2NPXA

Nadh binding site and catalysis of nadh peroxidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NADH binding site and catalysis of NADH peroxidase.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 139
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1992-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2npxA02
1KFYA 4Z2TA 4YTMA 4JN9A 4USQA 4U8PA 1M64A 3NLCA 4A7AA 3GWFA 5BULA 4YKFA 2JBVA 4APNA 2XVIA 2YM1A 3FPZA 3V76A 3ATRA 2TPRA 1PBFA 1BZLA 3VRAA 1BGNA 3AEFA 2EQ7A 1GREA 1CJ4A 2UZZA 4Z44A 5KWFA 1DXLA 1L9DA 2GVCA 2WOIA 3KLJA 2GAGB 5JCKA 1N4WA 3AB1A 3WE0A 4K5RA 3GRSA 2XVJA 1ZMCA 4UDQA 2JB3A 1N4UA 4Y4LA 1TDOA 3IHMA 4U2SA 3NHOX 1Y56A 4IV9A 2APGA 4OCGA 5HYMA 5U25A 2BK4A 2WPCA 3AWIA 3ZDNA 4H4YA 1K4QA 1E1NA 1RYIA 2GEWA 3K30A 2Q6UA 4U8MA 3LB8A 2B7RA 3NTDA 1P2HA 4EMJA 2X50A 4JY3A 2V3AA 1CJCA 4XWZA 1QJDA 1F3PA 2V6OA 4M52A 1ZP0A 2DKIA 4AP1A 1Y56B 3UTFA 2VRMA 4GUVA 1LVLA 1EL8A 3CPJG 3B6DA 2FJEA 2BA9A 2C3DA 2Q7VA 2B9XA 3OC4A 5U1OA 3ITJA 5J60A 3AE8A 2FJDA 2Z5YA 1CC6A 1YQ3A 2YQUA 1H84A 4EM3A 3DK8A 4KX6A 5FS8A 3CNPA 3SQPA 1CJ2A 3IHGA 1F8RA 1KF6A 2W0HA 4TLZA 4K22A 4BK1A 1GTEA 2C7GA 3REDA 2WOWA 1H6VA 4IVOB 4B67A 3LOVA 4AP3A 2EQ9A 1DJQA 1OJ9A 1S3EA 4J34A 3G5SA 3ZYXA 3CPIG 3ICSA 4OPCA 2RGHA 1V59A 3SGLA 3UOVA 1RP0A 3R9UA 1COYA 1S3BA 3DK4A 4H4TA 1NEKA 4GDEA 1D4EA 3KPFA 2RGJA 4GCMA 3C4AA 2XVEA 3DMEA 1OJAA 4CY6A 3GYJA 3CN8A 3CNTA 3LJPA 1FCDA 1CHUA 1P2EA 4TM1A 2TMDA 4YSHA 1PS9A 2V60A 2WESA 1NPXA 3SM8A 2YG4A 3AYIA 1GTHA 3UP5A 4U8IA 3HZLA 4MJWA 5KXJA 4JNAA 1GRTA 1XPQA 3ALMA 1FECA 1DOCA 2YG5A 3G5RA 1BF3A 2RABA 1E1KA 3NYEA 3EAOA 1XANA 2PHHA 4IVMB 2FJAA 3UTEA 5KOWA 4DSHA 1VDCA 4X9NA 1S2YA 3ICRA 4X4JA 1BKWA 2XLRA 3GD3A 4E0VA 1JU2A 1NG4A 3EF6A 3M12A 3AE9A 2C3CA 3LZWA 5BRTA 1TDFA 2YVJA 2XYOA 4FX9A 4H2PA 1E7PA 1GEUA 4EQSA 1LJ1A 2C64A 2H88A 1ONFA 4NZHA 1EL7A 2V3BA 3IC9A 3P1WA 2WU5A 1Q1RA 1MOKA 2X99A 5FS9A 3CGEA 1D4CA 1YY5A 2OA1A 2WETA 3NGCX 4OPLA 4B64A 5JCMA 1K0LA 1FEBA 3CNDA 2VRLA 3DA1A 2B9WA 3S61A 1PBBA 4WX1A 3NRNA 2WHDA 4K2XA 1PJ6A 1Q1WA 4YWOA 2HQMA 5DBJA 3GMBA 1S2QA 1E1MA 2XVFA 1OJCA 3DGHA 1NHQA 3QSSA 4C3XA 1E39A 1Z6LA 3AD7B 3K7TA 4DGKA 4J56A 2QAEA 3SFDA 2ZBWA 2BABA 4UDRA 2YVGA 4GDPA 2XFPA 1ZOYA 4GF7A 4HB9A 3Q6JA 5KVIA 2CVJA 2Q0LA 3BI5A 1F8SA 2VVLA 2R4EA 1Y0PA 4USRA 1FEAA 2F5ZA 2R46A 2CULA 2XFUA 3UTGA 4A79A 4K8DA 4HA6A 1H86A 1DODA 4CRTA 1O5WA 4UDPA 1DNCA 3K7QX 4CY8A 1GV4A 4LU6A 1TDEA 1W4XA 1DOBA 1PBDA 1NAAA 4EQRA 2VZ2A 3CIRA 3QVRA 5GSNA 4YSXA 2GR0A 1PBCA 3PO7A 1GSNA 3GD4A 2Y6RA 2XLSA 4Z26A 1ZMDA 2ZZBA 1X31B 3PS9A 4IA6A 3UKLA 4BK3A 4N9XA 3V3OA 4ZCDA 3AEAA 2WPFA 1QLBA 3ADAB 1ZOVA 1CC4A 3D1CA 2X3NA 2X8GA 1KSSA 1MXTA 1YKJA 1D7YA 2XLTA 4Z2RA 1TYPA 2NVKX 1DOEA 1L9CA 4H2RA 1LQUA 1PBEA 3SFEA 2BXRA 1GALA 3COXA 3KU9A 4JQ9A 4YKGA 3AEEA 5C2TA 4EQWA 4CCRA 2B7SA 3CGBA 1PXBA 1UKVG 3T37A 5JCIA 1N1PA 2GR2A 2YAUA 3NK1X 3NYFA 4NEVA 4EMIA 2WDRA 4U8NA 1H81A 5J7XA 3CNSA 3NIXA 2BK3A 3QSEA 5HXIA 3BHKA 3JSKA 4XWRA 2A8XA 1IUWA 2XFNA 2GR3A 4RG4A 3QFBA 2C72A 3GWDA 2C76A 2C66A 4O5QA 1OJTA 1MO9A 2GAHB 1GRGA 2Y6QA 1KNRA 4UP3A 4BJZA 1F6MA 1RSGA 1KDGA 3M13A 4BURA 2QA1A 4U8JA 1IUTA 3B3RA 3NG7X 4YSZA 3AE5A 5M0ZA 2X8HA 2YM2A 1DJNA 2RGOA 1IJHA 3UP4A 2WBAA 1GRBA 3RP6A 4LIIA 1H7XA 2GF3A 3CGCA 4H4SA 2IVDA 3UKHA 4D03A 2V61A 3FMWA 3OZ2A 1LV0A 3AYLA 3NT6A 3AEBA 3KA7A 4I59A 1JNZA 4DSGA 4FDCB 1XHCA 1IUUA 3NK0X 4EM4A 4Y4NA 3AD8B 4YSYA 4FK1C 4OPGA 1AOGA 1ZY8A 1GPEA 1CF3A 3BI4A 4U2LA 4U8KA 4H4QA 5IQ1A 3FBSA 2A89A 3AE6A 1FOHA 2IVEA 5L46A 4YXDA 2WS3A 3D8XA 3S5WA 4NEWA 2WP6A 2YVFA 4XXGA 4NTEA 2YLXA 3IWAA 3ALLA 1ZX9A 1TDNA 2GQWA 2BS4A 5ER0A 2IIDA 4CBQA 1LPFA 2BACA 1F8WA 3I3LA 3F8PA 3RHAA 5EBKA 2QCUA 1EBDA 2YR6A 2A87A 1NHRA 1VRQB 4OVIA 4OPTA 1GRAA 5GRTA 2I0ZA 4B63A 1PN0A 3ISHA 4BV6A 1ZDLA 4ADWA 2YWLA 4REKA 4B66A 1YQZA 2R0PA 2CDUA 2GH5A 2JK6A 2GR1A 1E1LA 3LADA 3GMCA 2OLOA 3KKJA 4AT0A 3P4QA 3RNMA 2E5VA 4B68A 4C5OA 4B69A 4Z43A 2AR8A 4X9MA 3VR9A 3H4KA 2YR4A 3VR8A 3DGZA 3AE4A 3ATQA 3IF9A 4OPDA 4BJYA 3GDNA 4EIPA 4NTCA 2FBWA 1QO8A 2VVLG 3UCLA 5JCNA 2YG7A 4RG3A 3NN0X 3RP8A 1GOSA 4P9SA 2JB2A 4IA5A 4J33A 3QFAA 3FIMB 3PVCA 2WPEA 1B37A 2JB1A 3GSIA 4GRTA 3H8IA 1VG0A 3AE3A 4D04A 4A5LA 4GR1A 4J2WA 1OJDA 4CNKA 3AECA 3UKKA 1O94A 3Q9TA 2VVMA 4EQXA 3M0OA 5CKUA 3UOYA 1ZKQA 5KRQA 2C73A 1B5QA 2J3NA 2BS3A 2C67A 3UKQA 4I58A 3UKPA 1JRYA 2GB0A 3DJEA 3UKAA 2E4GA 2ACZA 2O9ZA 2VQ7A 1H83A 3ABVA 3LZXA 2YLSA 4BK2A 3DK9A 4TM0A 2ARDA 2V5ZA 4H50A 2YLWA 5EB5A 5HHFA 5CQFA 2Z5XA 1ZK7A 3AEDA 2XCGA 3P4PA 4H4ZA 4JNQA 3VQRA 1JOAA 4H4VA 4H4UA 2AAQA 3ALJA 1JRXA 1PJ5A 4JY2A 4A6NA 4PABA 2WDVA 5BUKA 2R45A 3AE7A 4JDRA 4K7ZA 2WDQA 3P9UA 5FS6A 1NDAA 3P4SA 3I6DA 1PXAA 3BHFA 3DJGX 2YG6A 2GMHA 4YT0A 5FMHA 4TM4A 4C77A 3GYIA 3DH9A 1TYTA 3FG2P 3AE2A 2BC1A 2YLTA 4FK1A 3G5QA 2WQYA 1BWCA 3URHA 2CFYA 3H8LA 3DJJA 2XFQA 2XLUA 1LQTA 2JKCA 3KD9A 1LTXR 1VQWA 3UKFA 3QJ4A 4B1BA 1K0IA 3NK2X 3F8DA 2AQJA 2YG3A 1YQ4A 2E1MA 4H2QA 2C75A 4OPUA 4AOXA 5BVAA 3F8RA 2WEUA 3ICTA 2YLZA 4U2TA 3EPTA 2R4JA 5EB4A 4TLXA 3RP7A 4O5UA 3UOZA 1L9EA 2DKHA 3UTHA 2VOUA 4H4WA 5M10A 4B65A 3E1TA 1N4VA 2ZZ0A 3CGDA 3II4A 4ZCCA 5EOWA 4A65A 1GXFA 1EL5A 2BC0A 1ELIA 2ZZCA 2C65A 3UOXA 1GNDA 2WP9A 2XDOA 2XVHA 2YR5A 3AEGA 2R0GA 2XLPA 1KNPA 3VRBA 4A6NB 4EIQA 2GV8A 2OAMA 1PXCA 3C4NA 1GESA 2BCPA 4H4XA 4ECHA 1NENA 3BNMA 1K0JA 5C3JA 4H4PA 4A99A 3CTYA 4AOSA 1NHPA 1NG3A 4NTDA 3GDPA 4J31A 4AT2A 2PYXA 4C74A 4CNJA 3QSMA 1HYUA 4Z24A 2B9YA 1B8SA 1E6EA 2NPXA 3AXBA 3BI2A 1IUXA 2WP5A 1CL0A 2GRTA 3LXDA 1IUSA 3K7MX 4WCTA 1VG9A 1PHHA 4YTNA 2JAEA 4U8OA 4J57A 2BXSA 4H4RA 1PJ7A 5KOXA 2B76A 5FS7A 3NKSA 3P4RA 2Q0KA 5HY5A 3O0HA 2EQ6A 4Z2UA 1BGJA 4ICYA 3EANA 1SEZA 2X8CA 1TRBA 3C96A 4RSLA 1D4DA 1REOA 5IQ4A 1D5TA 2XFOA 5JCLA 1GERA 3V3NA 2C70A 4Z25A 1IUVA 1D7LA 1KSUA 4H7UA 2QA2A 3AE1A 3L8KA 1GT8A 3KVEA 4EMWA 1O95A 5U63A 1GETA 2BCGG 3GRTA 3DJDA 3AYJA 2OLNA 3CNJA 4K5SA 5TR3A 3AD9B 4PAAA 1JEHA 2WU2A 3NN6X 4DNAA 4C3YA 3BNUA 1GRFA 1B4VA 2OALA 2EQ8A 4CCQA 5KVHA 5LV9A 2WOVA 4ZN0A 2FJBA 2H89A 1CBOA 1FL2A 1L0VA 2BS2A 2R9ZA 1EL9A 1H82A 2BK5A 4U8LA 4YTPA 1CC2A 1GRHA 3NNEA 1XDIA 2GQFA 3CPHG 1M6IA 4Y4MA 3NYCA 4KPRA 1CJ3A 1Q9IA 1TDKA 2VQBA 1PDHA 2GMJA 4TM3A 1H7WA 4A9WA 3NTAA 3NH3X 4OPIA 2R0CA 3QVPA 2YLRA 4H2NA 3VRDB 4LA1A 1JRZA 3L1RA 5IPYA 1NHSA 2BYBA 1JNRA 4J36A
chains in the Genus database with same CATH superfamily
