2NPSD

Crystal structure of the early endosomal snare complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
63
structure length
63
Chain Sequence
b'DEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 4
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 27
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsD00
1NHLA 2KOGA 2NPSD 3VOPA 1N7SD 3HD7B 2N1TD 1KILC 1L4AD 1SFCC 3TSIA 5KJ7A 3RK2B 3B5NA 4WY4A 1T3JA 4W7ZA 1KILD 5CCHA 2WZ7A 3RK3C 1SFCD 4JF7A 3B5NB 3HD7A 4WY4B 4W7YA 4N78E 3KYQA 1GL2A 1URQB 5CCGA 3RK3D 1URQC 1GL2B 3HD7C 2HFED 3RK2C 3RL0B 2NPSA 3M0DC 3HD7D 3HTKB 2YMYA 1N7SA 5KJ7C 2N1TA 1L4AA 3B5NC 4OH8B 2NPSB 4WY4C 3RK2D 2H8PD 1N7SB 2PP6A 1JTHA 2N1TB 3P8CE 1HVVA 5CCHC 1L4AB 4W80A 5KJ7D 1KILA 2XDJA 3B5ND 1SFCA 1GL2C 4WY4D 1JTHB 1URQD 5CCGC 5CCHD 1KILB 1SFCB 4LGDE 3RL0C 1GL2D 2M8RA 5CCGD 2NPSC 3RK3B 3RL0D 2HG5D 1N7SC 1URQA 2N1TC 1L4AC 1XTGB 3PP5A
chains in the Genus database with same CATH superfamily
1FZBA 1ZR2A 2Y9YA 3VOPA 3I5CA 2JWDA 1L0LG 2KS1B 2R44A 1LWUA 3HTKA 3OW2O 4D6TJ 5APXA 2ZJSE 3L74E 2B87A 3CX5I 1JNMA 3H1KD 3HUSB 3MIWA 4RKUJ 4YXWH 3M0AA 3G3ZA 1VQ5P 2CPSA 1EDKA 2HYNA 4PD4D 1S5LH 3VMYA 3MP7B 2B89A 4GT1A 2O3JA 3HD7D 3L72G 1LGHB 4U3FE 3R4YA 3LW5H 1FZCC 1P84H 2W90A 2RKLA 2M3BA 4ZKPA 2M5AA 2YMKA 2OGUA 2V7QH 2XDJA 5GTIH 1K8AQ 1KQGB 1YIJP 1EXJA 2KZIA 3G9RA 2ZAEB 3VMXA 2ZVNB 1Z56A 1G1IA 1IC2A 3C8VA 2O1JA 3H1IE 3CXHH 3L75E 1PZQA 1M56D 3HE5A 1KYOD 4HJGH 1GD2E 5GTHE 5B66E 1PGOA 3G4SP 5CHXA 3H1HG 1VQLP 2NPSD 2FKWB 2KSEA 1AV1A 2HR3A 4PD4H 1SQQG 1H0TA 1L4AD 5B5EE 4C7NA 2G8YA 4Y28J 3GHGC 5KLVD 1BE3E 2IZ0A 1FZCA 2FYUG 1MKMA 1NTZD 3D71A 5KLIB 3B71A 1FJPA 1IFMA 5CBOA 1EZVD 1X9VA 1CI6B 3L73G 1S2EA 2Y0EA 2Q5UA 2OYHB 3L4FA 3AEBC 1JY2N 1NTZK 1OVVA 1OW7A 1S1CX 3A0BH 1BGYG 4N6JA 3H1JJ 1T2KC 5E79E 2QJKB 3SFDC 1W2BO 3RK2C 2IBZG 3O6QA 3T97A 1SQVJ 3IFMA 1KMIZ 5AW7B 1OVRA 2BCCJ 4BRYA 2E75D 3UIAA 1T8ZA 5KJ7D 1GMJA 1CW5A 1SQXD 2WTYA 3GHGA 3AEFC 4ASWA 2XNDH 2IYOA 1USEA 1GK6A 2JP3A 2K88A 4RESB 1N86A 2KIKA 1VQNP 1SQXK 3WUTA 5DJUB 1L0LJ 1DD3A 1PGQA 2GM4A 1XTGB 2FFDB 1N2DC 1VL2A 2KYVA 3AEAC 4YPCA 2Q7CA 1Q90D 1N73B 2Z5HA 5BU5A 1M7LA 1KB9E 3AE5C 4DJGA 1GU4A 2K37A 2I1KA 2W27A 3L37A 3L71E 3H1LE 5GTHH 3L72J 2D2CB 4HYTB 1DX7A 4GODA 1K04A 1NTMD 2HFED 2KXPB 4H13D 2LXCB 3WMM0 4IFFA 1SQPE 5B5EH 4H0LB 3EQ2A 3L70D 1RHZB 1YBKA 2WT7B 1NTMK 2RMZA 4A7PA 2WPSA 5L8RJ 4L74A 4CPGA 1Q81Q 1HVVA 1YITP 3GLMA 2E74B 1GL2C 1AVYA 2E76C 1ZR4A 5KLVG 2KP8A 1JTHB 1FBMA 3MTUE 1S5LX 1NJIQ 1SQBD 5CCGC 1NTKE 1NTZG 2FYZA 3H1HJ 2N9YB 3IR9A 1EZVG 1MFZA 3D6YA 2BCCE 1SQQJ 2XZRA 2Q3IA 4JYBA 1SQBK 3AE8C 3NXSA 1IFIA 3E1RA 1G2CB 2FYUJ 3M9QA 3TGUE 2HLOA 2LXBA 1R8EA 3L73J 1JY3N 1ZV8A 2N1TD 1KILC 1J1DB 3V4QA 2PRRA 3CWBE 4R4LA 4HKZH 3A0HE 3CPWO 1BGYJ 3V2NA 1ZLLA 4GOFA 4UB8H 1LWUB 5AVRB 4L73A 1SQXG 3WUUA 1GL2A 1GW4A 5KAFE 2AEMA 5CCGA 2A45G 2B87B 5DJTB 1SQPK 5KKZC 2V7QJ 3CD6P 3CMEP 2YNYA 2ZXEB 2OYOA 4OH8B 3O8ZA 3FX0A 1KB9H 1QL1A 2Y0DA 1KILA 4AQRD 2KK7A 1QVGO 2M5AB 1NKZB 1OWAA 2L91A 5AVQB 1AQ5A 2AEFA 2B88A 2RN0A 2P2UA 3Q3DA 1YQ4C 3GF3A 3KXDA 1IFJA 1ZOYC 3L35A 3PTZA 1IO4A 2WSSH 3H6PA 2J58A 3HE5B 3IF4A 1NTMG 4Z1MH 1L0ND 2ZT9C 2JO1A 1RF1C 1G1JA 4L75A 2Y9ZA 4OVNF 1HJBA 3L70G 2OYIC 3CCEP 4YTPC 1Q82Q 5AW5B 1H0TB 1KILE 5AW6B 1L0NK 1GU5A 4C7NB 3SSUA 3R2PA 1UIIA 1FZCB 2JWAA 2FYUE 1FE6A 4N78D 4N3YB 1PFIA 5AVTB 1SQBG 2FXMA 3MUDC 3L73E 1J1EC 2P10A 3AECC 4PV1C 1NOHA 1ZP0C 4IOIH 2K9JA 3M91A 4LLHA 4UB6E 1R5SA 1X79B 5KLVJ 1QL2A 1NU1E 1NTZJ 3O6QB 5AW9B 3T97B 2NZ2A 3AE6C 3GMAA 1RF1A 1EDJA 1NWQA 4BRYB 2OYIA 1QEXA 4PJ0E 1SP4A 3CX5E 4GDOA 3GHGB 1PGJA 3V6IA 3AE4C 1LTBC 2H7HA 3OA7A 3MD0A 1HH0A 2HG5D 4DZOA 3MUDA 1N7SC 2J59M 1LT9C 1RY3A 2KOGA 5AW4B 1VQ8P 3A2AA 1SQXJ 1CZQA 2PGDA 2WSFH 4EIJA 3RK2B 1D7MA 1P84D 4Y99C 3BCCE 4WWIA 3VN0A 2QE7H 5AVSB 3MGNA 4IFDK 2C9NY 1YTZI 2IBZI 4EYYQ 2K3RA 2W83C 1BCCD 1UIXA 3AEGC 3CXHD 1HWTC 5AW3B 1PP9J 3CCLP 4M3LA 1N7SA 4BWNA 3RBZA 1LT9A 1E5WA 