2NPXA

Nadh binding site and catalysis of nadh peroxidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title NADH binding site and catalysis of NADH peroxidase.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
total genus 139
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1992-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2npxA02
4CCRA 4TLZA 2XLRA 2FJBA 2Q0KA 4H4VA 3C4AA 3Q9TA 2XVEA 2X50A 4CNJA 4H4YA 1GT8A 3AYIA 5CKUA 1MOKA 2XLPA 3M0OA 4J2WA 4Y4LA 5FMHA 3ZYXA 5LV9A 5JCNA 1YY5A 2VQBA 2WP9A 3FMWA 4JY3A 2BS3A 4YTMA 3AEEA 3CIRA 5KVIA 4H2QA 4J31A 2RABA 1TDEA 4UDPA 3V3OA 3VR9A 1E7PA 3PO7A 4AT2A 4C77A 1JRXA 1GETA 1D7YA 4B69A 4UDQA 1NEKA 4JQ9A 4K7ZA 2OALA 4APNA 1EL7A 2WEUA 2XLTA 3NG7X 3KVEA 4E0VA 3GRSA 3DJJA 4Z2RA 4CCQA 4C3YA 3NYEA 4A6NA 1MXTA 4IA5A 1L0VA 1NDAA 4GDPA 2OAMA 5HYMA 3QVPA 2WPEA 3ATRA 4U2SA 2BXSA 5U63A 3CTYA 3FG2P 5U1OA 1MO9A 2GH5A 2BC0A 2YAUA 3M12A 3RHAA 4GF7A 2HQMA 1DODA 1GRHA 2FJEA 4WCTA 1BGNA 1S2YA 3II4A 3BI5A 3CPIG 3IHMA 2XLUA 2YR6A 2W0HA 2EQ9A 2E5VA 3NH3X 4O5QA 4U8IA 3SGLA 4Z43A 1BZLA 3K30A 1EL9A 2AR8A 4H2NA 2WP6A 2RGHA 4BJYA 5JCLA 1Y56B 4YXDA 3LB8A 2A89A 1TDKA 1BKWA 3ALLA 2BXRA 2QA2A 5FS7A 1K4QA 4FDCB 2OA1A 3UKAA 4YKFA 3VRBA 5IQ4A 1D4DA 2V5ZA 1NG4A 4FK1C 1CL0A 2GB0A 1FEBA 2GQWA 2GRTA 2YVJA 1CC2A 4H4WA 4TM1A 2R45A 3CNSA 5JCKA 2UZZA 4H2PA 2Y6QA 3G5RA 5BVAA 1KSUA 4OPDA 1OJDA 4UP3A 4ECHA 1PDHA 2WDVA 2YG4A 1DJNA 3GD4A 5KWFA 3LOVA 3UKPA 2C72A 3UKLA 3ALJA 1ZX9A 2FBWA 4NTCA 5FS9A 1GTHA 1QJDA 5KXJA 2V60A 4X4JA 1E1LA 4AP3A 1PXBA 1DOEA 1K0IA 3CGDA 2IVEA 3BI4A 4Y4MA 2X99A 4EIQA 1OJTA 3NK1X 1S2QA 1F3PA 1H81A 1ZOVA 3O0HA 4PAAA 3NK0X 1N4WA 4B1BA 3KD9A 4J36A 3D1CA 1TDFA 1BF3A 1E39A 3UTHA 5TR3A 2C70A 4NTDA 4JNAA 2RGOA 1E6EA 1FCDA 1PS9A 2WHDA 2V61A 4LIIA 2ZZBA 3UKKA 2F5ZA 2YG7A 3DGHA 4B66A 3LZWA 2AAQA 3AB1A 4GDEA 4OPCA 2X8HA 2DKIA 4U8LA 1GRTA 3V3NA 3KLJA 3NYFA 4WX1A 1KSSA 2JAEA 2ACZA 5J60A 2E1MA 4RG3A 2C75A 3AE1A 3NN6X 4AOSA 1KF6A 1GRGA 3DGZA 1HYUA 3EAOA 3P9UA 3BNUA 2XCGA 2YLRA 3AE7A 4Z25A 4I59A 3VRAA 2EQ6A 4H4RA 1YQZA 3EPTA 4K22A 2A87A 4U8KA 1EL8A 4CRTA 5EBKA 2C76A 2Q7VA 1GEUA 1XHCA 1CHUA 1OJAA 1Z6LA 3CNDA 3NTAA 4K2XA 2EQ8A 4C74A 2APGA 5ER0A 4YSXA 2B7RA 4IVMB 4BK1A 2BS2A 1S3BA 1XPQA 1K0JA 2C65A 5C3JA 3UTEA 4A99A 2AQJA 1FOHA 4REKA 3SQPA 3AD8B 2Z5XA 2WOIA 4DSHA 2GAHB 1YQ3A 2TPRA 2IVDA 1XDIA 1LVLA 1BGJA 3ISHA 5M0ZA 1H6VA 3B3RA 2R0CA 2VRLA 1JEHA 3CNTA 3E1TA 2RGJA 2VQ7A 5GRTA 1KFYA 2XLSA 3C4NA 3DJGX 1LQTA 2X8GA 1H83A 1TRBA 2XYOA 3DA1A 4RG4A 4LU6A 1EBDA 1IUUA 3GWFA 2GEWA 1OJ9A 4JY2A 3UOVA 4B67A 4J33A 4TM0A 3SM8A 2XFQA 4YSZA 3NK2X 3UKQA 3DK9A 5IPYA 2C73A 3AEGA 1H84A 3EF6A 3RP6A 2WOWA 4O5UA 4U8NA 3DH9A 3GMBA 2C3CA 4EQRA 3BI2A 1ZDLA 4C3XA 3G5SA 1RSGA 3EANA 4B65A 2XVHA 4YWOA 3RNMA 2R4JA 3ABVA 3IF9A 1COYA 1GREA 1P2HA 1QO8A 3REDA 1YQ4A 2YLWA 3BNMA 2Z5YA 4YSYA 3LXDA 1IUXA 3CNPA 4B63A 5FS6A 3HZLA 1JRYA 4KX6A 1DXLA 3UOYA 1N1PA 1PJ5A 2CVJA 3AYLA 5BRTA 2CULA 1RYIA 3F8RA 3D8XA 3CPJG 2XDOA 3QSMA 3UTGA 2GR1A 4DGKA 4YSHA 3AE5A 1O94A 1PBEA 2YG5A 4OVIA 3UKHA 2BK5A 2BC1A 3UTFA 4EIPA 1F8RA 5U25A 3I6DA 4XWRA 4BV6A 2WDQA 2XFUA 2XVJA 1VRQB 3AE3A 3G5QA 3QSEA 3P1WA 3UCLA 1NG3A 3BHKA 4Y4NA 4J56A 1DNCA 1M64A 1VQWA 4BK2A 4M52A 1Y56A 1P2EA 3GMCA 3SFEA 4TM3A 2V3BA 2XFNA 2ZZCA 1PJ7A 3P4RA 1CC6A 4MJWA 2WOVA 3VR8A 3NHOX 3S61A 1QLBA 2C66A 3AE4A 3GSIA 4NEWA 3WE0A 1NHSA 2GVCA 1Q9IA 1DJQA 2FJDA 2V6OA 3ICRA 4H4QA 2WQYA 3DK4A 3NT6A 3S5WA 4USRA 2YQUA 1K0LA 1PJ6A 3AYJA 3CGBA 2BABA 2WDRA 3AEFA 4EM4A 2VZ2A 2XFOA 3NKSA 1ZK7A 2OLOA 1Q1WA 3ITJA 4ZCDA 4DSGA 1F8WA 2JB2A 3CPHG 4I58A 2B9YA 3CGCA 3V76A 2X3NA 3AECA 4EM3A 1PXCA 1S3EA 5EB5A 4A7AA 4B68A 1IUTA 4YT0A 1PBFA 4FX9A 3NIXA 4K5SA 2GMJA 2YLZA 2H89A 4KPRA 4U8PA 4H2RA 3C96A 3PS9A 1L9EA 2H88A 4P9SA 4HB9A 2WPCA 1PHHA 2BCPA 2C64A 5GSNA 3VRDB 4CY6A 2WPFA 1N4VA 4OPTA 4AOXA 2C7GA 2VVLA 4LA1A 2B9WA 3GDPA 1YKJA 4GRTA 4BJZA 1IUWA 4OPUA 1GOSA 4BURA 2ZZ0A 2EQ7A 1BWCA 3B6DA 2R4EA 3RP8A 4XWZA 5JCMA 2Q0LA 2C3DA 3R9UA 2GR3A 2X8CA 4NEVA 3RP7A 2YM1A 2TMDA 4RSLA 5KOWA 3Q6JA 3GDNA 4CY8A 1PBDA 3VQRA 4A5LA 2YWLA 5CQFA 1CJCA 3P4SA 1E1MA 4DNAA 2B76A 4H4SA 3IWAA 3FPZA 5BUKA 2IIDA 3AE6A 4GR1A 5FS8A 1D7LA 3QVRA 1L9DA 3AEAA 2WESA 1VDCA 4Z24A 4U8OA 5DBJA 3UKFA 2BCGG 3AE9A 2C67A 1ZOYA 1GALA 1FEAA 4JNQA 4C5OA 4YTPA 1OJCA 1NENA 5HXIA 3QFBA 4H50A 5KOXA 4OCGA 4GUVA 4H4UA 4GCMA 3NTDA 2WS3A 4ADWA 1UKVG 1AOGA 1ZMCA 4EMWA 2I0ZA 4A6NB 1DOBA 1ZKQA 4H4PA 4EQXA 2BK4A 1ELIA 2CFYA 2YLXA 1NHQA 1XANA 1E1KA 1LV0A 3AEDA 3ATQA 5C2TA 3NRNA 3AD7B 3K7MX 3AD9B 5EOWA 4H7UA 4AT0A 3K7TA 1O95A 1FL2A 1LQUA 1TDNA 3DJEA 3F8DA 3K7QX 2R0GA 3KU9A 4A65A 1TDOA 4USQA 1CJ3A 4EMJA 3DMEA 1W4XA 1CJ2A 2OLNA 3H4KA 1CBOA 3UP5A 2YG3A 5M10A 4YKGA 1TYTA 2QCUA 2XVFA 