2NPXA

Nadh binding site and catalysis of nadh peroxidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
447
structure length
446
Chain Sequence
b'MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title NADH binding site and catalysis of NADH peroxidase.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
total genus 139
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1992-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2npxA02
4NZHA 2WPEA 1PXAA 3S61A 2WEUA 3OC4A 4RG4A 2XLRA 4H4YA 1N4WA 2OA1A 2R0CA 3G5QA 3P4RA 4TLXA 2OLNA 4OPIA 3FPZA 4BURA 3QVPA 4GCMA 2WETA 4J2WA 2GR3A 3UOYA 4U2TA 2B9XA 2YG6A 4HB9A 4B63A 2EQ7A 2YAUA 4UDRA 4Z2TA 2X8HA 2JB3A 4OPTA 3AE3A 3DK4A 4H4QA 1F6MA 4BK3A 5KOXA 2WESA 1E1KA 2BXSA 1Q1RA 1CJ3A 1ZMCA 3VRAA 3COXA 1JOAA 1GRBA 2TPRA 1HYUA 2E4GA 2WQYA 3JSKA 3IHGA 4OPCA 2GEWA 3NGCX 3AEEA 3V76A 2C64A 2I0ZA 1EBDA 1Y0PA 2XVEA 3AD8B 1B5QA 4NTEA 3UKFA 4BJYA 1D7YA 2EQ8A 5EBKA 3AEGA 5KWFA 2Q7VA 1OJAA 2RGHA 4M52A 3AYJA 3NRNA 1PJ6A 2EQ6A 1VRQB 3URHA 4C3XA 3GWDA 2CDUA 5JCNA 1N4UA 2XFOA 1JRZA 2RGOA 3K7QX 1O5WA 2IVDA 3UKHA 2WU5A 4EQXA 4USQA 4AT0A 1PJ7A 3V3NA 4YT0A 4EIPA 3ISHA 2WHDA 4OPGA 4U8JA 1TDNA 2OLOA 2BYBA 2YWLA 3GMBA 4I58A 4XXGA 1KSUA 1QO8A 3WE0A 2NPXA 4H4RA 2QCUA 1NG4A 1MXTA 4C77A 1D5TA 4K22A 4OPUA 1EL9A 1IUXA 1PXBA 4JNAA 3AE9A 1XANA 4IVOB 1GOSA 1GTEA 2YLTA 4APNA 3QFBA 3AE5A 1E1MA 4DGKA 2X8CA 3LOVA 1IUWA 3NT6A 1BGNA 2C65A 2JKCA 2APGA 3PVCA 3KKJA 3QSEA 4ZCCA 4EMJA 3AE4A 4K5RA 3UKAA 1EL8A 2R4EA 2GQWA 5C3JA 5IPYA 1BF3A 1OJDA 1L9DA 2QA2A 3HZLA 4H2QA 1PN0A 3ZDNA 1ZDLA 1H84A 3DJEA 4A5LA 2YG4A 1O95A 4U8PA 5DBJA 2XVIA 3UCLA 4TM3A 5KRQA 1D4DA 2HQMA 2H88A 3T37A 4CY6A 4WCTA 4A6NA 4TM1A 2GVCA 2Z5YA 3ABVA 3RP8A 2WOWA 1DOBA 1TDEA 3ATQA 1KFYA 2VVMA 1L0VA 3AE1A 2YR5A 4BJZA 2B7RA 3LJPA 2EQ9A 3O0HA 3VQRA 5GRTA 4HA6A 1XDIA 1GV4A 1DOEA 4GRTA 3I6DA 4BV6A 2BK5A 1Z6LA 1LQUA 2ACZA 3L8KA 1DNCA 3UOXA 2GQFA 2ZZ0A 3ALMA 1LJ1A 1MO9A 3D8XA 1S3BA 3K7TA 3PO7A 4YTMA 2VQ7A 4DSGA 4EIQA 1GRAA 2DKHA 1M64A 1GSNA 2FJAA 2OAMA 3CPIG 4CNJA 3UTGA 1DJQA 3AXBA 2BK4A 4YXDA 3LZXA 2ARDA 1H7WA 4U8OA 2BS2A 3EPTA 1TDKA 1NHSA 2Y6QA 4E0VA 3NLCA 4GDEA 2GR0A 1CC4A 4H4UA 2FJEA 2Y6RA 2BC0A 1OJCA 1PBEA 2GMJA 3BNUA 4H4XA 1NHPA 2R45A 3FBSA 3KA7A 4FX9A 1PBDA 1N4VA 3LZWA 3AE7A 4B67A 3NH3X 2OALA 3AWIA 2C72A 3GYIA 4Z2UA 3QSMA 4XWZA 3NK2X 4KX6A 4Y4LA 3AE8A 3UKPA 3M12A 1PS9A 4U8IA 1QJDA 5J60A 1S2YA 1PBFA 1BZLA 2QA1A 1ZX9A 4H4TA 1D4EA 5BRTA 2WP5A 3DH9A 4H2PA 2WP6A 1O94A 3UP5A 1OJ9A 3ZYXA 1LTXR 4USRA 4B65A 1GRHA 3CPJG 2XLPA 2YLZA 1GETA 3AE6A 3ALLA 5BUKA 3GMCA 3L1RA 1GEUA 2WDVA 4A6NB 4CRTA 3AECA 3NYEA 3KLJA 5M0ZA 1CBOA 2AQJA 2X8GA 3GSIA 5KVHA 1NDAA 2YG5A 3UKKA 1IUUA 1Y56A 1L9CA 4P9SA 2GR2A 4B1BA 4CCRA 2XVHA 4IVMB 4H4SA 1AOGA 1VG0A 2VZ2A 4ZCDA 4JN9A 1E39A 1P2HA 4O5UA 2V3BA 3OZ2A 1JRYA 5JCKA 4C5OA 3ICSA 4N9XA 3QVRA 3NTAA 1EL5A 4OVIA 2IIDA 4J56A 4GUVA 3UOZA 2FJBA 3BI4A 3D1CA 4AT2A 3E1TA 1LPFA 4UDQA 4EM3A 1PDHA 1GT8A 2WDRA 3AEDA 1B4VA 3M13A 4OPDA 5BVAA 4YSZA 1KF6A 1P2EA 3K30A 3NN6X 1K0JA 3G5SA 3P4PA 4K7ZA 2YM1A 2YR4A 4Z2RA 2R0GA 1B37A 4A7AA 1FEBA 4J34A 5HXIA 2V3AA 3FMWA 4YSHA 3IC9A 4DNAA 2GAGB 1KNPA 2JB1A 2VRLA 3KU9A 4NTDA 4WX1A 2O9ZA 2Q6UA 1PBCA 3NHOX 4OCGA 2BS3A 2PHHA 2R4JA 2GB0A 3SQPA 1JNRA 1BKWA 3Q6JA 1GPEA 4H2NA 1TDFA 4ADWA 1ELIA 3NK1X 3NTDA 1V59A 2YR6A 3AEFA 4EMIA 4CBQA 5C2TA 2TMDA 1IUTA 2GAHB 1GRFA 3UTFA 4DSHA 3R9UA 3LB8A 4U2SA 4LA1A 2YG3A 4BK1A 4CNKA 1W4XA 2GMHA 3G5RA 3BI5A 2R0PA 1CL0A 2R46A 4LU6A 3CNPA 3ICRA 4CY8A 2XYOA 1FCDA 1F8RA 3GDNA 2YLSA 4Y4NA 4UDPA 4YSXA 4NEVA 3DK9A 4X9NA 4AOSA 4Z25A 2R9ZA 5TR3A 5U25A 2WPCA 4A79A 4H4WA 3QFAA 1CC6A 4H50A 1YQ3A 2XLTA 5IQ1A 4Z44A 1ZMDA 5FS7A 3NG7X 3GDPA 4A9WA 5CQFA 3REDA 3C4NA 3S5WA 2F5ZA 4B69A 1ZY8A 1KNRA 3F8PA 4RG3A 1Y56B 2XLUA 4J36A 2BCGG 3I3LA 4Z43A 3NYCA 1F3PA 2WOVA 2JBVA 1KSSA 4H4VA 1H86A 2C73A 4D03A 2JB2A 1BWCA 3F8RA 2YLRA 2C3CA 3SM8A 1IUSA 5U63A 1XHCA 1ONFA 3LADA 2XVJA 3BHFA 4YWOA 4B66A 3BHKA 2RABA 1H83A 1FECA 2C75A 3PS9A 4B68A 1YQZA 1Q1WA 2WDQA 1H6VA 1KDGA 3IF9A 3EF6A 2YG7A 1ZP0A 1K0LA 3CNSA 1PBBA 2XFNA 4EM4A 1D4CA 4K5SA 1DJNA 2DKIA 3IWAA 1B8SA 3AYLA 2E1MA 2JAEA 3ICTA 1E1NA 2C76A 3UKLA 1FEAA 4H4PA 1LV0A 3AD9B 4FK1C 2V60A 4K2XA 3RHAA 5HY5A 1IJHA 4U2LA 3DMEA 1GESA 2NVKX 3ITJA 1CC2A 1Q9IA 4X4JA 2C66A 4NEWA 1NEKA 2YM2A 5FMHA 2H89A 2V6OA 4H4ZA 1NHQA 3CNJA 5FS9A 2BS4A 2BCPA 4JY2A 2X3NA 3CGBA 1GREA 2X99A 2X50A 1FOHA 1DOCA 1NPXA 2RGJA 2UZZA 3KD9A 4PAAA 3VR8A 3AEBA 4A99A 2VOUA 2ZBWA 3B3RA 2YLWA 5CKUA 4NTCA 1ZKQA 3H8IA 1F8SA 4H7UA 1CJ4A 3ALJA 2VQBA 4ECHA 3CTYA 3DJDA 1GRGA 4Y4MA 3II4A 1S2QA 3QSSA 1E1LA 2GH5A 3AE2A 2C7GA 3M0OA 1IUVA 3RP6A 2E5VA 4X9MA 1YKJA 1TYTA 1L9EA 1PHHA 1OJTA 2AAQA 4EQSA 2Q0LA 3DA1A 3UKQA 3UTHA 1DODA 4RSLA 3UTEA 1GNDA 4EQRA 5BULA 3EAOA 2WOIA 4JNQA 1DXLA 1NENA 2XVFA 3P4QA 1VQWA 2BACA 2BC1A 3NNEA 1RP0A 2YVFA 3GWFA 4OPLA 3V3OA 4I59A 4Z26A 2GF3A 1PJ5A 1CHUA 3C96A 5KVIA 1CJCA 5HYMA 1TDOA 5JCLA 5LV9A 1E7PA 1TRBA 5GSNA 5EB4A 3CNTA 1D7LA 3FIMB 1TYPA 4J33A 3NKSA 2XFQA 1YY5A 4AP3A 3QJ4A 4C74A 1M6IA 5HHFA 3DJJA 4FK1A 3NK0X 4J31A 2A89A 4U8MA 1GALA 4IA5A 4IA6A 1RSGA 5J7XA 4H2RA 2AR8A 3P1WA 1JRXA 4GR1A 1S3EA 4O5QA 2WBAA 4YTNA 2Q0KA 4CCQA 1GRTA 5L46A 2C67A 4YSYA 3AB1A 1BGJA 3Q9TA 2GV8A 4GDPA 3VRDB 4IV9A 2WS3A 4U8NA 2JK6A 2W0HA 4TM4A 1K4QA 2YQUA 1CF3A 2C70A 2BXRA 2B9WA 1K0IA 1H7XA 1COYA 1MOKA 1UKVG 5EB5A 4U8KA 5U1OA 3UOVA 3GD4A 1NAAA 1F8WA 4JDRA 2WU2A 2BABA 1YQ4A 1NG3A 3K7MX 5IQ4A 5JCMA 1PXCA 1RYIA 1JEHA 1H82A 4JY3A 2XFUA 1GXFA 2CFYA 4BK2A 1GERA 1XPQA 2A87A 5ER0A 1ZK7A 3UP4A 3KPFA 5KXJA 2BA9A 2Z5XA 3NYFA 4YKGA 3AEAA 2QAEA 2XFPA 2XLSA 4GF7A 4UP3A 3IHMA 4PABA 2BK3A 4K8DA 1EL7A 1ZOVA 4Z24A 1LQTA 2B7SA 2YLXA 3KVEA 4JQ9A 3RP7A 2YVJA 2FBWA 3B6DA 2GRTA 3GRTA 3ATRA 2B9YA 4EQWA 3DGZA 2FJDA 2WPFA 3C4AA 3CIRA 4B64A 4EMWA 1LVLA 3AYIA 4MJWA 2ZZBA 4AOXA 2XCGA 3BI2A 3GRSA 3SGLA 3H8LA 3NIXA 4A65A 3H4KA 3CPHG 5FS8A 1X31B 1JU2A 2ZZCA 1NHRA 3GD3A 2A8XA 2VRMA 3VRBA 4TM0A 3P9UA 1GTHA 5M10A 3GYJA 3DGHA 2VVLG 3NN0X 3P4SA 4ZN0A 3DJGX 3RNMA 1VG9A 4ICYA 1JNZA 3BNMA 4LIIA 1CJ2A 2B76A 2V5ZA 3AD7B 4YTPA 1ZOYA 3LXDA 3DK8A 2CULA 3SFEA 3CGEA 1VDCA 1E6EA 1H81A 4U8LA 4C3YA 4D04A 3SFDA 1REOA 5EOWA 4J57A 5KOWA 2V61A 2IVEA 2VVLA 3ADAB 5JCIA 2C3DA 5FS6A 3CNDA 3CN8A 3F8DA 4FDCB 3CGDA 3VR9A 1SEZA 3EANA 4TLZA 4XWRA 4YKFA 2CVJA 2XDOA 2YVGA 2WP9A 4REKA 2PYXA 4AP1A 1QLBA 4KPRA 1N1PA 1FL2A 3CGCA 3FG2P 2GR1A 2J3NA
chains in the Genus database with same CATH superfamily
