  4PD4 I;  3H1I D;  2XZR A;  2WSE H;  2WTY A;  3EWK A;  1LTS C;  1SS1 A;  1IO4 A;  1DEB A;  3F89 A;  2HOD A;  2WZ7 A;  3P8M C;  4H44 D;  3BCC G;  2FYU J;  3B8E B;  3HE5 B;  1HTL C;  3KYQ A;  3PTZ A;  1T8Z A;  4GKG A;  1KYO D;  5KAF E;  3TNU A;  2LKM A;  1BGY E;  1J1D B;  4JYB A;  1MV8 A;  1NTZ G;  2HPC A;  2B88 A;  2WSC J;  3L36 A;  4GT1 A;  4BWN A;  1RQU A;  3CI9 A;  2KLU A;  1GL2 C;  1JUN A;  4IFM A;  1DD3 A;  1KB9 H;  1SP4 A;  1LTJ A;  1M1J B;  2QJP C;  3EQ2 A;  1QVG O;  2QM8 A;  1HWT C;  3BCC E;  1P84 E;  3H1H J;  3HD7 A;  1LJ2 A;  1ZXG A;  2KXP B;  2POH A;  5AVY B;  2JR8 A;  2XND H;  1N2D C;  2R3C A;  1SQX D;  3L74 D;  3CWB G;  5BVZ A;  3VMZ A;  3AE4 C;  1NTK J;  4D6T G;  1EXJ A;  2HPC B;  2AEM A;  3EFF K;  1LT9 B;  2IZ0 A;  2R5B A;  3AEG C;  5AW1 B;  3S4R A;  1DIP A;  3Q3D A;  1QGK B;  1OWA A;  4PJ0 H;  5L8R J;  1XTC C;  1IJD B;  4RKU J;  4BRY A;  5B66 H;  1Y8A A;  5E79 H;  3H1J E;  2ZYG A;  1N8R Q;  4WY4 B;  3HE5 A;  2IBZ G;  2YMK A;  4XE5 B;  4C46 A;  3BRT B;  3C1L A;  2C0X A;  1YYC A;  3CCE P;  1GD2 E;  2W90 A;  2OYI B;  1Y47 A;  3A5T A;  1PP9 J;  2E5T A;  1NAF A;  3R4Y A;  2H7H A;  1YIT P;  1SQB E;  1U7J A;  3L72 G;  2E43 A;  4N6J A;  2YKQ A;  3JCU H;  1GDT A;  2Y0E A;  4C7N B;  3MHV A;  3H1K J;  2PGD A;  1NTK E;  1SFC B;  3EFG A;  4L75 A;  1KYO I;  3AEA C;  3RBX A;  3SFD C;  3A3Y B;  1ZLL A;  3AE8 C;  4L73 A;  2QEX P;  2E76 B;  2HG5 D;  3Q5S A;  3ABV C;  1EDL A;  2LR2 A;  3BCC J;  3H1H E;  4WVZ A;  1L0L K;  4GOE A;  2OYI A;  2E74 B;  4EIJ A;  3L74 G;  1JEK A;  3IAO A;  1IFP A;  4IL6 X;  2W6J H;  1S5L H;  5KAI E;  4KT0 J;  4H44 B;  3H1L D;  1U57 A;  5AW8 B;  5KLV E;  2HR3 A;  2FFD C;  3L70 G;  1SQV K;  4Y99 C;  1KIL E;  1RE4 A;  1H0T A;  3L75 G;  2OGU A;  4PD4 E;  5KKZ B;  4WY4 A;  1BSH A;  1T3J A;  5CHX A;  2O1K A;  2IBZ D;  1T6A A;  4ASV A;  1SFC C;  2Q1K A;  2NPS B;  5GTH E;  3G9R A;  2WSC H;  2E76 C;  1KN7 A;  3AE1 C;  1D7M A;  3H1K E;  1LWU B;  3RK3 D;  1BCC G;  2IFM A;  1YJN P;  1N73 C;  2RKL A;  1L0N K;  1LNQ A;  2Y0C A;  1EXI A;  1HH0 A;  2V7Q H;  3MIW A;  2B89 A;  4I7Z C;  3V6I A;  5GTI H;  1GW4 