3ZDNA 3ALMA 4Z44A 3GD3A 1GRBA 1PBBA 2PHHA 2V3AA 1IUSA 1H7XA 2YLTA 2GMHA 3DJDA 4Z2UA 3IC9A 1F6MA 2CDUA 2GR0A 3NLCA 4OPLA 1L9CA 2A8XA 4EMIA 2BACA 2DKHA 2VVLG 2VOUA 1O5WA 1X31B 2WETA 3M13A 3NNEA 4Z2TA 3GRTA 4H4TA 1ZY8A 4D03A 1Q1RA 1H82A 2QAEA 4H4ZA 1GPEA 1ZP0A 2ARDA 1D5TA 1N4UA 3ICTA 1IUVA 3ICSA 1TYPA 2O9ZA 3NN0X 3CNJA 1ZMDA 1KNRA 1D4EA 4CNKA 1B37A 3COXA 5J7XA 1B8SA 4ZN0A 4CBQA 2YR5A 1JRZA 1NHPA 1VG0A 5L46A 3L8KA 3CN8A 4K8DA 2YG6A 3QSSA 2R46A 1NAAA 2VRMA 3PVCA 3JSKA 2JB1A 3KKJA 2QA1A 4Z26A 3QFAA 2YVFA 5KRQA 4FK1A 2JK6A 3LADA 3NGCX 3URHA 1EL5A 3KPFA 5HY5A 1GSNA 3CGEA 4U8JA 2JBVA 1GRFA 1H7WA 3ADAB 3GYJA 3OZ2A 4OPGA 1DOCA 1LJ1A 4ZCCA 3FIMB 2YLSA 2XFPA 4IV9A 3UOXA 4J57A 3P4QA 1REOA 1E1NA 4JN9A 2VVMA 3UOZA 1GERA 4ICYA 2JKCA 4AP1A 3OC4A 4J34A 1D4CA 4IVOB 3I3LA 4B64A 1GTEA 1NPXA 1ONFA 3H8LA 2YM2A 2WBAA 1IJHA 1FECA 1RP0A 4A9WA 4H4XA 1CJ4A 1GNDA 2YVGA 4TLXA 5EB4A 1H86A 1CC4A 5KVHA 3AEBA 3SFDA 1VG9A 4IA6A 3LZXA 1GV4A 2GQFA 4TM4A 4UDRA 1KDGA 2BS4A 3FBSA 3KA7A 2E4GA 4N9XA 3L1RA 2WU2A 2GF3A 3IHGA 4A79A 4U2TA 3LJPA 2WP5A 4EQSA 5HHFA 1PBCA 2GAGB 4XXGA 2R0PA 4EQWA 1NHRA 4HA6A 2B9XA 2PYXA 3AXBA 1F8SA 1JNRA 1GRAA 1LPFA 2NPXA 2J3NA 2NVKX 3NYCA 3AE2A 4NZHA 3GYIA 3F8PA 4X9NA 1M6IA 1SEZA 3BHFA 1KNPA 2FJAA 4D04A 4U8MA 4PABA 2GR2A 4BK3A 5JCIA 1B4VA 2ZBWA 2BA9A 3UP4A 4NTEA 4U2LA 2Y6RA 3DK8A 1Y0PA 1B5QA 1JNZA 3AWIA 3T37A 2GV8A 5BULA 1CF3A 2Q6UA 2YR4A 2BK3A 2BYBA 3H8IA 1PXAA 3P4PA 1JU2A 4YTNA 1JOAA 4JDRA 1GXFA 2R9ZA 3AE8A 2B7SA 2JB3A 3GWDA 1PN0A 2WU5A 3QJ4A 1LTXR 4OPIA 5IQ1A 4X9MA 1GESA 2XVIA 4K5RA 1V59A
chains in the Genus database with same CATH superfamily
4CCRA 4TLZA 2XLRA 3RR1A 3TWAA 3AYIA 4YSXA 2PP1A 1MOKA 3ZYXA 5JCNA 4YTMA 3CIRA 3V3OA 4AT2A 4C77A 1GETA 4JQ9A 4APNA 2XLTA 2WEUA 3GRSA 4Z2RA 4IA5A 2ZC8A 2OAMA 5HYMA 4DWDA 2BXSA 3HYXA 1MO9A 3I6TA 2YAUA 3M12A 2HQMA 1BGNA 4GGHA 5FJOA 3OZYA 4HNCA 4ZOHB 2EQ9A 3NH3X 3DEQA 2HZGA 4U8IA 3K30A 2NQLA 3LB8A 3BSMA 1TDKA 1BKWA 1D4DA 1NG4A 4FK1C 1FEBA 3SR6B 1CC2A 1N5XA 1KKRA 3QPEA 5JCKA 2OZ3A 2WDVA 5KWFA 3GD4A 3LOVA 2FBWA 1GTHA 4X4JA 1DOEA 4G73A 2RDXA 3CT2A 4EIQA 4PAAA 4B1BA 1FHUA 3T4WA 1E39A 2C70A 2HXUA 1FCDA 2GL5A 3QTPA 2V61A 4B66A 4M0XA 2ACZA 4RG3A 3AE1A 2XSXA 3TOYA 1GRGA 4EWJA 2ZADA 2GDQA 4Z25A 4YWSA 4I59A 3VRAA 1X2GA 2EQ6A 3H8AA 1EL8A 5ER0A 5C3JA 2AQJA 5EU9A 2GAHB 2IVDA 3PK7A 1BGJA 1H6VA 3IJLA 2VRLA 2RGJA 1KFYA 2XLSA 3ZDNA 2X8GA 2XYOA 1EBDA 4II3A 3UJEA 4J33A 2XFQA 2C73A 2WOWA 3GMBA 2GGGA 4EQRA 4DN1A 1RSGA 4B65A 3Q45A 2R4JA 3ABVA 1COYA 1QO8A 1YQ4A 2QJMA 3LXDA 3CNPA 5J04A 1KKOA 2CVJA 1RYIA 3NFUA 1SJCA 2BC1A 3ZLHA 3I6DA 2OPJA 3G5QA 3QSEA 2PTZA 3BHKA 4M52A 3SFEA 2ZZCA 2WOVA 1QLBA 2C66A 3WE0A 2PU0A 2PP0A 2FJDA 2V6OA 3ICRA 3DK4A 3NT6A 5FJTA 2BABA 2WDRA 2VZ2A 3CB3A 3NKSA 2QDDA 1KCZA 3ITJA 4ZCDA 2CHRA 3V4BA 3CPHG 3GYXA 3V76A 4FX9A 3PS9A 2WPCA 4CY6A 5GSNA 2WPFA 2B9WA 3GDPA 4GRTA 1IUWA 4OPUA 1GOSA 5JCMA 4GISA 3SQSA 2GR3A 2X8CA 3V3WA 4H19A 2XH0A 1WYGA 1RM6B 3PFRA 3GDNA 1PBDA 3VQRA 4A5LA 3P4SA 3V5CA 3NVWB 4DNAA 3FPZA 3VA8A 2IIDA 5FS8A 3QVRA 2WESA 1FEAA 4JNQA 1OJCA 3DG6A 4H50A 4H4UA 3ZVIA 2PS2A 1N63C 2I0ZA 3NZGA 1SJBA 4A6NB 1XANA 3AEDA 4A6GA 5C2TA 3AD7B 3AD9B 5EOWA 4AT0A 3K7TA 3F8DA 4A65A 2OLNA 4K1WA 2OVLA 3HRDC 3UP5A 2YG3A 5M10A 1JDFA 4YKGA 2XVFA 3ALMA 4Z44A 1IUSA 1H7XA 3DDMA 1L9CA 5FJRA 3FVDA 3S47A 2WETA 3NNEA 4ZA0A 1ZY8A 1H82A 1MDLA 1GPEA 1ZP0A 1D5TA 3ICSA 2O9ZA 1D4EA 4HNLA 5L46A 2R46A 3T0KA 5KRQA 3QFAA 2JK6A 3LADA 5HY5A 1DOCA 2YLSA 3UOXA 1JROA 2VVMA 3UOZA 4KWSA 3OC4A 4J34A 5KMPA 3H8LA 2YM2A 1MNSA 2YVGA 3SN0A 2PGWA 5KVHA 3SBFA 3SFDA 4IA6A 1GV4A 1ZXIC 3VCCA 3KA7A 2P8BA 3U9IA 3UJRA 2O56A 2WP5A 3GD6A 2GAGB 3CMMA 4EQWA 4G74A 3ZVHB 4A3RA 3AXBA 3AE2A 3BHFA 4D04A 2PTWA 2BRAA 4U8MA 2GR2A 4BK3A 2ZBWA 4U2LA 1B5QA 1CF3A 1WUEA 1H2IA 2BK3A 3H8IA 1N62C 4JDRA 3S5SA 3OTRA 3QKEA 3GY1A 3QJ4A 4OPIA 1GESA 3VC5A 1TDEA 2Q0KA 4GIRA 2P0IA 4DXKA 4CNJA 3M0OA 4JY3A 2VQBA 3FMWA 5KOWA 2BS3A 2RABA 3UXKA 3A7AA 1JRXA 3N4EA 3NVZB 1FFUC 3DJJA 4C3YA 3NYEA 3QVPA 1FIQB 5U63A 3CTYA 3VDGA 5U1OA 2BC0A 3R0KA 2PU1A 3RHAA 2FJEA 1DODA 3QLDA 1S2YA 3CPIG 3HYWA 5JRBA 2PA6A 3SGLA 4Z43A 1BZLA 2AR8A 2WP6A 5JCLA 3ETRB 4YXDA 2QA2A 1PDYA 4FDCB 3VRBA 5IQ4A 1EBHA 1CL0A 4TVYA 3B97A 4H2PA 4OPDA 1OJDA 4UP3A 4ECHA 3D9XA 1ZX9A 4NTCA 5KXJA 2V60A 2PPGA 1PXBA 1K0IA 4Y4MA 1OJTA 3NK1X 4F4RA 1ZOVA 3O0HA 3NO1A 3D1CA 1BF3A 3CXOA 4NTDA 3PWIA 1E6EA 2WHDA 2YG7A 4GDEA 1GRTA 4MGGA 3KLJA 1KSSA 2AL1A 2E1MA 3RO6A 3CXBA 4AOSA 3DGZA 4GYPC 2XCGA 1E9IA 1YQZA 3EPTA 4U8KA 4K2XA 3DERA 2EQ8A 2APGA 2XGZA 2BS2A 1K0JA 2C65A 2P8CA 3UTEA 2W3SA 3SQPA 2Z5XA 3DG7A 3T2KA 2MNRA 3FYYA 2VQ7A 3SN1A 3DJGX 1TRBA 1H83A 3UCDA 1IUUA 3IK4A 3GWFA 2GEWA 1OJ9A 4TM0A 3SM8A 3EF6A 3RP6A 4O5UA 2XVHA 4GFIA 