2WPEA 3A7AA 2OA1A 2R0CA 3P4RA 3UJ2A 1ZXIC 3FXGA 3DK4A 2RDXA 1E1KA 2TPRA 1RVKA 3K1GA 4GIRA 3AEEA 2I0ZA 1T3QC 3AD8B 1PDYA 4BJYA 3DFYA 2EQ8A 5KWFA 3H70A 1N4UA 2XFOA 2IVDA 4AT0A 4USQA 3ZLFA 3ISHA 3NVVB 4U8JA 2YWLA 3GMBA 1D5TA 4OPUA 1MDRA 3AE9A 4F4RA 1IUWA 1BGNA 3U4FA 3PVCA 1EL8A 1BF3A 1PN0A 4A5LA 3NO1A 3A7UA 3V5FA 3AM9A 5KRQA 3CMMA 1EBHA 2YR5A 3O0HA 1GV4A 3SQSA 3I6DA 1Z6LA 2QDDA 3HYXA 2BRYA 3SN4A 1XS2A 4EIQA 1GRAA 4K2SA 1GSNA 4CNJA 3CPIG 1H7WA 3CAWA 1VDVA 1CC4A 2FJEA 3MKCA 4E6MA 3FCPA 3KA7A 4II2A 2OALA 2XGZA 2C72A 3GYIA 2AL2B 4KX6A 3DG6A 1PS9A 5J60A 1PBFA 1BZLA 4H4TA 2XH0A 3FJ4A 1TKKA 4H2PA 3ZYXA 4G6HA 4USRA 4B65A 1GETA 1P43A 2WDVA 3D46A 3NYEA 5M0ZA 3GSIA 3U9IA 4H4SA 1VG0A 2VZ2A 4JN9A 1JRYA 4C5OA 3QVRA 4OVIA 4GUVA 2FJBA 3BI4A 4AT2A 2AKZA 3FYYA 4OPDA 4JHMA 5J04A 3P4PA 3G5SA 2P0IA 4Z2RA 3MUCA 5HXIA 3IC9A 4DNAA 4NTDA 2O9ZA 2Q6UA 3NHOX 4OCGA 2BS3A 2PHHA 3SQPA 1GPEA 1TDFA 3AEFA 4EMIA 4MMWA 1IUTA 3STPA 2TMDA 3LB8A 3SZFA 1XPYA 3BI5A 4ROPA 3CNPA 3ICRA 1FCDA 1F8RA 2E3TA 4UDPA 5G5GB 4DYEA 3AMZA 4Z25A 5TR3A 2WPCA 4H50A 5IDZA 2XLTA 1ZMDA 3NG7X 4A9WA 1Y56B 1KN0A 3MY9A 3NYCA 2JBVA 1IUSA 1ONFA 3LADA 5KMPA 4YWOA 4KPLA 2RABA 2PP1A 3PS9A 2WDQA 1KDGA 1TE6A 3PG6A 3AYLA 4G8TA 2OKTA 3UKLA 4H4PA 2V60A 1IJHA 4U2LA 3SJNA 1CC2A 3CNJA 3TOYA 4K5RA 1GREA 4H2RA 1FOHA 1SJDA 1NPXA 3UGVA 2YLWA 3UJFA 4JN8A 1F8SA 1CJ4A 2E5AA 3DJDA 2OZ3A 4HYRA 5FJUA 3II4A 3SX6A 1E1LA 5JRBA 3ZLHA 3RCYA 3P3BA 1FFUC 3R1ZA 3ENLA 2OG9A 4X2PA 1DODA 4EQRA 4JNQA 2OZTA 3OZYA 3VC5A 2BC1A 2OPJA 5KVIA 1CJCA 1TRBA 1D7LA 1TYPA 4J33A 2XFQA 1YY5A 4AP3A 3QJ4A 4J31A 4U8MA 1GALA 4IA5A 2W3RA 4GR1A 4YTNA 1GRTA 2GV8A 1R6WA 4GYPA 4IV9A 1CF3A 2C70A 2B9WA 1MOKA 3UOVA 3D9XA 3NVYB 3DDMA 4JDRA 1X2GA 5IQ4A 2PTWA 3T9PA 4BK2A 3GC2A 3NYFA 2QAEA 2XLSA 3IHMA 4PABA 3KVEA 4G6GA 3T4WA 4XWZA 3AYIA 4AOXA 1ONEA 2OZ8A 3H8LA 1WUEA 3CPHG 1X31B 2ZZCA 2A8XA 3VRBA 3P9UA 3GYJA 3DIPA 3TQPA 1EBGA 3NN0X 1WYGA 3TJIA 1JNZA 4LIIA 1CJ2A 5FJOA 2B76A 2PGEA 4K8GA 2GDQA 4DXKA 1E6EA 4HCHA 3CNDA 3S5SA 3F8DA 3CGDA 4TLZA 2XDOA 2YVGA 2QJMA 2PYXA 4HPNA 1SJAA 1FL2A 3S61A 1N4WA 2QJJA 3G5QA 4OPIA 3BOXA 4GMEA 4BURA 2WETA 4J2WA 2B9XA 2YG6A 4HB9A 4B63A 4DX3A 4H4QA 4ZA0A 3UXKA 4BK3A 3OP2A 5KOXA 1Q1RA 4DWDA 3COXA 1JOAA 2E4GA 3R10A 2WQYA 3JSKA 3NGCX 3I6EA 2C64A 1Y0PA 2CHRA 2XVEA 1B5QA 1D7YA 5EBKA 3AEGA 5KMSA 2GGHA 1O5WA 1KKRA 3UKHA 4EQXA 1PJ7A 4YT0A 3NVWB 2WHDA 3FV9A 3SYIA 2OLOA 2BYBA 3R0KA 4I58A 1KSUA 3V5CA 3SZ0A 4K22A 3T8QA 1EL9A 1PXBA 5KMQA 2W3SA 4IVOB 3AE5A 3IJQA 2JKCA 3KKJA 3UKAA 4EMJA 1L8PA 2GQWA 2HNEA 1W6TA 4H2QA 2QA2A 1H84A 3DJEA 2YG4A 1O95A 5DBJA 2XVIA 1D4DA 4CY6A 3GYXA 3RP8A 2GGIA 1DOBA 3ATQA 1KFYA 2VVMA 1MRAA 3LJPA 2EQ9A 3VQRA 5GRTA 1EC9A 1XDIA 1FHVA 4BV6A 2BK5A 1LQUA 3ALMA 2ZZ0A 1LJ1A 1MO9A 1JPMA 2DKHA 4GFIA 3Q45A 2FJAA 3H12A 3AXBA 3P93A 2BS2A 1TDKA 1NHSA 2Y6QA 3QLDA 4NWZA 3EEZA 2GR0A 1JCTA 2BC0A 3BNUA 4H4XA 1NHPA 2R45A 3OZMA 3AWIA 4Z2UA 3QSMA 3D47A 3AE8A 3M12A 2QA1A 2WP5A 1O94A 3CK5A 1BQGA 2PTXA 5G5HB 3NZGA 3CPJG 3L1RA 4A6NB 3AECA 3SN0A 2X8GA 5KVHA 2PS2A 1N5XA 4ZCDA 1EL5A 2IIDA 4J56A 3A7RA 3E1TA 4UDQA 3AEDA 1B4VA 3M13A 5BVAA 3VCCA 3T2ZA 3K30A 4K7ZA 2YM1A 3BJSA 4A7AA 3R07C 4YSHA 2JB1A 3KU9A 2VRLA 2GB0A 3AN1A 3Q6JA 5FJRA 3T6CA 3NK1X 3NTDA 2GAHB 1FO4A 4Z17A 5BOEA 4BK1A 2GMHA 3G5RA 1V97A 2R46A 2YLSA 2PA6A 3DK9A 2R9ZA 4A79A 4H4WA 2PODA 3IJIA 3QFAA 3ZLGA 1CC6A 3REDA 3C4NA 4B69A 1E9IA 3F8PA 2BCGG 3I3LA 3RGTA 2HXUA 2WOVA 1KSSA 4H4VA 1H86A 2YLRA 3OTRA 1BKHA 2OFJA 1H83A 1FECA 1YQZA 3ES7A 3IF9A 2YG7A 1K0LA 1PBBA 2DKIA 2JAEA 3ICTA 1E1NA 3RHAA 5HY5A 2XH4A 3DMEA 4A6GA 3ITJA 3VCNA 4NEWA 1EC8A 4H4ZA 2BS4A 2BCPA 4JY2A 1DOCA 4PAAA 3L5OA 3AEBA 3CXBA 4HCDA 4H7UA 3DESA 3ALJA 2VQBA 4ECHA 4Y4MA 2GH5A 4FP1A 3SXIA 1IUVA 3UJRA 1YKJA 3UKQA 4RSLA 3UTEA 2W55A 5BULA 3EKGA 1DXLA 2XVFA 3P4QA 2BACA 3NNEA 2YVFA 3V3OA 3C96A 4EWJA 3T14A 4HNCA 5JCLA 1E7PA 3CNTA 4G73A 5KNLA 1M6IA 5J7XA 3HPFA 4CCQA 4IP5A 3UJSA 4YSYA 3ZVHA 4GDPA 3JW7A 3CT2A 1K4QA 3IJLA 1K0IA 1COYA 5EB5A 5U1OA 1NAAA 1F8WA 1FFVC 1YQ4A 3K7MX 5JCMA 1PXCA 1RYIA 1JEHA 4JY3A 1PDZA 1GXFA 2CFYA 1GERA 3SN1A 2XFPA 2P8CA 4Z24A 1EL7A 2YLXA 3RP7A 3B6DA 2YVJA 3GRTA 4KEMA 5BUKA 3DGZA 2FJDA 3T31A 4EMWA 2ZZBA 4IT1A 2XCGA 3NIXA 4A65A 5FS8A 2PGWA 1NHRA 1R0MA 2VRMA 4TM0A 1GTHA 5M10A 3DGHA 2VVLG 4ZN0A 4ICYA 3BNMA 1ZOYA 3LXDA 2CULA 3SFEA 2OQYA 1H81A 4C3YA 5EOWA 4J57A 2IVEA 3ADAB 3PWIA 3CN8A 3EANA 4XWRA 2QJNA 1QLBA 1N1PA 3CGCA 3FG2P 2J3NA 4NZHA 1PXAA 3HRDC 2WEUA 2GL5A 3NVZB 4RG4A 2XLRA 4TLXA 2OLNA 3FPZA 2GGGA 4GCMA 2GR3A 4U2TA 4Z2TA 3FVDA 3DG7A 2BXSA 3VRAA 1GRBA 4K1WA 3IHGA 2GEWA 2OQHA 3V76A 1EBDA 3UKFA 5ENLA 1FHUA 2Q7VA 1OJAA 2RGHA 4M52A 3AYJA 3NRNA 1VRQB 3URHA 3GWDA 2CDUA 2RGOA 3V3NA 4IL2A 4OPGA 1TDNA 3HW2A 1QO8A 3WE0A 2NPXA 3T0KA 1NG4A 4C77A 1IUXA 4H83A 2BRAA 1XANA 3QFBA 1E1MA 4DGKA 2AL2A 2X8CA 3LOVA 1WUFA 4YWSA 3DERA 1OJDA 3HZLA 4U8PA 3UXLA 2PP0A 1OEPA 3UCLA 3Q4DA 3T37A 4WCTA 4TM1A 3ABVA 3CB3A 1TDEA 3AE1A 4BJZA 2QGYA 4IHCA 3V4BA 4HA6A 4E4UA 3KUMA 4GRTA 3L8KA 3KPKA 3VC6A 4DSGA 2FKPA 4IZGA 1M64A 2W54A 2OAMA 2BK4A 3LZXA 1FIQB 4U8OA 3EPTA 4E0VA 2Y6RA 2MUCA 1PBEA 2GMJA 3FBSA 3LZWA 1RM6B 3NH3X 2ONEA 3VDGA 3TW9A 2ZC8A 3NK2X 4Y4LA 3B97A 1YEYA 4U8IA 1JPDX 5BRTA 3DH9A 2WP6A 3UP5A 1LTXR 1GRHA 3AE6A 3GMCA 1GEUA 4CRTA 4DN1A 1NDAA 3UKKA 1IUUA 1Y56A 1L9CA 4P9SA 2GR2A 4B1BA 3QN3A 2XVHA 4IVMB 1AOGA 5JCKA 3B9JB 3ICSA 4N9XA 4JN7A 3S47A 1LPFA 4EM3A 1GT8A 2WDRA 3GY1A 3SBFA 5FJTA 4YSZA 3N4EA 3SZCA 1MUCA 1SJCA 2V3AA 3FMWA 2GAGB 1KNPA 3DG3A 2R4JA 3T2KA 2DW7A 4HNLA 4HCLA 1F9CA 1ELIA 2YR6A 4J1OA 2OVLA 4CBQA 5C2TA 2QQ6A 4G74A 4U2SA 4LA1A 4CNKA 4LU6A 4CY8A 2XYOA 3N6HA 4YSXA 4E4FA 4X9NA 4AOSA 2XSXA 3UCDA 2QVHA 3S5WA 2F5ZA 1KNRA 2XLUA 4J36A 1F3PA 3R11A 4D03A 2C3CA 5U63A 3BHFA 2ZADA 1JROA 2POZA 4B66A 3BHKA 2C75A 2XH7A 1Q1WA 1H6VA 2PPGA 3EF6A 3CNSA 2XFNA 4K5SA 1D4CA 1DJNA 1B8SA 2E1MA 4FK1C 3AD9B 3NS1B 4TVYA 4X4JA 3QPEA 1NEKA 2YM2A 2H89A 2V6OA 1NHQA 3CGBA 2X99A 2X50A 3CXOA 3VA8A 3VR8A 3TJ4A 4A99A 1KD0A 2ZBWA 3B3RA 1N5WC 1ZKQA 3H8IA 4IL0A 2P3ZA 4E5TA 3CTYA 3JZUA 1GRGA 1S2QA 3QSSA 3AE2A 3M0OA 3RP6A 2E5VA 1TYTA 1L9EA 2AAQA 4EQSA 4GGHA 3EAOA 3ZVIA 2WOIA 1NENA 1VQWA 4OPLA 1RP0A 3GWFA 4Z26A 1PJ5A 1CHUA 3RITA 2OO6A 3RRAA 5HYMA 5LV9A 5EB4A 3NKSA 3MWCA 4GAPA 1VQZA 5HHFA 3OPSA 3DJJA 4FK1A 3NK0X 2A89A 4IA6A 3P1WA 4O5QA 1S3EA 2PU0A 1BGJA 3Q9TA 2WS3A 2JK6A 1KCZA 4TM4A 2YQUA 3UJEA 1UKVG 4U8KA 2XFUA 1XPQA 2A87A 1ZK7A 3UP4A 4TVWA 2PMQA 1IYXA 2BA9A 4YKGA 3AEAA 4GF7A 4GAVA 2BK3A 4K8DA 1ZOVA 4GISA 3ATRA 2WPFA 3CIRA 4MJWA 3V3WA 5FJPA 3SGLA 3GD3A 3HYVA 2QDEA 4J3ZA 3DJGX 1VG9A 2HXTA 3I4KA 2V5ZA 4GGBA 1SJBA 3DK8A 3RR1A 3CGEA 1VDCA 4U8LA 3SFDA 5KOWA 2V61A 3I6TA 5JCIA 2C3DA 3VR9A 4YKFA 2CVJA 5BOFA 3N4FA 4REKA 4AP1A 4KPRA 2C7GA 3OC4A 4E8GA 4H4YA 3QVPA 3UOYA 1NELA 2AL1A 1N63C 2EQ7A 2YAUA 4UDRA 2X8HA 3MZNA 2JB3A 4OPTA 3AE3A 4Z1YA 1F6MA 2WESA 1CJ3A 1ZMCA 1HYUA 1MNSA 4OPCA 1SB3B 3MSYA 4NTEA 3NFUA 1PJ6A 2EQ6A 4C3XA 