1YQ3C 4OGQC 4JYCA 5APYA 3SWFA 1L0NG 2PP6A 3B4SA 4MN4C 2KLUA 4AUWA 2WVRA 5EFWB 4AYCA 2HPCA 2FYNC 2D2CD 3FXEA 4KT0J 1NTMJ 4ZNCA 3N7NA 5TISE 3V2PA 4H0LD 4H44C 2WSEJ 1L2PA 1NO4A 1NHLA 1JOCA 3U1CA 1Y47A 1LTTC 2WPQA 5AVUB 2E74D 3I55P 1SQBJ 4PJ0H 1RE4C 4L76A 4RO0A 3CX5H 3TYYA 2ZXXA 4RJTA 3RK3C 4EOTA 3C9IA 3L74D 1URQB 3BATA 1YYCA 4YXDC 2MKVA 1KYOI 1GL2B 2E76B 3OAKA 1QX8A 2NRGA 4C7RA 2K9YA 4U3FD 5KAIH 1M90Q 2P58A 1IFNA 4I7ZC 5TJHA 1LP1A 1LTSC 1EZVI 5APVA 1RH5B 2A06E 4NPFX 1KILB 1RE4A 4D6TE 1HGZA 3JCUE 1PP9E 5CBNA 3EFGA 3H1ID 1NKNA 5APWA 1OIPA 1QGKB 3L75D 1PPJE 2ZVOB 2YO2A 2OTJP 2KUBA 2YXQB 5AVVB 1W2EA 3VTPC 2YO3A 5KKZB 2O1KA 4HH2A 1BE3D 3H1KG 2WSCH 1DEBA 4OWFA 1YTZT 2A45I 1ZRTE 4W7YA 4R4MA 3N4XA 5TISH 2KLVA 3RK3E 3QH9A 3KHUA 3NMDA 2R5DA 3HE4A 2KB7P 1JY2O 2CPBA 1L0NJ 2H89C 1BSHA 1MZ9A 3ABVC 1KZUB 3M0DC 2OARA 2K9JB 2W6AA 3S4RA 2K1AA 2Q3EA 1J2JB 3VMZA 1VQ7P 1BSNA 2ZYAA 5B66H 5CCHC 3P8CE 3AE9C 4W80A 3P8MC 5CMZA 2M3EA 1VF5C 2ZT9B 1R5LA 1RF1B 3EFFK 2IX7C 2J5UA 3MZWB 1QLED 2OYIB 1A02F 2GUVA 1LTJC 3Q5SA 3L74G 2WSFJ 3M9HA 2YXRB 3CLQA 1RQUA 1MV8A 3H1JE 1M57D 2MJZA 1Q7YQ 3GF7A 1J1EB 3M0DA 5E79H 1SFCC 1SQVE 4PV1B 1Q2NA 3V5BA 3C1LA 1GZLA 4U3FG 1ZXGA 3LIEA 2AXTE 1FZFA 3TNUA 5CCHA 1H89A 1KB9D 2QA4P 2I8DA 1ZW0A 1YI2P 3BRTB 3WU2E 2M0BA 3D70A 3L71D 3H1LD 2WITA 3CCRP 2QM7A 4IFMA 3I56P 3H1IG 1GW3A 1L0LE 1LTJA 2OTLP 1DH3A 1SQPD 1AA0A 3M06A 1LTIC 2QJPC 3HTKB 1EC5A 1T2KD 5AVXB 3B5NC 2DW3A 3NTNA 4WY4C 3RK2D 2QM8A 3LW5J 3M9BA 2IDBA 4GIFA 1N7SB 3FGAD 1LT9B 2YKOA 2ZFCA 3CC7P 2XNXA 2R3SA 1SFCA 3FWNA 3NFQA 3CI9A 1OMIA 1VDFA 3S9OA 1NTKD 2WQYC 3RL0C 1PV3A 2YIUC 2HPCB 2AXCA 3L72E 2BCCD 1OW8A 4Y99B 2OYHA 1FZEA 1NTKK 1KD1Q 1AFOA 3H1KJ 1FJKA 1S9KE 3AE3C 2C0XA 1OXZA 3A3YB 3TGUD 2E42A 1K9MQ 1S72P 3CWBD 3B5NA 1JY3O 2O01H 4WY4A 1VQPP 2R32A 4I1LA 4OGQB 1M1JC 3PRJA 1FDMA 3JC22 1AJYA 1IK9A 3H1HE 3HD7C 1SQQE 4NPDA 1YHQP 1KV4A 1K05A 1LJ2A 1X0TA 1HF9A 2WWWA 3CCMP 1AQTA 3Q2YA 1DD4A 4O9BA 4KJMA 4H44B 3KQGA 5CJ4A 2POHA 4NPEA 3L74J 2RH0A 1URQD 2BEQD 2E5TA 4DT0A 1JCCA 1BGYE 1S5LE 2KSJA 1LP1B 5APTA 3IN6A 1GDTA 2W6JH 1GL2D 2E76D 2M8RA 2IBZE 3A0HH 1S4XA 3JSVC 1M1JA 3U1AA 5CCGD 1AVOA 1IJDB 2NPSC 3RK3B 3U59A 1TU3F 3L71G 3H1LG 1L4AC 3HD7A 3KZIE 4U3FJ 5KAFH 2KZJA 1ZN5A 3GW6A 4WVZA 3P32A 4HB1A 1GK4A 1SQPG 4GKGA 1JB0J 1PL5A 1KILD 2JEEA 2GA1A 2HODA 2XU6A 1HGVA 2ZYGA 3Q5PA 3MHVA 3H1KE 3VP8A 3H1IJ 3KYQA 4JPZB 2FYUD 1U57A 2E43A 5AW2B 3F5HA 4BXLA 3ITKA 4I7ZB 1S3JA 1NTKG 3L73D 4PD4E 2Q6QA 2JDIH 3WUVA 1HBWA 1Y8AA 1WRGA 1RE3C 2FYUK 3AE1C 3B8EB 2QRXA 2NPSA 3HE4B 1JMMA 2E75C 1MUUA 3TF5A 3D6ZA 2G3AA 5KJ7C 1L4AA 1BDDA 1NU1D 1NAFA 4JBZA 5H2FE 1NH4A 1KTMA 3TGUG 1KORA 1P84I 3SWKA 3RGUA 2QEXP 3L36A 2BASA 3A0BE 1KN7A 1H8AA 2JJLA 4DCKA 3CWBG 3QWOC 1NU1K 2P1JA 3SFEC 1SS1A 3CX5D 1OX3A 4K35A 1KYOE 2H88C 3BASA 2QIWA 1OVUA 3VYIA 3CXHI 1YJ9P 5AVZB 5AW1B 3OJAB 4EDFA 1X8YA 5C39A 2ZYDA 5KTBA 3GG2A 1CSBA 1RE3A 1NAYA 4U7JA 5KLVE 3TSIA 5KJ7A 1RQVA 1NTZE 2C0WA 4I2LC 4PD4I 2ZT9D 4UB6H 2IFMA 2KNCA 3L70J 1EZVE 2Z5IA 2WZ7A 2OTKE 2QJYC 3V4WA 4H13C 2BEZF 2YKPA 3BCCD 1FOSF 3TNUB 2Z4EA 4XE5B 1VF5B 1JO5A 3KZIH 4JQ0D 1KQLA 2P67A 3USSA 5APQA 1DEEG 1EXIA 3BVHA 4PV1D 1LTJB 3II6A 2H8PD 4XFJA 3AE7C 3EWKA 1SQXE 5M1BA 2H43A 4EI2A 1LTAC 1U7JA 4IL6E 3L71J 3H1LJ 1W5CE 1DIPA 3Q1MA 1SFCB 1OFCX 2Y0CA 2R3CA 1BDCA 1YJWP 2PFXA 2FBWC 1IZNB 1SQPJ 2O01J 1JY2P 2N1TC 2QVAA 3V2RA 1FU1A 3E1IA 2ITAA 3P7KA 5KLVK 5CJ0A 4WB4A 5H2FH 1N7SD 5AW8B 1LTGC 1JEKA 3BRVB 1IK7A 1FS0E 3HRNA 3PJSK 4W7ZA 1NTKJ 1NU1G 2QJPB 4JF7A 2FXPA 3B5NB 1JCDA 4WY4B 1KYOH 1BCCG 3F89A 3CCVP 3W68A 4KHXA 1OZHA 2O01N 1NTME 1FDOA 2P7JA 3IAOA 4I6MC 3TGUJ 1M1KQ 3RL0B 2FY8A 3L70E 3V2QA 2YIUB 2IPPA 1PIXA 1SLQA 2N1TA 3CWBJ 4UB8E 3FWLA 1NYHA 3HUSC 3CC2P 4OGQD 1SQBE 2I1JA 4GOEA 3CMAP 2A06D 2IZ1A 2IYPA 3AEEC 4D6TD 3H25A 1MFTA 1KQSO 1VQ9P 1HTLC 1PP9D 3H32A 3CCJP 3BCCG 2UWJE 1H88A 1IFPA 3TDKA 1GTWA 1KQFB 1PPJD 1M1JB 2OQQA 1LNQA 4TT3H 1KFNA 5K5GB 2KS1A 3HD7B 