4Z2TA 4JN9A 3GWFA 5BULA 3V76A 4APNA 2XVIA 3QLDA 3VRAA 3AEFA 2GVCA 2GAGB 5JCKA 1N4WA 3AB1A 3WE0A 3GRSA 4UDQA 1N4UA 4Y4LA 4U2SA 3NHOX 1Y56A 4OCGA 5HYMA 2BK4A 3HYVA 1E1NA 2GEWA 3MWCA 2Q6UA 4K1WA 3H8AA 3NTDA 2X50A 4FP1A 1QJDA 3H7VA 3UTFA 2VRMA 4DX3A 2ONEA 1SB3B 3UJFA 1TE6A 2PGEA 4EM3A 2W0HA 4IP5A 4K22A 4X2PA 4IVOB 2EQ9A 1DJQA 1XS2A 4GAVA 3SGLA 4G74A 4DHGA 3R9UA 1COYA 1S3BA 4H4TA 1NEKA 3KPFA 3C4AA 2HZGA 3NZGA 3UGVA 3T4WA 5IDZA 3ALMA 1FECA 5KMRA 1XANA 4X4JA 1BKWA 2XLRA 1JU2A 1T3QC 3T31A 5BRTA 4EQSA 2H88A 1YY5A 5FS9A 1D4CA 2PU0A 2WETA 3H12A 4OPLA 1K0LA 2B9WA 1NELA 3NRNA 4K2XA 3PWGA 1Q1WA 3DDMA 1OJCA 4DGKA 3K7TA 3NVWB 3H70A 4HB9A 1F8SA 1Y0PA 2CULA 3FYYA 5KMSA 1H86A 1DODA 4CRTA 3HRDC 4LU6A 1TDEA 2RDXA 3QVRA 4YSXA 3ES8A 2QDDA 1SJCA 3S47A 3MSYA 3TQPA 2ZZBA 3PS9A 4IA6A 3B9JB 3D1CA 2X3NA 2X8GA 3CXOA 4H2RA 3COXA 3KU9A 5C2TA 2QJNA 3STPA 4DWDA 1UKVG 2P8CA 3NK1X 3GO2A 2GR3A 1KNRA 4BJZA 2OPJA 3M13A 2QA1A 4G73A 3CXBA 2X8HA 3RO6A 3UP4A 2WBAA 3RP6A 3CGCA 3UKHA 2V61A 3NVVB 3KA7A 4I59A 4DSGA 3NS1B 4OPGA 4U8KA 3FBSA 2A89A 2NQLA 3T8QA 4NEWA 3RCYA 3V4BA 2YVFA 2POZA 1TDNA 2GQWA 4CBQA 2BACA 1F8WA 4GYPC 5EBKA 2YR6A 2A87A 4G8TA 3ZVIA 3ISHA 2GDQA 3IK4A 4B66A 1YQZA 3GMCA 1MNSA 3RNMA 3P4QA 4B69A 3H4KA 3VR8A 3JW7A 1KCZA 4OPDA 3I6TA 3HW2A 3UCLA 5JCNA 3ENLA 4IZGA 2JB2A 1VG0A 3P0WA 4J2WA 3AECA 3Q9TA 3CAWA 3QTPA 1JRPA 1B5QA 2C67A 2GB0A 3CT2A 3LZXA 5CQFA 3BSMA 3SZCA 1ZK7A 3AEDA 3P4PA 3VQRA 3ALJA 1PJ5A 4JY2A 1EBHA 1FFUC 2WDQA 5FS6A 5FJPA 3GY1A 2HXTA 2GMHA 4YT0A 4TM4A 1TYTA 3AE2A 1STZA 4FK1A 2WQYA 1BWCA 3URHA 4HPNA 3H8LA 2XLUA 3DESA 1LTXR 4E8GA 5FJTA 2E1MA 1WUFA 1S7MA 3UTHA 2VOUA 5M10A 4B65A 1MDRA 3UOXA 4A6NB 3VRBA 2R0GA 2GV8A 2AL2B 2OAMA 7ENLA 3BNMA 1K0JA 5C3JA 3OZYA 3QSMA 1B8SA 1E6EA 4WCTA 1VG9A 4U8OA 4J57A 4H4RA 5FS7A 3MQTA 4II2A 2EQ6A 1SEZA 3R10A 4RSLA 1REOA 5IQ4A 1PDYA 1FHVA 4Z25A 1KSUA 3AE1A 1GT8A 1GETA 1NU5A 3DJDA 5TR3A 4PAAA 1JEHA 3NN6X 3ZVHA 3BNUA 1GRFA 2PSNA 2OALA 1SJDA 3UXKA 5KVHA 2WOVA 2FJBA 4U8LA 1GRHA 1MUCA 1WUEA 4KPRA 1TDKA 3CK5A 3VC5A 1PDHA 3ETRB 3NTAA 4G6HA 2GGJA 3VRDB 2PP3A 1NHSA 1FHUA 4USQA 3BJSA 3NLCA 2ZC8A 4Z17A 4H1ZA 1DTNA 3FPZA 2TPRA 1PBFA 1BGNA 1DXLA 3RRAA 4TVYA 4HN8A 1TDOA 3IHMA 4IV9A 2PS2A 2WPCA 1K4QA 3LB8A 3OPSA 1P2HA 3CMMA 4YWSA 1KN0A 4AP1A 4M52A 1ZP0A 1WYGA 3CPJG 1MDLA 2FJEA 2BA9A 5U1OA 3SJNA 3AE8A 2FJDA 2Z5YA 1YQ3A 2YQUA 1H84A 2GGEA 5FS8A 3IHGA 3SQPA 4BK1A 4ENLA 1GTEA 2WOWA 4B67A 1OJ9A 1S3EA 4OPCA 2RGHA 3UOVA 1RP0A 4GIRA 3TOYA 2RGJA 4GCMA 3DMEA 1KKOA 4YSHA 1CHUA 5JRBA 1PS9A 2V60A 2WESA 1NPXA 4GFIA 3SM8A 2YG4A 4U8IA 5KXJA 4E4FA 3MKCA 1XPQA 4G7FA 5KOWA 2PHHA 3UTEA 4F4RA 4FI4A 1S2YA 1FO4A 3GD3A 3LZWA 1TDFA 4H2PA 2C64A 1ONFA 3P1WA 2PP1A 3CYJA 2X99A 2OA1A 3SXIA 1FEBA 3CNDA 3DA1A 2WHDA 5DBJA 3GMBA 3DFHA 1NHQA 3QSSA 1Z6LA 3AD7B 1N62C 2QAEA 4UDRA 4GDPA 1ZOYA 3EUB3 3Q6JA 5KVIA 2CVJA 1R6WA 2R4EA 3PK7A 3AN1A 1O5WA 4UDPA 1W4XA 2VZ2A 5GSNA 4KEMA 1PBCA 2W3RA 3GD4A 2Y6RA 1ECQA 4BK3A 3V3OA 3AEAA 2WPFA 5FJOA 1MXTA 1D7YA 1L9CA 1DOEA 2BXRA 1GALA 4YKGA 3T2YA 4CCRA 2OKTA 3T37A 3TJ4A 2I5QA 2WDRA 1KD0A 3QKEA 1SJAA 2BK3A 3QSEA 5HXIA 3BHKA 3T2ZA 3JSKA 4XWRA 3R07C 2A8XA 1IUWA 2C72A 3GWDA 5FJRA 4O5QA 1MO9A 2GAHB 1RSGA 1KDGA 3DGBA 2QGYA 4U8JA 1IUTA 1DJNA 1KKRA 1GRBA 3SY4A 3NVZB 1H7XA 2GF3A 4H4SA 4D03A 3FMWA 1LV0A 4Y4NA 4GISA 1GPEA 3L5OA 3AE6A 1FOHA 3MY9A 4YXDA 2WS3A 3S5WA 2WP6A 3A7RA 1P43A 3UJEA 4KPLA 1ZX9A 4ROPA 2XH0A 3SSZA 3F8PA 2QCUA 2E5AA 4OPTA 3GYXA 3EKGA 4H83A 2GH5A 2JK6A 2GR1A 3LADA 4X9MA 2PTYA 4A35A 1E9IA 3DGZA 3DIPA 2PGWA 3D9XA 4NTCA 1RM6B 2PA6A 3T0KA 2YG7A 4RG3A 3QFAA 3PVCA 2WPEA 3GSIA 3H8IA 3SYIA 3AE3A 3R25A 4A5LA 4GR1A 3V5FA 3IJQA 2VVMA 4EQXA 5CKUA 3OTRA 5KRQA 2C73A 3SN1A 3UKPA 2VQ7A 2GGIA 4BK2A 4TM0A 2ARDA 4H50A 5EB5A 2Z5XA 1JOAA 4H4VA 1TKKA 2AAQA 1JPMA 4A6NA 3AE7A 4K7ZA 2XH7A 3P9UA 3GYIA 3DH9A 2BC1A 3DG6A 3QPEA 2CFYA 3UKFA 2AQJA 1YQ4A 4M0XA 4H2QA 2C75A 3U4FA 4J3ZA 4AOXA 4JN7A 3F8RA 2WEUA 4U2TA 3EPTA 2R4JA 2PU1A 4H4WA 4E4UA 2ZZ0A 3II4A 4GGBA 5EOWA 4A65A 1EL5A 1GNDA 2WP9A 2XDOA 1R0MA 1PXCA 2BCPA 4A99A 2P8BA 1NG3A 4NTDA 2B9YA 2NPXA 3Q45A 1IUXA 4YTNA 1IUSA 1PHHA 2BXSA 3O0HA 3P3BA 1ELSA 2BRAA 1GERA 2C70A 1IUVA 1D7LA 4H7UA 2GL5A 3GC2A 5U63A 2BCGG 3GRTA 2OLNA 4K5SA 2WU2A 5KMQA 3NFUA 4ZN0A 1VQZA 1EL9A 2BK5A 2QJJA 3CPHG 1M6IA 2PMQA 1CJ3A 1Q9IA 2VQBA 4TM3A 2GMJA 4H2NA 4LA1A 2BYBA 4J36A 1KFYA 1BKHA 4YTMA 3OZMA 4U8PA 4A7AA 2JBVA 3OP2A 3ATRA 1PDZA 4E6MA 1EC7A 1BZLA 2EQ7A 1CJ4A 2UZZA 4Z44A 2WOIA 2ZADA 5KMPA 4K5RA 1ZMCA 2JB3A 3ZDNA 3AWIA 4ZA0A 1RYIA 3K30A 4MMWA 1EBGA 4EMJA 4XWZA 2V6OA 2C3DA 1IYXA 2B9XA 5J60A 2OZ8A 3RGTA 1CC6A 2AL1A 3DK8A 1CJ2A 1KF6A 2MUCA 4TLZA 3REDA 3LOVA 4AP3A 2FKPA 2PPGA 3ICSA 3FCPA 1V59A 3FV9A 4GDEA 1OJAA 4CY6A 3CN8A 3LJPA 1P2EA 4TM1A 1F9CA 1YEYA 3AYIA 2E3TA 3UP5A 1JCTA 4MJWA 1DOCA 2YG5A 1BF3A 3EAOA 1VDCA 3ES7A 3TCSA 2GGGA 3M12A 3EF6A 3AE9A 2C3CA 2YVJA 1P48A 2XYOA 3EEZA 1E7PA 3K1GA 4NZHA 3TJIA 1MOKA 3CGEA 4B64A 5JCMA 3S61A 1PBBA 4WX1A 3MUCA 4YWOA 2HQMA 1S2QA 1E1MA 2XVFA 3RITA 4Z1YA 3DGHA 3SFDA 2BABA 2OLAA 2YVGA 2XGZA 2XFPA 3FJ4A 2OZ3A 4GF7A 5BOFA 1FEAA 3UTGA 2XFUA 4K8DA 4HA6A 1DNCA 4CY8A 1GV4A 1DOBA 1PBDA 3CIRA 2OQYA 2GR0A 1ZMDA 1X31B 3UKLA 3UXLA 4N9XA 4ZCDA 1QLBA 3ADAB 1ZOVA 1CC4A 2XLTA 4Z2RA 1LQUA 1PBEA 4JQ9A 3AEEA 4EQWA 1X2GA 2YAUA 3NYFA 4EMIA 3CNSA 1L8PA 3N4EA 3QFBA 2C76A 2C66A 1GRGA 4UP3A 1F6MA 4BURA 3B3RA 3NG7X 1ONEA 3AE5A 5M0ZA 4DYEA 2PP0A 1IJHA 5EU9A 3OZ2A 3T14A 3NT6A 1JNZA 4EM4A 3AD8B 3ZLFA 4FK1C 4U2LA 1CF3A 4H4QA 5IQ1A 1FFVC 2IVEA 5L46A 3D8XA 2AKMA 4XXGA 3TWBA 2YLXA 3IWAA 3BOXA 3CB3A 5ER0A 1N60C 2IIDA 2P0IA 3I3LA 1NHRA 1VRQB 2I0ZA 4REKA 2CDUA 1E1LA 4J1OA 2OLOA 4C5OA 4AT0A 4B68A 2E5VA 4Z43A 2AR8A 3VR9A 2HXUA 3SN0A 3AE4A 3GD6A 2C4CA 1ZXIC 4BJYA 2FBWA 2VVLG 3T2KA 3NN0X 3RP8A 5G5HB 4J33A 3R11A 5G5GB 3FIMB 1B37A 4GRTA 4DN1A 4D04A 4A3RA 1OJDA 4CNKA 4IT1A 1O94A 4K8GA 3M0OA 1MRAA 1ZKQA 3A7UA 3DG7A 3UKQA 4I58A 1N61C 2E4GA 2ACZA 1H83A 3VDGA 4DXKA 2W3SA 2XCGA 4JNQA 4H4ZA 3UJ2A 5BUKA 2R45A 4HNCA 6ENLA 3N6JA 1RVKA 1PXAA 3DJGX 5FMHA 4A6GA 3UJSA 3FG2P 2BRYA 2YLTA 4IL2A 2AL2A 3DJJA 1LQTA 2JKCA 3QJ4A 3F8DA 1V97A 2YG3A 4OPUA 3ICTA 5EB4A 2YLZA 3UOZA 3RP7A 1L9EA 3RR1A 2DKHA 3SX6A 3I4KA 3R0KA 4H19A 3CGDA 4ZCCA 1GXFA 2MNRA 1ELIA 2XVHA 2YR5A 4EIQA 1KNPA 1GESA 4H4XA 1NENA 4K2SA 1VDVA 3CTYA 4AOSA 1EC8A 4NNJA 4CNJA 4G6GA 4Z24A 1JDFA 3BI2A 3AXBA 4ZOHB 2WP5A 1CL0A 2GRTA 3K7MX 2QVHA 2JAEA 5KOXA 4KWSA 4GYPA 3SR6B 3NKSA 3P4RA 5HY5A 3VCNA 3EANA 3VA8A 2XFOA 2O56A 3V3NA 1BQGA 3IJIA 3JZUA 3L8KA 2OX4A 1X2HA 4EMWA 3AYJA 3AD9B 1B4VA 1CBOA 1FL2A 2BS2A 2R9ZA 3PG6A 1CC2A 1XDIA 2GQFA 4Y4MA 3PFRA 3SQSA 1H7WA 2OQHA 4A9WA 3TTEA 2OO6A 2R0CA 2P3ZA 3UJRA 1JRZA 3L1RA 5IPYA 1JNRA 4G9KA 2XH2A 1M64A 4YKFA 2YM1A 2OFJA 4HNLA 1GREA 2DW6A 5KWFA 1L9DA 3KLJA 2XVJA 3UCDA 2PODA 2APGA 3A7AA 5U25A 4H4YA 4U8MA 3P93A 2GSHA 2B7RA 4JY3A 2V3AA 1CJCA 1F3PA 2DKIA 1Y56B 4GUVA 1LVLA 1EL8A 3B6DA 2Q7VA 1EC9A 3OC4A 3D46A 3ITJA 4KX6A 3CNPA 4NWZA 1F8RA 4IL0A 2C7GA 2PTWA 1H6VA 2HNEA 3DG3A 2QQ6A 4J34A 3T9PA 4JHMA 