2I5QA 5JCNA 1JRZA 3K7QX 2WU5A 4EIPA 4KWSA 3RO6A 3THUA 3H8AA 4XXGA 4H4RA 2QCUA 1MXTA 6ENLA 4JNAA 3DFHA 4A3RA 1GOSA 1GTEA 2YLTA 4APNA 3ES8A 4H2HA 3NT6A 2C65A 2APGA 3QSEA 3QKEA 4ZCCA 3AE4A 2R4EA 1S7MA 5C3JA 5IPYA 1L9DA 1ECQA 3ZDNA 1ZDLA 4TM3A 3NXLA 2HQMA 2H88A 4A6NA 2GVCA 2Z5YA 2WOWA 3H7VA 3OW1A 1L0VA 2B7RA 3SY4A 2OX4A 1DOEA 1STZA 2ACZA 3BSMA 2MNRA 1DNCA 3UOXA 2GQFA 3D8XA 1S3BA 3K7TA 3PO7A 4YTMA 2VQ7A 4KT2A 3N6JA 4YXDA 3HYWA 3UTGA 1DJQA 2ARDA 1N61C 3NLCA 4GDEA 4H4UA 3DGBA 2GSHA 1OJCA 4FX9A 1PBDA 1N4VA 3AE7A 4B67A 5EU9A 3SSZA 3UKPA 1QJDA 1S2YA 4GYPC 1ZX9A 3T2YA 2P88A 1D4EA 1OJ9A 1NU5A 2PTYA 3R25A 2XLPA 2YLZA 3ALLA 4IP4A 3KLJA 1CBOA 2AKMA 2AQJA 2YG5A 3SZWA 4CCRA 4H1ZA 2O56A 3TTEA 1E39A 1P2HA 4O5UA 2V3BA 3OZ2A 3NTAA 3SR6B 3UOZA 1PDHA 4M6UA 1KF6A 1P2EA 2PCEA 2P8BA 3JVAA 3NN6X 2NQLA 1K0JA 2YR4A 2GGEA 2R0GA 1B37A 1FEBA 4J34A 4WX1A 1PBCA 1JNRA 1BKWA 4H2NA 4ADWA 1V59A 1GRFA 3UTFA 4DSHA 3R9UA 3MQTA 2YG3A 1W4XA 2PTZA 2R0PA 1CL0A 1TZZA 3GDNA 4Y4NA 4NEVA 5U25A 3EUB3 1YQ3A 1N62C 5IQ1A 4Z44A 2FYMA 3CYJA 5FS7A 4ZOHB 3GDPA 1N60C 5CQFA 1ZY8A 4RG3A 4G9KA 3TWAA 4Z43A 4DHGA 2C73A 2JB2A 1BWCA 3F8RA 3SM8A 3NRZB 1XHCA 2XVJA 3VFCA 4B68A 1H2IA 1ZP0A 4EM4A 3IWAA 2C76A 1FEAA 1LV0A 4K2XA 3DEQA 2C4CA 1GESA 2NVKX 1JDFA 4A35A 1Q9IA 2C66A 5FMHA 5FS9A 2X3NA 2RGJA 3KD9A 2UZZA 2PP3A 1MDLA 2VOUA 5CKUA 4NTCA 3P0WA 2GGJA 3ETRB 1ELSA 3TCSA 4X9MA 1PHHA 1OJTA 2Q0LA 3DA1A 3UTHA 1GNDA 4II3A 3QTPA 4I59A 2GF3A 3GO2A 3R0UA 1TDOA 5GSNA 3FIMB 4ZCWA 4C74A 1RSGA 2AR8A 1JRXA 2WBAA 2Q0KA 5L46A 3PFRA 2C67A 3AB1A 3VRDB 2HZGA 2W0HA 4U8NA 2BXRA 1H7XA 2PSNA 3GD4A 2WU2A 2BABA 1NG3A 1H82A 4HN8A 3PWGA 5ER0A 3KPFA 5KXJA 4MKSA 1EC7A 3GD6A 2Z5XA 5KMRA 4M0XA 1KKOA 2OLAA 3UCCA 4UP3A 3IK4A 1LQTA 2B7SA 4NNJA 4JQ9A 2FBWA 3D1CA 2GRTA 4FI4A 2B9YA 4EQWA 3C4AA 4B64A 1LVLA 2DW6A 3BI2A 3GRSA 4MGGA 3H4KA 1JU2A 1JRPA 4G7FA 3P4SA 3RNMA 1DTNA 3AD7B 4YTPA 7ENLA 4D04A 2PU1A 1REOA 2XH2A 4H19A 1X2HA 2VVLA 4ENLA 1P48A 5FS6A 3ZVHB 4FDCB 1SEZA 3TWBA 2WP9A 2GR1A 3PK7A
chains in the Genus database with same CATH topology
4NZHA 2WPEA 1PXAA 3S61A 2WEUA 3OC4A 4RG4A 2XLRA 4H4YA 1N4WA 2OA1A 2R0CA 3G5QA 3P4RA 4TLXA 2OLNA 4OPIA 3FPZA 4BURA 3QVPA 4GCMA 2WETA 4J2WA 2GR3A 3UOYA 4U2TA 2B9XA 2YG6A 4HB9A 4B63A 2EQ7A 2YAUA 4UDRA 4Z2TA 2X8HA 2JB3A 4OPTA 3AE3A 3DK4A 4H4QA 1F6MA 4BK3A 5KOXA 2WESA 1E1KA 2BXSA 1Q1RA 1CJ3A 1ZMCA 3VRAA 3COXA 1JOAA 1GRBA 2TPRA 1HYUA 2E4GA 2WQYA 3JSKA 3IHGA 4OPCA 2GEWA 3NGCX 3AEEA 3V76A 2C64A 2I0ZA 1EBDA 1Y0PA 2XVEA 3AD8B 1B5QA 4NTEA 3UKFA 4BJYA 1D7YA 2EQ8A 5EBKA 3AEGA 5KMSA 2Q7VA 5KWFA 1OJAA 2RGHA 4M52A 3AYJA 3NRNA 1PJ6A 2EQ6A 1VRQB 3URHA 4C3XA 3GWDA 2CDUA 5JCNA 1N4UA 2XFOA 1JRZA 2RGOA 3K7QX 1O5WA 2IVDA 3UKHA 2WU5A 4EQXA 4USQA 4AT0A 1PJ7A 3V3NA 4YT0A 4EIPA 3ISHA 2WHDA 4OPGA 4U8JA 3SYIA 1TDNA 2OLOA 2BYBA 2YWLA 3GMBA 4I58A 4XXGA 1KSUA 1QO8A 3WE0A 2NPXA 4H4RA 2QCUA 3T0KA 1NG4A 1MXTA 3SZ0A 4C77A 1D5TA 4K22A 4OPUA 1EL9A 1IUXA 1PXBA 4JNAA 5KMQA 3AE9A 2BRAA 1XANA 4IVOB 1GOSA 1GTEA 2YLTA 4APNA 3QFBA 3AE5A 1E1MA 4DGKA 2X8CA 3LOVA 1IUWA 3NT6A 1BGNA 2C65A 2JKCA 2APGA 3PVCA 3KKJA 3QSEA 4ZCCA 4EMJA 3AE4A 4K5RA 3UKAA 1EL8A 2R4EA 2GQWA 1S7MA 5C3JA 5IPYA 1BF3A 1OJDA 1L9DA 2QA2A 3HZLA 4H2QA 1PN0A 3ZDNA 1ZDLA 1H84A 3DJEA 4A5LA 2YG4A 1O95A 4U8PA 5DBJA 2XVIA 3UCLA 4TM3A 5KRQA 1D4DA 2HQMA 2H88A 3T37A 4CY6A 4WCTA 4A6NA 4TM1A 2GVCA 2Z5YA 3GYXA 3ABVA 3RP8A 2WOWA 1DOBA 1TDEA 3ATQA 1KFYA 3CMMA 2VVMA 1L0VA 3AE1A 2YR5A 4BJZA 2B7RA 3LJPA 2EQ9A 3O0HA 3SY4A 3VQRA 5GRTA 4HA6A 1XDIA 1GV4A 1DOEA 4GRTA 3I6DA 4BV6A 2BK5A 1Z6LA 1LQUA 2ACZA 3L8KA 1DNCA 3HYXA 3UOXA 2GQFA 2ZZ0A 3ALMA 1LJ1A 1MO9A 2BRYA 3D8XA 3KPKA 1S3BA 3K7TA 3PO7A 4YTMA 2VQ7A 4DSGA 4EIQA 1GRAA 2DKHA 1M64A 1GSNA 2FJAA 2OAMA 3CPIG 3HYWA 3UTGA 1DJQA 3AXBA 2BK4A 4CNJA 3LZXA 2ARDA 4YXDA 1H7WA 4U8OA 2BS2A 3EPTA 1TDKA 1NHSA 2Y6QA 4E0VA 3NLCA 4GDEA 4NWZA 2GR0A 1CC4A 4H4UA 2FJEA 2Y6RA 2BC0A 1OJCA 1PBEA 2GMJA 3BNUA 4H4XA 1NHPA 2R45A 3FBSA 3KA7A 4FX9A 1PBDA 1N4VA 3LZWA 3AE7A 4B67A 3NH3X 4II2A 2OALA 3AWIA 2C72A 3GYIA 4Z2UA 3QSMA 4XWZA 3NK2X 4KX6A 4Y4LA 3AE8A 3UKPA 3M12A 1PS9A 4U8IA 1QJDA 5J60A 1S2YA 1PBFA 1BZLA 2QA1A 1ZX9A 3T2YA 4H4TA 1D4EA 5BRTA 2WP5A 3DH9A 4H2PA 2WP6A 1O94A 3UP5A 1OJ9A 4G6HA 3ZYXA 1LTXR 4USRA 4B65A 1GRHA 3CPJG 2XLPA 2YLZA 1GETA 3AE6A 3ALLA 5BUKA 3GMCA 3L1RA 1GEUA 2WDVA 4A6NB 4CRTA 3AECA 3NYEA 3KLJA 5M0ZA 1CBOA 2AQJA 2X8GA 3GSIA 5KVHA 1NDAA 2YG5A 3SZWA 3UKKA 1IUUA 1Y56A 1L9CA 4P9SA 2GR2A 4B1BA 4CCRA 2XVHA 4IVMB 4H4SA 1AOGA 1VG0A 2VZ2A 4ZCDA 4JN9A 1E39A 1P2HA 4O5UA 2V3BA 3OZ2A 1JRYA 5JCKA 4C5OA 3ICSA 4N9XA 3QVRA 3NTAA 1EL5A 4OVIA 2IIDA 4J56A 4GUVA 3UOZA 2FJBA 3BI4A 3D1CA 4AT2A 3E1TA 1LPFA 4UDQA 4EM3A 1PDHA 1GT8A 2WDRA 3AEDA 1B4VA 3M13A 4OPDA 5BVAA 4YSZA 1KF6A 1P2EA 3SZCA 3T2ZA 3K30A 3NN6X 1K0JA 3G5SA 3P4PA 4K7ZA 2YM1A 2YR4A 4Z2RA 2R0GA 1B37A 4A7AA 1FEBA 4J34A 5HXIA 2V3AA 3FMWA 4YSHA 3IC9A 4DNAA 2GAGB 1KNPA 2JB1A 2VRLA 3KU9A 4NTDA 4WX1A 2O9ZA 2Q6UA 1PBCA 3NHOX 4OCGA 2BS3A 2PHHA 2R4JA 2GB0A 3T2KA 3SQPA 1JNRA 1BKWA 3Q6JA 1GPEA 4H2NA 1TDFA 4ADWA 1ELIA 3NK1X 3NTDA 1V59A 2YR6A 3AEFA 4EMIA 4CBQA 5C2TA 2TMDA 1IUTA 2GAHB 1GRFA 3UTFA 4DSHA 4G74A 3LB8A 3R9UA 3SZFA 4U2SA 4LA1A 2YG3A 4BK1A 4CNKA 1W4XA 2GMHA 3G5RA 3BI5A 2R0PA 1CL0A 2R46A 4LU6A 3CNPA 3ICRA 4CY8A 2XYOA 1FCDA 1F8RA 3GDNA 2YLSA 4Y4NA 4UDPA 4YSXA 4NEVA 3DK9A 4X9NA 4AOSA 4Z25A 2R9ZA 5TR3A 5U25A 2WPCA 4A79A 4H4WA 3QFAA 1CC6A 4H50A 1YQ3A 2XLTA 5IQ1A 4Z44A 1ZMDA 5FS7A 3NG7X 3GDPA 4A9WA 5CQFA 3REDA 3C4NA 3S5WA 2F5ZA 4B69A 1ZY8A 1KNRA 3F8PA 4RG3A 1Y56B 2XLUA 4G9KA 4J36A 1KN0A 2BCGG 3I3LA 4Z43A 3NYCA 1F3PA 2WOVA 2JBVA 1KSSA 4H4VA 1H86A 2C73A 4D03A 2JB2A 1BWCA 3F8RA 2YLRA 2C3CA 3SM8A 1IUSA 5U63A 1XHCA 1ONFA 3LADA 2XVJA 3BHFA 5KMPA 4YWOA 4B66A 3BHKA 2RABA 1H83A 1FECA 2C75A 3PS9A 4B68A 1YQZA 1Q1WA 2WDQA 1H6VA 1KDGA 3IF9A 3EF6A 1H2IA 1ZP0A 1K0LA 2YG7A 3CNSA 1PBBA 2XFNA 4EM4A 1D4CA 4K5SA 1DJNA 2DKIA 3IWAA 1B8SA 3PG6A 2E1MA 2JAEA 3AYLA 3ICTA 1E1NA 2C76A 3UKLA 1FEAA 4H4PA 1LV0A 3AD9B 4FK1C 2V60A 4K2XA 3RHAA 5HY5A 1IJHA 4U2LA 3DMEA 2C4CA 1GESA 2NVKX 3ITJA 1CC2A 1Q9IA 4X4JA 2C66A 4NEWA 1NEKA 2YM2A 5FMHA 2H89A 2V6OA 4H4ZA 1NHQA 3CNJA 5FS9A 2BS4A 2BCPA 4JY2A 2X3NA 3CGBA 1GREA 2X99A 2X50A 1FOHA 1DOCA 1NPXA 2RGJA 2UZZA 3KD9A 4PAAA 3VR8A 3L5OA 3AEBA 4A99A 2VOUA 2ZBWA 3B3RA 2YLWA 5CKUA 4NTCA 1ZKQA 3H8IA 1F8SA 4H7UA 1CJ4A 3ALJA 2VQBA 4ECHA 3CTYA 3DJDA 1GRGA 4Y4MA 3II4A 1S2QA 3QSSA 3SX6A 1E1LA 5JRBA 2GH5A 3AE2A 2C7GA 3SXIA 3M0OA 1IUVA 3RP6A 2E5VA 4X9MA 1YKJA 1TYTA 1L9EA 1PHHA 1OJTA 2AAQA 4EQSA 2Q0LA 3DA1A 3UKQA 3UTHA 1DODA 4RSLA 3UTEA 1GNDA 4EQRA 5BULA 3EAOA 4II3A 2WOIA 4JNQA 1DXLA 1NENA 2XVFA 3P4QA 1VQWA 2BACA 2BC1A 3NNEA 1RP0A 2YVFA 3GWFA 4OPLA 3V3OA 