4YWOA 3RNMA 3REDA 4ENLA 2Z5YA 1IUXA 4IL2A 3HZLA 4KX6A 1DXLA 3D8XA 3QSMA 4DGKA 1PBEA 2YG5A 4OVIA 3UKHA 3OW1A 4EIPA 3SXIA 4XWRA 2XFUA 1TE6A 4E4FA 2QJJA 1VQWA 3SSZA 4BK2A 1P2EA 2V3BA 2XFNA 1PJ7A 4MJWA 3NHOX 4H1ZA 2XH2A 3GSIA 1DJQA 3ZLFA 4USRA 3CGBA 3AEFA 4EM4A 3T2YA 1WUFA 2PSNA 1Q1WA 3DFYA 2X3NA 4JHMA 3AECA 4EM3A 1PXCA 1IUTA 1EC8A 4K5SA 1MUCA 2GMJA 4H2RA 2H88A 4P9SA 3UGVA 3SYIA 2BCPA 3VRDB 1N4VA 4OPTA 3R11A 1YKJA 3GO2A 4XWZA 2Q0LA 2PP3A 3SZ0A 3BJSA 3RP7A 3AM9A 2TMDA 2XH7A 4RSLA 5CQFA 1CJCA 3BOXA 2B76A 4H4SA 5BUKA 3AE6A 3VC6A 4Z24A 4U8OA 3AE9A 2C67A 1P48A 1XS2A 1GALA 4YTPA 5HXIA 3QFBA 1JCTA 1BKHA 4GCMA 3V5FA 4G6GA 5FJPA 4EQXA 2BK4A 1ELSA 1OEPA 1NHQA 3ATQA 4G8TA 2GGIA 3K7MX 2GGEA 1O95A 4GAVA 1FL2A 4HYRA 2R0GA 1STZA 4KEMA 2QCUA 3PWGA 3GD3A 1ONEA 2GMHA 5FJUA 1F6MA 3NLCA 2A8XA 2BACA 2DKHA 1VQZA 3HYVA 1O5WA 1X31B 3M13A 4IP4A 3GRTA 2QAEA 1NELA 3R10A 3NN0X 3CNJA 1KNRA 1XPYA 4CNKA 1B8SA 1VG0A 1NHPA 3QSSA 3A7UA 2VRMA 2JB1A 2QA1A 2YVFA 3NRZB 4FK1A 3URHA 1GSNA 3CGEA 2PCEA 3ADAB 3IJIA 3OZ2A 1LJ1A 1DTNA 4J57A 3P4QA 1REOA 1SB3B 2OO6A 4ICYA 2JKCA 3MKCA 3I3LA 1NPXA 1EBGA 3FXGA 3MUCA 4TM4A 3JVAA 4UDRA 2BS4A 4N9XA 3L1RA 2WU2A 2GF3A 4EQSA 5HHFA 1PBCA 1NHRA 4HA6A 2PYXA 1JNRA 2NVKX 2J3NA 1SEZA 3PG6A 5JCIA 1IYXA 3NVYB 3UP4A 2Y6RA 3AWIA 1JNZA 3AN1A 2GV8A 5BULA 2YR4A 1PXAA 1GXFA 2B7SA 2PGEA 1LTXR 1V59A 1BQGA 3MWCA 4H4VA 2QQ6A 2X50A 3DG3A 2WP9A 4H2QA 3VR9A 4UDPA 3TQPA 3PO7A 1D7YA 4B69A 1NEKA 4K7ZA 3VCNA 2OALA 1EL7A 3NG7X 3KVEA 4E0VA 4CCQA 4J1OA 4A6NA 1L0VA 2FYMA 2WPEA 3ATRA 2GH5A 3BI5A 3NXLA 2YR6A 4G6HA 4HN8A 3UJ2A 2E5VA 4GAPA 1SJAA 3MY9A 4O5QA 1EL9A 2RGHA 1Y56B 2FKPA 3ALLA 2QGYA 2OA1A 3SZCA 2V5ZA 2GQWA 2PTXA 3D46A 4H4WA 2R45A 3CNSA 2UZZA 3G5RA 4HPNA 1PDHA 3N6HA 1DJNA 2YG4A 3ALJA 5FS9A 1QJDA 2W3RA 4AP3A 2IVEA 3BI4A 2X99A 3IJQA 4IL0A 1F3PA 1ECQA 3NK0X 1N4WA 3KD9A 4J36A 1V97A 2RGOA 1PS9A 4LIIA 2ZZBA 3UKKA 2F5ZA 3N4FA 4IP5A 1SJDA 2AAQA 2QJNA 4OPCA 4U8LA 3V3NA 3R07C 2C4CA 2C75A 3NN6X 4NWZA 3MZNA 2P3ZA 3P9UA 3EAOA 3R1ZA 3BNUA 4JN8A 3ZVHA 4K22A 2A87A 5EBKA 2C76A 1GEUA 1XHCA 3CNDA 3NTAA 2E3TA 4C74A 4BK1A 3NVVB 2GGJA 4IT1A 1S3BA 1FOHA 4IHCA 3AD8B 2WOIA 4DSHA 1TKKA 1YQ3A 2TPRA 1LVLA 2DW6A 5M0ZA 3B3RA 2R0CA 3DA1A 4MMWA 1LQTA 4RG4A 4LU6A 3UOVA 3AMZA 3NK2X 5IPYA 3AEGA 2P88A 3ENLA 3DH9A 3TTEA 2C3CA 1ZDLA 3EANA 4K8GA 1GREA 3P3BA 3BNMA 3EKGA 4B63A 3DESA 5BRTA 1EC7A 2CULA 3CPJG 2XDOA 3UTGA 2GR1A 3T14A 4YSHA 5KNLA 1VDVA 1PDZA 1F8RA 3GC2A 2WDQA 3AE3A 2OG9A 3P1WA 1JPMA 4Y4NA 4J56A 1M64A 4Z1YA 2PODA 3P4RA 1CC6A 3VR8A 3S61A 3AE4A 4NEWA 1NHSA 2GVCA 1Q9IA 4H4QA 2WQYA 3T31A 3ZLGA 2YQUA 2XFOA 1ZK7A 2OLOA 4DSGA 2JB2A 4I58A 3CGCA 3UJFA 5EB5A 4A7AA 1S3EA 4B68A 3FV9A 3N6JA 2GSHA 3NIXA 2YLZA 2H89A 2DW7A 4U8PA 4ROPA 3C96A 4A35A 1L9EA 3TJ4A 4HB9A 2C64A 2OZTA 3CYJA 4LA1A 4BJZA 4II2A 5KMQA 2ZZ0A 2EQ7A 1BWCA 3B6DA 2R4EA 4NNJA 3RP8A 3R9UA 4CY8A 3T9PA 4KPLA 3AEAA 3UKFA 2OKTA 5DBJA 3DIPA 3HW2A 1ZOYA 4C5OA 2OX4A 5KOXA 4IZGA 4GUVA 3NTDA 2WS3A 1UKVG 1AOGA 1ZMCA 1N60C 1DOBA 3RITA 1ZKQA 4H4PA 4ZCWA 2YLXA 1E1KA 1LV0A 3UCCA 3NRNA 3SZFA 4H7UA 3KU9A 1CJ3A 4EMJA 1W4XA 3H4KA 5G5HB 3TJIA 1PBBA 2GGHA 3DJDA 3IC9A 4EMIA 2VVLG 4H4TA 1EC9A 1Q1RA 4H4ZA 1X2HA 1N4UA 1NU5A 1IUVA 2OFJA 3H7VA 3T6CA 1ZMDA 3OZMA 5J7XA 3L8KA 3CN8A 4K8DA 2YG6A 3PVCA 6ENLA 3JSKA 3OP2A 2AKMA 1FO4A 3NGCX 1EL5A 3KPFA 3Q4DA 1KD0A 4ZCCA 2XFPA 1E1NA 1GERA 4B64A 1ONFA 2PTYA 1R0MA 1IJHA 1FECA 1RP0A 4A9WA 2W55A 1GNDA 1CJ4A 4TLXA 5EB4A 1CC4A 3AEBA 3ES8A 2OQHA 3LZXA 2GQFA 2HXTA 3B9JB 5KMRA 1KDGA 3FBSA 3IHGA 3LJPA 3TW9A 2AKZA 2R0PA 3THUA 2B9XA 4G7FA 1F8SA 1FHVA 1LPFA 3NYCA 4NZHA 3GYIA 3P93A 1KNPA 4E5TA 1B4VA 5ENLA 2BA9A 2HNEA 3DK8A 3T37A 4GYPA 2BYBA 1JU2A 3AE8A 1RVKA 3GWDA 3FCPA 2I5QA 5IQ1A 2XVIA 4K5RA 3UCLA 2FJBA 1N61C 2W54A 3C4AA 3Q9TA 2XVEA 4K2SA 4H4YA 1GT8A 3D47A 5CKUA 2XLPA 4J2WA 4Y4LA 5FMHA 5LV9A 1YY5A 3AEEA 5KVIA 4J31A 3SX6A 3CK5A 1E7PA 4UDQA 3SZWA 4M6UA 2AL2B 4G9KA 1MXTA 3RCYA 1NDAA 4GDPA 4U2SA 3FG2P 4FP1A 4E4UA 4GF7A 1GRHA 4WCTA 2AL2A 3II4A 1T3QC 3IHMA 2XLUA 2OLAA 2XH4A 4E6MA 2W0HA 7ENLA 4H2NA 4BJYA 3NS1B 3T2ZA 2A89A 2BXRA 5FS7A 1K4QA 4GMEA 3UKAA 4YKFA 2GB0A 2GRTA 2YVJA 3RGTA 3VFCA 4TM1A 3I6EA 3TCSA 3L5OA 2Y6QA 5BVAA 1KSUA 3P0WA 3UKLA 3UKPA 3RRAA 2C72A 1E1LA 3KUMA 3CGDA 1S2QA 3CAWA 1H81A 3SN4A 1TDFA 3UTHA 5TR3A 4JNAA 2OZ8A 2QDEA 3I4KA 3DGHA 3JW7A 3LZWA 3AB1A 2X8HA 2DKIA 3NYFA 4WX1A 2JAEA 5J60A 3SY4A 1W6TA 3TWBA 1KF6A 1HYUA 2YLRA 3AE7A 4H4RA 4CRTA 2Q7VA 4HCDA 2E5AA 1CHUA 1OJAA 1Z6LA 2B7RA 4IVMB 1XPQA 4A99A 4REKA 1XDIA 3UXLA 3KPKA 3ISHA 4GGBA 1JEHA 3R25A 3CNTA 3E1TA 3UTFA 3C4NA 5GRTA 4JY2A 2OQYA 3EUB3 3UKQA 3DK9A 1H84A 1TZZA 3OPSA 4U8NA 3BI2A 4C3XA 3G5SA 2BRYA 3HPFA 1N5WC 2MUCA 3IF9A 1P2HA 5BOEA 3H70A 3MSYA 2YLWA 4YSYA 