3G5SA 3ZYXA 3CPIG 2DW7A 3DK4A 2OVLA 1D4EA 2XVEA 3GYJA 3CNTA 1FCDA 2TMDA 1GTHA 5KNLA 3HZLA 4JNAA 1GRTA 3QN3A 3NYEA 3G5RA 2RABA 1E1KA 3B97A 4IVMB 2FJAA 3DEQA 4DSHA 4X9NA 3HYXA 3ICRA 4E0VA 3UCCA 1NG4A 2QDEA 3HYWA 4FX9A 1GEUA 3VCCA 1LJ1A 1EL7A 2V3BA 3IC9A 2CHRA 2WU5A 1Q1RA 3I6EA 3NRZB 3NGCX 2VRLA 3N4FA 1TZZA 3ZVHB 1PJ6A 3TW9A 4H2HA 4TVWA 2P88A 4E5TA 4C3XA 1E39A 4J56A 2ZBWA 4HYRA 2Q0LA 3BI5A 2VVLA 3VC6A 4USRA 4II3A 2F5ZA 2R46A 4A79A 3K7QX 4HCDA 1NAAA 4EQRA 3NVYB 3PO7A 1GSNA 2XLSA 2PTZA 3N6HA 1KSSA 2FYMA 1YKJA 1TYPA 2NVKX 3SFEA 3VFCA 2B7SA 3CGBA 3KUMA 1PXBA 5JCIA 1N1PA 2GR2A 4NEVA 4U8NA 5J7XA 1H81A 3NO1A 3NIXA 2XFNA 4RG4A 1OJTA 2Y6QA 2OZTA 2GGHA 4GMEA 2W55A 4YSZA 2YM2A 2RGOA 4LIIA 2IVDA 5FJUA 3AYLA 3AEBA 4FDCB 1XHCA 1IUUA 3NK0X 4YSYA 1AOGA 1ZY8A 3BI4A 3ZLHA 4MGGA 4NTEA 3FXGA 3ALLA 3U9IA 3THUA 2BS4A 1LPFA 5J04A 3RHAA 1EBDA 2W54A 4OVIA 2XSXA 1GRAA 5GRTA 4B63A 1PN0A 4BV6A 1ZDLA 4ADWA 3V3WA 2YWLA 2R0PA 3KKJA 2AKZA 2YR4A 3FVDA 3ATQA 3IF9A 4MKSA 3V5CA 3GDNA 4EIPA 1OEPA 3R1ZA 4EWJA 1QO8A 1N5WC 1GOSA 4P9SA 4IA5A 4IP4A 1XPYA 2JB1A 1N63C 3TWAA 3UKKA 2QJMA 3UOYA 4HCHA 4ZCWA 3KPKA 2BS3A 2J3NA 1JRYA 3DJEA 3UKAA 3ABVA 2O9ZA 2YLSA 3DK9A 2V5ZA 3AM9A 2YLWA 5HHFA 4H4UA 3SZ0A 2OG9A 1JRXA 4PABA 4JN8A 2WDVA 4JDRA 1NDAA 3SZWA 3P4SA 3I6DA 3BHFA 2YG6A 4C77A 3DFYA 3NXLA 4IHCA 3Q4DA 3G5QA 4HCLA 2XFQA 3KD9A 1VQWA 3ZLGA 4KT2A 4B1BA 1K0IA 3NK2X 3PWIA 3SBFA 5BVAA 4TLXA 4O5UA 3E1TA 1N4VA 2BC0A 2ZZCA 2C65A 3AEGA 2XLPA 1H2IA 3C4NA 4ECHA 4H4PA 1JPDX 1N5XA 1NHPA 4AT2A 3GDPA 4J31A 2PYXA 4C74A 3T6CA 1HYUA 2XH4A 3HPFA 3LXDA 5BOEA 1PJ7A 2B76A 2PTXA 2Q0KA 3JVAA 3S5SA 4Z2UA 1BGJA 4ICYA 2X8CA 1SJBA 1TRBA 3C96A 1D4DA 1W6TA 3AMZA 1D5TA 5JCLA 2PCEA 3DERA 3SN4A 2QA2A 3OW1A 3KVEA 1O95A 3SZFA 4GAPA 3CNJA 4C3YA 4DNAA 4M6UA 2EQ8A 4CCQA 3IJLA 3R0UA 5LV9A 3D47A 2H89A 1L0VA 1H82A 5ENLA 4YTPA 3NNEA 3NYCA 1FIQB 4GGHA 1JROA 3NH3X 4OPIA 3QVPA 2YLRA 3MZNA 4Z26A
chains in the Genus database with same CATH topology
1KFYA 4G9KA 4Z2TA 4YTMA 4JN9A 4USQA 4U8PA 1M64A 3NLCA 4A7AA 3GWFA 5BULA 4YKFA 2JBVA 4APNA 2XVIA 2YM1A 3FPZA 3V76A 3ATRA 2TPRA 1PBFA 1BZLA 3VRAA 1BGNA 3AEFA 2EQ7A 1GREA 1CJ4A 2UZZA 4Z44A 5KWFA 1DXLA 1L9DA 2GVCA 2WOIA 3KLJA 2GAGB 5KMPA 5JCKA 1N4WA 3AB1A 3WE0A 4K5RA 3GRSA 2XVJA 1ZMCA 4UDQA 2JB3A 1N4UA 4Y4LA 1TDOA 3IHMA 4U2SA 3NHOX 1Y56A 4IV9A 2APGA 4OCGA 5HYMA 5U25A 2BK4A 2WPCA 3AWIA 3HYVA 4H4YA 1K4QA 1E1NA 1RYIA 2GEWA 3K30A 2Q6UA 4U8MA 3LB8A 2B7RA 3CMMA 1P2HA 4EMJA 3NTDA 2X50A 4JY3A 2V3AA 1CJCA 1KN0A 4XWZA 1QJDA 1F3PA 2V6OA 4M52A 1ZP0A 2DKIA 4AP1A 1Y56B 3UTFA 2VRMA 4GUVA 1LVLA 1EL8A 3CPJG 3B6DA 2FJEA 2BA9A 2C3DA 2Q7VA 2B9XA 3OC4A 5U1OA 3ITJA 5J60A 3AE8A 2FJDA 2Z5YA 1CC6A 1YQ3A 2YQUA 1H84A 4EM3A 3DK8A 4KX6A 5FS8A 3CNPA 3SQPA 1CJ2A 3IHGA 4NWZA 1F8RA 1KF6A 2W0HA 4TLZA 4K22A 4BK1A 1GTEA 2C7GA 3REDA 2WOWA 1H6VA 4IVOB 4B67A 3LOVA 4AP3A 2EQ9A 1DJQA 1OJ9A 1S3EA 4J34A 3G5SA 3ZYXA 3CPIG 3ICSA 4OPCA 2RGHA 1V59A 4GAVA 3SGLA 3UOVA 4G74A 1RP0A 3R9UA 1COYA 1S3BA 3DK4A 4H4TA 1NEKA 4GDEA 1D4EA 3KPFA 2RGJA 4GCMA 3C4AA 2XVEA 3DMEA 1OJAA 4CY6A 3GYJA 3CN8A 3CNTA 3LJPA 1FCDA 1CHUA 1P2EA 4TM1A 2TMDA 4YSHA 5JRBA 1PS9A 2V60A 2WESA 1NPXA 3SM8A 2YG4A 3AYIA 1GTHA 3UP5A 4U8IA 5KNLA 3HZLA 4MJWA 5KXJA 4JNAA 1GRTA 1XPQA 3ALMA 1FECA 5KMRA 1DOCA 2YG5A 3G5RA 1BF3A 2RABA 1E1KA 3NYEA 3EAOA 1XANA 2PHHA 4IVMB 2FJAA 3UTEA 5KOWA 4DSHA 1VDCA 4X9NA 3HYXA 1S2YA 3ICRA 4X4JA 1BKWA 2XLRA 3GD3A 4E0VA 1JU2A 1NG4A 3EF6A 3M12A 3AE9A 3T31A 2C3CA 3LZWA 5BRTA 1TDFA 2YVJA 3HYWA 2XYOA 4FX9A 4H2PA 1E7PA 1GEUA 4EQSA 1LJ1A 2C64A 2H88A 1ONFA 4NZHA 1EL7A 2V3BA 3IC9A 3P1WA 2WU5A 1Q1RA 1MOKA 2X99A 5FS9A 3CGEA 1D4CA 1YY5A 2OA1A 2WETA 3NGCX 4OPLA 3SXIA 5JCMA 1K0LA 1FEBA 3CNDA 2VRLA 3DA1A 2B9WA 3S61A 1PBBA 4WX1A 3NRNA 2WHDA 4K2XA 1PJ6A 1Q1WA 4YWOA 2HQMA 5DBJA 3GMBA 1S2QA 1E1MA 2XVFA 1OJCA 3DGHA 1NHQA 3QSSA 4C3XA 1E39A 1Z6LA 3AD7B 3K7TA 4DGKA 4J56A 2QAEA 3SFDA 2ZBWA 2BABA 4UDRA 2YVGA 4GDPA 2XFPA 1ZOYA 4GF7A 4HB9A 3Q6JA 5KVIA 2CVJA 2Q0LA 3BI5A 1F8SA 2VVLA 2R4EA 1Y0PA 4USRA 4II3A 1FEAA 2F5ZA 2R46A 2CULA 2XFUA 3UTGA 4A79A 4K8DA 4HA6A 5KMSA 1H86A 1DODA 4CRTA 1O5WA 4UDPA 1DNCA 3K7QX 4CY8A 1GV4A 4LU6A 1TDEA 1W4XA 1DOBA 1PBDA 1NAAA 4EQRA 2VZ2A 3CIRA 3QVRA 5GSNA 4YSXA 2GR0A 1PBCA 3PO7A 1GSNA 3GD4A 2Y6RA 2XLSA 4Z26A 1ZMDA 2ZZBA 1X31B 3PS9A 4IA6A 3UKLA 4BK3A 4N9XA 3V3OA 4ZCDA 3AEAA 2WPFA 1QLBA 3ADAB 1ZOVA 1CC4A 3D1CA 2X3NA 2X8GA 1KSSA 1MXTA 1YKJA 1D7YA 2XLTA 4Z2RA 1TYPA 2NVKX 1DOEA 1L9CA 4H2RA 1LQUA 1PBEA 3SFEA 2BXRA 1GALA 3COXA 3KU9A 4JQ9A 4YKGA 3AEEA 3T2YA 5C2TA 4EQWA 4CCRA 2B7SA 3CGBA 1PXBA 1UKVG 3T37A 5JCIA 1N1PA 2GR2A 2YAUA 3NK1X 3NYFA 4NEVA 4EMIA 2WDRA 4U8NA 1H81A 5J7XA 3CNSA 3NIXA 2BK3A 3QSEA 5HXIA 3BHKA 3T2ZA 3JSKA 4XWRA 2A8XA 1IUWA 2XFNA 2GR3A 4RG4A 3QFBA 2C72A 3GWDA 2C76A 2C66A 4O5QA 1OJTA 1MO9A 2GAHB 1GRGA 2Y6QA 1KNRA 4UP3A 4BJZA 1F6MA 1RSGA 1KDGA 3M13A 4BURA 2QA1A 4U8JA 1IUTA 3B3RA 3NG7X 4G73A 4YSZA 3AE5A 5M0ZA 2X8HA 2YM2A 1DJNA 2RGOA 1IJHA 3UP4A 2WBAA 1GRBA 3RP6A 3SY4A 4LIIA 1H7XA 2GF3A 3CGCA 4H4SA 2IVDA 3UKHA 4D03A 2V61A 3FMWA 3OZ2A 1LV0A 3AYLA 3NT6A 3T14A 3AEBA 3KA7A 4I59A 1JNZA 4DSGA 4FDCB 1XHCA 1IUUA 3NK0X 4EM4A 4Y4NA 3AD8B 4YSYA 4FK1C 4OPGA 1AOGA 1ZY8A 1GPEA 1CF3A 3BI4A 4U2LA 4U8KA 4H4QA 5IQ1A 3L5OA 3FBSA 2A89A 3AE6A 1FOHA 2IVEA 5L46A 4YXDA 2WS3A 3D8XA 3S5WA 4NEWA 2WP6A 2YVFA 4XXGA 4NTEA 2YLXA 3IWAA 3ALLA 1ZX9A 1TDNA 2GQWA 2BS4A 5ER0A 2IIDA 4CBQA 1LPFA 2BACA 1F8WA 3I3LA 3F8PA 3RHAA 5EBKA 2QCUA 1EBDA 2YR6A 2A87A 1NHRA 1VRQB 4OVIA 4OPTA 1GRAA 3GYXA 5GRTA 2I0ZA 4B63A 1PN0A 3ISHA 4BV6A 1ZDLA 4ADWA 2YWLA 4REKA 4B66A 1YQZA 2R0PA 2CDUA 2GH5A 2JK6A 2GR1A 1E1LA 3LADA 3GMCA 2OLOA 3KKJA 4AT0A 3P4QA 3RNMA 2E5VA 4B68A 4C5OA 4B69A 4Z43A 2AR8A 4X9MA 3VR9A 3H4KA 2YR4A 3VR8A 3DGZA 3AE4A 3ATQA 2C4CA 3IF9A 4OPDA 4BJYA 3GDNA 4EIPA 3D9XA 4NTCA 2FBWA 1QO8A 2VVLG 3T2KA 3T0KA 3UCLA 5JCNA 2YG7A 4RG3A 3NN0X 3RP8A 1GOSA 4P9SA 2JB2A 4IA5A 4J33A 3QFAA 3FIMB 3PVCA 2WPEA 1B37A 2JB1A 3GSIA 4GRTA 3H8IA 3SYIA 1VG0A 3AE3A 4D04A 4A5LA 4GR1A 4J2WA 1OJDA 4CNKA 3AECA 3UKKA 1O94A 3Q9TA 2VVMA 4EQXA 3M0OA 5CKUA 3UOYA 1ZKQA 5KRQA 2C73A 1B5QA 2J3NA 2BS3A 2C67A 3KPKA 4I58A 3UKPA 3UKQA 1JRYA 2GB0A 3DJEA 3UKAA 2E4GA 2ACZA 2O9ZA 2VQ7A 1H83A 3ABVA 3LZXA 2YLSA 4BK2A 3DK9A 4TM0A 2ARDA 2V5ZA 4H50A 2YLWA 5EB5A 5HHFA 5CQFA 3SZCA 2Z5XA 1ZK7A 3AEDA 2XCGA 3P4PA 4H4ZA 4JNQA 3VQRA 1JOAA 4H4VA 4H4UA 3SZ0A 2AAQA 3ALJA 1JRXA 1PJ5A 4JY2A 4A6NA 4PABA 2WDVA 5BUKA 2R45A 3AE7A 4JDRA 4K7ZA 2WDQA 3P9UA 5FS6A 1NDAA 3SZWA 3P4SA 3I6DA 1PXAA 3BHFA 3DJGX 2YG6A 2GMHA 4YT0A 5FMHA 4TM4A 4C77A 3ZDNA 3GYIA 3DH9A 1TYTA 3FG2P 3AE2A 2BC1A 2BRYA 2YLTA 4FK1A 3G5QA 2WQYA 1BWCA 3URHA 2CFYA 3H8LA 3DJJA 2XFQA 2XLUA 1LQTA 