4I59A 4Z26A 2GF3A 1PJ5A 1CHUA 3C96A 5KVIA 1CJCA 5HYMA 3T14A 1TDOA 5JCLA 5LV9A 1E7PA 1TRBA 5GSNA 5EB4A 3CNTA 1D7LA 3FIMB 1TYPA 4J33A 3NKSA 4G73A 2XFQA 1YY5A 4AP3A 4GAPA 5KNLA 3QJ4A 4C74A 1M6IA 5HHFA 3DJJA 4FK1A 3NK0X 4J31A 2A89A 4U8MA 1GALA 4IA5A 4IA6A 1RSGA 5J7XA 4H2RA 2AR8A 3P1WA 1JRXA 4GR1A 1S3EA 4O5QA 2WBAA 4YTNA 2Q0KA 4CCQA 1GRTA 5L46A 2C67A 4YSYA 3AB1A 1BGJA 3Q9TA 2GV8A 4GDPA 3VRDB 4IV9A 2WS3A 4U8NA 2JK6A 2W0HA 4TM4A 1K4QA 2YQUA 1CF3A 2C70A 2BXRA 2B9WA 1K0IA 1H7XA 1COYA 1MOKA 1UKVG 5EB5A 4U8KA 5U1OA 3UOVA 3GD4A 3D9XA 1NAAA 1F8WA 4JDRA 2WU2A 2BABA 1YQ4A 1NG3A 3K7MX 5IQ4A 5JCMA 1PXCA 1RYIA 1JEHA 1H82A 4JY3A 2XFUA 1GXFA 2CFYA 4BK2A 1GERA 1XPQA 2A87A 5ER0A 1ZK7A 3UP4A 3KPFA 5KXJA 2BA9A 2Z5XA 3NYFA 4YKGA 3AEAA 2QAEA 2XFPA 2XLSA 4GF7A 5KMRA 4UP3A 4GAVA 3IHMA 4PABA 2BK3A 4K8DA 1EL7A 1ZOVA 4Z24A 1LQTA 2B7SA 2YLXA 3KVEA 4NNJA 4G6GA 4JQ9A 3RP7A 2YVJA 2FBWA 3B6DA 2GRTA 3GRTA 3ATRA 2B9YA 4EQWA 3DGZA 2FJDA 2WPFA 3C4AA 3CIRA 3T31A 4EMWA 1LVLA 3AYIA 4MJWA 2ZZBA 4AOXA 4B64A 2XCGA 3BI2A 3GRSA 3SGLA 3H8LA 3NIXA 4A65A 3H4KA 3CPHG 5FS8A 1X31B 1JU2A 2ZZCA 1NHRA 3GD3A 2A8XA 2VRMA 3HYVA 3VRBA 4TM0A 3P9UA 1GTHA 5M10A 3GYJA 3DGHA 2VVLG 3NN0X 3P4SA 4ZN0A 3DJGX 3RNMA 1VG9A 4ICYA 1JNZA 3BNMA 4LIIA 1CJ2A 2B76A 2V5ZA 3AD7B 4YTPA 1ZOYA 3LXDA 3DK8A 2CULA 3SFEA 3CGEA 1VDCA 1E6EA 1H81A 4U8LA 4C3YA 4D04A 3SFDA 1REOA 5EOWA 4J57A 5KOWA 2V61A 2IVEA 2VVLA 3ADAB 5JCIA 2C3DA 5FS6A 3CNDA 3CN8A 3F8DA 4FDCB 3CGDA 3VR9A 1SEZA 3EANA 4TLZA 4XWRA 4YKFA 2CVJA 2XDOA 2YVGA 2WP9A 4REKA 2PYXA 4AP1A 1QLBA 4KPRA 1N1PA 1FL2A 3CGCA 3FG2P 2GR1A 2J3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NZH A;  2WPE A;  1PXA A;  3S61 A;  2WEU A;  3OC4 A;  4RG4 A;  2XLR A;  4H4Y A;  1N4W A;  2OA1 A;  2R0C A;  3G5Q A;  3P4R A;  4TLX A;  2OLN A;  4OPI A;  3FPZ A;  4BUR A;  3QVP A;  4GCM A;  2WET A;  4J2W A;  2GR3 A;  3UOY A;  4U2T A;  2B9X A;  2YG6 A;  4HB9 A;  4B63 A;  2EQ7 A;  2YAU A;  4UDR A;  4Z2T A;  2X8H A;  2JB3 A;  4OPT A;  3AE3 A;  3DK4 A;  4H4Q A;  1F6M A;  4BK3 A;  5KOX A;  2WES A;  1E1K A;  2BXS A;  1Q1R A;  1CJ3 A;  1ZMC A;  3VRA A;  3COX A;  1JOA A;  1GRB A;  2TPR A;  1HYU A;  2E4G A;  2WQY A;  3JSK A;  3IHG A;  4OPC A;  2GEW A;  3NGC X;  3AEE A;  3V76 A;  2C64 A;  2I0Z A;  1EBD A;  1Y0P A;  2XVE A;  3AD8 B;  1B5Q A;  4NTE A;  3UKF A;  4BJY A;  1D7Y A;  2EQ8 A;  5EBK A;  3AEG A;  5KWF A;  2Q7V A;  1OJA A;  2RGH A;  4M52 A;  3AYJ A;  3NRN A;  1PJ6 A;  2EQ6 A;  1VRQ B;  3URH A;  4C3X A;  3GWD A;  2CDU A;  5JCN A;  1N4U A;  2XFO A;  1JRZ A;  2RGO A;  3K7Q X;  1O5W A;  2IVD A;  3UKH A;  2WU5 A;  4EQX A;  4USQ A;  4AT0 A;  1PJ7 A;  3V3N A;  4YT0 A;  4EIP A;  3ISH A;  2WHD A;  4OPG A;  4U8J A;  1TDN A;  2OLO A;  2BYB A;  2YWL A;  3GMB A;  4I58 A;  4XXG A;  1KSU A;  1QO8 A;  3WE0 A;  2NPX A;  4H4R A;  2QCU A;  1NG4 A;  1MXT A;  4C77 A;  1D5T A;  4K22 A;  4OPU A;  1EL9 A;  1IUX A;  1PXB A;  4JNA A;  3AE9 A;  1XAN A;  4IVO B;  1GOS A;  1GTE A;  2YLT A;  4APN A;  3QFB A;  3AE5 A;  1E1M A;  4DGK A;  2X8C A;  3LOV A;  1IUW A;  3NT6 A;  1BGN A;  2C65 A;  2JKC A;  2APG A;  3PVC A;  3KKJ A;  3QSE A;  4ZCC A;  4EMJ A;  3AE4 A;  4K5R A;  3UKA A;  1EL8 A;  2R4E A;  2GQW A;  5C3J A;  5IPY A;  1BF3 A;  1OJD A;  1L9D A;  2QA2 A;  3HZL A;  4H2Q A;  1PN0 A;  3ZDN A;  1ZDL A;  1H84 A;  3DJE A;  4A5L A;  2YG4 A;  1O95 A;  4U8P A;  5DBJ A;  2XVI A;  3UCL A;  4TM3 A;  5KRQ A;  1D4D A;  2HQM A;  2H88 A;  3T37 A;  4CY6 A;  4WCT A;  4A6N A;  4TM1 A;  2GVC A;  2Z5Y A;  3ABV A;  3RP8 A;  2WOW A;  1DOB A;  1TDE A;  3ATQ A;  1KFY A;  2VVM A;  1L0V A;  3AE1 A;  2YR5 A;  4BJZ A;  2B7R A;  3LJP A;  2EQ9 A;  3O0H A;  3VQR A;  5GRT A;  4HA6 A;  1XDI A;  1GV4 A;  1DOE A;  4GRT A;  3I6D A;  4BV6 A;  2BK5 A;  1Z6L A;  1LQU A;  2ACZ A;  3L8K A;  1DNC A;  3UOX A;  2GQF A;  2ZZ0 A;  3ALM A;  1LJ1 A;  1MO9 A;  3D8X A;  1S3B A;  3K7T A;  3PO7 A;  4YTM A;  2VQ7 A;  4DSG A;  4EIQ A;  1GRA A;  2DKH A;  1M64 A;  1GSN A;  2FJA A;  2OAM A;  3CPI G;  4CNJ A;  3UTG A;  1DJQ A;  3AXB A;  2BK4 A;  4YXD A;  3LZX A;  2ARD A;  1H7W A;  4U8O A;  2BS2 A;  3EPT A;  1TDK A;  1NHS A;  2Y6Q A;  4E0V A;  3NLC A;  4GDE A;  2GR0 A;  1CC4 A;  4H4U A;  2FJE A;  2Y6R A;  2BC0 A;  1OJC A;  1PBE A;  2GMJ A;  3BNU A;  4H4X A;  1NHP A;  2R45 A;  3FBS A;  3KA7 A;  4FX9 A;  1PBD A;  1N4V A;  3LZW A;  3AE7 A;  4B67 A;  3NH3 X;  2OAL A;  3AWI A;  2C72 A;  3GYI A;  4Z2U A;  3QSM A;  4XWZ A;  3NK2 X;  4KX6 A;  4Y4L A;  3AE8 A;  3UKP A;  3M12 A;  1PS9 A;  4U8I A;  1QJD A;  5J60 A;  1S2Y A;  1PBF A;  1BZL A;  2QA1 A;  1ZX9 A;  4H4T A;  1D4E A;  5BRT A;  2WP5 A;  3DH9 A;  4H2P A;  2WP6 A;  1O94 A;  3UP5 A;  1OJ9 A;  3ZYX A;  1LTX R;  4USR A;  4B65 A;  1GRH A;  3CPJ G;  2XLP A;  2YLZ A;  1GET A;  3AE6 A;  3ALL A;  5BUK A;  3GMC A;  3L1R A;  1GEU A;  2WDV A;  4A6N B;  4CRT A;  3AEC A;  3NYE A;  3KLJ A;  5M0Z A;  1CBO A;  2AQJ A;  2X8G A;  3GSI A;  5KVH A;  1NDA A;  2YG5 A;  3UKK A;  1IUU A;  1Y56 A;  1L9C A;  4P9S A;  2GR2 A;  4B1B A;  4CCR A;  2XVH A;  4IVM B;  4H4S A;  1AOG A;  1VG0 A;  2VZ2 A;  4ZCD A;  4JN9 A;  1E39 A;  1P2H A;  4O5U A;  2V3B A;  3OZ2 A;  1JRY A;  5JCK A;  4C5O A;  3ICS A;  4N9X A;  3QVR A;  3NTA A;  1EL5 A;  4OVI A;  2IID A;  4J56 A;  4GUV A;  3UOZ A;  2FJB A;  3BI4 A;  3D1C A;  4AT2 A;  3E1T A;  1LPF A;  4UDQ A;  4EM3 A;  1PDH A;  1GT8 A;  2WDR A;  3AED A;  1B4V A;  3M13 A;  4OPD A;  5BVA A;  4YSZ A;  1KF6 A;  1P2E A;  3K30 A;  3NN6 X;  1K0J A;  3G5S A;  3P4P A;  4K7Z A;  2YM1 A;  2YR4 A;  4Z2R A;  2R0G A;  1B37 A;  4A7A A;  1FEB A;  4J34 A;  5HXI A;  2V3A A;  3FMW A;  4YSH A;  3IC9 A;  4DNA A;  2GAG B;  1KNP A;  2JB1 A;  2VRL A;  3KU9 A;  4NTD A;  4WX1 A;  2O9Z A;  2Q6U A;  1PBC A;  3NHO X;  4OCG A;  2BS3 A;  2PHH A;  2R4J A;  2GB0 A;  3SQP A;  1JNR A;  1BKW A;  3Q6J A;  1GPE A;  4H2N A;  1TDF A;  4ADW A;  1ELI A;  3NK1 X;  3NTD A;  1V59 A;  2YR6 A;  3AEF A;  4EMI A;  4CBQ A;  5C2T A;  2TMD A;  1IUT A;  2GAH B;  1GRF A;  3UTF A;  4DSH A;  3R9U A;  3LB8 A;  4U2S A;  4LA1 A;  2YG3 A;  4BK1 A;  4CNK A;  1W4X A;  2GMH A;  3G5R A;  3BI5 A;  2R0P A;  1CL0 A;  2R46 A;  4LU6 A;  3CNP A;  3ICR A;  4CY8 A;  2XYO A;  1FCD A;  1F8R A;  3GDN A;  2YLS A;  4Y4N A;  4UDP A;  4YSX A;  4NEV A;  3DK9 A;  4X9N A;  4AOS A;  4Z25 A;  2R9Z A;  5TR3 A;  5U25 A;  2WPC A;  4A79 A;  4H4W A;  3QFA A;  1CC6 A;  4H50 A;  1YQ3 A;  2XLT A;  5IQ1 A;  4Z44 A;  1ZMD A;  5FS7 A;  3NG7 X;  3GDP A;  4A9W A;  5CQF A;  3RED A;  3C4N A;  3S5W A;  2F5Z A;  4B69 A;  1ZY8 A;  1KNR A;  3F8P A;  4RG3 A;  1Y56 B;  2XLU A;  4J36 A;  2BCG G;  3I3L A;  4Z43 A;  3NYC A;  1F3P A;  2WOV A;  2JBV