3CCSP 4H44D 2GUSA 3CC4P 4IL6H 4ZMDA 2A45H 1K73Q 1Y9BA 1OW6A 3KPEA 3HUSA 3TK1A 1ZRTD 2HODB 3RK3D 3CCUP 3CL3D 1URQC 3PH0A 3A5TA 3K5BA 2W8ZA 5AVYB 1WMKA 3G6EP 3JCUH 3RBXA 5KLIC 1FC2C 4XA4A 2YMYA 3S1KA 2NPSB 3CCQP 2OYHC 1L4AB 3P8CD 1SVFA 1JY3P 1NVOA 2QSIA 1KB9I 4QMAA 3L75G 2QJKC 4ZKUA 3E7KA 1LT1A 3VMAA 1YJNP 2WMMA 1NGMB 5APSA 5AVWB 1VPCA 3A7OA 1URQA 2WSEH 1ZMEC 2AEJA 5AW0B 1L0NE 2VRSA 1NU1J 3H1JD 1BE3G 1U7MA 2KI7B 3G71P 1BCCJ 5BU8B 1JMBA 1SQVD 1RF0C 1CI6A 4LC1A 2E75B 2LR2A 2YKQA 2FXOA 2WPVB 2KNCB 4N78E 1KFMA 1SQVK 2FFDC 4DOJA 2Q9IA 2A06G 2L5GB 4ASVA 1HJ0A 2QG4A 4D6TG 2JR8A 1M8OB 1PP9G 2B9BA 1N73C 2V4HA 3W67A 1L0LD 2JKVA 1PPJG 1WT6A 2W6BA 1IFDA 3RL0g 1L0LK 2D2CC 3BCCJ 4TLFA 2FYNB 3ZDMA 1RF0A 1FOSE 1QVFO 5CCHD 3KDPB 3FXDA 4LGDE 3AE2C 1X22A 4C46A 1VF5D 4H0LC 2C9LY 2AXTH 1T3UA 1E79H 2FFDA 2E5YA 1T6AA 1FAVA 2SPZA 2QJYB 2IFNA 3L72D 4H13B 1PGPA 3WU2H 2Q1KA 4WBAA 2E74C 1S9KD 1N73A 3PHLA 2PAJA 2N9BA 2XKMA 3VP9A 1P84E 1T3JA 2WSCJ 1EDIA 2R5BA 3SWYA 1SFCD 5GTIE 1HUCA 1N7LA 5BVZA 1FZGA 1VQKP 2WPRA 3H1HD 1BCCE 1J1DC 4IL6X 1JUNA 1A02J 3CXHE 2WT7A 1VQMP 1SQQD 3PLNA 1N8RQ 1KC8Q 3Q5RA 3LIDA 1VQ6P 2LKMA 3L75J 1Q86Q 1LWUC 2CK3H 1FDIA 3H1JG 1USDA 1JTHA 2N1TB 1SQQK 1XTCC 1EQ7A 3B5ND 4WY4D 1SQVG 1FZAA 2XV5A 2BCCG 1EDLA 1BGYD 1VQOP 1JM0A 1BE3J 4B86A 2IBZD 1G2CA 5APUA 5KAIE 3AEDC 4K3AA 3RL0D 1VQ4P 3H32B 3PP5A
chains in the Genus database with same CATH topology
3HE5B 3E1IA 1FZBA 1ZR2A 3P7KA 5KLVK 5CJ0A 4WB4A 2MJZA 3VOPA 1RF1C 1G1JA 1N7SD 1J1EB 3I5CA 3M0DA 1HJBA 5AW8B 1LTGC 1SFCC 3BRVB 2OYIC 3V5BA 3HRNA 1GZLA 5AW5B 1LWUA 3HTKA 5AW6B 3LIEA 1L0NK 4W7ZA 4C7NB 1GU5A 1FZFA 3TNUA 5CCHA 1H89A 4JF7A 5APXA 3B5NB 3R2PA 1JCDA 1FZCB 4WY4B 3BRTB 1JNMA 4N78D 4N3YB 3HUSB 3MIWA 1PFIA 5AVTB 4KHXA 3M0AA 3G3ZA 2FXMA 2WITA 2CPSA 1J1EC 2HYNA 2QM7A 4IFMA 2P7JA 1NOHA 4I6MC 3VMYA 3M91A 4LLHA 1GW3A 1LTJA 3RL0B 4GT1A 1DH3A 3V2QA 3HD7D 3M06A 2IPPA 1SLQA 1LTIC 1X79B 3HTKB 1LGHB 2N1TA 1T2KD 5AVXB 1QL2A 3B5NC 3LW5H 1FZCC 3NTNA 4WY4C 3RK2D 2QM8A 5AW9B 3M9BA 4GIFA 1N7SB 2M3BA 1LT9B 2YKOA 2ZFCA 3HUSC 4ZKPA 1RF1A 1NWQA 2XNXA 2XDJA 1SFCA 2OYIA 2I1JA 3NFQA 3CI9A 1VDFA 3VMXA 1SP4A 1Z56A 1G1IA 3GHGB 1IC2A 3RL0C 2O1JA 1HTLC 3H32A 2HPCB 1LTBC 2H7HA 3HE5A 3OA7A 3MD0A 1H88A 1HH0A 1GD2E 2HG5D 4Y99B 4DZOA 3MUDA 2OYHA 1N7SC 1GTWA 1FZEA 1NTKK 2J59M 1LT9C 1M1JB 5CHXA 1AFOA 1RY3A 1FJKA 2KOGA 1S9KE 2NPSD 2C0XA 5AW4B 1OXZA 1KFNA 3A3YB 2FKWB 2E42A 3HD7B 1L4AD 3A2AA 2GUSA 1CZQA 4C7NA 3GHGC 2WSFH 4EIJA 2A45H 3RK2B 3B5NA 1FZCA 1JY3O 2O01H 4WY4A 1FJPA 3KPEA 1IFMA 3HUSA 1X9VA 4Y99C 1CI6B 2R32A 4I1LA 3VN0A 5AVSB 1M1JC 3MGNA 3TK1A 4IFDK 2Q5UA 2OYHB 1FDMA 3L4FA 2HODB 2C9NY 1JY2N 1NTZK 1YTZI 1IK9A 3RK3D 3CL3D 1URQC 3HD7C 3A5TA 4N6JA 1T2KC 3RK2C 5AVYB 1HWTC 5AW3B 3T97A 4XA4A 2YMYA 1N7SA 4M3LA 3IFMA 1LT9A 5AW7B 2WWWA 1E5WA 2NPSB 4JYCA 5APYA 3SWFA 4O9BA 2OYHC 2PP6A 3UIAA 1L4AB 1T8ZA 3P8CD 5KJ7D 3KQGA 1SVFA 1JY3P 5CJ4A 2POHA 1CW5A 2WTYA 3GHGA 4AUWA 1URQD 4AYCA 4ZKUA 1JCCA 2KSJA 1GK6A 2HPCA 5APTA 1GDTA 4RESB 1GL2D 1N86A 3N7NA 2M8RA 1SQXK 1M1JA 5APSA 3U1AA 5CCGD 3V2PA 1IJDB 2NPSC 5AVWB 3RK3B 1VPCA 3U59A 3A7OA 1URQA 2WSEH 1L4AC 1XTGB 2GM4A 3HD7A 2FFDB 5AW0B 1N2DC 1NO4A 2VRSA 1NHLA 1JOCA 2KYVA 1ZN5A 3P32A 1GK4A 3U1CA 2Q7CA 5BU8B 1LTTC 2WPQA 5AVUB 1RF0C 1N73B 1CI6A 4GKGA 1RE4C 4LC1A 3TYYA 2Z5HA 2YKQA 1KILD 2JEEA 5BU5A 1M7LA 2HODA 3RK3C 4EOTA 2XU6A 1HGVA 3C9IA 1GU4A 2I1KA 3VP8A 4N78E 2W27A 3KYQA 3L37A 1KFMA 1SQVK 1URQB 2FFDC 4DOJA 2E43A 5AW2B 3BATA 4HYTB 1YYCA 1DX7A 2Q9IA 2L5GB 1GL2B 2HFED 3OAKA 3WMM0 1HBWA 1WRGA 1RE3C 2FYUK 4IFFA 1N73C 3B8EB 3HE4B 2NPSA 1JMMA 1MUUA 3EQ2A 4C7RA 5KJ7C 2WT7B 1L4AA 1WT6A 1NTMK 2W6BA 1IFDA 2WPSA 1NAFA 1IFNA 1HVVA 1NH4A 1L0LK 3L36A 2BASA 1GL2C 1LTSC 1ZR4A 1H8AA 2JJLA 1JTHB 2KP8A 5APVA 1FBMA 1RF0A 3MTUE 1FOSE 5CCGC 5CCHD 1KILB 1NU1K 1RE4A 2P1JA 3KDPB 4LGDE 2FYZA 4C46A 1HGZA 3IR9A 1MFZA 2C9LY 3EFGA 1NKNA 5APWA 1T3UA 3BASA 2XZRA 2FFDA 2Q3IA 4JYBA 1SQBK 