2JKCA 3KD9A 1LTXR 1VQWA 3UKFA 3QJ4A 4B1BA 1K0IA 3NK2X 3F8DA 2AQJA 2YG3A 4B64A 1YQ4A 2E1MA 4H2QA 2C75A 4OPUA 4AOXA 5BVAA 3F8RA 2WEUA 3ICTA 2YLZA 4U2TA 3EPTA 2R4JA 5EB4A 4TLXA 3RP7A 1S7MA 4O5UA 1L9EA 3UOZA 2DKHA 3SX6A 3UTHA 2VOUA 4H4WA 5M10A 4B65A 3E1TA 1N4VA 2ZZ0A 3CGDA 3II4A 4ZCCA 5EOWA 4A65A 1GXFA 1EL5A 2BC0A 1ELIA 2ZZCA 2C65A 3UOXA 1GNDA 2WP9A 2XDOA 2XVHA 2YR5A 3AEGA 2R0GA 2XLPA 1KNPA 3VRBA 4A6NB 4EIQA 2GV8A 1H2IA 2OAMA 1PXCA 3C4NA 1GESA 2BCPA 4H4XA 4ECHA 1NENA 3BNMA 1K0JA 5C3JA 4H4PA 4A99A 3CTYA 4AOSA 4NNJA 1NHPA 1NG3A 4NTDA 3GDPA 4J31A 4AT2A 2PYXA 4C74A 4CNJA 3QSMA 1HYUA 4G6GA 4Z24A 2B9YA 1B8SA 1E6EA 2NPXA 3AXBA 3BI2A 1IUXA 2WP5A 1CL0A 2GRTA 3LXDA 1IUSA 3K7MX 4WCTA 1VG9A 1PHHA 4YTNA 2JAEA 4U8OA 4J57A 2BXSA 4H4RA 1PJ7A 5KOXA 2B76A 5FS7A 3NKSA 3P4RA 2Q0KA 4II2A 5HY5A 3O0HA 2EQ6A 4Z2UA 1BGJA 4ICYA 3EANA 1SEZA 2X8CA 1TRBA 2BRAA 3C96A 4RSLA 1D4DA 1REOA 5IQ4A 1D5TA 2XFOA 5JCLA 1GERA 3V3NA 2C70A 4Z25A 1IUVA 1D7LA 1KSUA 4H7UA 2QA2A 3AE1A 3L8KA 1GT8A 3KVEA 4EMWA 1O95A 5U63A 1GETA 2BCGG 3GRTA 3SZFA 3DJDA 3AYJA 4GAPA 2OLNA 3CNJA 4K5SA 5TR3A 3AD9B 4PAAA 1JEHA 2WU2A 3NN6X 4DNAA 4C3YA 3BNUA 1GRFA 1B4VA 2OALA 2EQ8A 5KMQA 4CCQA 5KVHA 5LV9A 2WOVA 4ZN0A 2FJBA 2H89A 1CBOA 1FL2A 1L0VA 2BS2A 2R9ZA 1EL9A 1H82A 2BK5A 4U8LA 4YTPA 3PG6A 1CC2A 1GRHA 3NNEA 1XDIA 2GQFA 3CPHG 1M6IA 4Y4MA 3NYCA 4KPRA 1CJ3A 1Q9IA 1TDKA 2VQBA 1PDHA 2GMJA 4TM3A 1H7WA 4A9WA 3NTAA 3NH3X 4OPIA 2R0CA 4G6HA 3QVPA 2YLRA 4H2NA 3VRDB 4LA1A 1JRZA 3L1RA 5IPYA 1NHSA 2BYBA 1JNRA 4J36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFY A;  4Z2T A;  4YTM A;  4JN9 A;  4USQ A;  4U8P A;  1M64 A;  3NLC A;  4A7A A;  3GWF A;  5BUL A;  4YKF A;  2JBV A;  4APN A;  2XVI A;  2YM1 A;  3FPZ A;  3V76 A;  3ATR A;  2TPR A;  1PBF A;  1BZL A;  3VRA A;  1BGN A;  3AEF A;  2EQ7 A;  1GRE A;  1CJ4 A;  2UZZ A;  4Z44 A;  5KWF A;  1DXL A;  1L9D A;  2GVC A;  2WOI A;  3KLJ A;  2GAG B;  5JCK A;  1N4W A;  3AB1 A;  3WE0 A;  4K5R A;  3GRS A;  2XVJ A;  1ZMC A;  4UDQ A;  2JB3 A;  1N4U A;  4Y4L A;  1TDO A;  3IHM A;  4U2S A;  3NHO X;  1Y56 A;  4IV9 A;  2APG A;  4OCG A;  5HYM A;  5U25 A;  2BK4 A;  2WPC A;  3AWI A;  3ZDN A;  4H4Y A;  1K4Q A;  1E1N A;  1RYI A;  2GEW A;  3K30 A;  2Q6U A;  4U8M A;  3LB8 A;  2B7R A;  3NTD A;  1P2H A;  4EMJ A;  2X50 A;  4JY3 A;  2V3A A;  1CJC A;  4XWZ A;  1QJD A;  1F3P A;  2V6O A;  4M52 A;  1ZP0 A;  2DKI A;  4AP1 A;  1Y56 B;  3UTF A;  2VRM A;  4GUV A;  1LVL A;  1EL8 A;  3CPJ G;  3B6D A;  2FJE A;  2BA9 A;  2C3D A;  2Q7V A;  2B9X A;  3OC4 A;  5U1O A;  3ITJ A;  5J60 A;  3AE8 A;  2FJD A;  2Z5Y A;  1CC6 A;  1YQ3 A;  2YQU A;  1H84 A;  4EM3 A;  3DK8 A;  4KX6 A;  5FS8 A;  3CNP A;  3SQP A;  1CJ2 A;  3IHG A;  1F8R A;  1KF6 A;  2W0H A;  4TLZ A;  4K22 A;  4BK1 A;  1GTE A;  2C7G A;  3RED A;  2WOW A;  1H6V A;  4IVO B;  4B67 A;  3LOV A;  4AP3 A;  2EQ9 A;  1DJQ A;  1OJ9 A;  1S3E A;  4J34 A;  3G5S A;  3ZYX A;  3CPI G;  3ICS A;  4OPC A;  2RGH A;  1V59 A;  3SGL A;  3UOV A;  1RP0 A;  3R9U A;  1COY A;  1S3B A;  3DK4 A;  4H4T A;  1NEK A;  4GDE A;  1D4E A;  3KPF A;  2RGJ A;  4GCM A;  3C4A A;  2XVE A;  3DME A;  1OJA A;  4CY6 A;  3GYJ A;  3CN8 A;  3CNT A;  3LJP A;  1FCD A;  1CHU A;  1P2E A;  4TM1 A;  2TMD A;  4YSH A;  1PS9 A;  2V60 A;  2WES A;  1NPX A;  3SM8 A;  2YG4 A;  3AYI A;  1GTH A;  3UP5 A;  4U8I A;  3HZL A;  4MJW A;  5KXJ A;  4JNA A;  1GRT A;  1XPQ A;  3ALM A;  1FEC A;  1DOC A;  2YG5 A;  3G5R A;  1BF3 A;  2RAB A;  1E1K A;  3NYE A;  3EAO A;  1XAN A;  2PHH A;  4IVM B;  2FJA A;  3UTE A;  5KOW A;  4DSH A;  1VDC A;  4X9N A;  1S2Y A;  3ICR A;  4X4J A;  1BKW A;  2XLR A;  3GD3 A;  4E0V A;  1JU2 A;  1NG4 A;  3EF6 A;  3M12 A;  3AE9 A;  2C3C A;  3LZW A;  5BRT A;  1TDF A;  2YVJ A;  2XYO A;  4FX9 A;  4H2P A;  1E7P A;  1GEU A;  4EQS A;  1LJ1 A;  2C64 A;  2H88 A;  1ONF A;  4NZH A;  1EL7 A;  2V3B A;  3IC9 A;  3P1W A;  2WU5 A;  1Q1R A;  1MOK A;  2X99 A;  5FS9 A;  3CGE A;  1D4C A;  1YY5 A;  2OA1 A;  2WET A;  3NGC X;  4OPL A;  4B64 A;  5JCM A;  1K0L A;  1FEB A;  3CND A;  2VRL A;  3DA1 A;  2B9W A;  3S61 A;  1PBB A;  4WX1 A;  3NRN A;  2WHD A;  4K2X A;  1PJ6 A;  1Q1W A;  4YWO A;  2HQM A;  5DBJ A;  3GMB A;  1S2Q A;  1E1M A;  2XVF A;  1OJC A;  3DGH A;  1NHQ A;  3QSS A;  4C3X A;  1E39 A;  1Z6L A;  3AD7 B;  3K7T A;  4DGK A;  4J56 A;  2QAE A;  3SFD A;  2ZBW A;  2BAB A;  4UDR A;  2YVG A;  4GDP A;  2XFP A;  1ZOY A;  4GF7 A;  4HB9 A;  3Q6J A;  5KVI A;  2CVJ A;  2Q0L A;  3BI5 A;  1F8S A;  2VVL A;  2R4E A;  1Y0P A;  4USR A;  1FEA A;  2F5Z A;  2R46 A;  2CUL A;  2XFU A;  3UTG A;  4A79 A;  4K8D A;  4HA6 A;  1H86 A;  1DOD A;  4CRT A;  1O5W A;  4UDP A;  1DNC A;  3K7Q X;  4CY8 A;  1GV4 A;  4LU6 A;  1TDE A;  1W4X A;  1DOB A;  1PBD A;  1NAA A;  4EQR A;  2VZ2 A;  3CIR A;  3QVR A;  5GSN A;  4YSX A;  2GR0 A;  1PBC A;  3PO7 A;  1GSN A;  3GD4 A;  2Y6R A;  2XLS A;  4Z26 A;  1ZMD A;  2ZZB A;  1X31 B;  3PS9 A;  4IA6 A;  3UKL A;  4BK3 A;  4N9X A;  3V3O A;  4ZCD A;  3AEA A;  2WPF A;  1QLB A;  3ADA B;  1ZOV A;  1CC4 A;  3D1C A;  2X3N A;  2X8G A;  1KSS A;  1MXT A;  1YKJ A;  1D7Y A;  2XLT A;  4Z2R A;  1TYP A;  2NVK X;  1DOE A;  1L9C A;  4H2R A;  1LQU A;  1PBE A;  3SFE A;  2BXR A;  1GAL A;  3COX A;  3KU9 A;  4JQ9 A;  4YKG A;  3AEE A;  5C2T A;  4EQW A;  4CCR A;  2B7S A;  3CGB A;  1PXB A;  1UKV G;  3T37 A;  5JCI A;  1N1P A;  2GR2 A;  2YAU A;  3NK1 X;  3NYF A;  4NEV A;  4EMI A;  2WDR A;  4U8N A;  1H81 A;  5J7X A;  3CNS A;  3NIX A;  2BK3 A;  3QSE A;  5HXI A;  3BHK A;  3JSK A;  4XWR A;  2A8X A;  1IUW A;  2XFN A;  2GR3 A;  4RG4 A;  3QFB A;  2C72 A;  3GWD A;  2C76 A;  2C66 A;  4O5Q A;  1OJT A;  1MO9 A;  2GAH B;  1GRG A;  2Y6Q A;  1KNR A;  4UP3 A;  4BJZ A;  1F6M A;  1RSG A;  1KDG A;  3M13 A;  4BUR A;  2QA1 A;  4U8J A;  1IUT A;  3B3R A;  3NG7 X;  4YSZ A;  3AE5 A;  5M0Z A;  2X8H A;  2YM2 A;  1DJN A;  2RGO A;  1IJH A;  3UP4 A;  2WBA A;  1GRB A;  3RP6 A;  4LII A;  1H7X A;  2GF3 A;  3CGC A;  4H4S A;  2IVD A;  3UKH A;  4D03 A;  2V61 A;  3FMW A;  3OZ2 A;  1LV0 A;  3AYL A;  3NT6 A;  3AEB A;  3KA7 A;  4I59 A;  1JNZ A;  4DSG A;  4FDC B;  1XHC A;  1IUU A;  3NK0 X;  4EM4 A;  4Y4N A;  3AD8 B;  4YSY A;  4FK1 C;  4OPG A;  1AOG A;  1ZY8 A;  1GPE A;  1CF3 A;  3BI4 A;  4U2L A;  4U8K A;  4H4Q A;  5IQ1 A;  3FBS A;  2A89 A;  3AE6 A;  1FOH A;  2IVE A;  5L46 A;  4YXD A;  2WS3 A;  3D8X A;  3S5W A;  4NEW A;  2WP6 A;  2YVF A;  4XXG A;  4NTE A;  2YLX A;  3IWA A;  3ALL A;  1ZX9 A;  1TDN A;  2GQW A;  2BS4 A;  5ER0 A;  2IID A;  4CBQ A;  1LPF A;  2BAC A;  1F8W A;  3I3L A;  3F8P A;  3RHA A;  5EBK A;  2QCU A;  1EBD A;  2YR6 A;  2A87 A;  1NHR A;  1VRQ B;  4OVI A;  4OPT A;  1GRA A;  5GRT A;  2I0Z A;  