A;  1KSS A;  4H4V A;  1H86 A;  2C73 A;  4D03 A;  2JB2 A;  1BWC A;  3F8R A;  2YLR A;  2C3C A;  3SM8 A;  1IUS A;  5U63 A;  1XHC A;  1ONF A;  3LAD A;  2XVJ A;  3BHF A;  4YWO A;  4B66 A;  3BHK A;  2RAB A;  1H83 A;  1FEC A;  2C75 A;  3PS9 A;  4B68 A;  1YQZ A;  1Q1W A;  2WDQ A;  1H6V A;  1KDG A;  3IF9 A;  3EF6 A;  2YG7 A;  1ZP0 A;  1K0L A;  3CNS A;  1PBB A;  2XFN A;  4EM4 A;  1D4C A;  4K5S A;  1DJN A;  2DKI A;  3IWA A;  1B8S A;  3AYL A;  2E1M A;  2JAE A;  3ICT A;  1E1N A;  2C76 A;  3UKL A;  1FEA A;  4H4P A;  1LV0 A;  3AD9 B;  4FK1 C;  2V60 A;  4K2X A;  3RHA A;  5HY5 A;  1IJH A;  4U2L A;  3DME A;  1GES A;  2NVK X;  3ITJ A;  1CC2 A;  1Q9I A;  4X4J A;  2C66 A;  4NEW A;  1NEK A;  2YM2 A;  5FMH A;  2H89 A;  2V6O A;  4H4Z A;  1NHQ A;  3CNJ A;  5FS9 A;  2BS4 A;  2BCP A;  4JY2 A;  2X3N A;  3CGB A;  1GRE A;  2X99 A;  2X50 A;  1FOH A;  1DOC A;  1NPX A;  2RGJ A;  2UZZ A;  3KD9 A;  4PAA A;  3VR8 A;  3AEB A;  4A99 A;  2VOU A;  2ZBW A;  3B3R A;  2YLW A;  5CKU A;  4NTC A;  1ZKQ A;  3H8I A;  1F8S A;  4H7U A;  1CJ4 A;  3ALJ A;  2VQB A;  4ECH A;  3CTY A;  3DJD A;  1GRG A;  4Y4M A;  3II4 A;  1S2Q A;  3QSS A;  1E1L A;  2GH5 A;  3AE2 A;  2C7G A;  3M0O A;  1IUV A;  3RP6 A;  2E5V A;  4X9M A;  1YKJ A;  1TYT A;  1L9E A;  1PHH A;  1OJT A;  2AAQ A;  4EQS A;  2Q0L A;  3DA1 A;  3UKQ A;  3UTH A;  1DOD A;  4RSL A;  3UTE A;  1GND A;  4EQR A;  5BUL A;  3EAO A;  2WOI A;  4JNQ A;  1DXL A;  1NEN A;  2XVF A;  3P4Q A;  1VQW A;  2BAC A;  2BC1 A;  3NNE A;  1RP0 A;  2YVF A;  3GWF A;  4OPL A;  3V3O A;  4I59 A;  4Z26 A;  2GF3 A;  1PJ5 A;  1CHU A;  3C96 A;  5KVI A;  1CJC A;  5HYM A;  1TDO A;  5JCL A;  5LV9 A;  1E7P A;  1TRB A;  5GSN A;  5EB4 A;  3CNT A;  1D7L A;  3FIM B;  1TYP A;  4J33 A;  3NKS A;  2XFQ A;  1YY5 A;  4AP3 A;  3QJ4 A;  4C74 A;  1M6I A;  5HHF A;  3DJJ A;  4FK1 A;  3NK0 X;  4J31 A;  2A89 A;  4U8M A;  1GAL A;  4IA5 A;  4IA6 A;  1RSG A;  5J7X A;  4H2R A;  2AR8 A;  3P1W A;  1JRX A;  4GR1 A;  1S3E A;  4O5Q A;  2WBA A;  4YTN A;  2Q0K A;  4CCQ A;  1GRT A;  5L46 A;  2C67 A;  4YSY A;  3AB1 A;  1BGJ A;  3Q9T A;  2GV8 A;  4GDP A;  3VRD B;  4IV9 A;  2WS3 A;  4U8N A;  2JK6 A;  2W0H A;  4TM4 A;  1K4Q A;  2YQU A;  1CF3 A;  2C70 A;  2BXR A;  2B9W A;  1K0I A;  1H7X A;  1COY A;  1MOK A;  1UKV G;  5EB5 A;  4U8K A;  5U1O A;  3UOV A;  3GD4 A;  1NAA A;  1F8W A;  4JDR A;  2WU2 A;  2BAB A;  1YQ4 A;  1NG3 A;  3K7M X;  5IQ4 A;  5JCM A;  1PXC A;  1RYI A;  1JEH A;  1H82 A;  4JY3 A;  2XFU A;  1GXF A;  2CFY A;  4BK2 A;  1GER A;  1XPQ A;  2A87 A;  5ER0 A;  1ZK7 A;  3UP4 A;  3KPF A;  5KXJ A;  2BA9 A;  2Z5X A;  3NYF A;  4YKG A;  3AEA A;  2QAE A;  2XFP A;  2XLS A;  4GF7 A;  4UP3 A;  3IHM A;  4PAB A;  2BK3 A;  4K8D A;  1EL7 A;  1ZOV A;  4Z24 A;  1LQT A;  2B7S A;  2YLX A;  3KVE A;  4JQ9 A;  3RP7 A;  2YVJ A;  2FBW A;  3B6D A;  2GRT A;  3GRT A;  3ATR A;  2B9Y A;  4EQW A;  3DGZ A;  2FJD A;  2WPF A;  3C4A A;  3CIR A;  4B64 A;  4EMW A;  1LVL A;  3AYI A;  4MJW A;  2ZZB A;  4AOX A;  2XCG A;  3BI2 A;  3GRS A;  3SGL A;  3H8L A;  3NIX A;  4A65 A;  3H4K A;  3CPH G;  5FS8 A;  1X31 B;  1JU2 A;  2ZZC A;  1NHR A;  3GD3 A;  2A8X A;  2VRM A;  3VRB A;  4TM0 A;  3P9U A;  1GTH A;  5M10 A;  3GYJ A;  3DGH A;  2VVL G;  3NN0 X;  3P4S A;  4ZN0 A;  3DJG X;  3RNM A;  1VG9 A;  4ICY A;  1JNZ A;  3BNM A;  4LII A;  1CJ2 A;  2B76 A;  2V5Z A;  3AD7 B;  4YTP A;  1ZOY A;  3LXD A;  3DK8 A;  2CUL A;  3SFE A;  3CGE A;  1VDC A;  1E6E A;  1H81 A;  4U8L A;  4C3Y A;  4D04 A;  3SFD A;  1REO A;  5EOW A;  4J57 A;  5KOW A;  2V61 A;  2IVE A;  2VVL A;  3ADA B;  5JCI A;  2C3D A;  5FS6 A;  3CND A;  3CN8 A;  3F8D A;  4FDC B;  3CGD A;  3VR9 A;  1SEZ A;  3EAN A;  4TLZ A;  4XWR A;  4YKF A;  2CVJ A;  2XDO A;  2YVG A;  2WP9 A;  4REK A;  2PYX A;  4AP1 A;  1QLB A;  4KPR A;  1N1P A;  1FL2 A;  3CGC A;  3FG2 P;  2GR1 A;  2J3N A; 
#chains in the Genus database with same CATH topology
 2WPE A;  3A7A A;  2OA1 A;  2R0C A;  3P4R A;  3UJ2 A;  1ZXI C;  3FXG A;  3DK4 A;  2RDX A;  1E1K A;  2TPR A;  1RVK A;  3K1G A;  4GIR A;  3AEE A;  2I0Z A;  1T3Q C;  3AD8 B;  1PDY A;  4BJY A;  3DFY A;  2EQ8 A;  5KWF A;  3H70 A;  1N4U A;  2XFO A;  2IVD A;  4AT0 A;  4USQ A;  3ZLF A;  3ISH A;  3NVV B;  4U8J A;  2YWL A;  3GMB A;  1D5T A;  4OPU A;  1MDR A;  3AE9 A;  4F4R A;  1IUW A;  1BGN A;  3U4F A;  3PVC A;  1EL8 A;  1BF3 A;  1PN0 A;  4A5L A;  3NO1 A;  3A7U A;  3V5F A;  3AM9 A;  5KRQ A;  3CMM A;  1EBH A;  2YR5 A;  3O0H A;  1GV4 A;  3SQS A;  3I6D A;  1Z6L A;  2QDD A;  3HYX A;  2BRY A;  3SN4 A;  1XS2 A;  4EIQ A;  1GRA A;  4K2S A;  1GSN A;  4CNJ A;  3CPI G;  1H7W A;  3CAW A;  1VDV A;  1CC4 A;  2FJE A;  3MKC A;  4E6M A;  3FCP A;  3KA7 A;  4II2 A;  2OAL A;  2XGZ A;  2C72 A;  3GYI A;  2AL2 B;  4KX6 A;  3DG6 A;  1PS9 A;  5J60 A;  1PBF A;  1BZL A;  4H4T A;  2XH0 A;  3FJ4 A;  1TKK A;  4H2P A;  3ZYX A;  4G6H A;  4USR A;  4B65 A;  1GET A;  1P43 A;  2WDV A;  3D46 A;  3NYE A;  5M0Z A;  3GSI A;  3U9I A;  4H4S A;  1VG0 A;  2VZ2 A;  4JN9 A;  1JRY A;  4C5O A;  3QVR A;  4OVI A;  4GUV A;  2FJB A;  3BI4 A;  4AT2 A;  2AKZ A;  3FYY A;  4OPD A;  4JHM A;  5J04 A;  3P4P A;  3G5S A;  2P0I A;  4Z2R A;  3MUC A;  5HXI A;  3IC9 A;  4DNA A;  4NTD A;  2O9Z A;  2Q6U A;  3NHO X;  4OCG A;  2BS3 A;  2PHH A;  3SQP A;  1GPE A;  1TDF A;  3AEF A;  4EMI A;  4MMW A;  1IUT A;  3STP A;  2TMD A;  3LB8 A;  3SZF A;  1XPY A;  3BI5 A;  4ROP A;  3CNP A;  3ICR A;  1FCD A;  1F8R A;  2E3T A;  4UDP A;  5G5G B;  4DYE A;  3AMZ A;  4Z25 A;  5TR3 A;  2WPC A;  4H50 A;  5IDZ A;  2XLT A;  1ZMD A;  3NG7 X;  4A9W A;  1Y56 B;  1KN0 A;  3MY9 A;  3NYC A;  2JBV A;  1IUS A;  1ONF A;  3LAD A;  5KMP A;  4YWO A;  4KPL A;  2RAB A;  2PP1 A;  3PS9 A;  2WDQ A;  1KDG A;  1TE6 A;  3PG6 A;  3AYL A;  4G8T A;  2OKT A;  3UKL A;  4H4P A;  2V60 A;  1IJH A;  4U2L A;  3SJN A;  1CC2 A;  3CNJ A;  3TOY A;  4K5R A;  1GRE A;  4H2R A;  1FOH A;  1SJD A;  1NPX A;  3UGV A;  2YLW A;  3UJF A;  4JN8 A;  1F8S A;  1CJ4 A;  2E5A A;  3DJD A;  2OZ3 A;  4HYR A;  5FJU A;  3II4 A;  3SX6 A;  1E1L A;  5JRB A;  3ZLH A;  3RCY A;  3P3B A;  1FFU C;  3R1Z A;  3ENL A;  2OG9 A;  4X2P A;  1DOD A;  4EQR A;  4JNQ A;  2OZT A;  3OZY A;  3VC5 A;  2BC1 A;  2OPJ A;  5KVI A;  1CJC A;  1TRB A;  1D7L A;  1TYP A;  4J33 A;  2XFQ A;  1YY5 A;  4AP3 A;  3QJ4 A;  4J31 A;  4U8M A;  1GAL A;  4IA5 A;  2W3R A;  4GR1 A;  4YTN A;  1GRT A;  2GV8 A;  1R6W A;  4GYP A;  4IV9 A;  1CF3 A;  2C70 A;  2B9W A;  1MOK A;  3UOV A;  3D9X A;  3NVY B;  3DDM A;  4JDR A;  1X2G A;  5IQ4 A;  2PTW A;  3T9P A;  4BK2 A;  3GC2 A;  3NYF A;  2QAE A;  2XLS A;  3IHM A;  4PAB A;  3KVE A;  4G6G A;  3T4W A;  4XWZ A;  3AYI A;  4AOX A;  1ONE A;  2OZ8 A;  3H8L