5FS6A 1JRYA 3UOYA 1N1PA 5BOFA 1PJ5A 3AYLA 3F8RA 3AE5A 1O94A 3DFHA 2BK5A 5U25A 3UJSA 4BV6A 2XVJA 1VRQB 1NG3A 1DNCA 1Y56A 3GMCA 4TM3A 3S5WA 1K0LA 1PJ6A 3AYJA 1MDRA 1YEYA 1F8WA 2B9YA 3JZUA 4DX3A 1L8PA 4YT0A 1PBFA 3K1GA 4KPRA 1PHHA 1FFVC 4AOXA 2C7GA 2VVLA 5IDZA 4BURA 2C3DA 2ONEA 3ES7A 4NEVA 2YM1A 3Q6JA 2YWLA 4H2HA 1E1MA 4DHGA 4JN7A 3IWAA 4GR1A 1D7LA 1L9DA 1VDCA 5KMSA 2BCGG 1NENA 4OCGA 4KT2A 4ADWA 3T8QA 4EMWA 4E8GA 5G5GB 1ELIA 2CFYA 1LQUA 1TDNA 3DJEA 3K7QX 1TDOA 4USQA 3DMEA 1CJ2A 1CBOA 1TYTA 3STPA 1GRBA 2PHHA 2V3AA 2YLTA 4Z2UA 4OPLA 2CDUA 2GR0A 2VOUA 4Z2TA 4TVWA 3A7RA 4D03A 3R0UA 2ARDA 3ICTA 1TYPA 3FJ4A 3QN3A 1B37A 3COXA 4ZN0A 4Z17A 4CBQA 2YR5A 1JRZA 1NAAA 1JPDX 3KKJA 4Z26A 1R6WA 1P43A 4X2PA 4U8JA 2JBVA 1GRFA 1H7WA 4H83A 3GYJA 4OPGA 3FIMB 4IV9A 4JN9A 4AP1A 1D4CA 4IVOB 1JRPA 1GTEA 2WBAA 3MQTA 4DYEA 4H4XA 4FI4A 1H86A 1VG9A 2PMQA 3EEZA 1KN0A 4MKSA 2E4GA 3H12A 4A79A 1S7MA 4U2TA 4XXGA 2POZA 1GRAA 2NPXA 4J3ZA 3F8PA 4X9NA 1F9CA 1M6IA 2QVHA 2FJAA 4PABA 3DGBA 4NTEA 1Y0PA 2Q6UA 3P4PA 4YTNA 1MRAA 1JOAA 3U4FA 2R9ZA 2JB3A 1PN0A 2WU5A 4HCLA 4HCHA 3SJNA 4X9MA 4B67A 4YSZA
chains in the Genus database with same CATH topology
4CCRA 4TLZA 2XLRA 2FJBA 2Q0KA 4H4VA 3C4AA 3Q9TA 2XVEA 2X50A 4CNJA 4H4YA 1GT8A 3AYIA 5CKUA 1MOKA 2XLPA 3M0OA 4J2WA 4Y4LA 5FMHA 3ZYXA 5LV9A 5JCNA 1YY5A 2VQBA 2WP9A 3FMWA 4JY3A 2BS3A 4YTMA 3AEEA 3CIRA 5KVIA 4H2QA 4J31A 2RABA 1TDEA 4UDPA 3SX6A 3V3OA 3VR9A 1E7PA 3PO7A 4AT2A 4C77A 1JRXA 1GETA 1D7YA 4B69A 4UDQA 1NEKA 4JQ9A 4K7ZA 3SZWA 2OALA 4APNA 1EL7A 2WEUA 2XLTA 3NG7X 3KVEA 4E0VA 3GRSA 3DJJA 4Z2RA 4CCQA 4C3YA 3NYEA 4A6NA 4G9KA 1MXTA 4IA5A 1L0VA 1NDAA 4GDPA 2OAMA 5HYMA 3QVPA 2WPEA 3ATRA 4U2SA 2BXSA 5U63A 3CTYA 3FG2P 3HYXA 5U1OA 1MO9A 2GH5A 2BC0A 2YAUA 3M12A 3RHAA 4GF7A 2HQMA 1DODA 1GRHA 2FJEA 4WCTA 1BGNA 1S2YA 3II4A 3BI5A 3CPIG 3IHMA 2XLUA 2YR6A 2W0HA 2EQ9A 3HYWA 4G6HA 5JRBA 2E5VA 3NH3X 4GAPA 4O5QA 4U8IA 3SGLA 4Z43A 1BZLA 3K30A 1EL9A 2AR8A 4H2NA 2WP6A 2RGHA 4BJYA 5JCLA 1Y56B 3T2ZA 4YXDA 3LB8A 2A89A 1TDKA 1BKWA 3ALLA 2BXRA 2QA2A 5FS7A 1K4QA 4FDCB 2OA1A 3UKAA 4YKFA 3VRBA 5IQ4A 1D4DA 3SZCA 2V5ZA 1NG4A 4FK1C 1CL0A 2GB0A 1FEBA 2GQWA 2GRTA 2YVJA 1CC2A 4H4WA 4TM1A 2R45A 3CNSA 3L5OA 5JCKA 2UZZA 4H2PA 2Y6QA 3G5RA 5BVAA 1KSUA 4OPDA 1OJDA 4UP3A 4ECHA 1PDHA 2WDVA 2YG4A 1DJNA 3GD4A 5KWFA 3D9XA 3LOVA 2C72A 3UKPA 3UKLA 3ALJA 1ZX9A 2FBWA 4NTCA 5FS9A 1GTHA 1QJDA 5KXJA 2V60A 4X4JA 1E1LA 4AP3A 1PXBA 1DOEA 1K0IA 3CGDA 2IVEA 3BI4A 4Y4MA 2X99A 4G73A 4EIQA 1OJTA 3NK1X 1S2QA 1F3PA 1H81A 1ZOVA 3O0HA 4PAAA 3NK0X 1N4WA 4B1BA 3KD9A 4J36A 3D1CA 1TDFA 1BF3A 1E39A 3UTHA 5TR3A 2C70A 4NTDA 4JNAA 2RGOA 1E6EA 1FCDA 1PS9A 2WHDA 2V61A 4LIIA 2ZZBA 3UKKA 2F5ZA 2YG7A 3DGHA 4B66A 3LZWA 2AAQA 3AB1A 4GDEA 4OPCA 2X8HA 2DKIA 4U8LA 1GRTA 3V3NA 3KLJA 3NYFA 4WX1A 1KSSA 2JAEA 2ACZA 5J60A 2E1MA 2C4CA 3SY4A 4RG3A 2C75A 3AE1A 3NN6X 4AOSA 1KF6A 1GRGA 3DGZA 4NWZA 1HYUA 3EAOA 3P9UA 3BNUA 2XCGA 2YLRA 3AE7A 4Z25A 4I59A 3VRAA 2EQ6A 4H4RA 1YQZA 3EPTA 4K22A 2A87A 4U8KA 1EL8A 4CRTA 5EBKA 2C76A 2Q7VA 1GEUA 1XHCA 1CHUA 1OJAA 1Z6LA 3CNDA 3NTAA 4K2XA 2EQ8A 4C74A 2APGA 5ER0A 4YSXA 2B7RA 4IVMB 4BK1A 2BS2A 1S3BA 1XPQA 1K0JA 2C65A 5C3JA 3UTEA 4A99A 2AQJA 1FOHA 4REKA 3SQPA 3AD8B 2Z5XA 2WOIA 4DSHA 3T2KA 2GAHB 1YQ3A 2TPRA 2IVDA 1XDIA 1LVLA 3KPKA 1BGJA 3ISHA 5M0ZA 1H6VA 3B3RA 2R0CA 2VRLA 1JEHA 3CNTA 3E1TA 2RGJA 2VQ7A 5GRTA 1KFYA 2XLSA 3C4NA 3DJGX 1LQTA 2X8GA 1H83A 1TRBA 2XYOA 3DA1A 4RG4A 4LU6A 1EBDA 4II3A 1IUUA 3GWFA 2GEWA 1OJ9A 4JY2A 3UOVA 4B67A 4J33A 4TM0A 3SM8A 2XFQA 4YSZA 3NK2X 3UKQA 3DK9A 5IPYA 2C73A 3AEGA 1H84A 3EF6A 3RP6A 2WOWA 4O5UA 4U8NA 3DH9A 3GMBA 2C3CA 4EQRA 3BI2A 1ZDLA 4C3XA 3G5SA 1RSGA 3EANA 4B65A 2BRYA 2XVHA 4YWOA 3RNMA 2R4JA 3ABVA 3IF9A 1COYA 1GREA 1P2HA 1QO8A 3REDA 1YQ4A 2YLWA 3BNMA 2Z5YA 4YSYA 3LXDA 1IUXA 3CNPA 4B63A 5FS6A 3HZLA 1JRYA 4KX6A 1DXLA 3UOYA 1N1PA 1PJ5A 2CVJA 3AYLA 5BRTA 2CULA 1RYIA 3F8RA 3D8XA 3CPJG 2XDOA 3QSMA 3UTGA 2GR1A 3T14A 4DGKA 4YSHA 3AE5A 1O94A 1PBEA 5KNLA 2YG5A 4OVIA 3UKHA 2BK5A 2BC1A 3UTFA 4EIPA 1F8RA 3SXIA 5U25A 3I6DA 4XWRA 4BV6A 2WDQA 2XFUA 2XVJA 1VRQB 3AE3A 3G5QA 3QSEA 3P1WA 3UCLA 1NG3A 3BHKA 4Y4NA 4J56A 1DNCA 1M64A 1VQWA 4BK2A 4M52A 1Y56A 1P2EA 3GMCA 3SFEA 4TM3A 2V3BA 2XFNA 2ZZCA 1PJ7A 3P4RA 1CC6A 4MJWA 2WOVA 3VR8A 3NHOX 3S61A 1QLBA 2C66A 3AE4A 3GSIA 4NEWA 3WE0A 1NHSA 2GVCA 1Q9IA 1DJQA 2FJDA 2V6OA 3ICRA 4H4QA 2WQYA 3DK4A 3T31A 3NT6A 3S5WA 4USRA 2YQUA 1K0LA 1PJ6A 3AYJA 3CGBA 2BABA 2WDRA 3AEFA 4EM4A 2VZ2A 2XFOA 3NKSA 3T2YA 1ZK7A 2OLOA 1Q1WA 3ITJA 4ZCDA 4DSGA 1F8WA 3GYXA 2JB2A 3CPHG 4I58A 2B9YA 3CGCA 3V76A 2X3NA 3AECA 4EM3A 1PXCA 1S3EA 5EB5A 4A7AA 4B68A 1IUTA 4YT0A 1PBFA 4FX9A 3NIXA 4K5SA 2GMJA 2YLZA 2H89A 4KPRA 4U8PA 4H2RA 3C96A 3PS9A 1L9EA 