4B63 A;  1PN0 A;  3ISH A;  4BV6 A;  1ZDL A;  4ADW A;  2YWL A;  4REK A;  4B66 A;  1YQZ A;  2R0P A;  2CDU A;  2GH5 A;  2JK6 A;  2GR1 A;  1E1L A;  3LAD A;  3GMC A;  2OLO A;  3KKJ A;  4AT0 A;  3P4Q A;  3RNM A;  2E5V A;  4B68 A;  4C5O A;  4B69 A;  4Z43 A;  2AR8 A;  4X9M A;  3VR9 A;  3H4K A;  2YR4 A;  3VR8 A;  3DGZ A;  3AE4 A;  3ATQ A;  3IF9 A;  4OPD A;  4BJY A;  3GDN A;  4EIP A;  4NTC A;  2FBW A;  1QO8 A;  2VVL G;  3UCL A;  5JCN A;  2YG7 A;  4RG3 A;  3NN0 X;  3RP8 A;  1GOS A;  4P9S A;  2JB2 A;  4IA5 A;  4J33 A;  3QFA A;  3FIM B;  3PVC A;  2WPE A;  1B37 A;  2JB1 A;  3GSI A;  4GRT A;  3H8I A;  1VG0 A;  3AE3 A;  4D04 A;  4A5L A;  4GR1 A;  4J2W A;  1OJD A;  4CNK A;  3AEC A;  3UKK A;  1O94 A;  3Q9T A;  2VVM A;  4EQX A;  3M0O A;  5CKU A;  3UOY A;  1ZKQ A;  5KRQ A;  2C73 A;  1B5Q A;  2J3N A;  2BS3 A;  2C67 A;  3UKQ A;  4I58 A;  3UKP A;  1JRY A;  2GB0 A;  3DJE A;  3UKA A;  2E4G A;  2ACZ A;  2O9Z A;  2VQ7 A;  1H83 A;  3ABV A;  3LZX A;  2YLS A;  4BK2 A;  3DK9 A;  4TM0 A;  2ARD A;  2V5Z A;  4H50 A;  2YLW A;  5EB5 A;  5HHF A;  5CQF A;  2Z5X A;  1ZK7 A;  3AED A;  2XCG A;  3P4P A;  4H4Z A;  4JNQ A;  3VQR A;  1JOA A;  4H4V A;  4H4U A;  2AAQ A;  3ALJ A;  1JRX A;  1PJ5 A;  4JY2 A;  4A6N A;  4PAB A;  2WDV A;  5BUK A;  2R45 A;  3AE7 A;  4JDR A;  4K7Z A;  2WDQ A;  3P9U A;  5FS6 A;  1NDA A;  3P4S A;  3I6D A;  1PXA A;  3BHF A;  3DJG X;  2YG6 A;  2GMH A;  4YT0 A;  5FMH A;  4TM4 A;  4C77 A;  3GYI A;  3DH9 A;  1TYT A;  3FG2 P;  3AE2 A;  2BC1 A;  2YLT A;  4FK1 A;  3G5Q A;  2WQY A;  1BWC A;  3URH A;  2CFY A;  3H8L A;  3DJJ A;  2XFQ A;  2XLU A;  1LQT A;  2JKC A;  3KD9 A;  1LTX R;  1VQW A;  3UKF A;  3QJ4 A;  4B1B A;  1K0I A;  3NK2 X;  3F8D A;  2AQJ A;  2YG3 A;  1YQ4 A;  2E1M A;  4H2Q A;  2C75 A;  4OPU A;  4AOX A;  5BVA A;  3F8R A;  2WEU A;  3ICT A;  2YLZ A;  4U2T A;  3EPT A;  2R4J A;  5EB4 A;  4TLX A;  3RP7 A;  4O5U A;  3UOZ A;  1L9E A;  2DKH A;  3UTH A;  2VOU A;  4H4W A;  5M10 A;  4B65 A;  3E1T A;  1N4V A;  2ZZ0 A;  3CGD A;  3II4 A;  4ZCC A;  5EOW A;  4A65 A;  1GXF A;  1EL5 A;  2BC0 A;  1ELI A;  2ZZC A;  2C65 A;  3UOX A;  1GND A;  2WP9 A;  2XDO A;  2XVH A;  2YR5 A;  3AEG A;  2R0G A;  2XLP A;  1KNP A;  3VRB A;  4A6N B;  4EIQ A;  2GV8 A;  2OAM A;  1PXC A;  3C4N A;  1GES A;  2BCP A;  4H4X A;  4ECH A;  1NEN A;  3BNM A;  1K0J A;  5C3J A;  4H4P A;  4A99 A;  3CTY A;  4AOS A;  1NHP A;  1NG3 A;  4NTD A;  3GDP A;  4J31 A;  4AT2 A;  2PYX A;  4C74 A;  4CNJ A;  3QSM A;  1HYU A;  4Z24 A;  2B9Y A;  1B8S A;  1E6E A;  2NPX A;  3AXB A;  3BI2 A;  1IUX A;  2WP5 A;  1CL0 A;  2GRT A;  3LXD A;  1IUS A;  3K7M X;  4WCT A;  1VG9 A;  1PHH A;  4YTN A;  2JAE A;  4U8O A;  4J57 A;  2BXS A;  4H4R A;  1PJ7 A;  5KOX A;  2B76 A;  5FS7 A;  3NKS A;  3P4R A;  2Q0K A;  5HY5 A;  3O0H A;  2EQ6 A;  4Z2U A;  1BGJ A;  4ICY A;  3EAN A;  1SEZ A;  2X8C A;  1TRB A;  3C96 A;  4RSL A;  1D4D A;  1REO A;  5IQ4 A;  1D5T A;  2XFO A;  5JCL A;  1GER A;  3V3N A;  2C70 A;  4Z25 A;  1IUV A;  1D7L A;  1KSU A;  4H7U A;  2QA2 A;  3AE1 A;  3L8K A;  1GT8 A;  3KVE A;  4EMW A;  1O95 A;  5U63 A;  1GET A;  2BCG G;  3GRT A;  3DJD A;  3AYJ A;  2OLN A;  3CNJ A;  4K5S A;  5TR3 A;  3AD9 B;  4PAA A;  1JEH A;  2WU2 A;  3NN6 X;  4DNA A;  4C3Y A;  3BNU A;  1GRF A;  1B4V A;  2OAL A;  2EQ8 A;  4CCQ A;  5KVH A;  5LV9 A;  2WOV A;  4ZN0 A;  2FJB A;  2H89 A;  1CBO A;  1FL2 A;  1L0V A;  2BS2 A;  2R9Z A;  1EL9 A;  1H82 A;  2BK5 A;  4U8L A;  4YTP A;  1CC2 A;  1GRH A;  3NNE A;  1XDI A;  2GQF A;  3CPH G;  1M6I A;  4Y4M A;  3NYC A;  4KPR A;  1CJ3 A;  1Q9I A;  1TDK A;  2VQB A;  1PDH A;  2GMJ A;  4TM3 A;  1H7W A;  4A9W A;  3NTA A;  3NH3 X;  4OPI A;  2R0C A;  3QVP A;  2YLR A;  4H2N A;  3VRD B;  4LA1 A;  1JRZ A;  3L1R A;  5IPY A;  1NHS A;  2BYB A;  1JNR A;  4J36 A; 
#chains in the Genus database with same CATH topology
 4Z2T A;  4JN9 A;  3GWF A;  5BUL A;  3V76 A;  4APN A;  2XVI A;  3QLD A;  3VRA A;  3AEF A;  2GVC A;  2GAG B;  5JCK A;  1N4W A;  3AB1 A;  3WE0 A;  3GRS A;  4UDQ A;  1N4U A;  4Y4L A;  4U2S A;  3NHO X;  1Y56 A;  4OCG A;  5HYM A;  2BK4 A;  3HYV A;  1E1N A;  2GEW A;  3MWC A;  2Q6U A;  4K1W A;  3H8A A;  3NTD A;  2X50 A;  4FP1 A;  1QJD A;  3H7V A;  3UTF A;  2VRM A;  4DX3 A;  2ONE A;  1SB3 B;  3UJF A;  1TE6 A;  2PGE A;  4EM3 A;  2W0H A;  4IP5 A;  4K22 A;  4X2P A;  4IVO B;  2EQ9 A;  1DJQ A;  1XS2 A;  4GAV A;  3SGL A;  4G74 A;  4DHG A;  3R9U A;  1COY A;  1S3B A;  4H4T A;  1NEK A;  3KPF A;  3C4A A;  2HZG A;  3NZG A;  3UGV A;  3T4W A;  5IDZ A;  3ALM A;  1FEC A;  5KMR A;  1XAN A;  4X4J A;  1BKW A;  2XLR A;  1JU2 A;  1T3Q C;  3T31 A;  5BRT A;  4EQS A;  2H88 A;  1YY5 A;  5FS9 A;  1D4C A;  2PU0 A;  2WET A;  3H12 A;  4OPL A;  1K0L A;  2B9W A;  1NEL A;  3NRN A;  4K2X A;  3PWG A;  1Q1W A;  3DDM A;  1OJC A;  4DGK A;  3K7T A;  3NVW B;  3H70 A;  4HB9 A;  1F8S A;  1Y0P A;  2CUL A;  3FYY A;  5KMS A;  1H86 A;  1DOD A;  4CRT A;  3HRD C;  4LU6 A;  1TDE A;  2RDX A;  3QVR A;  4YSX A;  3ES8 A;  2QDD A;  1SJC A;  3S47 A;  3MSY A;  3TQP A;  2ZZB A;  3PS9 A;  4IA6 A;  3B9J B;  3D1C A;  2X3N A;  2X8G A;  3CXO A;  4H2R A;  3COX A;  3KU9 A;  5C2T A;  2QJN A;  3STP A;  4DWD A;  1UKV G;  2P8C A;  3NK1 X;  3GO2 A;  2GR3 A;  1KNR A;  4BJZ A;  2OPJ A;  3M13 A;  2QA1 A;  4G73 A;  3CXB A;  2X8H A;  3RO6 A;  3UP4 A;  2WBA A;  3RP6 A;  3CGC A;  3UKH A;  2V61 A;  3NVV B;  3KA7 A;  4I59 A;  4DSG A;  3NS1 B;  4OPG A;  4U8K A;  3FBS A;  2A89 A;  2NQL A;  3T8Q A;  4NEW A;  3RCY A;  3V4B A;  2YVF A;  2POZ A;  1TDN A;  2GQW A;  4CBQ A;  2BAC A;  1F8W A;  4GYP C;  5EBK A;  2YR6 A;  2A87 A;  4G8T A;  3ZVI A;  3ISH A;  2GDQ A;  3IK4 A;  4B66 A;  1YQZ A;  3GMC A;  1MNS A;  3RNM A;  3P4Q A;  4B69 A;  3H4K A;  3VR8 A;  3JW7 A;  1KCZ A;  4OPD A;  3I6T A;  3HW2 A;  3UCL A;  5JCN A;  3ENL A;  4IZG A;  2JB2 A;  1VG0 A;  3P0W A;  4J2W A;  3AEC A;  3Q9T A;  3CAW A;  3QTP A;  1JRP A;  1B5Q A;  2C67 A;  2GB0 A;  3CT2 A;  3LZX A;  5CQF A;  3BSM A;  3SZC A;  1ZK7 A;  3AED A;  3P4P A;  3VQR A;  3ALJ A;  1PJ5 A;  4JY2 A;  1EBH A;  1FFU C;  2WDQ A;  5FS6 A;  5FJP A;  3GY1 A;  2HXT A;  2GMH A;  4YT0 A;  4TM4 A;  1TYT A;  3AE2 A;  1STZ A;  4FK1 A;  2WQY A;  1BWC A;  3URH A;  4HPN A;  3H8L A;  2XLU A;  3DES A;  1LTX R;  4E8G A;  5FJT A;  2E1M A;  1WUF A;  1S7M A;  3UTH A;  2VOU A;  5M10 A;  4B65 A;  1MDR A;  3UOX A;  4A6N B;  3VRB A;  2R0G A;  2GV8 A;  2AL2 B;  2OAM A;  7ENL A;  3BNM A;  1K0J A;  5C3J A;  3OZY A;  3QSM A;  1B8S A;  1E6E A;  4WCT A;  1VG9 A;  4U8O A;  4J57 A;  4H4R A;  5FS7 A;  3MQT A;  4II2 A;  2EQ6 A;  1SEZ A;  3R10 A;  4RSL A;  1REO A;  5IQ4 A;  1PDY A;  1FHV A;  4Z25 A;  1KSU A;  