A;  1WUE A;  3CPH G;  1X31 B;  2ZZC A;  2A8X A;  3VRB A;  3P9U A;  3GYJ A;  3DIP A;  3TQP A;  1EBG A;  3NN0 X;  1WYG A;  3TJI A;  1JNZ A;  4LII A;  1CJ2 A;  5FJO A;  2B76 A;  2PGE A;  4K8G A;  2GDQ A;  4DXK A;  1E6E A;  4HCH A;  3CND A;  3S5S A;  3F8D A;  3CGD A;  4TLZ A;  2XDO A;  2YVG A;  2QJM A;  2PYX A;  4HPN A;  1SJA A;  1FL2 A;  3S61 A;  1N4W A;  2QJJ A;  3G5Q A;  4OPI A;  3BOX A;  4GME A;  4BUR A;  2WET A;  4J2W A;  2B9X A;  2YG6 A;  4HB9 A;  4B63 A;  4DX3 A;  4H4Q A;  4ZA0 A;  3UXK A;  4BK3 A;  3OP2 A;  5KOX A;  1Q1R A;  4DWD A;  3COX A;  1JOA A;  2E4G A;  3R10 A;  2WQY A;  3JSK A;  3NGC X;  3I6E A;  2C64 A;  1Y0P A;  2CHR A;  2XVE A;  1B5Q A;  1D7Y A;  5EBK A;  3AEG A;  5KMS A;  2GGH A;  1O5W A;  1KKR A;  3UKH A;  4EQX A;  1PJ7 A;  4YT0 A;  3NVW B;  2WHD A;  3FV9 A;  3SYI A;  2OLO A;  2BYB A;  3R0K A;  4I58 A;  1KSU A;  3V5C A;  3SZ0 A;  4K22 A;  3T8Q A;  1EL9 A;  1PXB A;  5KMQ A;  2W3S A;  4IVO B;  3AE5 A;  3IJQ A;  2JKC A;  3KKJ A;  3UKA A;  4EMJ A;  1L8P A;  2GQW A;  2HNE A;  1W6T A;  4H2Q A;  2QA2 A;  1H84 A;  3DJE A;  2YG4 A;  1O95 A;  5DBJ A;  2XVI A;  1D4D A;  4CY6 A;  3GYX A;  3RP8 A;  2GGI A;  1DOB A;  3ATQ A;  1KFY A;  2VVM A;  1MRA A;  3LJP A;  2EQ9 A;  3VQR A;  5GRT A;  1EC9 A;  1XDI A;  1FHV A;  4BV6 A;  2BK5 A;  1LQU A;  3ALM A;  2ZZ0 A;  1LJ1 A;  1MO9 A;  1JPM A;  2DKH A;  4GFI A;  3Q45 A;  2FJA A;  3H12 A;  3AXB A;  3P93 A;  2BS2 A;  1TDK A;  1NHS A;  2Y6Q A;  3QLD A;  4NWZ A;  3EEZ A;  2GR0 A;  1JCT A;  2BC0 A;  3BNU A;  4H4X A;  1NHP A;  2R45 A;  3OZM A;  3AWI A;  4Z2U A;  3QSM A;  3D47 A;  3AE8 A;  3M12 A;  2QA1 A;  2WP5 A;  1O94 A;  3CK5 A;  1BQG A;  2PTX A;  5G5H B;  3NZG A;  3CPJ G;  3L1R A;  4A6N B;  3AEC A;  3SN0 A;  2X8G A;  5KVH A;  2PS2 A;  1N5X A;  4ZCD A;  1EL5 A;  2IID A;  4J56 A;  3A7R A;  3E1T A;  4UDQ A;  3AED A;  1B4V A;  3M13 A;  5BVA A;  3VCC A;  3T2Z A;  3K30 A;  4K7Z A;  2YM1 A;  3BJS A;  4A7A A;  3R07 C;  4YSH A;  2JB1 A;  3KU9 A;  2VRL A;  2GB0 A;  3AN1 A;  3Q6J A;  5FJR A;  3T6C A;  3NK1 X;  3NTD A;  2GAH B;  1FO4 A;  4Z17 A;  5BOE A;  4BK1 A;  2GMH A;  3G5R A;  1V97 A;  2R46 A;  2YLS A;  2PA6 A;  3DK9 A;  2R9Z A;  4A79 A;  4H4W A;  2POD A;  3IJI A;  3QFA A;  3ZLG A;  1CC6 A;  3RED A;  3C4N A;  4B69 A;  1E9I A;  3F8P A;  2BCG G;  3I3L A;  3RGT A;  2HXU A;  2WOV A;  1KSS A;  4H4V A;  1H86 A;  2YLR A;  3OTR A;  1BKH A;  2OFJ A;  1H83 A;  1FEC A;  1YQZ A;  3ES7 A;  3IF9 A;  2YG7 A;  1K0L A;  1PBB A;  2DKI A;  2JAE A;  3ICT A;  1E1N A;  3RHA A;  5HY5 A;  2XH4 A;  3DME A;  4A6G A;  3ITJ A;  3VCN A;  4NEW A;  1EC8 A;  4H4Z A;  2BS4 A;  2BCP A;  4JY2 A;  1DOC A;  4PAA A;  3L5O A;  3AEB A;  3CXB A;  4HCD A;  4H7U A;  3DES A;  3ALJ A;  2VQB A;  4ECH A;  4Y4M A;  2GH5 A;  4FP1 A;  3SXI A;  1IUV A;  3UJR A;  1YKJ A;  3UKQ A;  4RSL A;  3UTE A;  2W55 A;  5BUL A;  3EKG A;  1DXL A;  2XVF A;  3P4Q A;  2BAC A;  3NNE A;  2YVF A;  3V3O A;  3C96 A;  4EWJ A;  3T14 A;  4HNC A;  5JCL A;  1E7P A;  3CNT A;  4G73 A;  5KNL A;  1M6I A;  5J7X A;  3HPF A;  4CCQ A;  4IP5 A;  3UJS A;  4YSY A;  3ZVH A;  4GDP A;  3JW7 A;  3CT2 A;  1K4Q A;  3IJL A;  1K0I A;  1COY A;  5EB5 A;  5U1O A;  1NAA A;  1F8W A;  1FFV C;  1YQ4 A;  3K7M X;  5JCM A;  1PXC A;  1RYI A;  1JEH A;  4JY3 A;  1PDZ A;  1GXF A;  2CFY A;  1GER A;  3SN1 A;  2XFP A;  2P8C A;  4Z24 A;  1EL7 A;  2YLX A;  3RP7 A;  3B6D A;  2YVJ A;  3GRT A;  4KEM A;  5BUK A;  3DGZ A;  2FJD A;  3T31 A;  4EMW A;  2ZZB A;  4IT1 A;  2XCG A;  3NIX A;  4A65 A;  5FS8 A;  2PGW A;  1NHR A;  1R0M A;  2VRM A;  4TM0 A;  1GTH A;  5M10 A;  3DGH A;  2VVL G;  4ZN0 A;  4ICY A;  3BNM A;  1ZOY A;  3LXD A;  2CUL A;  3SFE A;  2OQY A;  1H81 A;  4C3Y A;  5EOW A;  4J57 A;  2IVE A;  3ADA B;  3PWI A;  3CN8 A;  3EAN A;  4XWR A;  2QJN A;  1QLB A;  1N1P A;  3CGC A;  3FG2 P;  2J3N A;  4NZH A;  1PXA A;  3HRD C;  2WEU A;  2GL5 A;  3NVZ B;  4RG4 A;  2XLR A;  4TLX A;  2OLN A;  3FPZ A;  2GGG A;  4GCM A;  2GR3 A;  4U2T A;  4Z2T A;  3FVD A;  3DG7 A;  2BXS A;  3VRA A;  1GRB A;  4K1W A;  3IHG A;  2GEW A;  2OQH A;  3V76 A;  1EBD A;  3UKF A;  5ENL A;  1FHU A;  2Q7V A;  1OJA A;  2RGH A;  4M52 A;  3AYJ A;  3NRN A;  1VRQ B;  3URH A;  3GWD A;  2CDU A;  2RGO A;  3V3N A;  4IL2 A;  4OPG A;  1TDN A;  3HW2 A;  1QO8 A;  3WE0 A;  2NPX A;  3T0K A;  1NG4 A;  4C77 A;  1IUX A;  4H83 A;  2BRA A;  1XAN A;  3QFB A;  1E1M A;  4DGK A;  2AL2 A;  2X8C A;  3LOV A;  1WUF A;  4YWS A;  3DER A;  1OJD A;  3HZL A;  4U8P A;  3UXL A;  2PP0 A;  1OEP A;  3UCL A;  3Q4D A;  3T37 A;  4WCT A;  4TM1 A;  3ABV A;  3CB3 A;  1TDE A;  3AE1 A;  4BJZ A;  2QGY A;  4IHC A;  3V4B A;  4HA6 A;  4E4U A;  3KUM A;  4GRT A;  3L8K A;  3KPK A;  3VC6 A;  4DSG A;  2FKP A;  4IZG A;  1M64 A;  2W54 A;  2OAM A;  2BK4 A;  3LZX A;  1FIQ B;  4U8O A;  3EPT A;  4E0V A;  2Y6R A;  2MUC A;  1PBE A;  2GMJ A;  3FBS A;  3LZW A;  1RM6 B;  3NH3 X;  2ONE A;  3VDG A;  3TW9 A;  2ZC8 A;  3NK2 X;  4Y4L A;  3B97 A;  1YEY A;  4U8I A;  1JPD X;  5BRT A;  3DH9 A;  2WP6 A;  3UP5 A;  1LTX R;  1GRH A;  3AE6 A;  3GMC A;  1GEU A;  4CRT A;  4DN1 A;  1NDA A;  3UKK A;  1IUU A;  1Y56 A;  1L9C A;  4P9S A;  2GR2 A;  4B1B A;  3QN3 A;  2XVH A;  4IVM B;  1AOG A;  5JCK A;  3B9J B;  3ICS A;  4N9X A;  4JN7 A;  3S47 A;  1LPF A;  4EM3 A;  1GT8 A;  2WDR A;  3GY1 A;  3SBF A;  5FJT A;  4YSZ A;  3N4E A;  3SZC A;  1MUC A;  1SJC A;  2V3A A;  3FMW A;  2GAG B;  1KNP A;  3DG3 A;  2R4J A;  3T2K A;  2DW7 A;  4HNL A;  4HCL A;  1F9C A;  1ELI A;  2YR6 A;  4J1O A;  2OVL A;  4CBQ A;  5C2T A;  2QQ6 A;  4G74 A;  4U2S A;  4LA1 A;  4CNK A;  4LU6 A;  4CY8 A;  2XYO A;  3N6H A;  4YSX A;  4E4F A;  4X9N A;  4AOS A;  2XSX A;  3UCD A;  2QVH A;  3S5W A;  2F5Z A;  1KNR A;  2XLU A;  4J36 A;  1F3P A;  3R11 A;  4D03 A;  2C3C A;  5U63 A;  3BHF A;  2ZAD A;  1JRO A;  2POZ A;  4B66 A;  3BHK A;  2C75 A;  2XH7 A;  1Q1W A;  1H6V A;  2PPG A;  3EF6 A;  3CNS A;  2XFN A;  4K5S A;  1D4C A;  1DJN A;  1B8S A;  2E1M A;  4FK1 C;  3AD9 B;  3NS1 B;  4TVY A;  4X4J A;  3QPE A;  1NEK A;  2YM2 A;  2H89 A;  2V6O A;  1NHQ A;  3CGB A;  2X99 A;  2X50 A;  3CXO A;  3VA8 A;  3VR8 A;  3TJ4 A;  4A99 A;  1KD0 A;  2ZBW A;  3B3R A;  1N5W C;  1ZKQ A;  3H8I A;  4IL0 A;  2P3Z A;  4E5T A;  3CTY A;  3JZU A;  1GRG A;  1S2Q A;  3QSS A;  3AE2 A;  3M0O A;  3RP6 A;  2E5V A;  1TYT A;  1L9E A;  2AAQ A;  4EQS A;  4GGH A;  3EAO A;  3ZVI A;  2WOI A;  1NEN A;  1VQW A;  4OPL A;  1RP0 A;  3GWF A;  4Z26 A;  1PJ5 A;  1CHU A;  3RIT A;  2OO6 A;  3RRA A;  5HYM A;  5LV9 A;  5EB4 A;  3NKS A;  3MWC A;  4GAP A;  1VQZ A;  5HHF A;  3OPS A;  3DJJ A;  4FK1 A;  3NK0 X;  2A89 A;  4IA6 A;  3P1W A;  4O5Q A;  1S3E A;  2PU0 