2H88A 4P9SA 4HB9A 2WPCA 3SYIA 1PHHA 2BCPA 2C64A 5GSNA 3VRDB 4CY6A 2WPFA 1N4VA 4OPTA 4AOXA 2C7GA 2VVLA 4LA1A 2B9WA 3GDPA 1YKJA 4GRTA 4BJZA 4II2A 5KMQA 1IUWA 4OPUA 1GOSA 4BURA 2ZZ0A 2EQ7A 1BWCA 3B6DA 2R4EA 4NNJA 3RP8A 4XWZA 5JCMA 2Q0LA 2C3DA 3SZ0A 3R9UA 2GR3A 2X8CA 4NEVA 3RP7A 2YM1A 2TMDA 4RSLA 5KOWA 3Q6JA 3GDNA 4CY8A 1PBDA 3VQRA 4A5LA 2YWLA 5CQFA 1CJCA 3P4SA 1E1MA 4DNAA 2B76A 4H4SA 3IWAA 3FPZA 5BUKA 2IIDA 3AE6A 4GR1A 5FS8A 1D7LA 3QVRA 1L9DA 3AEAA 2WESA 1VDCA 4Z24A 4U8OA 5DBJA 3UKFA 5KMSA 2BCGG 3AE9A 2C67A 1ZOYA 1GALA 1FEAA 4JNQA 4C5OA 4YTPA 1OJCA 1NENA 5HXIA 3QFBA 4H50A 5KOXA 4OCGA 4GUVA 4H4UA 4GCMA 3NTDA 2WS3A 4ADWA 1UKVG 1AOGA 1ZMCA 4EMWA 4G6GA 2I0ZA 4A6NB 1DOBA 1ZKQA 4H4PA 4EQXA 2BK4A 1ELIA 2CFYA 2YLXA 1NHQA 1XANA 1E1KA 1LV0A 3AEDA 3ATQA 5C2TA 3NRNA 3AD7B 3K7MX 3AD9B 3SZFA 5EOWA 4H7UA 4AT0A 3K7TA 1O95A 4GAVA 1FL2A 1LQUA 1TDNA 3DJEA 3F8DA 3K7QX 2R0GA 3KU9A 4A65A 1TDOA 4USQA 1CJ3A 4EMJA 3DMEA 1W4XA 1CJ2A 2OLNA 3H4KA 1CBOA 3UP5A 2YG3A 5M10A 4YKGA 1TYTA 2QCUA 2XVFA 3ZDNA 3ALMA 4Z44A 3GD3A 1GRBA 1PBBA 2PHHA 2V3AA 1IUSA 1H7XA 2YLTA 2GMHA 3DJDA 4Z2UA 3IC9A 1F6MA 2CDUA 2GR0A 3NLCA 4OPLA 1L9CA 2A8XA 4EMIA 2BACA 2DKHA 2VVLG 3HYVA 2VOUA 1O5WA 1X31B 2WETA 3M13A 3NNEA 4Z2TA 3GRTA 4H4TA 1ZY8A 4D03A 1Q1RA 1H82A 2QAEA 4H4ZA 1GPEA 1ZP0A 2ARDA 1D5TA 1N4UA 3ICTA 1IUVA 3ICSA 1TYPA 2O9ZA 3NN0X 3CNJA 1ZMDA 1KNRA 1D4EA 4CNKA 1B37A 3COXA 5J7XA 1B8SA 4ZN0A 4CBQA 2YR5A 1JRZA 1NHPA 1VG0A 5L46A 3L8KA 3CN8A 4K8DA 2YG6A 3QSSA 2R46A 1NAAA 2VRMA 3PVCA 3JSKA 3T0KA 2JB1A 3KKJA 2QA1A 4Z26A 3QFAA 2YVFA 5KRQA 4FK1A 2JK6A 3LADA 3NGCX 3URHA 1EL5A 3KPFA 5HY5A 1GSNA 3CGEA 4U8JA 2JBVA 1GRFA 1H7WA 3ADAB 3GYJA 3OZ2A 4OPGA 1DOCA 1LJ1A 4ZCCA 3FIMB 2YLSA 2XFPA 4IV9A 3UOXA 4J57A 3P4QA 1REOA 1E1NA 4JN9A 2VVMA 3UOZA 1GERA 4ICYA 2JKCA 4AP1A 3OC4A 4J34A 1D4CA 5KMPA 4IVOB 3I3LA 4B64A 1GTEA 1NPXA 1ONFA 3H8LA 2YM2A 2WBAA 1IJHA 1FECA 1RP0A 4A9WA 4H4XA 1CJ4A 1GNDA 2YVGA 4TLXA 5EB4A 1H86A 1CC4A 5KVHA 3AEBA 3SFDA 1VG9A 4IA6A 3LZXA 1GV4A 2GQFA 1KN0A 5KMRA 4TM4A 4UDRA 1KDGA 2BS4A 3FBSA 3KA7A 2E4GA 4N9XA 3L1RA 2WU2A 2GF3A 3IHGA 4A79A 1S7MA 4U2TA 3LJPA 2WP5A 4EQSA 5HHFA 1PBCA 2GAGB 4XXGA 3CMMA 2R0PA 4EQWA 4G74A 1NHRA 4HA6A 2B9XA 2PYXA 3AXBA 1F8SA 1JNRA 1GRAA 1LPFA 2NPXA 2J3NA 2NVKX 3NYCA 3AE2A 4NZHA 3GYIA 3F8PA 4X9NA 1M6IA 1SEZA 3BHFA 1KNPA 2FJAA 4D04A 3PG6A 2BRAA 4U8MA 4PABA 2GR2A 4BK3A 5JCIA 1B4VA 2ZBWA 2BA9A 3UP4A 4NTEA 4U2LA 2Y6RA 3DK8A 1Y0PA 1B5QA 1JNZA 3AWIA 3T37A 2GV8A 5BULA 1CF3A 2Q6UA 2YR4A 2BK3A 1H2IA 2BYBA 1PXAA 3H8IA 1JU2A 3P4PA 4YTNA 1JOAA 4JDRA 1GXFA 2R9ZA 3AE8A 2B7SA 2JB3A 3GWDA 1PN0A 2WU5A 3QJ4A 1LTXR 4OPIA 5IQ1A 4X9MA 1GESA 2XVIA 4K5RA 1V59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCR A;  4TLZ A;  2XLR A;  2FJB A;  2Q0K A;  4H4V A;  3C4A A;  3Q9T A;  2XVE A;  2X50 A;  4CNJ A;  4H4Y A;  1GT8 A;  3AYI A;  5CKU A;  1MOK A;  2XLP A;  3M0O A;  4J2W A;  4Y4L A;  5FMH A;  3ZYX A;  5LV9 A;  5JCN A;  1YY5 A;  2VQB A;  2WP9 A;  3FMW A;  4JY3 A;  2BS3 A;  4YTM A;  3AEE A;  3CIR A;  5KVI A;  4H2Q A;  4J31 A;  2RAB A;  1TDE A;  4UDP A;  3V3O A;  3VR9 A;  1E7P A;  3PO7 A;  4AT2 A;  4C77 A;  1JRX A;  1GET A;  1D7Y A;  4B69 A;  4UDQ A;  1NEK A;  4JQ9 A;  4K7Z A;  2OAL A;  4APN A;  1EL7 A;  2WEU A;  2XLT A;  3NG7 X;  3KVE A;  4E0V A;  3GRS A;  3DJJ A;  4Z2R A;  4CCQ A;  4C3Y A;  3NYE A;  4A6N A;  1MXT A;  4IA5 A;  1L0V A;  1NDA A;  4GDP A;  2OAM A;  5HYM A;  3QVP A;  2WPE A;  3ATR A;  4U2S A;  2BXS A;  5U63 A;  3CTY A;  3FG2 P;  5U1O A;  1MO9 A;  2GH5 A;  2BC0 A;  2YAU A;  3M12 A;  3RHA A;  4GF7 A;  2HQM A;  1DOD A;  1GRH A;  2FJE A;  4WCT A;  1BGN A;  1S2Y A;  3II4 A;  3BI5 A;  3CPI G;  3IHM A;  2XLU A;  2YR6 A;  2W0H A;  2EQ9 A;  2E5V A;  3NH3 X;  4O5Q A;  4U8I A;  3SGL A;  4Z43 A;  1BZL A;  3K30 A;  1EL9 A;  2AR8 A;  4H2N A;  2WP6 A;  2RGH A;  4BJY A;  5JCL A;  1Y56 B;  4YXD A;  3LB8 A;  2A89 A;  1TDK A;  1BKW A;  3ALL A;  2BXR A;  2QA2 A;  5FS7 A;  1K4Q A;  4FDC B;  2OA1 A;  3UKA A;  4YKF A;  3VRB A;  5IQ4 A;  1D4D A;  2V5Z A;  1NG4 A;  4FK1 C;  1CL0 A;  2GB0 A;  1FEB A;  2GQW A;  2GRT A;  2YVJ A;  1CC2 A;  4H4W A;  4TM1 A;  2R45 A;  3CNS A;  5JCK A;  2UZZ A;  4H2P A;  2Y6Q A;  3G5R A;  5BVA A;  1KSU A;  4OPD A;  1OJD A;  4UP3 A;  4ECH A;  1PDH A;  2WDV A;  2YG4 A;  1DJN A;  3GD4 A;  5KWF A;  3LOV A;  3UKP A;  2C72 A;  3UKL A;  3ALJ A;  1ZX9 A;  2FBW A;  4NTC A;  5FS9 A;  1GTH A;  1QJD A;  5KXJ A;  2V60 A;  4X4J A;  1E1L A;  4AP3 A;  1PXB A;  1DOE A;  1K0I A;  3CGD A;  2IVE A;  3BI4 A;  4Y4M A;  2X99 A;  4EIQ A;  1OJT A;  3NK1 X;  1S2Q A;  1F3P A;  1H81 A;  1ZOV A;  3O0H A;  4PAA A;  3NK0 X;  1N4W A;  4B1B A;  3KD9 A;  4J36 A;  3D1C A;  1TDF A;  