3AE1 A;  1GT8 A;  1GET A;  1NU5 A;  3DJD A;  5TR3 A;  4PAA A;  1JEH A;  3NN6 X;  3ZVH A;  3BNU A;  1GRF A;  2PSN A;  2OAL A;  1SJD A;  3UXK A;  5KVH A;  2WOV A;  2FJB A;  4U8L A;  1GRH A;  1MUC A;  1WUE A;  4KPR A;  1TDK A;  3CK5 A;  3VC5 A;  1PDH A;  3ETR B;  3NTA A;  4G6H A;  2GGJ A;  3VRD B;  2PP3 A;  1NHS A;  1FHU A;  4USQ A;  3BJS A;  3NLC A;  2ZC8 A;  4Z17 A;  4H1Z A;  1DTN A;  3FPZ A;  2TPR A;  1PBF A;  1BGN A;  1DXL A;  3RRA A;  4TVY A;  4HN8 A;  1TDO A;  3IHM A;  4IV9 A;  2PS2 A;  2WPC A;  1K4Q A;  3LB8 A;  3OPS A;  1P2H A;  3CMM A;  4YWS A;  1KN0 A;  4AP1 A;  4M52 A;  1ZP0 A;  1WYG A;  3CPJ G;  1MDL A;  2FJE A;  2BA9 A;  5U1O A;  3SJN A;  3AE8 A;  2FJD A;  2Z5Y A;  1YQ3 A;  2YQU A;  1H84 A;  2GGE A;  5FS8 A;  3IHG A;  3SQP A;  4BK1 A;  4ENL A;  1GTE A;  2WOW A;  4B67 A;  1OJ9 A;  1S3E A;  4OPC A;  2RGH A;  3UOV A;  1RP0 A;  4GIR A;  3TOY A;  2RGJ A;  4GCM A;  3DME A;  1KKO A;  4YSH A;  1CHU A;  5JRB A;  1PS9 A;  2V60 A;  2WES A;  1NPX A;  4GFI A;  3SM8 A;  2YG4 A;  4U8I A;  5KXJ A;  4E4F A;  3MKC A;  1XPQ A;  4G7F A;  5KOW A;  2PHH A;  3UTE A;  4F4R A;  4FI4 A;  1S2Y A;  1FO4 A;  3GD3 A;  3LZW A;  1TDF A;  4H2P A;  2C64 A;  1ONF A;  3P1W A;  2PP1 A;  3CYJ A;  2X99 A;  2OA1 A;  3SXI A;  1FEB A;  3CND A;  3DA1 A;  2WHD A;  5DBJ A;  3GMB A;  3DFH A;  1NHQ A;  3QSS A;  1Z6L A;  3AD7 B;  1N62 C;  2QAE A;  4UDR A;  4GDP A;  1ZOY A;  3EUB 3;  3Q6J A;  5KVI A;  2CVJ A;  1R6W A;  2R4E A;  3PK7 A;  3AN1 A;  1O5W A;  4UDP A;  1W4X A;  2VZ2 A;  5GSN A;  4KEM A;  1PBC A;  2W3R A;  3GD4 A;  2Y6R A;  1ECQ A;  4BK3 A;  3V3O A;  3AEA A;  2WPF A;  5FJO A;  1MXT A;  1D7Y A;  1L9C A;  1DOE A;  2BXR A;  1GAL A;  4YKG A;  3T2Y A;  4CCR A;  2OKT A;  3T37 A;  3TJ4 A;  2I5Q A;  2WDR A;  1KD0 A;  3QKE A;  1SJA A;  2BK3 A;  3QSE A;  5HXI A;  3BHK A;  3T2Z A;  3JSK A;  4XWR A;  3R07 C;  2A8X A;  1IUW A;  2C72 A;  3GWD A;  5FJR A;  4O5Q A;  1MO9 A;  2GAH B;  1RSG A;  1KDG A;  3DGB A;  2QGY A;  4U8J A;  1IUT A;  1DJN A;  1KKR A;  1GRB A;  3SY4 A;  3NVZ B;  1H7X A;  2GF3 A;  4H4S A;  4D03 A;  3FMW A;  1LV0 A;  4Y4N A;  4GIS A;  1GPE A;  3L5O A;  3AE6 A;  1FOH A;  3MY9 A;  4YXD A;  2WS3 A;  3S5W A;  2WP6 A;  3A7R A;  1P43 A;  3UJE A;  4KPL A;  1ZX9 A;  4ROP A;  2XH0 A;  3SSZ A;  3F8P A;  2QCU A;  2E5A A;  4OPT A;  3GYX A;  3EKG A;  4H83 A;  2GH5 A;  2JK6 A;  2GR1 A;  3LAD A;  4X9M A;  2PTY A;  4A35 A;  1E9I A;  3DGZ A;  3DIP A;  2PGW A;  3D9X A;  4NTC A;  1RM6 B;  2PA6 A;  3T0K A;  2YG7 A;  4RG3 A;  3QFA A;  3PVC A;  2WPE A;  3GSI A;  3H8I A;  3SYI A;  3AE3 A;  3R25 A;  4A5L A;  4GR1 A;  3V5F A;  3IJQ A;  2VVM A;  4EQX A;  5CKU A;  3OTR A;  5KRQ A;  2C73 A;  3SN1 A;  3UKP A;  2VQ7 A;  2GGI A;  4BK2 A;  4TM0 A;  2ARD A;  4H50 A;  5EB5 A;  2Z5X A;  1JOA A;  4H4V A;  1TKK A;  2AAQ A;  1JPM A;  4A6N A;  3AE7 A;  4K7Z A;  2XH7 A;  3P9U A;  3GYI A;  3DH9 A;  2BC1 A;  3DG6 A;  3QPE A;  2CFY A;  3UKF A;  2AQJ A;  1YQ4 A;  4M0X A;  4H2Q A;  2C75 A;  3U4F A;  4J3Z A;  4AOX A;  4JN7 A;  3F8R A;  2WEU A;  4U2T A;  3EPT A;  2R4J A;  2PU1 A;  4H4W A;  4E4U A;  2ZZ0 A;  3II4 A;  4GGB A;  5EOW A;  4A65 A;  1EL5 A;  1GND A;  2WP9 A;  2XDO A;  1R0M A;  1PXC A;  2BCP A;  4A99 A;  2P8B A;  1NG3 A;  4NTD A;  2B9Y A;  2NPX A;  3Q45 A;  1IUX A;  4YTN A;  1IUS A;  1PHH A;  2BXS A;  3O0H A;  3P3B A;  1ELS A;  2BRA A;  1GER A;  2C70 A;  1IUV A;  1D7L A;  4H7U A;  2GL5 A;  3GC2 A;  5U63 A;  2BCG G;  3GRT A;  2OLN A;  4K5S A;  2WU2 A;  5KMQ A;  3NFU A;  4ZN0 A;  1VQZ A;  1EL9 A;  2BK5 A;  2QJJ A;  3CPH G;  1M6I A;  2PMQ A;  1CJ3 A;  1Q9I A;  2VQB A;  4TM3 A;  2GMJ A;  4H2N A;  4LA1 A;  2BYB A;  4J36 A;  1KFY A;  1BKH A;  4YTM A;  3OZM A;  4U8P A;  4A7A A;  2JBV A;  3OP2 A;  3ATR A;  1PDZ A;  4E6M A;  1EC7 A;  1BZL A;  2EQ7 A;  1CJ4 A;  2UZZ A;  4Z44 A;  2WOI A;  2ZAD A;  5KMP A;  4K5R A;  1ZMC A;  2JB3 A;  3ZDN A;  3AWI A;  4ZA0 A;  1RYI A;  3K30 A;  4MMW A;  1EBG A;  4EMJ A;  4XWZ A;  2V6O A;  2C3D A;  1IYX A;  2B9X A;  5J60 A;  2OZ8 A;  3RGT A;  1CC6 A;  2AL1 A;  3DK8 A;  1CJ2 A;  1KF6 A;  2MUC A;  4TLZ A;  3RED A;  3LOV A;  4AP3 A;  2FKP A;  2PPG A;  3ICS A;  3FCP A;  1V59 A;  3FV9 A;  4GDE A;  1OJA A;  4CY6 A;  3CN8 A;  3LJP A;  1P2E A;  4TM1 A;  1F9C A;  1YEY A;  3AYI A;  2E3T A;  3UP5 A;  1JCT A;  4MJW A;  1DOC A;  2YG5 A;  1BF3 A;  3EAO A;  1VDC A;  3ES7 A;  3TCS A;  2GGG A;  3M12 A;  3EF6 A;  3AE9 A;  2C3C A;  2YVJ A;  1P48 A;  2XYO A;  3EEZ A;  1E7P A;  3K1G A;  4NZH A;  3TJI A;  1MOK A;  3CGE A;  4B64 A;  5JCM A;  3S61 A;  1PBB A;  4WX1 A;  3MUC A;  4YWO A;  2HQM A;  1S2Q A;  1E1M A;  2XVF A;  3RIT A;  4Z1Y A;  3DGH A;  3SFD A;  2BAB A;  2OLA A;  2YVG A;  2XGZ A;  2XFP A;  3FJ4 A;  2OZ3 A;  4GF7 A;  5BOF A;  1FEA A;  3UTG A;  2XFU A;  4K8D A;  4HA6 A;  1DNC A;  4CY8 A;  1GV4 A;  1DOB A;  1PBD A;  3CIR A;  2OQY A;  2GR0 A;  1ZMD A;  1X31 B;  3UKL A;  3UXL A;  4N9X A;  4ZCD A;  1QLB A;  3ADA B;  1ZOV A;  1CC4 A;  2XLT A;  4Z2R A;  1LQU A;  1PBE A;  4JQ9 A;  3AEE A;  4EQW A;  1X2G A;  2YAU A;  3NYF A;  4EMI A;  3CNS A;  1L8P A;  3N4E A;  3QFB A;  2C76 A;  2C66 A;  1GRG A;  4UP3 A;  1F6M A;  4BUR A;  3B3R A;  3NG7 X;  1ONE A;  3AE5 A;  5M0Z A;  4DYE A;  2PP0 A;  1IJH A;  5EU9 A;  3OZ2 A;  3T14 A;  3NT6 A;  1JNZ A;  4EM4 A;  3AD8 B;  3ZLF A;  4FK1 C;  4U2L A;  1CF3 A;  4H4Q A;  5IQ1 A;  1FFV C;  2IVE A;  5L46 A;  3D8X A;  2AKM A;  4XXG A;  3TWB A;  2YLX A;  3IWA A;  3BOX A;  3CB3 A;  5ER0 A;  1N60 C;  2IID A;  2P0I A;  3I3L A;  1NHR A;  1VRQ B;  2I0Z A;  4REK A;  2CDU A;  1E1L A;  4J1O A;  2OLO A;  4C5O A;  4AT0 A;  4B68 A;  2E5V A;  4Z43 A;  2AR8 A;  3VR9 A;  2HXU A;  3SN0 A;  3AE4 A;  3GD6 A;  2C4C A;  1ZXI C;  4BJY A;  2FBW A;  2VVL G;  3T2K A;  3NN0 X;  3RP8 A;  5G5H B;  4J33 A;  3R11 A;  5G5G B;  3FIM B;  1B37 A;  4GRT A;  4DN1 A;  4D04 A;  4A3R A;  1OJD A;  4CNK A;  4IT1 A;  1O94 A;  4K8G A;  3M0O A;  1MRA A;  1ZKQ A;  3A7U A;  3DG7 A;  3UKQ A;  4I58 A;  1N61 C;  2E4G A;  2ACZ A;  1H83 A;  3VDG A;  4DXK A;  2W3S A;  2XCG A;  4JNQ A;  4H4Z A;  3UJ2 A;  5BUK A;  2R45 A;  4HNC A;  6ENL A;  3N6J A;  1RVK A;  1PXA A;  3DJG X;  5FMH A;  4A6G A;  3UJS A;  3FG2 P;  2BRY A;  2YLT A;  4IL2 A;  2AL2 A;  3DJJ A;  1LQT A;  2JKC A;  3QJ4 A;  3F8D A;  1V97 A;  2YG3 A;  4OPU A;  3ICT A;  5EB4 A;  2YLZ A;  3UOZ A;  3RP7 A;  1L9E A;  3RR1 A;  2DKH A;  3SX6 A;  3I4K A;  3R0K A;  4H19 A;  3CGD A;  4ZCC A;  1GXF A;  2MNR A;  1ELI A;  2XVH A;  2YR5 A;  4EIQ A;  1KNP A;  1GES A;  4H4X A;  1NEN A;  4K2S A;  1VDV A;  3CTY A;  4AOS A;  1EC8 A;  4NNJ A;  4CNJ A;  4G6G A;  4Z24 A;  1JDF