1FAVA 2IFNA 3NXSA 1IFIA 3VYIA 2YO2A 5AVZB 5AW1B 3OJAB 1G2CB 1X8YA 3M9QA 4WBAA 5KTBA 5AVVB 1CSBA 2HLOA 1S9KD 1W2EA 3VTPC 1N73A 1RE3A 2YO3A 1JY3N 1ZV8A 2N1TD 2PAJA 1KILC 1J1DB 2N9BA 3V4QA 3TSIA 5KJ7A 2O1KA 4HH2A 2C0WA 2XKMA 4I2LC 3VP9A 2WSCH 2IFMA 1T3JA 1DEBA 2R5BA 3SWYA 3V2NA 2Z5IA 2WZ7A 1SFCD 1YTZT 1ZLLA 2A45I 1LWUB 4W7YA 3N4XA 5AVRB 3V4WA 1HUCA 1FOSF 2KLVA 2YKPA 1GL2A 1GW4A 1N7LA 3TNUB 5BVZA 1FZGA 2Z4EA 4XE5B 5CCGA 3NMDA 2A45G 2WPRA 2R5DA 1JO5A 3HE4A 1SQPK 1J1DC 2KB7P 1JUNA 1JY2O 2CPBA 1A02J 1MZ9A 2WT7A 1KQLA 2P67A 1KZUB 2YNYA 3M0DC 5APQA 2ZXEB 3LIDA 2OARA 3BVHA 2LKMA 2W6AA 1LTJB 4OH8B 3O8ZA 1LWUC 1J2JB 3II6A 3VMZA 2H8PD 5CCHC 1JTHA 2N1TB 3P8CE 1SQQK 4W80A 1QL1A 1XTCC 3P8MC 5CMZA 1EQ7A 1KILA 2H43A 1LTAC 3B5ND 4AQRD 4WY4D 1RF1B 1FZAA 1NKZB 1OWAA 2XV5A 5AVQB 1AQ5A 2IX7C 1SFCB 2OYIB 1A02F 2GUVA 2R3CA 4B86A 2P2UA 1LTJC 1G2CA 3M9HA 5APUA 3RL0D 3CLQA 1IFJA 3L35A 1IO4A 1JY2P 2N1TC 3H32B 1MV8A 3H6PA 2J58A 3V2RA 1FU1A 3PP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHL A;  2KOG A;  2NPS D;  3VOP A;  1N7S D;  3HD7 B;  2N1T D;  1KIL C;  1L4A D;  1SFC C;  3TSI A;  5KJ7 A;  3RK2 B;  3B5N A;  4WY4 A;  1T3J A;  4W7Z A;  1KIL D;  5CCH A;  2WZ7 A;  3RK3 C;  1SFC D;  4JF7 A;  3B5N B;  3HD7 A;  4WY4 B;  4W7Y A;  4N78 E;  3KYQ A;  1GL2 A;  1URQ B;  5CCG A;  3RK3 D;  1URQ C;  1GL2 B;  3HD7 C;  2HFE D;  3RK2 C;  3RL0 B;  2NPS A;  3M0D C;  3HD7 D;  3HTK B;  2YMY A;  1N7S A;  5KJ7 C;  2N1T A;  1L4A A;  3B5N C;  4OH8 B;  2NPS B;  4WY4 C;  3RK2 D;  2H8P D;  1N7S B;  2PP6 A;  1JTH A;  2N1T B;  3P8C E;  1HVV A;  5CCH C;  1L4A B;  4W80 A;  5KJ7 D;  1KIL A;  2XDJ A;  3B5N D;  1SFC A;  1GL2 C;  4WY4 D;  1JTH B;  1URQ D;  5CCG C;  5CCH D;  1KIL B;  1SFC B;  4LGD E;  3RL0 C;  1GL2 D;  2M8R A;  5CCG D;  2NPS C;  3RK3 B;  3RL0 D;  2HG5 D;  1N7S C;  1URQ A;  2N1T C;  1L4A C;  1XTG B;  3PP5 A; 
#chains in the Genus database with same CATH topology
 1FZB A;  1ZR2 A;  2Y9Y A;  3VOP A;  3I5C A;  2JWD A;  1L0L G;  2KS1 B;  2R44 A;  1LWU A;  3HTK A;  3OW2 O;  4D6T J;  5APX A;  2ZJS E;  3L74 E;  2B87 A;  3CX5 I;  1JNM A;  3H1K D;  3HUS B;  3MIW A;  4RKU J;  4YXW H;  3M0A A;  3G3Z A;  1VQ5 P;  2CPS A;  1EDK A;  2HYN A;  4PD4 D;  1S5L H;  3VMY A;  3MP7 B;  2B89 A;  4GT1 A;  2O3J A;  3HD7 D;  3L72 G;  1LGH B;  4U3F E;  3R4Y A;  3LW5 H;  1FZC C;  1P84 H;  2W90 A;  2RKL A;  2M3B A;  4ZKP A;  2M5A A;  2YMK A;  2OGU A;  2V7Q H;  2XDJ A;  5GTI H;  1K8A Q;  1KQG B;  1YIJ P;  1EXJ A;  2KZI A;  3G9R A;  2ZAE B;  3VMX A;  2ZVN B;  1Z56 A;  1G1I A;  1IC2 A;  3C8V A;  2O1J A;  3H1I E;  3CXH H;  3L75 E;  1PZQ A;  1M56 D;  3HE5 A;  1KYO D;  4HJG H;  1GD2 E;  5GTH E;  5B66 E;  1PGO A;  3G4S P;  5CHX A;  3H1H G;  1VQL P;  2NPS D;  2FKW B;  2KSE A;  1AV1 A;  2HR3 A;  4PD4 H;  1SQQ G;  1H0T A;  1L4A D;  5B5E E;  4C7N A;  2G8Y A;  4Y28 J;  3GHG C;  5KLV D;  1BE3 E;  2IZ0 A;  1FZC A;  2FYU G;  1MKM A;  1NTZ D;  3D71 A;  5KLI B;  3B71 A;  1FJP A;  1IFM A;  5CBO A;  1EZV D;  1X9V A;  1CI6 B;  3L73 G;  1S2E A;  2Y0E A;  2Q5U A;  2OYH B;  3L4F A;  3AEB C;  1JY2 N;  1NTZ K;  1OVV A;  1OW7 A;  1S1C X;  3A0B H;  1BGY G;  4N6J A;  3H1J J;  1T2K C;  5E79 E;  2QJK B;  3SFD C;  1W2B O;  3RK2 C;  2IBZ G;  3O6Q A;  3T97 A;  1SQV J;  3IFM A;  1KMI Z;  5AW7 B;  1OVR A;  2BCC J;  4BRY A;  2E75 D;  3UIA A;  1T8Z A;  5KJ7 D;  1GMJ A;  1CW5 A;  1SQX D;  2WTY A;  3GHG A;  3AEF C;  4ASW A;  2XND H;  2IYO A;  1USE A;  1GK6 A;  2JP3 A;  2K88 A;  4RES B;  1N86 A;  2KIK A;  1VQN P;  1SQX K;  3WUT A;  5DJU B;  1L0L J;  1DD3 A;  1PGQ A;  2GM4 A;  1XTG B;  2FFD B;  1N2D C;  1VL2 A;  2KYV A;  3AEA C;  4YPC A;  2Q7C A;  1Q90 D;  1N73 B;  2Z5H A;  5BU5 A;  1M7L A;  1KB9 E;  3AE5 C;  4DJG A;  1GU4 A;  2K37 A;  2I1K A;  2W27 A;  3L37 A;  3L71 E;  3H1L E;  5GTH H;  3L72 J;  2D2C B;  4HYT B;  1DX7 A;  4GOD A;  1K04 A;  1NTM D;  2HFE D;  2KXP B;  4H13 D;  2LXC B;  3WMM 0;  