A;  1S3J A;  2ZJS E;  1CZQ A;  3H1I E;  1M1K Q;  1P84 I;  1KD1 Q;  1X8Y A;  2WMM A;  3CWB D;  5AVW B;  1KB9 I;  1KIL A;  3TGU J;  3H1L G;  1PP9 G;  3L35 A;  2O3J A;  4GOD A;  3VTP C;  3L70 D;  4PD4 D;  5BU8 B;  1H0T B;  3IR9 A;  1SQV G;  4U3F G;  1KIL D;  1WRG A;  2ZAE B;  3L73 J;  3RK3 B;  3G6E P;  4OWF A;  3CX5 H;  1KQG B;  3CCJ P;  1GU4 A;  1JY2 O;  1IK9 A;  2AXC A;  2E75 C;  3KPE A;  3OW2 O;  1YTZ T;  3PHL A;  1WMK A;  1NTZ D;  1OMI A;  2J5U A;  3CLQ A;  1HVV A;  1OXZ A;  1VQN P;  1JY3 O;  2FKW B;  3Q1M A;  2WSF H;  2M8R A;  1HF9 A;  2G8Y A;  3JC2 2;  5APQ A;  1OVU A;  2K9J B;  1EZV G;  3SFE C;  3WUU A;  5CBO A;  5TIS H;  1JM0 A;  3TK1 A;  3RL0 B;  5KLV K;  1X9V A;  4U7J A;  1N7S A;  3U59 A;  1GL2 D;  1EC5 A;  5CJ4 A;  3LW5 H;  1AFO A;  4JF7 A;  4LC1 A;  2PFX A;  2V4H A;  1WT6 A;  1E5W A;  1SQX G;  4WB4 A;  2P58 A;  1NTM K;  1N7S D;  3CCR P;  3LID A;  3AE3 C;  2WSE J;  3BAT A;  2KP8 A;  5CCH D;  1RF1 B;  2OYH B;  2N1T D;  2CPB A;  2Y0D A;  2RH0 A;  2P1J A;  1J1E B;  1PP9 D;  2OTL P;  1NTM E;  1X22 A;  1L4A C;  5GTH H;  5M1B A;  5AW3 B;  1L0N J;  5APX A;  1PGQ A;  1OW7 A;  5DJT B;  5KTB A;  1PPJ E;  4JBZ A;  3CCQ P;  3RL0 C;  4BRY B;  1SQQ J;  2N1T C;  3MUD C;  1QEX A;  1SQX E;  2IFN A;  5CCH C;  3SWK A;  2BEQ D;  4UB6 E;  1LT9 A;  2PP6 A;  2IZ1 A;  3RBZ A;  1LTG C;  1DEE G;  1YQ4 C;  1Q82 Q;  3CL3 D;  1EZV E;  3RK2 D;  4WBA A;  3O6Q A;  1ZRT D;  4JQ0 D;  1KMI Z;  1SQQ D;  3TYY A;  3K5B A;  1FOS F;  3CX5 D;  3L71 G;  1FZA A;  2I1J A;  1FZG A;  1KB9 D;  1ZOY C;  1BCC J;  1YQ3 C;  3MD0 A;  1PV3 A;  1R5L A;  4TLF A;  2NRG A;  3P8C D;  1VQ6 P;  5B66 E;  1JCC A;  2I1K A;  2Q3I A;  3A0H E;  1QX8 A;  3GG2 A;  3MGN A;  3AED C;  1P84 H;  2A45 I;  3SSU A;  4YXW H;  3M0D C;  2BCC G;  4A7P A;  3Q5R A;  3BAS A;  3H1H D;  2O01 N;  1M7L A;  1SVF A;  3S9O A;  2K3R A;  5AW9 B;  1JY3 N;  2NPS D;  1RHZ B;  1M57 D;  2WPS A;  1NU1 D;  3MP7 B;  1FS0 E;  3PLN A;  5CMZ A;  5APV A;  2D2C D;  3GHG A;  3CC4 P;  3GLM A;  2J58 A;  4MN4 C;  1NTM G;  2B87 B;  2FYZ A;  2QE7 H;  1VL2 A;  3CCU P;  1GK4 A;  1YHQ P;  1NWQ A;  1GL2 B;  2PAJ A;  