A;  1BGJ A;  3Q9T A;  2WS3 A;  2JK6 A;  1KCZ A;  4TM4 A;  2YQU A;  3UJE A;  1UKV G;  4U8K A;  2XFU A;  1XPQ A;  2A87 A;  1ZK7 A;  3UP4 A;  4TVW A;  2PMQ A;  1IYX A;  2BA9 A;  4YKG A;  3AEA A;  4GF7 A;  4GAV A;  2BK3 A;  4K8D A;  1ZOV A;  4GIS A;  3ATR A;  2WPF A;  3CIR A;  4MJW A;  3V3W A;  5FJP A;  3SGL A;  3GD3 A;  3HYV A;  2QDE A;  4J3Z A;  3DJG X;  1VG9 A;  2HXT A;  3I4K A;  2V5Z A;  4GGB A;  1SJB A;  3DK8 A;  3RR1 A;  3CGE A;  1VDC A;  4U8L A;  3SFD A;  5KOW A;  2V61 A;  3I6T A;  5JCI A;  2C3D A;  3VR9 A;  4YKF A;  2CVJ A;  5BOF A;  3N4F A;  4REK A;  4AP1 A;  4KPR A;  2C7G A;  3OC4 A;  4E8G A;  4H4Y A;  3QVP A;  3UOY A;  1NEL A;  2AL1 A;  1N63 C;  2EQ7 A;  2YAU A;  4UDR A;  2X8H A;  3MZN A;  2JB3 A;  4OPT A;  3AE3 A;  4Z1Y A;  1F6M A;  2WES A;  1CJ3 A;  1ZMC A;  1HYU A;  1MNS A;  4OPC A;  1SB3 B;  3MSY A;  4NTE A;  3NFU A;  1PJ6 A;  2EQ6 A;  4C3X A;  2I5Q A;  5JCN A;  1JRZ A;  3K7Q X;  2WU5 A;  4EIP A;  4KWS A;  3RO6 A;  3THU A;  3H8A A;  4XXG A;  4H4R A;  2QCU A;  1MXT A;  6ENL A;  4JNA A;  3DFH A;  4A3R A;  1GOS A;  1GTE A;  2YLT A;  4APN A;  3ES8 A;  4H2H A;  3NT6 A;  2C65 A;  2APG A;  3QSE A;  3QKE A;  4ZCC A;  3AE4 A;  2R4E A;  1S7M A;  5C3J A;  5IPY A;  1L9D A;  1ECQ A;  3ZDN A;  1ZDL A;  4TM3 A;  3NXL A;  2HQM A;  2H88 A;  4A6N A;  2GVC A;  2Z5Y A;  2WOW A;  3H7V A;  3OW1 A;  1L0V A;  2B7R A;  3SY4 A;  2OX4 A;  1DOE A;  1STZ A;  2ACZ A;  3BSM A;  2MNR A;  1DNC A;  3UOX A;  2GQF A;  3D8X A;  1S3B A;  3K7T A;  3PO7 A;  4YTM A;  2VQ7 A;  4KT2 A;  3N6J A;  4YXD A;  3HYW A;  3UTG A;  1DJQ A;  2ARD A;  1N61 C;  3NLC A;  4GDE A;  4H4U A;  3DGB A;  2GSH A;  1OJC A;  4FX9 A;  1PBD A;  1N4V A;  3AE7 A;  4B67 A;  5EU9 A;  3SSZ A;  3UKP A;  1QJD A;  1S2Y A;  4GYP C;  1ZX9 A;  3T2Y A;  2P88 A;  1D4E A;  1OJ9 A;  1NU5 A;  2PTY A;  3R25 A;  2XLP A;  2YLZ A;  3ALL A;  4IP4 A;  3KLJ A;  1CBO A;  2AKM A;  2AQJ A;  2YG5 A;  3SZW A;  4CCR A;  4H1Z A;  2O56 A;  3TTE A;  1E39 A;  1P2H A;  4O5U A;  2V3B A;  3OZ2 A;  3NTA A;  3SR6 B;  3UOZ A;  1PDH A;  4M6U A;  1KF6 A;  1P2E A;  2PCE A;  2P8B A;  3JVA A;  3NN6 X;  2NQL A;  1K0J A;  2YR4 A;  2GGE A;  2R0G A;  1B37 A;  1FEB A;  4J34 A;  4WX1 A;  1PBC A;  1JNR A;  1BKW A;  4H2N A;  4ADW A;  1V59 A;  1GRF A;  3UTF A;  4DSH A;  3R9U A;  3MQT A;  2YG3 A;  1W4X A;  2PTZ A;  2R0P A;  1CL0 A;  1TZZ A;  3GDN A;  4Y4N A;  4NEV A;  5U25 A;  3EUB 3;  1YQ3 A;  1N62 C;  5IQ1 A;  4Z44 A;  2FYM A;  3CYJ A;  5FS7 A;  4ZOH B;  3GDP A;  1N60 C;  5CQF A;  1ZY8 A;  4RG3 A;  4G9K A;  3TWA A;  4Z43 A;  4DHG A;  2C73 A;  2JB2 A;  1BWC A;  3F8R A;  3SM8 A;  3NRZ B;  1XHC A;  2XVJ A;  3VFC A;  4B68 A;  1H2I A;  1ZP0 A;  4EM4 A;  3IWA A;  2C76 A;  1FEA A;  1LV0 A;  4K2X A;  3DEQ A;  2C4C A;  1GES A;  2NVK X;  1JDF A;  4A35 A;  1Q9I A;  2C66 A;  5FMH A;  5FS9 A;  2X3N A;  2RGJ A;  3KD9 A;  2UZZ A;  2PP3 A;  1MDL A;  2VOU A;  5CKU A;  4NTC A;  3P0W A;  2GGJ A;  3ETR B;  1ELS A;  3TCS A;  4X9M A;  1PHH A;  1OJT A;  2Q0L A;  3DA1 A;  3UTH A;  1GND A;  4II3 A;  3QTP A;  4I59 A;  2GF3 A;  3GO2 A;  3R0U A;  1TDO A;  5GSN A;  3FIM B;  4ZCW A;  4C74 A;  1RSG A;  2AR8 A;  1JRX A;  2WBA A;  2Q0K A;  5L46 A;  3PFR A;  2C67 A;  3AB1 A;  3VRD B;  2HZG A;  2W0H A;  4U8N A;  2BXR A;  1H7X A;  2PSN A;  3GD4 A;  2WU2 A;  2BAB A;  1NG3 A;  1H82 A;  4HN8 A;  3PWG A;  5ER0 A;  3KPF A;  5KXJ A;  4MKS A;  1EC7 A;  3GD6 A;  2Z5X A;  5KMR A;  4M0X A;  1KKO A;  2OLA A;  3UCC A;  4UP3 A;  3IK4 A;  1LQT A;  2B7S A;  4NNJ A;  4JQ9 A;  2FBW A;  3D1C A;  2GRT A;  4FI4 A;  2B9Y A;  4EQW A;  3C4A A;  4B64 A;  1LVL A;  2DW6 A;  3BI2 A;  3GRS A;  4MGG A;  3H4K A;  1JU2 A;  1JRP A;  4G7F A;  3P4S A;  3RNM A;  1DTN A;  3AD7 B;  4YTP A;  7ENL A;  4D04 A;  2PU1 A;  1REO A;  2XH2 A;  4H19 A;  1X2H A;  2VVL A;  4ENL A;  1P48 A;  5FS6 A;  3ZVH B;  4FDC B;  1SEZ A;  3TWB A;  2WP9 A;  2GR1 A;  3PK7 A; 
#chains in the Genus database with same CATH homology
 4NZH A;  2WPE A;  1PXA A;  3S61 A;  2WEU A;  3OC4 A;  4RG4 A;  2XLR A;  4H4Y A;  1N4W A;  2OA1 A;  2R0C A;  3G5Q A;  3P4R A;  4TLX A;  2OLN A;  4OPI A;  3FPZ A;  4BUR A;  3QVP A;  4GCM A;  2WET A;  4J2W A;  2GR3 A;  3UOY A;  4U2T A;  2B9X A;  2YG6 A;  4HB9 A;  4B63 A;  2EQ7 A;  2YAU A;  4UDR A;  4Z2T A;  2X8H A;  2JB3 A;  4OPT A;  3AE3 A;  3DK4 A;  4H4Q A;  1F6M A;  4BK3 A;  5KOX A;  2WES A;  1E1K A;  2BXS A;  1Q1R A;  1CJ3 A;  1ZMC A;  3VRA A;  3COX A;  1JOA A;  1GRB A;  2TPR A;  1HYU A;  2E4G A;  2WQY A;  3JSK A;  3IHG A;  4OPC A;  2GEW A;  3NGC X;  3AEE A;  3V76 A;  2C64 A;  2I0Z A;  1EBD A;  1Y0P A;  2XVE A;  3AD8 B;  1B5Q A;  4NTE A;  3UKF A;  4BJY A;  1D7Y A;  2EQ8 A;  5EBK A;  3AEG A;  5KMS A;  2Q7V A;  5KWF A;  1OJA A;  2RGH A;  4M52 A;  3AYJ A;  3NRN A;  1PJ6 A;  2EQ6 A;  1VRQ B;  3URH A;  4C3X A;  3GWD A;  2CDU A;  5JCN A;  1N4U A;  2XFO A;  1JRZ A;  2RGO A;  3K7Q X;  1O5W A;  2IVD A;  3UKH A;  2WU5 A;  4EQX A;  4USQ A;  4AT0 A;  1PJ7 A;  3V3N A;  4YT0 A;  4EIP A;  3ISH A;  2WHD A;  4OPG A;  4U8J A;  3SYI A;  1TDN A;  2OLO A;  2BYB A;  2YWL A;  3GMB A;  4I58 A;  4XXG A;  1KSU A;  1QO8 A;  3WE0 A;  2NPX A;  4H4R A;  2QCU A;  3T0K A;  1NG4 A;  1MXT A;  3SZ0 A;  4C77 A;  1D5T A;  4K22 A;  4OPU A;  1EL9 A;  1IUX A;  1PXB A;  4JNA A;  5KMQ A;  3AE9 A;  2BRA A;  1XAN A;  4IVO B;  1GOS A;  1GTE A;  2YLT A;  4APN A;  3QFB A;  3AE5 A;  1E1M A;  4DGK A;  2X8C A;  3LOV A;  1IUW A;  3NT6 A;  1BGN A;  2C65 A;  2JKC A;  2APG A;  3PVC A;  3KKJ A;  3QSE A;  4ZCC A;  4EMJ A;  3AE4 A;  4K5R A;  3UKA A;  1EL8 A;  2R4E A;  2GQW A;  1S7M A;  5C3J A;  5IPY A;  1BF3 A;  1OJD A;  1L9D A;  2QA2 A;  3HZL A;  4H2Q A;  1PN0 A;  3ZDN A;  1ZDL A;  1H84 A;  3DJE A;  4A5L A;  2YG4 A;  1O95 A;  4U8P A;  5DBJ A;  2XVI A;  3UCL A;  4TM3 A;  5KRQ A;  1D4D A;  2HQM A;  2H88 A;  3T37 A;  4CY6 A;  4WCT A;  4A6N A;  4TM1 A;  2GVC A;  2Z5Y A;  3GYX A;  3ABV A;  3RP8 A;  2WOW A;  1DOB A;  1TDE A;  3ATQ A;  1KFY A;  3CMM A;  2VVM A;  1L0V A;  3AE1 A;  2YR5 A;  4BJZ A;  2B7R A;  3LJP A;  2EQ9 A;  3O0H A;  3SY4 A;  3VQR A;  5GRT A;  4HA6 A;  1XDI A;  1GV4 A;  1DOE A;  4GRT A;  3I6D A;  4BV6 A;  2BK5 A;  1Z6L A;  1LQU A;  2ACZ A;  3L8K A;  1DNC A;  3HYX A;  3UOX A;  2GQF A;  2ZZ0 A;  3ALM A;  1LJ1 A;  1MO9 A;  2BRY A;  3D8X A;  3KPK A;  1S3B A;  3K7T A;  3PO7 A;  4YTM A;  2VQ7 A;  4DSG A;  4EIQ A;  1GRA A;  2DKH A;  1M64 A;  1GSN A;  2FJA A;  2OAM A;  3CPI G;  3HYW A;  3UTG A;  1DJQ A;  3AXB A;  2BK4 A;  4CNJ A;  3LZX A;  2ARD A;  4YXD A;  1H7W A;  4U8O A;  2BS2 A;  3EPT A;  1TDK A;  1NHS A;  2Y6Q A;  4E0V A;  3NLC A;  4GDE A;  4NWZ A;  2GR0 A;  1CC4 