4IFF A;  1SQP E;  5B5E H;  4H0L B;  3EQ2 A;  3L70 D;  1RHZ B;  1YBK A;  2WT7 B;  1NTM K;  2RMZ A;  4A7P A;  2WPS A;  5L8R J;  4L74 A;  4CPG A;  1Q81 Q;  1HVV A;  1YIT P;  3GLM A;  2E74 B;  1GL2 C;  1AVY A;  2E76 C;  1ZR4 A;  5KLV G;  2KP8 A;  1JTH B;  1FBM A;  3MTU E;  1S5L X;  1NJI Q;  1SQB D;  5CCG C;  1NTK E;  1NTZ G;  2FYZ A;  3H1H J;  2N9Y B;  3IR9 A;  1EZV G;  1MFZ A;  3D6Y A;  2BCC E;  1SQQ J;  2XZR A;  2Q3I A;  4JYB A;  1SQB K;  3AE8 C;  3NXS A;  1IFI A;  3E1R A;  1G2C B;  2FYU J;  3M9Q A;  3TGU E;  2HLO A;  2LXB A;  1R8E A;  3L73 J;  1JY3 N;  1ZV8 A;  2N1T D;  1KIL C;  1J1D B;  3V4Q A;  2PRR A;  3CWB E;  4R4L A;  4HKZ H;  3A0H E;  3CPW O;  1BGY J;  3V2N A;  1ZLL A;  4GOF A;  4UB8 H;  1LWU B;  5AVR B;  4L73 A;  1SQX G;  3WUU A;  1GL2 A;  1GW4 A;  5KAF E;  2AEM A;  5CCG A;  2A45 G;  2B87 B;  5DJT B;  1SQP K;  5KKZ C;  2V7Q J;  3CD6 P;  3CME P;  2YNY A;  2ZXE B;  2OYO A;  4OH8 B;  3O8Z A;  3FX0 A;  1KB9 H;  1QL1 A;  2Y0D A;  1KIL A;  4AQR D;  2KK7 A;  1QVG O;  2M5A B;  1NKZ B;  1OWA A;  2L91 A;  5AVQ B;  1AQ5 A;  2AEF A;  2B88 A;  2RN0 A;  2P2U A;  3Q3D A;  1YQ4 C;  3GF3 A;  3KXD A;  1IFJ A;  1ZOY C;  3L35 A;  3PTZ A;  1IO4 A;  2WSS H;  3H6P A;  2J58 A;  3HE5 B;  3IF4 A;  1NTM G;  4Z1M H;  1L0N D;  2ZT9 C;  2JO1 A;  1RF1 C;  1G1J A;  4L75 A;  2Y9Z A;  4OVN F;  1HJB A;  3L70 G;  2OYI C;  3CCE P;  4YTP C;  1Q82 Q;  5AW5 B;  1H0T B;  1KIL E;  5AW6 B;  1L0N K;  1GU5 A;  4C7N B;  3SSU A;  3R2P A;  1UII A;  1FZC B;  2JWA A;  2FYU E;  1FE6 A;  4N78 D;  4N3Y B;  1PFI A;  5AVT B;  1SQB G;  2FXM A;  3MUD C;  3L73 E;  1J1E C;  2P10 A;  3AEC C;  4PV1 C;  1NOH A;  1ZP0 C;  4IOI H;  2K9J A;  3M91 A;  4LLH A;  4UB6 E;  1R5S A;  1X79 B;  5KLV J;  1QL2 A;  1NU1 E;  1NTZ J;  3O6Q B;  5AW9 B;  3T97 B;  2NZ2 A;  3AE6 C;  3GMA A;  1RF1 A;  1EDJ A;  1NWQ A;  4BRY B;  2OYI A;  1QEX A;  4PJ0 E;  1SP4 A;  3CX5 E;  4GDO A;  3GHG B;  1PGJ A;  3V6I A;  3AE4 C;  1LTB C;  2H7H A;  3OA7 A;  3MD0 A;  1HH0 A;  2HG5 D;  4DZO A;  3MUD A;  1N7S C;  2J59 M;  1LT9 C;  1RY3 A;  2KOG A;  5AW4 B;  1VQ8 P;  3A2A A;  1SQX J;  1CZQ A;  2PGD A;  2WSF H;  4EIJ A;  3RK2 B;  1D7M A;  1P84 D;  4Y99 C;  3BCC E;  4WWI A;  3VN0 A;  2QE7 H;  5AVS B;  3MGN A;  4IFD K;  2C9N Y;  1YTZ I;  2IBZ I;  4EYY Q;  2K3R A;  2W83 C;  1BCC D;  1UIX A;  3AEG C;  3CXH D;  1HWT C;  5AW3 B;  1PP9 J;  3CCL P;  4M3L A;  1N7S A;  4BWN A;  3RBZ A;  1LT9 A;  1E5W A;  1YQ3 C;  4OGQ C;  4JYC A;  5APY A;  3SWF A;  1L0N G;  2PP6 A;  3B4S A;  4MN4 C;  2KLU A;  4AUW A;  2WVR A;  5EFW B;  4AYC A;  2HPC A;  2FYN C;  2D2C D;  3FXE A;  4KT0 J;  1NTM J;  4ZNC A;  3N7N A;  5TIS E;  3V2P A;  4H0L D;  4H44 C;  2WSE J;  1L2P A;  1NO4 A;  1NHL A;  1JOC A;  3U1C A;  1Y47 A;  1LTT C;  2WPQ A;  5AVU B;  2E74 D;  3I55 P;  1SQB J;  4PJ0 H;  1RE4 C;  4L76 A;  4RO0 A;  3CX5 H;  3TYY A;  2ZXX A;  4RJT A;  3RK3 C;  4EOT A;  3C9I A;  3L74 D;  1URQ B;  3BAT A;  1YYC A;  4YXD C;  2MKV A;  1KYO I;  1GL2 B;  2E76 B;  3OAK A;  1QX8 A;  2NRG A;  4C7R A;  2K9Y A;  4U3F D;  5KAI H;  1M90 Q;  2P58 A;  1IFN A;  4I7Z C;  5TJH A;  1LP1 A;  1LTS C;  1EZV I;  5APV A;  1RH5 B;  2A06 E;  4NPF X;  1KIL B;  1RE4 A;  4D6T E;  1HGZ A;  3JCU E;  1PP9 E;  5CBN A;  3EFG A;  3H1I D;  1NKN A;  5APW A;  1OIP A;  1QGK B;  3L75 D;  1PPJ E;  2ZVO B;  2YO2 A;  2OTJ P;  2KUB A;  2YXQ B;  5AVV B;  1W2E A;  3VTP C;  2YO3 A;  5KKZ B;  2O1K A;  4HH2 A;  1BE3 D;  3H1K G;  2WSC H;  1DEB A;  4OWF A;  1YTZ T;  2A45 I;  1ZRT E;  4W7Y A;  4R4M A;  3N4X A;  5TIS H;  2KLV A;  3RK3 E;  3QH9 A;  3KHU A;  3NMD A;  2R5D A;  3HE4 A;  2KB7 P;  1JY2 O;  2CPB A;  1L0N J;  2H89 C;  1BSH A;  1MZ9 A;  3ABV C;  1KZU B;  3M0D C;  2OAR A;  2K9J B;  2W6A A;  3S4R A;  2K1A A;  2Q3E A;  1J2J B;  3VMZ A;  1VQ7 P;  1BSN A;  2ZYA A;  5B66 H;  5CCH C;  3P8C E;  3AE9 C;  4W80 A;  3P8M C;  5CMZ A;  2M3E A;  1VF5 C;  2ZT9 B;  1R5L A;  1RF1 B;  