1IFD A;  2YXR B;  3B5N B;  2Y9Y A;  5KJ7 A;  3LIE A;  1PPJ D;  3CCV P;  1JY2 P;  1NTZ K;  1M1J C;  1BDD A;  2QJP B;  2W8Z A;  3KZI H;  3V2P A;  5KAF H;  1FOS E;  1CI6 A;  3R2P A;  3D70 A;  1MFT A;  4YPC A;  5KJ7 D;  3OJA B;  2NZ2 A;  2ZT9 D;  3H6P A;  3G71 P;  1Q90 D;  2Y9Z A;  2XDJ A;  1S5L X;  1NTZ J;  3G3Z A;  3H1I G;  3L75 E;  1W2B O;  4BXL A;  3NTN A;  4LLH A;  4UB8 E;  1HJ0 A;  1U7M A;  4H13 C;  2YNY A;  3M91 A;  1KIL B;  2E74 D;  2M3B A;  2YKP A;  3H32 A;  3AE9 C;  2A06 D;  3FGA D;  1NVO A;  2AXT E;  2R44 A;  2K1A A;  2YO3 A;  3HUS A;  3TF5 A;  3H1J D;  1JTH B;  1SLQ A;  3P8C E;  1VQ9 P;  1ZW0 A;  2H89 C;  3B5N C;  5AW0 B;  1YTZ I;  2GUV A;  3AE5 C;  4ASW A;  4D6T J;  3ZDM A;  3HE4 B;  1LT1 A;  3H1L E;  1K05 A;  2KSJ A;  1RF0 A;  1SQQ G;  2R32 A;  2C9N Y;  5AVZ B;  1YIJ P;  1Q86 Q;  3HE4 A;  1YJ9 P;  3CC7 P;  3PH0 A;  2N9Y B;  3TNU B;  1L0N D;  2AEF A;  4D6T D;  5CCG D;  1TU3 F;  4L76 A;  1LTI C;  4IL6 H;  1K73 Q;  3CMA P;  4HYT B;  1A02 J;  1VQ7 P;  2KNC A;  3S1K A;  4W7Z A;  1IK7 A;  1SQP J;  2QIW A;  2KS1 B;  4KJM A;  2ZFC A;  4QMA A;  4EDF A;  2NPS A;  2QA4 P;  2K9Y A;  5AW4 B;  3USS A;  1KFN A;  2JEE A;  3IFM A;  1OW6 A;  3L71 J;  1PGP A;  4IFF A;  3ITK A;  2ITA A;  1JMB A;  2HOD B;  1IFJ A;  2W6B A;  1KFM A;  1NTK G;  2OYH A;  2BCC D;  1SQV E;  4U3F E;  3B4S A;  4OH8 B;  4GOF A;  2KK7 A;  3F5H A;  3L72 E;  1M8O B;  3VP9 A;  5K5G B;  1FAV A;  2JP3 A;  1N7S B;  4K3A A;  3L4F A;  3M06 A;  1SQP E;  2FYN B;  1CSB A;  1L0L G;  3GF3 A;  2GUS A;  2BCC J;  4OGQ D;  1URQ A;  3L70 J;  5DJU B;  2R5D A;  2WPQ A;  4Y28 J;  4L74 A;  5APU A;  4DOJ A;  1LP1 B;  5CCG A;  1IZN B;  5KLI B;  1DH3 A;  1BSN A;  1S4X A;  1SQP K;  3L74 E;  4XFJ A;  2KI7 B;  1JOC A;  2QJK C;  2QVA A;  1VF5 B;  1JCD A;  2E76 D;  3LW5 J;  3NFQ A;  1P84 D;  4PV1 D;  4DZO A;  2C9L Y;  3FWN A;  2YXQ B;  2PRR A;  3HRN A;  1GTW A;  2YKO A;  1FE6 A;  3CWB E;  3M9H A;  1UII A;  2E75 D;  2ZXX A;  1VQK P;  1NU1 J;  1H88 A;  2BAS A;  2AXT H;  1SQV D;  4U3F D;  1ZP0 C;  1GK6 A;  2LXC B;  2ZYD A;  3CXH D;  1JB0 J;  4HB1 A;  4M3L A;  2JWA A;  1AVO A;  1M56 