1BF3 A;  1E39 A;  3UTH A;  5TR3 A;  2C70 A;  4NTD A;  4JNA A;  2RGO A;  1E6E A;  1FCD A;  1PS9 A;  2WHD A;  2V61 A;  4LII A;  2ZZB A;  3UKK A;  2F5Z A;  2YG7 A;  3DGH A;  4B66 A;  3LZW A;  2AAQ A;  3AB1 A;  4GDE A;  4OPC A;  2X8H A;  2DKI A;  4U8L A;  1GRT A;  3V3N A;  3KLJ A;  3NYF A;  4WX1 A;  1KSS A;  2JAE A;  2ACZ A;  5J60 A;  2E1M A;  4RG3 A;  2C75 A;  3AE1 A;  3NN6 X;  4AOS A;  1KF6 A;  1GRG A;  3DGZ A;  1HYU A;  3EAO A;  3P9U A;  3BNU A;  2XCG A;  2YLR A;  3AE7 A;  4Z25 A;  4I59 A;  3VRA A;  2EQ6 A;  4H4R A;  1YQZ A;  3EPT A;  4K22 A;  2A87 A;  4U8K A;  1EL8 A;  4CRT A;  5EBK A;  2C76 A;  2Q7V A;  1GEU A;  1XHC A;  1CHU A;  1OJA A;  1Z6L A;  3CND A;  3NTA A;  4K2X A;  2EQ8 A;  4C74 A;  2APG A;  5ER0 A;  4YSX A;  2B7R A;  4IVM B;  4BK1 A;  2BS2 A;  1S3B A;  1XPQ A;  1K0J A;  2C65 A;  5C3J A;  3UTE A;  4A99 A;  2AQJ A;  1FOH A;  4REK A;  3SQP A;  3AD8 B;  2Z5X A;  2WOI A;  4DSH A;  2GAH B;  1YQ3 A;  2TPR A;  2IVD A;  1XDI A;  1LVL A;  1BGJ A;  3ISH A;  5M0Z A;  1H6V A;  3B3R A;  2R0C A;  2VRL A;  1JEH A;  3CNT A;  3E1T A;  2RGJ A;  2VQ7 A;  5GRT A;  1KFY A;  2XLS A;  3C4N A;  3DJG X;  1LQT A;  2X8G A;  1H83 A;  1TRB A;  2XYO A;  3DA1 A;  4RG4 A;  4LU6 A;  1EBD A;  1IUU A;  3GWF A;  2GEW A;  1OJ9 A;  4JY2 A;  3UOV A;  4B67 A;  4J33 A;  4TM0 A;  3SM8 A;  2XFQ A;  4YSZ A;  3NK2 X;  3UKQ A;  3DK9 A;  5IPY A;  2C73 A;  3AEG A;  1H84 A;  3EF6 A;  3RP6 A;  2WOW A;  4O5U A;  4U8N A;  3DH9 A;  3GMB A;  2C3C A;  4EQR A;  3BI2 A;  1ZDL A;  4C3X A;  3G5S A;  1RSG A;  3EAN A;  4B65 A;  2XVH A;  4YWO A;  3RNM A;  2R4J A;  3ABV A;  3IF9 A;  1COY A;  1GRE A;  1P2H A;  1QO8 A;  3RED A;  1YQ4 A;  2YLW A;  3BNM A;  2Z5Y A;  4YSY A;  3LXD A;  1IUX A;  3CNP A;  4B63 A;  5FS6 A;  3HZL A;  1JRY A;  4KX6 A;  1DXL A;  3UOY A;  1N1P A;  1PJ5 A;  2CVJ A;  3AYL A;  5BRT A;  2CUL A;  1RYI A;  3F8R A;  3D8X A;  3CPJ G;  2XDO A;  3QSM A;  3UTG A;  2GR1 A;  4DGK A;  4YSH A;  3AE5 A;  1O94 A;  1PBE A;  2YG5 A;  4OVI A;  3UKH A;  2BK5 A;  2BC1 A;  3UTF A;  4EIP A;  1F8R A;  5U25 A;  3I6D A;  4XWR A;  4BV6 A;  2WDQ A;  2XFU A;  2XVJ A;  1VRQ B;  3AE3 A;  3G5Q A;  3QSE A;  3P1W A;  3UCL A;  1NG3 A;  3BHK A;  4Y4N A;  4J56 A;  1DNC A;  1M64 A;  1VQW A;  4BK2 A;  4M52 A;  1Y56 A;  1P2E A;  3GMC A;  3SFE A;  4TM3 A;  2V3B A;  2XFN A;  2ZZC A;  1PJ7 A;  3P4R A;  1CC6 A;  4MJW A;  2WOV A;  3VR8 A;  3NHO X;  3S61 A;  1QLB A;  2C66 A;  3AE4 A;  3GSI A;  4NEW A;  3WE0 A;  1NHS A;  2GVC A;  1Q9I A;  1DJQ A;  2FJD A;  2V6O A;  3ICR A;  4H4Q A;  2WQY A;  3DK4 A;  3NT6 A;  3S5W A;  4USR A;  2YQU A;  1K0L A;  1PJ6 A;  3AYJ A;  3CGB A;  2BAB A;  2WDR A;  3AEF A;  4EM4 A;  2VZ2 A;  2XFO A;  3NKS A;  1ZK7 A;  2OLO A;  1Q1W A;  3ITJ A;  4ZCD A;  4DSG A;  1F8W A;  2JB2 A;  3CPH G;  4I58 A;  2B9Y A;  3CGC A;  3V76 A;  2X3N A;  3AEC A;  4EM3 A;  1PXC A;  1S3E A;  5EB5 A;  4A7A A;  4B68 A;  1IUT A;  4YT0 A;  1PBF A;  4FX9 A;  3NIX A;  4K5S A;  2GMJ A;  2YLZ A;  2H89 A;  4KPR A;  4U8P A;  4H2R A;  3C96 A;  3PS9 A;  1L9E A;  2H88 A;  4P9S A;  4HB9 A;  2WPC A;  1PHH A;  2BCP A;  2C64 A;  5GSN A;  3VRD B;  4CY6 A;  2WPF A;  1N4V A;  4OPT A;  4AOX A;  2C7G A;  2VVL A;  4LA1 A;  2B9W A;  3GDP A;  1YKJ A;  4GRT A;  4BJZ A;  1IUW A;  4OPU A;  1GOS A;  4BUR A;  2ZZ0 A;  2EQ7 A;  1BWC A;  3B6D A;  2R4E A;  3RP8 A;  4XWZ A;  5JCM A;  2Q0L A;  2C3D A;  3R9U A;  2GR3 A;  2X8C A;  4NEV A;  3RP7 A;  2YM1 A;  2TMD A;  4RSL A;  5KOW A;  3Q6J A;  3GDN A;  4CY8 A;  1PBD A;  3VQR A;  4A5L A;  2YWL A;  5CQF A;  1CJC A;  3P4S A;  1E1M A;  4DNA A;  2B76 A;  4H4S A;  3IWA A;  3FPZ A;  5BUK A;  2IID A;  3AE6 A;  4GR1 A;  5FS8 A;  1D7L A;  3QVR A;  1L9D A;  3AEA A;  2WES A;  1VDC A;  4Z24 A;  4U8O A;  5DBJ A;  3UKF A;  2BCG G;  3AE9 A;  2C67 A;  1ZOY A;  1GAL A;  1FEA A;  4JNQ A;  4C5O A;  4YTP A;  1OJC A;  1NEN A;  5HXI A;  3QFB A;  4H50 A;  5KOX A;  4OCG A;  4GUV A;  4H4U A;  4GCM A;  3NTD A;  2WS3 A;  4ADW A;  1UKV G;  1AOG A;  1ZMC A;  4EMW A;  2I0Z A;  4A6N B;  1DOB A;  1ZKQ A;  4H4P A;  4EQX A;  2BK4 A;  1ELI A;  2CFY A;  2YLX A;  1NHQ A;  1XAN A;  1E1K A;  1LV0 A;  3AED A;  3ATQ A;  5C2T A;  3NRN A;  3AD7 B;  3K7M X;  3AD9 B;  5EOW A;  4H7U A;  4AT0 A;  3K7T A;  1O95 A;  1FL2 A;  1LQU A;  1TDN A;  3DJE A;  3F8D A;  3K7Q X;  2R0G A;  3KU9 A;  4A65 A;  1TDO A;  4USQ A;  1CJ3 A;  4EMJ A;  3DME A;  1W4X A;  1CJ2 A;  2OLN A;  3H4K A;  1CBO A;  3UP5 A;  2YG3 A;  5M10 A;  4YKG A;  1TYT A;  2QCU A;  2XVF A;  3ZDN A;  3ALM A;  4Z44 A;  3GD3 A;  1GRB A;  1PBB A;  2PHH A;  2V3A A;  1IUS A;  1H7X A;  2YLT A;  2GMH A;  3DJD A;  4Z2U A;  3IC9 A;  1F6M A;  2CDU A;  2GR0 A;  3NLC A;  4OPL