A;  3BI2 A;  3AXB A;  4ZOH B;  2WP5 A;  1CL0 A;  2GRT A;  3K7M X;  2QVH A;  2JAE A;  5KOX A;  4KWS A;  4GYP A;  3SR6 B;  3NKS A;  3P4R A;  5HY5 A;  3VCN A;  3EAN A;  3VA8 A;  2XFO A;  2O56 A;  3V3N A;  1BQG A;  3IJI A;  3JZU A;  3L8K A;  2OX4 A;  1X2H A;  4EMW A;  3AYJ A;  3AD9 B;  1B4V A;  1CBO A;  1FL2 A;  2BS2 A;  2R9Z A;  3PG6 A;  1CC2 A;  1XDI A;  2GQF A;  4Y4M A;  3PFR A;  3SQS A;  1H7W A;  2OQH A;  4A9W A;  3TTE A;  2OO6 A;  2R0C A;  2P3Z A;  3UJR A;  1JRZ A;  3L1R A;  5IPY A;  1JNR A;  4G9K A;  2XH2 A;  1M64 A;  4YKF A;  2YM1 A;  2OFJ A;  4HNL A;  1GRE A;  2DW6 A;  5KWF A;  1L9D A;  3KLJ A;  2XVJ A;  3UCD A;  2POD A;  2APG A;  3A7A A;  5U25 A;  4H4Y A;  4U8M A;  3P93 A;  2GSH A;  2B7R A;  4JY3 A;  2V3A A;  1CJC A;  1F3P A;  2DKI A;  1Y56 B;  4GUV A;  1LVL A;  1EL8 A;  3B6D A;  2Q7V A;  1EC9 A;  3OC4 A;  3D46 A;  3ITJ A;  4KX6 A;  3CNP A;  4NWZ A;  1F8R A;  4IL0 A;  2C7G A;  2PTW A;  1H6V A;  2HNE A;  3DG3 A;  2QQ6 A;  4J34 A;  3T9P A;  4JHM A;  3G5S A;  3ZYX A;  3CPI G;  2DW7 A;  3DK4 A;  2OVL A;  1D4E A;  2XVE A;  3GYJ A;  3CNT A;  1FCD A;  2TMD A;  1GTH A;  5KNL A;  3HZL A;  4JNA A;  1GRT A;  3QN3 A;  3NYE A;  3G5R A;  2RAB A;  1E1K A;  3B97 A;  4IVM B;  2FJA A;  3DEQ A;  4DSH A;  4X9N A;  3HYX A;  3ICR A;  4E0V A;  3UCC A;  1NG4 A;  2QDE A;  3HYW A;  4FX9 A;  1GEU A;  3VCC A;  1LJ1 A;  1EL7 A;  2V3B A;  3IC9 A;  2CHR A;  2WU5 A;  1Q1R A;  3I6E A;  3NRZ B;  3NGC X;  2VRL A;  3N4F A;  1TZZ A;  3ZVH B;  1PJ6 A;  3TW9 A;  4H2H A;  4TVW A;  2P88 A;  4E5T A;  4C3X A;  1E39 A;  4J56 A;  2ZBW A;  4HYR A;  2Q0L A;  3BI5 A;  2VVL A;  3VC6 A;  4USR A;  4II3 A;  2F5Z A;  2R46 A;  4A79 A;  3K7Q X;  4HCD A;  1NAA A;  4EQR A;  3NVY B;  3PO7 A;  1GSN A;  2XLS A;  2PTZ A;  3N6H A;  1KSS A;  2FYM A;  1YKJ A;  1TYP A;  2NVK X;  3SFE A;  3VFC A;  2B7S A;  3CGB A;  3KUM A;  1PXB A;  5JCI A;  1N1P A;  2GR2 A;  4NEV A;  4U8N A;  5J7X A;  1H81 A;  3NO1 A;  3NIX A;  2XFN A;  4RG4 A;  1OJT A;  2Y6Q A;  2OZT A;  2GGH A;  4GME A;  2W55 A;  4YSZ A;  2YM2 A;  2RGO A;  4LII A;  2IVD A;  5FJU A;  3AYL A;  3AEB A;  4FDC B;  1XHC A;  1IUU A;  3NK0 X;  4YSY A;  1AOG A;  1ZY8 A;  3BI4 A;  3ZLH A;  4MGG A;  4NTE A;  3FXG A;  3ALL A;  3U9I A;  3THU A;  2BS4 A;  1LPF A;  5J04 A;  3RHA A;  1EBD A;  2W54 A;  4OVI A;  2XSX A;  1GRA A;  5GRT A;  4B63 A;  1PN0 A;  4BV6 A;  1ZDL A;  4ADW A;  3V3W A;  2YWL A;  2R0P A;  3KKJ A;  2AKZ A;  2YR4 A;  3FVD A;  3ATQ A;  3IF9 A;  4MKS A;  3V5C A;  3GDN A;  4EIP A;  1OEP A;  3R1Z A;  4EWJ A;  1QO8 A;  1N5W C;  1GOS A;  4P9S A;  4IA5 A;  4IP4 A;  1XPY A;  2JB1 A;  1N63 C;  3TWA A;  3UKK A;  2QJM A;  3UOY A;  4HCH A;  4ZCW A;  3KPK A;  2BS3 A;  2J3N A;  1JRY A;  3DJE A;  3UKA A;  3ABV A;  2O9Z A;  2YLS A;  3DK9 A;  2V5Z A;  3AM9 A;  2YLW A;  5HHF A;  4H4U A;  3SZ0 A;  2OG9 A;  1JRX A;  4PAB A;  4JN8 A;  2WDV A;  4JDR A;  1NDA A;  3SZW A;  3P4S A;  3I6D A;  3BHF A;  2YG6 A;  4C77 A;  3DFY A;  3NXL A;  4IHC A;  3Q4D A;  3G5Q A;  4HCL A;  2XFQ A;  3KD9 A;  1VQW A;  3ZLG A;  4KT2 A;  4B1B A;  1K0I A;  3NK2 X;  3PWI A;  3SBF A;  5BVA A;  4TLX A;  4O5U A;  3E1T A;  1N4V A;  2BC0 A;  2ZZC A;  2C65 A;  3AEG A;  2XLP A;  1H2I A;  3C4N A;  4ECH A;  4H4P A;  1JPD X;  1N5X A;  1NHP A;  4AT2 A;  3GDP A;  4J31 A;  2PYX A;  4C74 A;  3T6C A;  1HYU A;  2XH4 A;  3HPF A;  3LXD A;  5BOE A;  1PJ7 A;  2B76 A;  2PTX A;  2Q0K A;  3JVA A;  3S5S A;  4Z2U A;  1BGJ A;  4ICY A;  2X8C A;  1SJB A;  1TRB A;  3C96 A;  1D4D A;  1W6T A;  3AMZ A;  1D5T A;  5JCL A;  2PCE A;  3DER A;  3SN4 A;  2QA2 A;  3OW1 A;  3KVE A;  1O95 A;  3SZF A;  4GAP A;  3CNJ A;  4C3Y A;  4DNA A;  4M6U A;  2EQ8 A;  4CCQ A;  3IJL A;  3R0U A;  5LV9 A;  3D47 A;  2H89 A;  1L0V A;  1H82 A;  5ENL A;  4YTP A;  3NNE A;  3NYC A;  1FIQ B;  4GGH A;  1JRO A;  3NH3 X;  4OPI A;  3QVP A;  2YLR A;  3MZN A;  4Z26 A; 
#chains in the Genus database with same CATH homology
 1KFY A;  4G9K A;  4Z2T A;  4YTM A;  4JN9 A;  4USQ A;  4U8P A;  1M64 A;  3NLC A;  4A7A A;  3GWF A;  5BUL A;  4YKF A;  2JBV A;  4APN A;  2XVI A;  2YM1 A;  3FPZ A;  3V76 A;  3ATR A;  2TPR A;  1PBF A;  1BZL A;  3VRA A;  1BGN A;  3AEF A;  2EQ7 A;  1GRE A;  1CJ4 A;  2UZZ A;  4Z44 A;  5KWF A;  1DXL A;  1L9D A;  2GVC A;  2WOI A;  3KLJ A;  2GAG B;  5KMP A;  5JCK A;  1N4W A;  3AB1 A;  3WE0 A;  4K5R A;  3GRS A;  2XVJ A;  1ZMC A;  4UDQ A;  2JB3 A;  1N4U A;  4Y4L A;  1TDO A;  3IHM A;  4U2S A;  3NHO X;  1Y56 A;  4IV9 A;  2APG A;  4OCG A;  5HYM A;  5U25 A;  2BK4 A;  2WPC A;  3AWI A;  3HYV A;  4H4Y A;  1K4Q A;  1E1N A;  1RYI A;  2GEW A;  3K30 A;  2Q6U A;  4U8M A;  3LB8 A;  2B7R A;  3CMM A;  1P2H A;  4EMJ A;  3NTD A;  2X50 A;  4JY3 A;  2V3A A;  1CJC A;  1KN0 A;  4XWZ A;  1QJD A;  1F3P A;  2V6O A;  4M52 A;  1ZP0 A;  2DKI A;  4AP1 A;  1Y56 B;  3UTF A;  2VRM A;  4GUV A;  1LVL A;  1EL8 A;  3CPJ G;  3B6D A;  2FJE A;  2BA9 A;  2C3D A;  2Q7V A;  2B9X A;  3OC4 A;  5U1O A;  3ITJ A;  5J60 A;  3AE8 A;  2FJD A;  2Z5Y A;  1CC6 A;  1YQ3 A;  2YQU A;  1H84 A;  4EM3 A;  3DK8 A;  4KX6 A;  5FS8 A;  3CNP A;  3SQP A;  1CJ2 A;  3IHG A;  4NWZ A;  1F8R A;  1KF6 A;  2W0H A;  4TLZ A;  4K22 A;  4BK1 A;  1GTE A;  2C7G A;  3RED A;  2WOW A;  1H6V A;  4IVO B;  4B67 A;  3LOV A;  4AP3 A;  2EQ9 A;  1DJQ A;  1OJ9 A;  1S3E A;  4J34 A;  3G5S A;  3ZYX A;  3CPI G;  3ICS A;  4OPC A;  2RGH A;  1V59 A;  4GAV A;  3SGL A;  3UOV A;  4G74 A;  1RP0 A;  3R9U A;  1COY A;  1S3B A;  3DK4 A;  4H4T A;  1NEK A;  4GDE A;  1D4E A;  3KPF A;  2RGJ A;  4GCM A;  3C4A A;  2XVE A;  3DME A;  1OJA A;  4CY6 A;  3GYJ A;  3CN8 A;  3CNT A;  3LJP A;  1FCD A;  1CHU A;  1P2E A;  4TM1 A;  2TMD A;  4YSH A;  5JRB A;  1PS9 A;  2V60 A;  2WES A;  1NPX A;  3SM8 A;  2YG4 A;  3AYI A;  1GTH A;  3UP5 A;  4U8I A;  5KNL A;  3HZL A;  4MJW A;  5KXJ A;  4JNA A;  1GRT A;  1XPQ A;  3ALM A;  1FEC A;  5KMR A;  1DOC A;  2YG5 A;  3G5R A;  1BF3 A;  2RAB A;  1E1K A;  3NYE A;  3EAO A;  1XAN A;  2PHH A;  4IVM B;  2FJA A;  3UTE A;  5KOW A;  4DSH A;  1VDC A;  4X9N A;  3HYX A;  1S2Y A;  3ICR A;  4X4J A;  1BKW A;  2XLR A;  3GD3 A;  4E0V A;  1JU2 A;  1NG4 A;  3EF6 A;  3M12 A;  3AE9 A;  3T31 A;  2C3C A;  3LZW A;  5BRT A;  1TDF A;  2YVJ A;  3HYW A;  2XYO A;  4FX9 A;  4H2P A;  1E7P A;  1GEU A;  4EQS A;  1LJ1 A;  2C64 A;  2H88 A;  1ONF A;  4NZH A;  1EL7 A;  2V3B A;  3IC9 A;  3P1W A;  2WU5 A;  1Q1R A;  1MOK A;  2X99 A;  5FS9 A;  3CGE A;  1D4C A;  1YY5 A;  2OA1 A;  2WET A;  3NGC X;  4OPL A;  3SXI A;  5JCM A;  1K0L A;  1FEB A;  3CND A;  2VRL A;  3DA1 A;  2B9W A;  3S61 A;  1PBB A;  4WX1 A;  3NRN A;  2WHD A;  4K2X A;  1PJ6 A;  1Q1W A;  4YWO A;  2HQM A;  