D;  1HUC A;  5B5E E;  2KS1 A;  4OVN F;  1BDC A;  3KZI E;  3AE7 C;  3L70 E;  1KQF B;  2FYN C;  1FC2 C;  1RE3 A;  2IDB A;  1OIP A;  1MKM A;  1W5C E;  2KUB A;  1NTZ E;  2ZXE B;  3H1J G;  3L72 D;  1X79 B;  3E1I A;  3L75 J;  4KHX A;  4PD4 H;  4RO0 A;  1L0L E;  3MZW B;  3TSI A;  1RF1 A;  1SQX K;  2OYI C;  1SQP G;  4B86 A;  1PL5 A;  2WVR A;  5KAI H;  5AW2 B;  1LWU A;  2Z5H A;  3V2Q A;  3HUS B;  4TT3 H;  1ZR4 A;  1E79 H;  1EDI A;  1OZH A;  3L73 G;  1KYO H;  1BE3 G;  1BE3 E;  4CPG A;  1AQ5 A;  1NH4 A;  1RE4 C;  1ZN5 A;  2XNX A;  3NXS A;  3Q5P A;  1USE A;  1NOH A;  1FZC A;  3RK3 E;  3CC2 P;  1PGJ A;  1VF5 D;  3W67 A;  3U1C A;  2BEZ F;  1MZ9 A;  3JCU E;  3VN0 A;  4RES B;  3CXH E;  2MJZ A;  3UIA A;  1KV4 A;  1Q7Y Q;  2IX7 C;  1IC2 A;  2A45 G;  4HJG H;  2KZI A;  2W6A A;  1N73 A;  1KZU B;  2IYO A;  2K88 A;  2WIT A;  3VOP A;  5GTI E;  3GMA A;  4N78 E;  2P10 A;  1JY2 N;  2FXM A;  3CX5 E;  4W7Y A;  3TDK A;  4D6T E;  1G1I A;  4JYC A;  2FYU K;  4H0L D;  2M5A A;  1L0L D;  4K35 A;  1NU1 K;  4NPF X;  5AW6 B;  3PJS K;  2Q9I A;  1GL2 A;  3GF7 A;  4DJG A;  1QVF O;  3QH9 A;  2FYU G;  2K9J A;  2OYO A;  2D2C C;  3L71 D;  3T97 A;  1LTJ C;  3O8Z A;  3D71 A;  3GHG B;  1K8A Q;  1N73 B;  1VQ4 P;  4I7Z B;  2RN0 A;  4R4M A;  1L0L J;  2B9B A;  2H88 C;  1LGH B;  2P2U A;  1KB9 E;  1OW8 A;  2CPS A;  1BGY G;  2CK3 H;  2R3S A;  3HD7 C;  3HTK A;  4UB6 H;  2KSE A;  5AVQ B;  4AQR D;  2N1T B;  2FFD A;  5AW5 B;  5TJH A;  2QJK B;  3KHU A;  1R8E A;  3L37 A;  2E42 A;  3JSV C;  2WSS H;  3VMY A;  3N7N A;  1T3U A;  3CX5 I;  3IN6 A;  1L0N E;  1SQB D;  3FXD A;  1Y9B A;  1JMM A;  2KNC B;  1ZR2 A;  1W2E A;  5APT A;  5AW7 B;  5KLI C;  1N7S C;  2GA1 A;  1X0T A;  3CWB J;  1HBW A;  1G2C B;  1HJB A;  2P67 A;  1FZB A;  3PRJ A;  2KB7 P;  3M9Q A;  3TGU D;  3V2R A;  1A02 F;  2HYN A;  3HD7 B;  2QM7 A;  3WU2 E;  1UIX A;  1G2C A;  5AVX B;  3L73 D;  1JO5 A;  1LTJ B;  2V7Q J;  3O6Q B;  4XA4 A;  2AEJ A;  3E7K A;  2OTJ P;  1GZL A;  1OVV A;  4H0L B;  2JJL A;  1VDF A;  2P7J A;  4N78 D;  2L5G B;  2L91 A;  1S9K D;  3AEE C;  2N9B A;  1ZME C;  1VQM P;  1BGY D;  2N1T A;  4I2L C;  1YBK A;  