A;  1L9C A;  2A8X A;  4EMI A;  2BAC A;  2DKH A;  2VVL G;  2VOU A;  1O5W A;  1X31 B;  2WET A;  3M13 A;  3NNE A;  4Z2T A;  3GRT A;  4H4T A;  1ZY8 A;  4D03 A;  1Q1R A;  1H82 A;  2QAE A;  4H4Z A;  1GPE A;  1ZP0 A;  2ARD A;  1D5T A;  1N4U A;  3ICT A;  1IUV A;  3ICS A;  1TYP A;  2O9Z A;  3NN0 X;  3CNJ A;  1ZMD A;  1KNR A;  1D4E A;  4CNK A;  1B37 A;  3COX A;  5J7X A;  1B8S A;  4ZN0 A;  4CBQ A;  2YR5 A;  1JRZ A;  1NHP A;  1VG0 A;  5L46 A;  3L8K A;  3CN8 A;  4K8D A;  2YG6 A;  3QSS A;  2R46 A;  1NAA A;  2VRM A;  3PVC A;  3JSK A;  2JB1 A;  3KKJ A;  2QA1 A;  4Z26 A;  3QFA A;  2YVF A;  5KRQ A;  4FK1 A;  2JK6 A;  3LAD A;  3NGC X;  3URH A;  1EL5 A;  3KPF A;  5HY5 A;  1GSN A;  3CGE A;  4U8J A;  2JBV A;  1GRF A;  1H7W A;  3ADA B;  3GYJ A;  3OZ2 A;  4OPG A;  1DOC A;  1LJ1 A;  4ZCC A;  3FIM B;  2YLS A;  2XFP A;  4IV9 A;  3UOX A;  4J57 A;  3P4Q A;  1REO A;  1E1N A;  4JN9 A;  2VVM A;  3UOZ A;  1GER A;  4ICY A;  2JKC A;  4AP1 A;  3OC4 A;  4J34 A;  1D4C A;  4IVO B;  3I3L A;  4B64 A;  1GTE A;  1NPX A;  1ONF A;  3H8L A;  2YM2 A;  2WBA A;  1IJH A;  1FEC A;  1RP0 A;  4A9W A;  4H4X A;  1CJ4 A;  1GND A;  2YVG A;  4TLX A;  5EB4 A;  1H86 A;  1CC4 A;  5KVH A;  3AEB A;  3SFD A;  1VG9 A;  4IA6 A;  3LZX A;  1GV4 A;  2GQF A;  4TM4 A;  4UDR A;  1KDG A;  2BS4 A;  3FBS A;  3KA7 A;  2E4G A;  4N9X A;  3L1R A;  2WU2 A;  2GF3 A;  3IHG A;  4A79 A;  4U2T A;  3LJP A;  2WP5 A;  4EQS A;  5HHF A;  1PBC A;  2GAG B;  4XXG A;  2R0P A;  4EQW A;  1NHR A;  4HA6 A;  2B9X A;  2PYX A;  3AXB A;  1F8S A;  1JNR A;  1GRA A;  1LPF A;  2NPX A;  2J3N A;  2NVK X;  3NYC A;  3AE2 A;  4NZH A;  3GYI A;  3F8P A;  4X9N A;  1M6I A;  1SEZ A;  3BHF A;  1KNP A;  2FJA A;  4D04 A;  4U8M A;  4PAB A;  2GR2 A;  4BK3 A;  5JCI A;  1B4V A;  2ZBW A;  2BA9 A;  3UP4 A;  4NTE A;  4U2L A;  2Y6R A;  3DK8 A;  1Y0P A;  1B5Q A;  1JNZ A;  3AWI A;  3T37 A;  2GV8 A;  5BUL A;  1CF3 A;  2Q6U A;  2YR4 A;  2BK3 A;  2BYB A;  3H8I A;  1PXA A;  3P4P A;  1JU2 A;  4YTN A;  1JOA A;  4JDR A;  1GXF A;  2R9Z A;  3AE8 A;  2B7S A;  2JB3 A;  3GWD A;  1PN0 A;  2WU5 A;  3QJ4 A;  1LTX R;  4OPI A;  5IQ1 A;  4X9M A;  1GES A;  2XVI A;  4K5R A;  1V59 A; 
#chains in the Genus database with same CATH topology
 4CCR A;  4TLZ A;  2XLR A;  3RR1 A;  3TWA A;  3AYI A;  4YSX A;  2PP1 A;  1MOK A;  3ZYX A;  5JCN A;  4YTM A;  3CIR A;  3V3O A;  4AT2 A;  4C77 A;  1GET A;  4JQ9 A;  4APN A;  2XLT A;  2WEU A;  3GRS A;  4Z2R A;  4IA5 A;  2ZC8 A;  2OAM A;  5HYM A;  4DWD A;  2BXS A;  3HYX A;  1MO9 A;  3I6T A;  2YAU A;  3M12 A;  2HQM A;  1BGN A;  4GGH A;  5FJO A;  3OZY A;  4HNC A;  4ZOH B;  2EQ9 A;  3NH3 X;  3DEQ A;  2HZG A;  4U8I A;  3K30 A;  2NQL A;  3LB8 A;  3BSM A;  1TDK A;  1BKW A;  1D4D A;  1NG4 A;  4FK1 C;  1FEB A;  3SR6 B;  1CC2 A;  1N5X A;  1KKR A;  3QPE A;  5JCK A;  2OZ3 A;  2WDV A;  5KWF A;  3GD4 A;  3LOV A;  2FBW A;  1GTH A;  4X4J A;  1DOE A;  4G73 A;  2RDX A;  3CT2 A;  4EIQ A;  4PAA A;  4B1B A;  1FHU A;  3T4W A;  1E39 A;  2C70 A;  2HXU A;  1FCD A;  2GL5 A;  3QTP A;  2V61 A;  4B66 A;  4M0X A;  2ACZ A;  4RG3 A;  3AE1 A;  2XSX A;  3TOY A;  1GRG A;  4EWJ A;  2ZAD A;  2GDQ A;  4Z25 A;  4YWS A;  4I59 A;  3VRA A;  1X2G A;  2EQ6 A;  3H8A A;  1EL8 A;  5ER0 A;  5C3J A;  2AQJ A;  5EU9 A;  2GAH B;  2IVD A;  3PK7 A;  1BGJ A;  1H6V A;  3IJL A;  2VRL A;  2RGJ A;  1KFY A;  2XLS A;  3ZDN A;  2X8G A;  2XYO A;  1EBD A;  4II3 A;  3UJE A;  4J33 A;  2XFQ A;  2C73 A;  2WOW A;  3GMB A;  2GGG A;  4EQR A;  4DN1 A;  1RSG A;  4B65 A;  3Q45 A;  2R4J A;  3ABV A;  1COY A;  1QO8 A;  1YQ4 A;  2QJM A;  3LXD A;  3CNP A;  5J04 A;  1KKO A;  2CVJ A;  1RYI A;  3NFU A;  1SJC A;  2BC1 A;  3ZLH A;  3I6D A;  2OPJ A;  3G5Q A;  3QSE A;  2PTZ A;  3BHK A;  4M52 A;  3SFE A;  2ZZC A;  2WOV A;  1QLB A;  2C66 A;  3WE0 A;  2PU0 A;  2PP0 A;  2FJD A;  2V6O A;  3ICR A;  3DK4 A;  3NT6 A;  5FJT A;  2BAB A;  2WDR A;  2VZ2 A;  3CB3 A;  3NKS A;  2QDD A;  1KCZ A;  3ITJ A;  4ZCD A;  2CHR A;  3V4B A;  3CPH G;  3GYX A;  3V76 A;  4FX9 A;  3PS9 A;  2WPC A;  4CY6 A;  5GSN A;  2WPF A;  2B9W A;  3GDP A;  4GRT A;  1IUW A;  4OPU A;  1GOS A;  5JCM A;  4GIS A;  3SQS A;  2GR3 A;  2X8C A;  3V3W A;  4H19 A;  2XH0 A;  1WYG A;  1RM6 B;  3PFR A;  3GDN A;  1PBD A;  3VQR A;  4A5L A;  3P4S A;  3V5C A;  3NVW B;  4DNA A;  3FPZ A;  3VA8 A;  2IID A;  5FS8 A;  3QVR A;  2WES A;  1FEA A;  4JNQ A;  1OJC A;  3DG6 A;  4H50 A;  4H4U A;  3ZVI A;  2PS2 A;  1N63 C;  2I0Z A;  3NZG A;  1SJB A;  4A6N B;  1XAN A;  3AED A;  4A6G A;  5C2T A;  3AD7 B;  3AD9 B;  5EOW A;  4AT0 A;  3K7T A;  3F8D A;  4A65 A;  2OLN A;  4K1W A;  2OVL A;  3HRD C;  3UP5 A;  2YG3 A;  5M10 A;  1JDF A;  4YKG A;  2XVF A;  3ALM A;  4Z44 A;  1IUS A;  1H7X A;  