3EFF K;  2IX7 C;  2J5U A;  3MZW B;  1QLE D;  2OYI B;  1A02 F;  2GUV A;  1LTJ C;  3Q5S A;  3L74 G;  2WSF J;  3M9H A;  2YXR B;  3CLQ A;  1RQU A;  1MV8 A;  3H1J E;  1M57 D;  2MJZ A;  1Q7Y Q;  3GF7 A;  1J1E B;  3M0D A;  5E79 H;  1SFC C;  1SQV E;  4PV1 B;  1Q2N A;  3V5B A;  3C1L A;  1GZL A;  4U3F G;  1ZXG A;  3LIE A;  2AXT E;  1FZF A;  3TNU A;  5CCH A;  1H89 A;  1KB9 D;  2QA4 P;  2I8D A;  1ZW0 A;  1YI2 P;  3BRT B;  3WU2 E;  2M0B A;  3D70 A;  3L71 D;  3H1L D;  2WIT A;  3CCR P;  2QM7 A;  4IFM A;  3I56 P;  3H1I G;  1GW3 A;  1L0L E;  1LTJ A;  2OTL P;  1DH3 A;  1SQP D;  1AA0 A;  3M06 A;  1LTI C;  2QJP C;  3HTK B;  1EC5 A;  1T2K D;  5AVX B;  3B5N C;  2DW3 A;  3NTN A;  4WY4 C;  3RK2 D;  2QM8 A;  3LW5 J;  3M9B A;  2IDB A;  4GIF A;  1N7S B;  3FGA D;  1LT9 B;  2YKO A;  2ZFC A;  3CC7 P;  2XNX A;  2R3S A;  1SFC A;  3FWN A;  3NFQ A;  3CI9 A;  1OMI A;  1VDF A;  3S9O A;  1NTK D;  2WQY C;  3RL0 C;  1PV3 A;  2YIU C;  2HPC B;  2AXC A;  3L72 E;  2BCC D;  1OW8 A;  4Y99 B;  2OYH A;  1FZE A;  1NTK K;  1KD1 Q;  1AFO A;  3H1K J;  1FJK A;  1S9K E;  3AE3 C;  2C0X A;  1OXZ A;  3A3Y B;  3TGU D;  2E42 A;  1K9M Q;  1S72 P;  3CWB D;  3B5N A;  1JY3 O;  2O01 H;  4WY4 A;  1VQP P;  2R32 A;  4I1L A;  4OGQ B;  1M1J C;  3PRJ A;  1FDM A;  3JC2 2;  1AJY A;  1IK9 A;  3H1H E;  3HD7 C;  1SQQ E;  4NPD A;  1YHQ P;  1KV4 A;  1K05 A;  1LJ2 A;  1X0T A;  1HF9 A;  2WWW A;  3CCM P;  1AQT A;  3Q2Y A;  1DD4 A;  4O9B A;  4KJM A;  4H44 B;  3KQG A;  5CJ4 A;  2POH A;  4NPE A;  3L74 J;  2RH0 A;  1URQ D;  2BEQ D;  2E5T A;  4DT0 A;  1JCC A;  1BGY E;  1S5L E;  2KSJ A;  1LP1 B;  5APT A;  3IN6 A;  1GDT A;  2W6J H;  1GL2 D;  2E76 D;  2M8R A;  2IBZ E;  3A0H H;  1S4X A;  3JSV C;  1M1J A;  3U1A A;  5CCG D;  1AVO A;  1IJD B;  2NPS C;  3RK3 B;  3U59 A;  1TU3 F;  3L71 G;  3H1L G;  1L4A C;  3HD7 A;  3KZI E;  4U3F J;  5KAF H;  2KZJ A;  1ZN5 A;  3GW6 A;  4WVZ A;  3P32 A;  4HB1 A;  1GK4 A;  1SQP G;  4GKG A;  1JB0 J;  1PL5 A;  1KIL D;  2JEE A;  2GA1 A;  2HOD A;  2XU6 A;  1HGV A;  2ZYG A;  3Q5P A;  3MHV A;  3H1K E;  3VP8 A;  3H1I J;  3KYQ A;  4JPZ B;  2FYU D;  1U57 A;  2E43 A;  5AW2 B;  3F5H A;  4BXL A;  3ITK A;  4I7Z B;  1S3J A;  1NTK G;  3L73 D;  4PD4 E;  2Q6Q A;  2JDI H;  3WUV A;  1HBW A;  1Y8A A;  1WRG A;  1RE3 C;  2FYU K;  3AE1 C;  3B8E B;  2QRX A;  2NPS A;  3HE4 B;  1JMM A;  2E75 C;  1MUU A;  3TF5 A;  3D6Z A;  2G3A A;  5KJ7 C;  1L4A A;  1BDD A;  1NU1 D;  1NAF A;  4JBZ A;  5H2F E;  1NH4 A;  1KTM A;  3TGU G;  1KOR A;  1P84 I;  3SWK A;  3RGU A;  2QEX P;  3L36 A;  2BAS A;  3A0B E;  1KN7 A;  1H8A A;  2JJL A;  4DCK A;  3CWB G;  3QWO C;  1NU1 K;  2P1J A;  3SFE C;  1SS1 A;  3CX5 D;  1OX3 A;  4K35 A;  1KYO E;  2H88 C;  3BAS A;  2QIW A;  1OVU A;  3VYI A;  3CXH I;  1YJ9 P;  5AVZ B;  5AW1 B;  3OJA B;  4EDF A;  1X8Y A;  5C39 A;  2ZYD A;  5KTB A;  3GG2 A;  1CSB A;  1RE3 A;  1NAY A;  4U7J A;  5KLV E;  3TSI A;  5KJ7 A;  1RQV A;  1NTZ E;  2C0W A;  4I2L C;  4PD4 I;  2ZT9 D;  4UB6 H;  2IFM A;  2KNC A;  3L70 J;  1EZV E;  2Z5I A;  2WZ7 A;  2OTK E;  2QJY C;  3V4W A;  4H13 C;  2BEZ F;  2YKP A;  3BCC D;  1FOS F;  3TNU B;  2Z4E A;  4XE5 B;  1VF5 B;  1JO5 A;  3KZI H;  4JQ0 D;  1KQL A;  2P67 A;  3USS A;  5APQ A;  1DEE G;  1EXI A;  3BVH A;  4PV1 D;  1LTJ B;  3II6 A;  2H8P D;  4XFJ A;  3AE7 C;  3EWK A;  1SQX E;  5M1B A;  2H43 A;  4EI2 A;  1LTA C;  1U7J A;  4IL6 E;  3L71 J;  3H1L J;  1W5C E;  1DIP A;  3Q1M A;  1SFC B;  1OFC X;  2Y0C A;  2R3C A;  1BDC A;  1YJW P;  2PFX A;  2FBW C;  1IZN B;  1SQP J;  2O01 J;  1JY2 P;  2N1T C;  2QVA A;  3V2R A;  1FU1 A;  3E1I A;  2ITA A;  3P7K A;  5KLV K;  5CJ0 A;  4WB4 A;  5H2F H;  1N7S D;  5AW8 B;  1LTG C;  1JEK A;  3BRV B;  1IK7 A;  1FS0 E;  3HRN A;  3PJS K;  4W7Z A;  1NTK J;  1NU1 G;  2QJP B;  4JF7 A;  2FXP A;  3B5N B;  1JCD A;  4WY4 B;  1KYO H;  1BCC G;  3F89 A;  3CCV P;  3W68 A;  4KHX A;  1OZH A;  2O01 N;  1NTM E;  1FDO A;  2P7J A;  3IAO A;  4I6M C;  