3L72 J;  2E75 B;  3P32 A;  3FX0 A;  3L75 D;  3G4S P;  1LT9 C;  1BE3 J;  2J59 M;  1YJW P;  4GDO A;  1FDM A;  3QWO C;  5AVU B;  1Q81 Q;  2H43 A;  3CXH I;  2WWW A;  3L71 E;  1QL1 A;  3P7K A;  4YTP C;  1S1C X;  1ZV8 A;  4WY4 C;  5KLV D;  2QSI A;  4W80 A;  1PIX A;  3WU2 H;  2W83 C;  5E79 E;  3I5C A;  5KLV G;  1SFC A;  1Z56 A;  2XKM A;  4HH2 A;  2QRX A;  4IOI H;  2M5A B;  2QJY C;  4EI2 A;  3TGU E;  2Q5U A;  1EZV I;  2K37 A;  1NKN A;  3D6Y A;  1SQQ E;  4H0L C;  4IL6 E;  2Q6Q A;  3KQG A;  1H8A A;  2Q3E A;  5KKZ C;  3CME P;  1OVR A;  1S2E A;  1HGV A;  1DD4 A;  1NU1 E;  4OGQ B;  3PP5 A;  3M0D A;  1T2K D;  1L4A B;  2JKV A;  1OFC X;  3WUV A;  1N7L A;  1FZE A;  4IFD K;  2E74 C;  1QLE D;  3CPW O;  1LTT C;  2E5Y A;  3GW6 A;  3M0A A;  1S5L E;  1KIL C;  1USD A;  4H44 C;  2HLO A;  4PV1 B;  2A06 G;  2WPR A;  2YIU C;  3GHG C;  3L74 J;  3CCS P;  2OTK E;  1NTK D;  1VF5 C;  2Z5I A;  1OX3 A;  2IPP A;  3VP8 A;  3A0B H;  2BCC E;  2G3A A;  1SQQ K;  1BCC D;  5KJ7 C;  4YXD C;  4UB8 H;  1M1J A;  1NKZ B;  1GU5 A;  1J2J B;  3NMD A;  4OGQ C;  3TGU G;  5TIS E;  5APY A;  1PPJ G;  1Q2N A;  2WQY C;  3VMA A;  1JTH A;  4NPD A;  1SQV J;  1SQB K;  4U3F J;  1RH5 B;  3U1A A;  1VQP P;  1EDJ A;  4WWI A;  2IBZ I;  1GMJ A;  1HGZ A;  2H8P D;  3SWF A;  2KYV A;  3V4W A;  1IFN A;  4WY4 D;  1URQ D;  3W68 A;  1VQL P;  4NPE A;  1GW3 A;  1AJY A;  2KOG A;  2O01 J;  1SQB J;  1JNM A;  5CJ0 A;  2SPZ A;  1KC8 Q;  4H13 D;  2WT7 A;  3MTU E;  3H32 B;  1PP9 E;  5H2F E;  1M90 Q;  1KQS O;  1AVY A;  1L4A D;  3BCC D;  3HUS C;  3I56 P;  1PZQ A;  2YO2 A;  1FDO A;  3V2N A;  3T97 B;  1L4A A;  3AE6 C;  1NO4 A;  3H1L J;  3WUT A;  2WSF J;  2A06 E;  2QG4 A;  3B71 A;  4N3Y B;  4ZKU A;  1RF0 C;  1XTG B;  2M0B A;  2W27 A;  3KXD A;  1S72 P;  2Q7C A;  2XV5 A;  1URQ B;  3II6 A;  3MUD A;  1ZRT E;  2RMZ A;  5CCH A;  4EOT A;  4AUW A;  1EZV D;  1KYO E;  1S9K E;  1FDI A;  1KOR A;  4HKZ H;  4EYY Q;  2YIU B;  2I8D A;  2JWD A;  3RK2 C;  1L0N G;  2M3E A;  2B87 A;  4Z1M H;  2NPS C;  1MFZ A;  2KIK A;  1KTM A;  1NTK K;  2OAR A;  3AEF C;  1EQ7 A;  1AQT A;  1SFC D;  2O1J A;  4I6M C;  3BRV B;  4ZKP A;  2OYH C;  