A;  4H4U A;  2FJE A;  2Y6R A;  2BC0 A;  1OJC A;  1PBE A;  2GMJ A;  3BNU A;  4H4X A;  1NHP A;  2R45 A;  3FBS A;  3KA7 A;  4FX9 A;  1PBD A;  1N4V A;  3LZW A;  3AE7 A;  4B67 A;  3NH3 X;  4II2 A;  2OAL A;  3AWI A;  2C72 A;  3GYI A;  4Z2U A;  3QSM A;  4XWZ A;  3NK2 X;  4KX6 A;  4Y4L A;  3AE8 A;  3UKP A;  3M12 A;  1PS9 A;  4U8I A;  1QJD A;  5J60 A;  1S2Y A;  1PBF A;  1BZL A;  2QA1 A;  1ZX9 A;  3T2Y A;  4H4T A;  1D4E A;  5BRT A;  2WP5 A;  3DH9 A;  4H2P A;  2WP6 A;  1O94 A;  3UP5 A;  1OJ9 A;  4G6H A;  3ZYX A;  1LTX R;  4USR A;  4B65 A;  1GRH A;  3CPJ G;  2XLP A;  2YLZ A;  1GET A;  3AE6 A;  3ALL A;  5BUK A;  3GMC A;  3L1R A;  1GEU A;  2WDV A;  4A6N B;  4CRT A;  3AEC A;  3NYE A;  3KLJ A;  5M0Z A;  1CBO A;  2AQJ A;  2X8G A;  3GSI A;  5KVH A;  1NDA A;  2YG5 A;  3SZW A;  3UKK A;  1IUU A;  1Y56 A;  1L9C A;  4P9S A;  2GR2 A;  4B1B A;  4CCR A;  2XVH A;  4IVM B;  4H4S A;  1AOG A;  1VG0 A;  2VZ2 A;  4ZCD A;  4JN9 A;  1E39 A;  1P2H A;  4O5U A;  2V3B A;  3OZ2 A;  1JRY A;  5JCK A;  4C5O A;  3ICS A;  4N9X A;  3QVR A;  3NTA A;  1EL5 A;  4OVI A;  2IID A;  4J56 A;  4GUV A;  3UOZ A;  2FJB A;  3BI4 A;  3D1C A;  4AT2 A;  3E1T A;  1LPF A;  4UDQ A;  4EM3 A;  1PDH A;  1GT8 A;  2WDR A;  3AED A;  1B4V A;  3M13 A;  4OPD A;  5BVA A;  4YSZ A;  1KF6 A;  1P2E A;  3SZC A;  3T2Z A;  3K30 A;  3NN6 X;  1K0J A;  3G5S A;  3P4P A;  4K7Z A;  2YM1 A;  2YR4 A;  4Z2R A;  2R0G A;  1B37 A;  4A7A A;  1FEB A;  4J34 A;  5HXI A;  2V3A A;  3FMW A;  4YSH A;  3IC9 A;  4DNA A;  2GAG B;  1KNP A;  2JB1 A;  2VRL A;  3KU9 A;  4NTD A;  4WX1 A;  2O9Z A;  2Q6U A;  1PBC A;  3NHO X;  4OCG A;  2BS3 A;  2PHH A;  2R4J A;  2GB0 A;  3T2K A;  3SQP A;  1JNR A;  1BKW A;  3Q6J A;  1GPE A;  4H2N A;  1TDF A;  4ADW A;  1ELI A;  3NK1 X;  3NTD A;  1V59 A;  2YR6 A;  3AEF A;  4EMI A;  4CBQ A;  5C2T A;  2TMD A;  1IUT A;  2GAH B;  1GRF A;  3UTF A;  4DSH A;  4G74 A;  3LB8 A;  3R9U A;  3SZF A;  4U2S A;  4LA1 A;  2YG3 A;  4BK1 A;  4CNK A;  1W4X A;  2GMH A;  3G5R A;  3BI5 A;  2R0P A;  1CL0 A;  2R46 A;  4LU6 A;  3CNP A;  3ICR A;  4CY8 A;  2XYO A;  1FCD A;  1F8R A;  3GDN A;  2YLS A;  4Y4N A;  4UDP A;  4YSX A;  4NEV A;  3DK9 A;  4X9N A;  4AOS A;  4Z25 A;  2R9Z A;  5TR3 A;  5U25 A;  2WPC A;  4A79 A;  4H4W A;  3QFA A;  1CC6 A;  4H50 A;  1YQ3 A;  2XLT A;  5IQ1 A;  4Z44 A;  1ZMD A;  5FS7 A;  3NG7 X;  3GDP A;  4A9W A;  5CQF A;  3RED A;  3C4N A;  3S5W A;  2F5Z A;  4B69 A;  1ZY8 A;  1KNR A;  3F8P A;  4RG3 A;  1Y56 B;  2XLU A;  4G9K A;  4J36 A;  1KN0 A;  2BCG G;  3I3L A;  4Z43 A;  3NYC A;  1F3P A;  2WOV A;  2JBV A;  1KSS A;  4H4V A;  1H86 A;  2C73 A;  4D03 A;  2JB2 A;  1BWC A;  3F8R A;  2YLR A;  2C3C A;  3SM8 A;  1IUS A;  5U63 A;  1XHC A;  1ONF A;  3LAD A;  2XVJ A;  3BHF A;  5KMP A;  4YWO A;  4B66 A;  3BHK A;  2RAB A;  1H83 A;  1FEC A;  2C75 A;  3PS9 A;  4B68 A;  1YQZ A;  1Q1W A;  2WDQ A;  1H6V A;  1KDG A;  3IF9 A;  3EF6 A;  1H2I A;  1ZP0 A;  1K0L A;  2YG7 A;  3CNS A;  1PBB A;  2XFN A;  4EM4 A;  1D4C A;  4K5S A;  1DJN A;  2DKI A;  3IWA A;  1B8S A;  3PG6 A;  2E1M A;  2JAE A;  3AYL A;  3ICT A;  1E1N A;  2C76 A;  3UKL A;  1FEA A;  4H4P A;  1LV0 A;  3AD9 B;  4FK1 C;  2V60 A;  4K2X A;  3RHA A;  5HY5 A;  1IJH A;  4U2L A;  3DME A;  2C4C A;  1GES A;  2NVK X;  3ITJ A;  1CC2 A;  1Q9I A;  4X4J A;  2C66 A;  4NEW A;  1NEK A;  2YM2 A;  5FMH A;  2H89 A;  2V6O A;  4H4Z A;  1NHQ A;  3CNJ A;  5FS9 A;  2BS4 A;  2BCP A;  4JY2 A;  2X3N A;  3CGB A;  1GRE A;  2X99 A;  2X50 A;  1FOH A;  1DOC A;  1NPX A;  2RGJ A;  2UZZ A;  3KD9 A;  4PAA A;  3VR8 A;  3L5O A;  3AEB A;  4A99 A;  2VOU A;  2ZBW A;  3B3R A;  2YLW A;  5CKU A;  4NTC A;  1ZKQ A;  3H8I A;  1F8S A;  4H7U A;  1CJ4 A;  3ALJ A;  2VQB A;  4ECH A;  3CTY A;  3DJD A;  1GRG A;  4Y4M A;  3II4 A;  1S2Q A;  3QSS A;  3SX6 A;  1E1L A;  5JRB A;  2GH5 A;  3AE2 A;  2C7G A;  3SXI A;  3M0O A;  1IUV A;  3RP6 A;  2E5V A;  4X9M A;  1YKJ A;  1TYT A;  1L9E A;  1PHH A;  1OJT A;  2AAQ A;  4EQS A;  2Q0L A;  3DA1 A;  3UKQ A;  3UTH A;  1DOD A;  4RSL A;  3UTE A;  1GND A;  4EQR A;  5BUL A;  3EAO A;  4II3 A;  2WOI A;  4JNQ A;  1DXL A;  1NEN A;  2XVF A;  3P4Q A;  1VQW A;  2BAC A;  2BC1 A;  3NNE A;  1RP0 A;  2YVF A;  3GWF A;  4OPL A;  3V3O A;  4I59 A;  4Z26 A;  2GF3 A;  1PJ5 A;  1CHU A;  3C96 A;  5KVI A;  1CJC A;  5HYM A;  3T14 A;  1TDO A;  5JCL A;  5LV9 A;  1E7P A;  1TRB A;  5GSN A;  5EB4 A;  3CNT A;  1D7L A;  3FIM B;  1TYP A;  4J33 A;  3NKS A;  4G73 A;  2XFQ A;  1YY5 A;  4AP3 A;  4GAP A;  5KNL A;  3QJ4 A;  4C74 A;  1M6I A;  5HHF A;  3DJJ A;  4FK1 A;  3NK0 X;  4J31 A;  2A89 A;  4U8M A;  1GAL A;  4IA5 A;  4IA6 A;  1RSG A;  5J7X A;  4H2R A;  2AR8 A;  3P1W A;  1JRX A;  4GR1 A;  1S3E A;  4O5Q A;  2WBA A;  4YTN A;  2Q0K A;  4CCQ A;  1GRT A;  5L46 A;  2C67 A;  4YSY A;  3AB1 A;  1BGJ A;  3Q9T A;  2GV8 A;  4GDP A;  3VRD B;  4IV9 A;  2WS3 A;  4U8N A;  2JK6 A;  2W0H A;  4TM4 A;  1K4Q A;  2YQU A;  1CF3 A;  2C70 A;  2BXR A;  2B9W A;  1K0I A;  1H7X A;  1COY A;  1MOK A;  1UKV G;  5EB5 A;  4U8K A;  5U1O A;  3UOV A;  3GD4 A;  3D9X A;  1NAA A;  1F8W A;  4JDR A;  2WU2 A;  2BAB A;  1YQ4 A;  1NG3 A;  3K7M X;  5IQ4 A;  5JCM A;  1PXC A;  1RYI A;  1JEH A;  1H82 A;  4JY3 A;  2XFU A;  1GXF A;  2CFY A;  4BK2 A;  1GER A;  1XPQ A;  2A87 A;  5ER0 A;  1ZK7 A;  3UP4 A;  3KPF A;  5KXJ A;  2BA9 A;  2Z5X A;  3NYF A;  4YKG A;  3AEA A;  2QAE A;  2XFP A;  2XLS A;  4GF7 A;  5KMR A;  4UP3 A;  4GAV A;  3IHM A;  4PAB A;  2BK3 A;  4K8D A;  1EL7 A;  1ZOV A;  4Z24 A;  1LQT A;  2B7S A;  2YLX A;  3KVE A;  4NNJ A;  4G6G A;  4JQ9 A;  3RP7 A;  2YVJ A;  2FBW A;  3B6D A;  2GRT A;  3GRT A;  3ATR A;  2B9Y A;  4EQW A;  3DGZ A;  2FJD A;  2WPF A;  3C4A A;  3CIR A;  3T31 A;  4EMW A;  1LVL A;  3AYI A;  4MJW A;  2ZZB A;  4AOX A;  4B64 A;  2XCG A;  3BI2 A;  3GRS A;  3SGL A;  3H8L A;  3NIX A;  4A65 A;  3H4K A;  3CPH G;  5FS8 A;  1X31 B;  1JU2 A;  2ZZC A;  1NHR A;  3GD3 A;  2A8X A;  2VRM A;  3HYV A;  3VRB A;  4TM0 A;  3P9U A;  1GTH A;  5M10 A;  3GYJ A;  3DGH A;  2VVL G;  3NN0 X;  3P4S A;  4ZN0 A;  3DJG X;  3RNM A;  1VG9 A;  4ICY A;  1JNZ A;  3BNM A;  4LII A;  1CJ2 A;  2B76 A;  2V5Z A;  3AD7 B;  4YTP A;  1ZOY A;  3LXD A;  3DK8 A;  2CUL A;  3SFE A;  3CGE A;  1VDC A;  1E6E A;  1H81 A;  4U8L A;  4C3Y A;  4D04 A;  3SFD A;  1REO A;  5EOW A;  4J57 A;  5KOW A;  2V61 A;  2IVE A;  2VVL A;  3ADA B;  5JCI A;  2C3D A;  5FS6 A;  3CND A;  3CN8 A;  3F8D A;  4FDC B;  3CGD A;  3VR9 A;  1SEZ A;  3EAN A;  4TLZ A;  4XWR A;  4YKF A;  2CVJ A;  2XDO A;  2YVG A;  2WP9 A;  4REK A;  2PYX A;  4AP1 A;  1QLB A;  4KPR A;  1N1P A;  1FL2 A;  3CGC A;  3FG2 P;  2GR1 A;  2J3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...