3TGU J;  1M1K Q;  3RL0 B;  2FY8 A;  3L70 E;  3V2Q A;  2YIU B;  2IPP A;  1PIX A;  1SLQ A;  2N1T A;  3CWB J;  4UB8 E;  3FWL A;  1NYH A;  3HUS C;  3CC2 P;  4OGQ D;  1SQB E;  2I1J A;  4GOE A;  3CMA P;  2A06 D;  2IZ1 A;  2IYP A;  3AEE C;  4D6T D;  3H25 A;  1MFT A;  1KQS O;  1VQ9 P;  1HTL C;  1PP9 D;  3H32 A;  3CCJ P;  3BCC G;  2UWJ E;  1H88 A;  1IFP A;  3TDK A;  1GTW A;  1KQF B;  1PPJ D;  1M1J B;  2OQQ A;  1LNQ A;  4TT3 H;  1KFN A;  5K5G B;  2KS1 A;  3HD7 B;  3CCS P;  4H44 D;  2GUS A;  3CC4 P;  4IL6 H;  4ZMD A;  2A45 H;  1K73 Q;  1Y9B A;  1OW6 A;  3KPE A;  3HUS A;  3TK1 A;  1ZRT D;  2HOD B;  3RK3 D;  3CCU P;  3CL3 D;  1URQ C;  3PH0 A;  3A5T A;  3K5B A;  2W8Z A;  5AVY B;  1WMK A;  3G6E P;  3JCU H;  3RBX A;  5KLI C;  1FC2 C;  4XA4 A;  2YMY A;  3S1K A;  2NPS B;  3CCQ P;  2OYH C;  1L4A B;  3P8C D;  1SVF A;  1JY3 P;  1NVO A;  2QSI A;  1KB9 I;  4QMA A;  3L75 G;  2QJK C;  4ZKU A;  3E7K A;  1LT1 A;  3VMA A;  1YJN P;  2WMM A;  1NGM B;  5APS A;  5AVW B;  1VPC A;  3A7O A;  1URQ A;  2WSE H;  1ZME C;  2AEJ A;  5AW0 B;  1L0N E;  2VRS A;  1NU1 J;  3H1J D;  1BE3 G;  1U7M A;  2KI7 B;  3G71 P;  1BCC J;  5BU8 B;  1JMB A;  1SQV D;  1RF0 C;  1CI6 A;  4LC1 A;  2E75 B;  2LR2 A;  2YKQ A;  2FXO A;  2WPV B;  2KNC B;  4N78 E;  1KFM A;  1SQV K;  2FFD C;  4DOJ A;  2Q9I A;  2A06 G;  2L5G B;  4ASV A;  1HJ0 A;  2QG4 A;  4D6T G;  2JR8 A;  1M8O B;  1PP9 G;  2B9B A;  1N73 C;  2V4H A;  3W67 A;  1L0L D;  2JKV A;  1PPJ G;  1WT6 A;  2W6B A;  1IFD A;  3RL0 g;  1L0L K;  2D2C C;  3BCC J;  4TLF A;  2FYN B;  3ZDM A;  1RF0 A;  1FOS E;  1QVF O;  5CCH D;  3KDP B;  3FXD A;  4LGD E;  3AE2 C;  1X22 A;  4C46 A;  1VF5 D;  4H0L C;  2C9L Y;  2AXT H;  1T3U A;  1E79 H;  2FFD A;  2E5Y A;  1T6A A;  1FAV A;  2SPZ A;  2QJY B;  2IFN A;  3L72 D;  4H13 B;  1PGP A;  3WU2 H;  2Q1K A;  4WBA A;  2E74 C;  1S9K D;  1N73 A;  3PHL A;  2PAJ A;  2N9B A;  2XKM A;  3VP9 A;  1P84 E;  1T3J A;  2WSC J;  1EDI A;  2R5B A;  3SWY A;  1SFC D;  5GTI E;  1HUC A;  1N7L A;  5BVZ A;  1FZG A;  1VQK P;  2WPR A;  3H1H D;  1BCC E;  1J1D C;  4IL6 X;  1JUN A;  1A02 J;  3CXH E;  2WT7 A;  1VQM P;  1SQQ D;  3PLN A;  1N8R Q;  1KC8 Q;  3Q5R A;  3LID A;  1VQ6 P;  2LKM A;  3L75 J;  1Q86 Q;  1LWU C;  2CK3 H;  1FDI A;  3H1J G;  1USD A;  1JTH A;  2N1T B;  1SQQ K;  1XTC C;  1EQ7 A;  3B5N D;  4WY4 D;  1SQV G;  1FZA A;  2XV5 A;  2BCC G;  1EDL A;  1BGY D;  1VQO P;  1JM0 A;  1BE3 J;  4B86 A;  2IBZ D;  1G2C A;  5APU A;  5KAI E;  3AED C;  4K3A A;  3RL0 D;  1VQ4 P;  3H32 B;  3PP5 A; 
#chains in the Genus database with same CATH homology
 3HE5 B;  3E1I A;  1FZB A;  1ZR2 A;  3P7K A;  5KLV K;  5CJ0 A;  4WB4 A;  2MJZ A;  3VOP A;  1RF1 C;  1G1J A;  1N7S D;  1J1E B;  3I5C A;  3M0D A;  1HJB A;  5AW8 B;  1LTG C;  1SFC C;  3BRV B;  2OYI C;  3V5B A;  3HRN A;  1GZL A;  5AW5 B;  1LWU A;  3HTK A;  5AW6 B;  3LIE A;  1L0N K;  4W7Z A;  4C7N B;  1GU5 A;  1FZF A;  3TNU A;  5CCH A;  1H89 A;  4JF7 A;  5APX A;  3B5N B;  3R2P A;  1JCD A;  1FZC B;  4WY4 B;  3BRT B;  1JNM A;  4N78 D;  4N3Y B;  3HUS B;  3MIW A;  1PFI A;  5AVT B;  4KHX A;  3M0A A;  3G3Z A;  2FXM A;  2WIT A;  2CPS A;  1J1E C;  2HYN A;  2QM7 A;  4IFM A;  2P7J A;  1NOH A;  4I6M C;  3VMY A;  3M91 A;  4LLH A;  1GW3 A;  1LTJ A;  3RL0 B;  4GT1 A;  1DH3 A;  3V2Q A;  3HD7 D;  3M06 A;  2IPP A;  1SLQ A;  1LTI C;  1X79 B;  3HTK B;  1LGH B;  2N1T A;  1T2K D;  5AVX B;  1QL2 A;  3B5N C;  3LW5 H;  1FZC C;  3NTN A;  4WY4 C;  3RK2 D;  2QM8 A;  5AW9 B;  3M9B A;  4GIF A;  1N7S B;  2M3B A;  1LT9 B;  2YKO A;  2ZFC A;  3HUS C;  4ZKP A;  1RF1 A;  1NWQ A;  2XNX A;  2XDJ A;  1SFC A;  2OYI A;  2I1J A;  3NFQ A;  3CI9 A;  1VDF A;  3VMX A;  1SP4 A;  1Z56 A;  1G1I A;  3GHG B;  1IC2 A;  3RL0 C;  2O1J A;  1HTL C;  3H32 A;  2HPC B;  1LTB C;  2H7H A;  3HE5 A;  3OA7 A;  3MD0 A;  1H88 A;  1HH0 A;  1GD2 E;  2HG5 D;  4Y99 B;  4DZO A;  3MUD A;  2OYH A;  1N7S C;  1GTW A;  1FZE A;  1NTK K;  2J59 