3I55 P;  1KQL A;  2JDI H;  1J1D C;  1RY3 A;  1FU1 A;  2VRS A;  2ZVN B;  2C0W A;  3KDP B;  1J1E C;  2FY8 A;  5EFW B;  5B5E H;  2D2C B;  5KLV J;  2WT7 B;  3Q2Y A;  1VPC A;  3AEC C;  1SQX J;  3AE2 C;  2WPV B;  1K9M Q;  1FZF A;  3A0B E;  5APS A;  5AVT B;  3V4Q A;  4H13 B;  1LTA C;  2FXP A;  1FZC B;  1MUU A;  1FJP A;  2Z4E A;  2ZT9 C;  1H89 A;  2FYU E;  1FJK A;  3H1H G;  3HD7 D;  4GIF A;  4I1L A;  2OQQ A;  4PV1 C;  1URQ C;  3AEB C;  3RK2 B;  3VYI A;  3BVH A;  1NU1 G;  3OA7 A;  4R4L A;  5CCG C;  1QL2 A;  1RQV A;  2GM4 A;  1VQ5 P;  2QJY B;  1FBM A;  1NAY A;  1SQP D;  1JY3 P;  1LTB C;  3E1R A;  3RGU A;  2ZYA A;  1VQ8 P;  2DW3 A;  3WMM 0;  5CBN A;  1NGM B;  4DCK A;  1IFM A;  2A45 H;  3CXH H;  4C7R A;  3FWL A;  3B5N D;  1L2P A;  3RK3 C;  3CCL P;  2FXO A;  3H1J J;  3M9B A;  4PJ0 E;  3H1K D;  3V5B A;  2IBZ E;  3RL0 g;  3VMX A;  3C8V A;  5APW A;  1VQO P;  1AV1 A;  2IYP A;  1N86 A;  2JO1 A;  1IFI A;  2O01 H;  4LGD E;  1NJI Q;  5BU5 A;  2UWJ E;  1BCC E;  2FBW C;  1PFI A;  5C39 A;  1G1J A;  2MKV A;  3A2A A;  4O9B A;  1RE3 C;  1PGO A;  1AA0 A;  4ZNC A; 
#chains in the Genus database with same CATH homology
 3C9I A;  1T2K C;  2YMY A;  3HTK B;  1RF1 C;  2FFD B;  1CI6 B;  2KLV A;  3A7O A;  5AVS B;  1CW5 A;  1LWU C;  2HFE D;  4AYC A;  4C7N A;  5AVR B;  2XU6 A;  1FZC C;  3B5N A;  5AVV B;  1DX7 A;  3N4X A;  1NHL A;  3OAK A;  4Y99 B;  3RL0 D;  3SWY A;  2XZR A;  2WSE H;  2WTY A;  1LTS C;  1IO4 A;  1DEB A;  2HOD A;  2WZ7 A;  3P8M C;  3HE5 B;  3B8E B;  3KYQ A;  1HTL C;  1T8Z A;  4GKG A;  3TNU A;  2LKM A;  1J1D B;  4JYB A;  1MV8 A;  2HPC A;  3L36 A;  4GT1 A;  3CI9 A;  1GL2 C;  1JUN A;  4IFM A;  1SP4 A;  1LTJ A;  1M1J B;  3EQ2 A;  1HWT C;  2QM8 A;  3HD7 A;  5AVY B;  2POH A;  2FFD C;  5BVZ A;  1N2D C;  2R3C A;  3U1C A;  1RF1 B;  3VMZ A;  2HPC B;  5AW1 B;  1LT9 B;  2R5B A;  1OWA A;  1XTC C;  1IJD B;  4WY4 B;  3HE5 A;  4XE5 B;  4C46 A;  3BRT B;  2C0X A;  1YYC A;  1GD2 E;  2OYI B;  1NAF A;  2H7H A;  2E43 A;  4N6J A;  2YKQ A;  1GDT A;  4C7N B;  1SFC B;  3EFG A;  1GTW A;  3A3Y B;  1ZLL A;  2HG5 D;  1L0L K;  2OYI A;  4EIJ A;  5AW8 B;  1SQV K;  4Y99 