5DBJ A;  3GMB A;  1S2Q A;  1E1M A;  2XVF A;  1OJC A;  3DGH A;  1NHQ A;  3QSS A;  4C3X A;  1E39 A;  1Z6L A;  3AD7 B;  3K7T A;  4DGK A;  4J56 A;  2QAE A;  3SFD A;  2ZBW A;  2BAB A;  4UDR A;  2YVG A;  4GDP A;  2XFP A;  1ZOY A;  4GF7 A;  4HB9 A;  3Q6J A;  5KVI A;  2CVJ A;  2Q0L A;  3BI5 A;  1F8S A;  2VVL A;  2R4E A;  1Y0P A;  4USR A;  4II3 A;  1FEA A;  2F5Z A;  2R46 A;  2CUL A;  2XFU A;  3UTG A;  4A79 A;  4K8D A;  4HA6 A;  5KMS A;  1H86 A;  1DOD A;  4CRT A;  1O5W A;  4UDP A;  1DNC A;  3K7Q X;  4CY8 A;  1GV4 A;  4LU6 A;  1TDE A;  1W4X A;  1DOB A;  1PBD A;  1NAA A;  4EQR A;  2VZ2 A;  3CIR A;  3QVR A;  5GSN A;  4YSX A;  2GR0 A;  1PBC A;  3PO7 A;  1GSN A;  3GD4 A;  2Y6R A;  2XLS A;  4Z26 A;  1ZMD A;  2ZZB A;  1X31 B;  3PS9 A;  4IA6 A;  3UKL A;  4BK3 A;  4N9X A;  3V3O A;  4ZCD A;  3AEA A;  2WPF A;  1QLB A;  3ADA B;  1ZOV A;  1CC4 A;  3D1C A;  2X3N A;  2X8G A;  1KSS A;  1MXT A;  1YKJ A;  1D7Y A;  2XLT A;  4Z2R A;  1TYP A;  2NVK X;  1DOE A;  1L9C A;  4H2R A;  1LQU A;  1PBE A;  3SFE A;  2BXR A;  1GAL A;  3COX A;  3KU9 A;  4JQ9 A;  4YKG A;  3AEE A;  3T2Y A;  5C2T A;  4EQW A;  4CCR A;  2B7S A;  3CGB A;  1PXB A;  1UKV G;  3T37 A;  5JCI A;  1N1P A;  2GR2 A;  2YAU A;  3NK1 X;  3NYF A;  4NEV A;  4EMI A;  2WDR A;  4U8N A;  1H81 A;  5J7X A;  3CNS A;  3NIX A;  2BK3 A;  3QSE A;  5HXI A;  3BHK A;  3T2Z A;  3JSK A;  4XWR A;  2A8X A;  1IUW A;  2XFN A;  2GR3 A;  4RG4 A;  3QFB A;  2C72 A;  3GWD A;  2C76 A;  2C66 A;  4O5Q A;  1OJT A;  1MO9 A;  2GAH B;  1GRG A;  2Y6Q A;  1KNR A;  4UP3 A;  4BJZ A;  1F6M A;  1RSG A;  1KDG A;  3M13 A;  4BUR A;  2QA1 A;  4U8J A;  1IUT A;  3B3R A;  3NG7 X;  4G73 A;  4YSZ A;  3AE5 A;  5M0Z A;  2X8H A;  2YM2 A;  1DJN A;  2RGO A;  1IJH A;  3UP4 A;  2WBA A;  1GRB A;  3RP6 A;  3SY4 A;  4LII A;  1H7X A;  2GF3 A;  3CGC A;  4H4S A;  2IVD A;  3UKH A;  4D03 A;  2V61 A;  3FMW A;  3OZ2 A;  1LV0 A;  3AYL A;  3NT6 A;  3T14 A;  3AEB A;  3KA7 A;  4I59 A;  1JNZ A;  4DSG A;  4FDC B;  1XHC A;  1IUU A;  3NK0 X;  4EM4 A;  4Y4N A;  3AD8 B;  4YSY A;  4FK1 C;  4OPG A;  1AOG A;  1ZY8 A;  1GPE A;  1CF3 A;  3BI4 A;  4U2L A;  4U8K A;  4H4Q A;  5IQ1 A;  3L5O A;  3FBS A;  2A89 A;  3AE6 A;  1FOH A;  2IVE A;  5L46 A;  4YXD A;  2WS3 A;  3D8X A;  3S5W A;  4NEW A;  2WP6 A;  2YVF A;  4XXG A;  4NTE A;  2YLX A;  3IWA A;  3ALL A;  1ZX9 A;  1TDN A;  2GQW A;  2BS4 A;  5ER0 A;  2IID A;  4CBQ A;  1LPF A;  2BAC A;  1F8W A;  3I3L A;  3F8P A;  3RHA A;  5EBK A;  2QCU A;  1EBD A;  2YR6 A;  2A87 A;  1NHR A;  1VRQ B;  4OVI A;  4OPT A;  1GRA A;  3GYX A;  5GRT A;  2I0Z A;  4B63 A;  1PN0 A;  3ISH A;  4BV6 A;  1ZDL A;  4ADW A;  2YWL A;  4REK A;  4B66 A;  1YQZ A;  2R0P A;  2CDU A;  2GH5 A;  2JK6 A;  2GR1 A;  1E1L A;  3LAD A;  3GMC A;  2OLO A;  3KKJ A;  4AT0 A;  3P4Q A;  3RNM A;  2E5V A;  4B68 A;  4C5O A;  4B69 A;  4Z43 A;  2AR8 A;  4X9M A;  3VR9 A;  3H4K A;  2YR4 A;  3VR8 A;  3DGZ A;  3AE4 A;  3ATQ A;  2C4C A;  3IF9 A;  4OPD A;  4BJY A;  3GDN A;  4EIP A;  3D9X A;  4NTC A;  2FBW A;  1QO8 A;  2VVL G;  3T2K A;  3T0K A;  3UCL A;  5JCN A;  2YG7 A;  4RG3 A;  3NN0 X;  3RP8 A;  1GOS A;  4P9S A;  2JB2 A;  4IA5 A;  4J33 A;  3QFA A;  3FIM B;  3PVC A;  2WPE A;  1B37 A;  2JB1 A;  3GSI A;  4GRT A;  3H8I A;  3SYI A;  1VG0 A;  3AE3 A;  4D04 A;  4A5L A;  4GR1 A;  4J2W A;  1OJD A;  4CNK A;  3AEC A;  3UKK A;  1O94 A;  3Q9T A;  2VVM A;  4EQX A;  3M0O A;  5CKU A;  3UOY A;  1ZKQ A;  5KRQ A;  2C73 A;  1B5Q A;  2J3N A;  2BS3 A;  2C67 A;  3KPK A;  4I58 A;  3UKP A;  3UKQ A;  1JRY A;  2GB0 A;  3DJE A;  3UKA A;  2E4G A;  2ACZ A;  2O9Z A;  2VQ7 A;  1H83 A;  3ABV A;  3LZX A;  2YLS A;  4BK2 A;  3DK9 A;  4TM0 A;  2ARD A;  2V5Z A;  4H50 A;  2YLW A;  5EB5 A;  5HHF A;  5CQF A;  3SZC A;  2Z5X A;  1ZK7 A;  3AED A;  2XCG A;  3P4P A;  4H4Z A;  4JNQ A;  3VQR A;  1JOA A;  4H4V A;  4H4U A;  3SZ0 A;  2AAQ A;  3ALJ A;  1JRX A;  1PJ5 A;  4JY2 A;  4A6N A;  4PAB A;  2WDV A;  5BUK A;  2R45 A;  3AE7 A;  4JDR A;  4K7Z A;  2WDQ A;  3P9U A;  5FS6 A;  1NDA A;  3SZW A;  3P4S A;  3I6D A;  1PXA A;  3BHF A;  3DJG X;  2YG6 A;  2GMH A;  4YT0 A;  5FMH A;  4TM4 A;  4C77 A;  3ZDN A;  3GYI A;  3DH9 A;  1TYT A;  3FG2 P;  3AE2 A;  2BC1 A;  2BRY A;  2YLT A;  4FK1 A;  3G5Q A;  2WQY A;  1BWC A;  3URH A;  2CFY A;  3H8L A;  3DJJ A;  2XFQ A;  2XLU A;  1LQT A;  2JKC A;  3KD9 A;  1LTX R;  1VQW A;  3UKF A;  3QJ4 A;  4B1B A;  1K0I A;  3NK2 X;  3F8D A;  2AQJ A;  2YG3 A;  4B64 A;  1YQ4 A;  2E1M A;  4H2Q A;  2C75 A;  4OPU A;  4AOX A;  5BVA A;  3F8R A;  2WEU A;  3ICT A;  2YLZ A;  4U2T A;  3EPT A;  2R4J A;  5EB4 A;  4TLX A;  3RP7 A;  1S7M A;  4O5U A;  1L9E A;  3UOZ A;  2DKH A;  3SX6 A;  3UTH A;  2VOU A;  4H4W A;  5M10 A;  4B65 A;  3E1T A;  1N4V A;  2ZZ0 A;  3CGD A;  3II4 A;  4ZCC A;  5EOW A;  4A65 A;  1GXF A;  1EL5 A;  2BC0 A;  1ELI A;  2ZZC A;  2C65 A;  3UOX A;  1GND A;  2WP9 A;  2XDO A;  2XVH A;  2YR5 A;  3AEG A;  2R0G A;  2XLP A;  1KNP A;  3VRB A;  4A6N B;  4EIQ A;  2GV8 A;  1H2I A;  2OAM A;  1PXC A;  3C4N A;  1GES A;  2BCP A;  4H4X A;  4ECH A;  1NEN A;  3BNM A;  1K0J A;  5C3J A;  4H4P A;  4A99 A;  3CTY A;  4AOS A;  4NNJ A;  1NHP A;  1NG3 A;  4NTD A;  3GDP A;  4J31 A;  4AT2 A;  2PYX A;  4C74 A;  4CNJ A;  3QSM A;  1HYU A;  4G6G A;  4Z24 A;  2B9Y A;  1B8S A;  1E6E A;  2NPX A;  3AXB A;  3BI2 A;  1IUX A;  2WP5 A;  1CL0 A;  2GRT A;  3LXD A;  1IUS A;  3K7M X;  4WCT A;  1VG9 A;  1PHH A;  4YTN A;  2JAE A;  4U8O A;  4J57 A;  2BXS A;  4H4R A;  1PJ7 A;  5KOX A;  2B76 A;  5FS7 A;  3NKS A;  3P4R A;  2Q0K A;  4II2 A;  5HY5 A;  3O0H A;  2EQ6 A;  4Z2U A;  1BGJ A;  4ICY A;  3EAN A;  1SEZ A;  2X8C A;  1TRB A;  2BRA A;  3C96 A;  4RSL A;  1D4D A;  1REO A;  5IQ4 A;  1D5T A;  2XFO A;  5JCL A;  1GER A;  3V3N A;  2C70 A;  4Z25 A;  1IUV A;  1D7L A;  1KSU A;  4H7U A;  2QA2 A;  3AE1 A;  3L8K A;  1GT8 A;  3KVE A;  4EMW A;  1O95 A;  5U63 A;  1GET A;  2BCG G;  3GRT A;  3SZF A;  3DJD A;  3AYJ A;  4GAP A;  2OLN A;  3CNJ A;  4K5S A;  5TR3 A;  3AD9 B;  4PAA A;  1JEH A;  2WU2 A;  3NN6 X;  4DNA A;  4C3Y A;  3BNU A;  1GRF A;  1B4V A;  2OAL A;  2EQ8 A;  5KMQ A;  4CCQ A;  5KVH A;  5LV9 A;  2WOV A;  4ZN0 A;  2FJB A;  2H89 A;  1CBO A;  1FL2 A;  1L0V A;  2BS2 A;  2R9Z A;  1EL9 A;  1H82 A;  2BK5 A;  4U8L A;  4YTP A;  3PG6 A;  1CC2 A;  1GRH A;  3NNE A;  1XDI A;  2GQF A;  3CPH G;  1M6I A;  4Y4M A;  3NYC A;  4KPR A;  1CJ3 A;  1Q9I A;  1TDK A;  2VQB A;  1PDH A;  2GMJ A;  4TM3 A;  1H7W A;  4A9W A;  3NTA A;  3NH3 X;  4OPI A;  2R0C A;  4G6H A;  3QVP A;  2YLR A;  4H2N A;  3VRD B;  4LA1 A;  1JRZ A;  3L1R A;  5IPY A;  1NHS A;  2BYB A;  1JNR A;  4J36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...