M;  1LT9 C;  1M1J B;  5CHX A;  1AFO A;  1RY3 A;  1FJK A;  2KOG A;  1S9K E;  2NPS D;  2C0X A;  5AW4 B;  1OXZ A;  1KFN A;  3A3Y B;  2FKW B;  2E42 A;  3HD7 B;  1L4A D;  3A2A A;  2GUS A;  1CZQ A;  4C7N A;  3GHG C;  2WSF H;  4EIJ A;  2A45 H;  3RK2 B;  3B5N A;  1FZC A;  1JY3 O;  2O01 H;  4WY4 A;  1FJP A;  3KPE A;  1IFM A;  3HUS A;  1X9V A;  4Y99 C;  1CI6 B;  2R32 A;  4I1L A;  3VN0 A;  5AVS B;  1M1J C;  3MGN A;  3TK1 A;  4IFD K;  2Q5U A;  2OYH B;  1FDM A;  3L4F A;  2HOD B;  2C9N Y;  1JY2 N;  1NTZ K;  1YTZ I;  1IK9 A;  3RK3 D;  3CL3 D;  1URQ C;  3HD7 C;  3A5T A;  4N6J A;  1T2K C;  3RK2 C;  5AVY B;  1HWT C;  5AW3 B;  3T97 A;  4XA4 A;  2YMY A;  1N7S A;  4M3L A;  3IFM A;  1LT9 A;  5AW7 B;  2WWW A;  1E5W A;  2NPS B;  4JYC A;  5APY A;  3SWF A;  4O9B A;  2OYH C;  2PP6 A;  3UIA A;  1L4A B;  1T8Z A;  3P8C D;  5KJ7 D;  3KQG A;  1SVF A;  1JY3 P;  5CJ4 A;  2POH A;  1CW5 A;  2WTY A;  3GHG A;  4AUW A;  1URQ D;  4AYC A;  4ZKU A;  1JCC A;  2KSJ A;  1GK6 A;  2HPC A;  5APT A;  1GDT A;  4RES B;  1GL2 D;  1N86 A;  3N7N A;  2M8R A;  1SQX K;  1M1J A;  5APS A;  3U1A A;  5CCG D;  3V2P A;  1IJD B;  2NPS C;  5AVW B;  3RK3 B;  1VPC A;  3U59 A;  3A7O A;  1URQ A;  2WSE H;  1L4A C;  1XTG B;  2GM4 A;  3HD7 A;  2FFD B;  5AW0 B;  1N2D C;  1NO4 A;  2VRS A;  1NHL A;  1JOC A;  2KYV A;  1ZN5 A;  3P32 A;  1GK4 A;  3U1C A;  2Q7C A;  5BU8 B;  1LTT C;  2WPQ A;  5AVU B;  1RF0 C;  1N73 B;  1CI6 A;  4GKG A;  1RE4 C;  4LC1 A;  3TYY A;  2Z5H A;  2YKQ A;  1KIL D;  2JEE A;  5BU5 A;  1M7L A;  2HOD A;  3RK3 C;  4EOT A;  2XU6 A;  1HGV A;  3C9I A;  1GU4 A;  2I1K A;  3VP8 A;  4N78 E;  2W27 A;  3KYQ A;  3L37 A;  1KFM A;  1SQV K;  1URQ B;  2FFD C;  4DOJ A;  2E43 A;  5AW2 B;  3BAT A;  4HYT B;  1YYC A;  1DX7 A;  2Q9I A;  2L5G B;  1GL2 B;  2HFE D;  3OAK A;  3WMM 0;  1HBW A;  1WRG A;  1RE3 C;  2FYU K;  4IFF A;  1N73 C;  3B8E B;  3HE4 B;  2NPS A;  1JMM A;  1MUU A;  3EQ2 A;  4C7R A;  5KJ7 C;  2WT7 B;  1L4A A;  1WT6 A;  1NTM K;  2W6B A;  1IFD A;  2WPS A;  1NAF A;  1IFN A;  1HVV A;  1NH4 A;  1L0L K;  3L36 A;  2BAS A;  1GL2 C;  1LTS C;  1ZR4 A;  1H8A A;  2JJL A;  1JTH B;  2KP8 A;  5APV A;  1FBM A;  1RF0 A;  3MTU E;  1FOS E;  5CCG C;  5CCH D;  1KIL B;  1NU1 K;  1RE4 A;  2P1J A;  3KDP B;  4LGD E;  2FYZ A;  4C46 A;  1HGZ A;  3IR9 A;  1MFZ A;  2C9L Y;  3EFG A;  1NKN A;  5APW A;  1T3U A;  3BAS A;  2XZR A;  2FFD A;  2Q3I A;  4JYB A;  1SQB K;  1FAV A;  2IFN A;  3NXS A;  1IFI A;  3VYI A;  2YO2 A;  5AVZ B;  5AW1 B;  3OJA B;  1G2C B;  1X8Y A;  3M9Q A;  4WBA A;  5KTB A;  5AVV B;  1CSB A;  2HLO A;  1S9K D;  1W2E A;  3VTP C;  1N73 A;  1RE3 A;  2YO3 A;  1JY3 N;  1ZV8 A;  2N1T D;  2PAJ A;  1KIL C;  1J1D B;  2N9B A;  3V4Q A;  3TSI A;  5KJ7 A;  2O1K A;  4HH2 A;  2C0W A;  2XKM A;  4I2L C;  3VP9 A;  2WSC H;  2IFM A;  1T3J A;  1DEB A;  2R5B A;  3SWY A;  3V2N A;  2Z5I A;  2WZ7 A;  1SFC D;  1YTZ T;  1ZLL A;  2A45 I;  1LWU B;  4W7Y A;  3N4X A;  5AVR B;  3V4W A;  1HUC A;  1FOS F;  2KLV A;  2YKP A;  1GL2 A;  1GW4 A;  1N7L A;  3TNU B;  5BVZ A;  1FZG A;  2Z4E A;  4XE5 B;  5CCG A;  3NMD A;  2A45 G;  2WPR A;  2R5D A;  1JO5 A;  3HE4 A;  1SQP K;  1J1D C;  2KB7 P;  1JUN A;  1JY2 O;  2CPB A;  1A02 J;  1MZ9 A;  2WT7 A;  1KQL A;  2P67 A;  1KZU B;  2YNY A;  3M0D C;  5APQ A;  2ZXE B;  3LID A;  2OAR A;  3BVH A;  2LKM A;  2W6A A;  1LTJ B;  4OH8 B;  3O8Z A;  1LWU C;  1J2J B;  3II6 A;  3VMZ A;  2H8P D;  5CCH C;  1JTH A;  2N1T B;  3P8C E;  1SQQ K;  4W80 A;  1QL1 A;  1XTC C;  3P8M C;  5CMZ A;  1EQ7 A;  1KIL A;  2H43 A;  1LTA C;  3B5N D;  4AQR D;  4WY4 D;  1RF1 B;  1FZA A;  1NKZ B;  1OWA A;  2XV5 A;  5AVQ B;  1AQ5 A;  2IX7 C;  1SFC B;  2OYI B;  1A02 F;  2GUV A;  2R3C A;  4B86 A;  2P2U A;  1LTJ C;  1G2C A;  3M9H A;  5APU A;  3RL0 D;  3CLQ A;  1IFJ A;  3L35 A;  1IO4 A;  1JY2 P;  2N1T C;  3H32 B;  1MV8 A;  3H6P A;  2J58 A;  3V2R A;  1FU1 A;  3PP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...