C;  1RE4 A;  4WY4 A;  1T3J A;  5CHX A;  2O1K A;  1SFC C;  2NPS B;  2WSC H;  1LWU B;  3RK3 D;  2IFM A;  1N73 C;  1L0N K;  1HH0 A;  3MIW A;  1GW4 A;  1CZQ A;  1X8Y A;  5AVW B;  1KIL A;  3L35 A;  3VTP C;  5BU8 B;  3IR9 A;  3RK3 B;  1KIL D;  1WRG A;  1GU4 A;  3KPE A;  1IK9 A;  1JY2 O;  1YTZ T;  3CLQ A;  1HVV A;  1OXZ A;  1JY3 O;  2FKW B;  2WSF H;  2M8R A;  5APQ A;  3TK1 A;  3RL0 B;  5KLV K;  1X9V A;  3U59 A;  1N7S A;  5CJ4 A;  1GL2 D;  1AFO A;  3LW5 H;  4JF7 A;  4LC1 A;  4WB4 A;  1WT6 A;  1E5W A;  1NTM K;  1N7S D;  3LID A;  5CCH D;  2KP8 A;  2OYH B;  2N1T D;  2CPB A;  2P1J A;  1J1E B;  1L4A C;  5AW3 B;  5APX A;  5KTB A;  3RL0 C;  2N1T C;  2IFN A;  5CCH C;  1LT9 A;  2PP6 A;  1LTG C;  3CL3 D;  3RK2 D;  4WBA A;  3TYY A;  1FOS F;  1FZA A;  2I1J A;  1FZG A;  3MD0 A;  3P8C D;  1JCC A;  2I1K A;  2Q3I A;  3MGN A;  2A45 I;  3M0D C;  3BAS A;  1M7L A;  1SVF A;  5AW9 B;  1JY3 N;  2NPS D;  2WPS A;  5CMZ A;  5APV A;  3GHG A;  2J58 A;  2FYZ A;  1NWQ A;  1GK4 A;  1GL2 B;  2PAJ A;  1IFD A;  3B5N B;  5KJ7 A;  3LIE A;  1JY2 P;  1NTZ K;  1M1J C;  3V2P A;  1FOS E;  1CI6 A;  3R2P A;  5KJ7 D;  3OJA B;  3H6P A;  2XDJ A;  3G3Z A;  3NTN A;  4LLH A;  2YNY A;  3M91 A;  1KIL B;  2M3B A;  2YKP A;  3H32 A;  2YO3 A;  3HUS A;  1JTH B;  1SLQ A;  3P8C E;  3B5N C;  5AW0 B;  1YTZ I;  2GUV A;  3HE4 B;  2KSJ A;  1RF0 A;  2C9N Y;  2R32 A;  5AVZ B;  3HE4 A;  3TNU B;  5CCG D;  1FDM A;  1A02 J;  1LTI C;  4HYT B;  4W7Z A;  2ZFC A;  2NPS A;  5AW4 B;  1KFN A;  2JEE A;  3IFM A;  4IFF A;  2OYH A;  2W6B A;  2HOD B;  1IFJ A;  1KFM A;  4OH8 B;  3VP9 A;  1FAV A;  1N7S B;  3L4F A;  3M06 A;  1CSB A;  2GUS A;  1URQ A;  2R5D A;  2WPQ A;  5APU A;  4DOJ A;  1DH3 A;  5CCG A;  1SQP K;  1JOC A;  3NFQ A;  1JCD A;  4DZO A;  2C9L Y;  3HRN A;  2YKO A;  3M9H A;  1H88 A;  2BAS A;  1GK6 A;  4M3L A;  1HUC A;  1RE3 A;  2ZXE B;  4KHX A;  1X79 B;  3E1I A;  3TSI A;  1RF1 A;  1SQX K;  2OYI C;  4B86 A;  5AW2 B;  1LWU A;  2Z5H A;  3V2Q A;  3HUS B;  1ZR4 A;  1AQ5 A;  1NH4 A;  1RE4 C;  1ZN5 A;  2XNX A;  3NXS A;  1NOH A;  1FZC A;  1MZ9 A;  3VN0 A;  4RES B;  3UIA A;  2MJZ A;  2IX7 C;  1IC2 A;  2A45 G;  2W6A A;  1N73 A;  1KZU B;  2WIT A;  3VOP A;  4N78 E;  1JY2 N;  2FXM A;  4W7Y A;  1G1I A;  4JYC A;  2FYU K;  1NU1 K;  5AW6 B;  2Q9I A;  1GL2 A;  1N73 B;  3T97 A;  1LTJ C;  3O8Z A;  3GHG B;  2P2U A;  3BAT A;  1LGH B;  3HD7 C;  4AUW A;  2CPS A;  4AQR D;  3HTK A;  5AVQ B;  2FFD A;  2N1T B;  5AW5 B;  3L37 A;  2E42 A;  3VMY A;  3N7N A;  1T3U A;  1JMM A;  1ZR2 A;  1W2E A;  5APT A;  5AW7 B;  1N7S C;  1HBW A;  1G2C B;  1HJB A;  2P67 A;  1FZB A;  2KB7 P;  3M9Q A;  3V2R A;  1A02 F;  2HYN A;  3HD7 B;  2QM7 A;  1G2C A;  5AVX B;  1JO5 A;  1LTJ B;  4XA4 A;  1GZL A;  2JJL A;  1VDF A;  2P7J A;  4N78 D;  2L5G B;  1S9K D;  2N9B A;  2N1T A;  4I2L C;  3P32 A;  1LT9 C;  2J59 M;  5AVU B;  2H43 A;  2WWW A;  1QL1 A;  3P7K A;  1ZV8 A;  4WY4 C;  4W80 A;  3I5C A;  1SFC A;  1Z56 A;  2XKM A;  4HH2 A;  2Q5U A;  1NKN A;  3KQG A;  1H8A A;  1HGV A;  3PP5 A;  3M0D A;  1T2K D;  1L4A B;  1N7L A;  1FZE A;  4IFD K;  1LTT C;  3M0A A;  1KIL C;  2HLO A;  2WPR A;  3GHG C;  2Z5I A;  2IPP A;  3VP8 A;  1SQQ K;  5KJ7 C;  1M1J A;  1NKZ B;  1GU5 A;  1J2J B;  3NMD A;  5APY A;  1JTH A;  1SQB K;  3U1A A;  2H8P D;  1HGZ A;  3SWF A;  2KYV A;  3V4W A;  1IFN A;  4WY4 D;  1URQ D;  1GW3 A;  2KOG A;  1JNM A;  5CJ0 A;  2WT7 A;  3MTU E;  3H32 B;  1L4A D;  3HUS C;  2YO2 A;  3V2N A;  1L4A A;  1NO4 A;  4N3Y B;  4ZKU A;  1RF0 C;  1XTG B;  2W27 A;  2Q7C A;  2XV5 A;  1URQ B;  3II6 A;  3MUD A;  5CCH A;  4EOT A;  1S9K E;  3RK2 C;  2NPS C;  1MFZ A;  1NTK K;  2OAR A;  1EQ7 A;  1SFC D;  2O1J A;  4I6M C;  4ZKP A;  3BRV B;  2OYH C;  1KQL A;  3KDP B;  1J1D C;  1RY3 A;  1FU1 A;  2VRS A;  3A5T A;  2C0W A;  1J1E C;  2WT7 B;  1VPC A;  1FZF A;  5APS A;  5AVT B;  3V4Q A;  1FZC B;  1FJP A;  1LTA C;  1MUU A;  2Z4E A;  1H89 A;  3HD7 D;  1FJK A;  4GIF A;  4I1L A;  3BVH A;  3RK2 B;  1URQ C;  3VYI A;  3OA7 A;  5CCG C;  1QL2 A;  2GM4 A;  1FBM A;  1JY3 P;  1LTB C;  3WMM 0;  1IFM A;  2A45 H;  4C7R A;  3B5N D;  3RK3 C;  3M9B A;  3V5B A;  3VMX A;  5APW A;  1N86 A;  1IFI A;  2O01 H;  4LGD E;  5BU5 A;  1PFI A;  1G1J A;  3A2A A;  4O9B A;  1RE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...