3DDM A;  1L9C A;  5FJR A;  3FVD A;  3S47 A;  2WET A;  3NNE A;  4ZA0 A;  1ZY8 A;  1H82 A;  1MDL A;  1GPE A;  1ZP0 A;  1D5T A;  3ICS A;  2O9Z A;  1D4E A;  4HNL A;  5L46 A;  2R46 A;  3T0K A;  5KRQ A;  3QFA A;  2JK6 A;  3LAD A;  5HY5 A;  1DOC A;  2YLS A;  3UOX A;  1JRO A;  2VVM A;  3UOZ A;  4KWS A;  3OC4 A;  4J34 A;  5KMP A;  3H8L A;  2YM2 A;  1MNS A;  2YVG A;  3SN0 A;  2PGW A;  5KVH A;  3SBF A;  3SFD A;  4IA6 A;  1GV4 A;  1ZXI C;  3VCC A;  3KA7 A;  2P8B A;  3U9I A;  3UJR A;  2O56 A;  2WP5 A;  3GD6 A;  2GAG B;  3CMM A;  4EQW A;  4G74 A;  3ZVH B;  4A3R A;  3AXB A;  3AE2 A;  3BHF A;  4D04 A;  2PTW A;  2BRA A;  4U8M A;  2GR2 A;  4BK3 A;  2ZBW A;  4U2L A;  1B5Q A;  1CF3 A;  1WUE A;  1H2I A;  2BK3 A;  3H8I A;  1N62 C;  4JDR A;  3S5S A;  3OTR A;  3QKE A;  3GY1 A;  3QJ4 A;  4OPI A;  1GES A;  3VC5 A;  1TDE A;  2Q0K A;  4GIR A;  2P0I A;  4DXK A;  4CNJ A;  3M0O A;  4JY3 A;  2VQB A;  3FMW A;  5KOW A;  2BS3 A;  2RAB A;  3UXK A;  3A7A A;  1JRX A;  3N4E A;  3NVZ B;  1FFU C;  3DJJ A;  4C3Y A;  3NYE A;  3QVP A;  1FIQ B;  5U63 A;  3CTY A;  3VDG A;  5U1O A;  2BC0 A;  3R0K A;  2PU1 A;  3RHA A;  2FJE A;  1DOD A;  3QLD A;  1S2Y A;  3CPI G;  3HYW A;  5JRB A;  2PA6 A;  3SGL A;  4Z43 A;  1BZL A;  2AR8 A;  2WP6 A;  5JCL A;  3ETR B;  4YXD A;  2QA2 A;  1PDY A;  4FDC B;  3VRB A;  5IQ4 A;  1EBH A;  1CL0 A;  4TVY A;  3B97 A;  4H2P A;  4OPD A;  1OJD A;  4UP3 A;  4ECH A;  3D9X A;  1ZX9 A;  4NTC A;  5KXJ A;  2V60 A;  2PPG A;  1PXB A;  1K0I A;  4Y4M A;  1OJT A;  3NK1 X;  4F4R A;  1ZOV A;  3O0H A;  3NO1 A;  3D1C A;  1BF3 A;  3CXO A;  4NTD A;  3PWI A;  1E6E A;  2WHD A;  2YG7 A;  4GDE A;  1GRT A;  4MGG A;  3KLJ A;  1KSS A;  2AL1 A;  2E1M A;  3RO6 A;  3CXB A;  4AOS A;  3DGZ A;  4GYP C;  2XCG A;  1E9I A;  1YQZ A;  3EPT A;  4U8K A;  4K2X A;  3DER A;  2EQ8 A;  2APG A;  2XGZ A;  2BS2 A;  1K0J A;  2C65 A;  2P8C A;  3UTE A;  2W3S A;  3SQP A;  2Z5X A;  3DG7 A;  3T2K A;  2MNR A;  3FYY A;  2VQ7 A;  3SN1 A;  3DJG X;  1TRB A;  1H83 A;  3UCD A;  1IUU A;  3IK4 A;  3GWF A;  2GEW A;  1OJ9 A;  4TM0 A;  3SM8 A;  3EF6 A;  3RP6 A;  4O5U A;  2XVH A;  4GFI A;  4YWO A;  3RNM A;  3RED A;  4ENL A;  2Z5Y A;  1IUX A;  4IL2 A;  3HZL A;  4KX6 A;  1DXL A;  3D8X A;  3QSM A;  4DGK A;  1PBE A;  2YG5 A;  4OVI A;  3UKH A;  3OW1 A;  4EIP A;  3SXI A;  4XWR A;  2XFU A;  1TE6 A;  4E4F A;  2QJJ A;  1VQW A;  3SSZ A;  4BK2 A;  1P2E A;  2V3B A;  2XFN A;  1PJ7 A;  4MJW A;  3NHO X;  4H1Z A;  2XH2 A;  3GSI A;  1DJQ A;  3ZLF A;  4USR A;  3CGB A;  3AEF A;  4EM4 A;  3T2Y A;  1WUF A;  2PSN A;  1Q1W A;  3DFY A;  2X3N A;  4JHM A;  3AEC A;  4EM3 A;  1PXC A;  1IUT A;  1EC8 A;  4K5S A;  1MUC A;  2GMJ A;  4H2R A;  2H88 A;  4P9S A;  3UGV A;  3SYI A;  2BCP A;  3VRD B;  1N4V A;  4OPT A;  3R11 A;  1YKJ A;  3GO2 A;  4XWZ A;  2Q0L A;  2PP3 A;  3SZ0 A;  3BJS A;  3RP7 A;  3AM9 A;  2TMD A;  2XH7 A;  4RSL A;  5CQF A;  1CJC A;  3BOX A;  2B76 A;  4H4S A;  5BUK A;  3AE6 A;  3VC6 A;  4Z24 A;  4U8O A;  3AE9 A;  2C67 A;  1P48 A;  1XS2 A;  1GAL A;  4YTP A;  5HXI A;  3QFB A;  1JCT A;  1BKH A;  4GCM A;  3V5F A;  4G6G A;  5FJP A;  4EQX A;  2BK4 A;  1ELS A;  1OEP A;  1NHQ A;  3ATQ A;  4G8T A;  2GGI A;  3K7M X;  2GGE A;  1O95 A;  4GAV A;  1FL2 A;  4HYR A;  2R0G A;  1STZ A;  4KEM A;  2QCU A;  3PWG A;  3GD3 A;  1ONE A;  2GMH A;  5FJU A;  1F6M A;  3NLC A;  2A8X A;  2BAC A;  2DKH A;  1VQZ A;  3HYV A;  1O5W A;  1X31 B;  3M13 A;  4IP4 A;  3GRT A;  2QAE A;  1NEL A;  3R10 A;  3NN0 X;  3CNJ A;  1KNR A;  1XPY A;  4CNK A;  1B8S A;  1VG0 A;  1NHP A;  3QSS A;  3A7U A;  2VRM A;  2JB1 A;  2QA1 A;  2YVF A;  3NRZ B;  4FK1 A;  3URH A;  1GSN A;  3CGE A;  2PCE A;  3ADA B;  3IJI A;  3OZ2 A;  1LJ1 A;  1DTN A;  4J57 A;  3P4Q A;  1REO A;  1SB3 B;  2OO6 A;  4ICY A;  2JKC A;  3MKC A;  3I3L A;  1NPX A;  1EBG A;  3FXG A;  3MUC A;  4TM4 A;  3JVA A;  4UDR A;  2BS4 A;  4N9X A;  3L1R A;  2WU2 A;  2GF3 A;  4EQS A;  5HHF A;  1PBC A;  1NHR A;  4HA6 A;  2PYX A;  1JNR A;  2NVK X;  2J3N A;  1SEZ A;  3PG6 A;  5JCI A;  1IYX A;  3NVY B;  3UP4 A;  2Y6R A;  3AWI A;  1JNZ A;  3AN1 A;  2GV8 A;  5BUL A;  2YR4 A;  1PXA A;  1GXF A;  2B7S A;  2PGE A;  1LTX R;  1V59 A;  1BQG A;  3MWC A;  4H4V A;  2QQ6 A;  2X50 A;  3DG3 A;  2WP9 A;  4H2Q A;  3VR9 A;  4UDP A;  3TQP A;  3PO7 A;  1D7Y A;  4B69 A;  1NEK A;  4K7Z A;  3VCN A;  2OAL A;  1EL7 A;  3NG7 X;  3KVE A;  4E0V A;  4CCQ A;  4J1O A;  4A6N A;  1L0V A;  2FYM A;  2WPE A;  3ATR A;  2GH5 A;  3BI5 A;  3NXL A;  2YR6 A;  4G6H A;  4HN8 A;  3UJ2 A;  2E5V A;  4GAP A;  1SJA A;  3MY9 A;  4O5Q A;  1EL9 A;  2RGH A;  1Y56 B;  2FKP A;  3ALL A;  2QGY A;  2OA1 A;  3SZC A;  2V5Z A;  2GQW A;  2PTX A;  3D46 A;  4H4W A;  2R45 A;  3CNS A;  2UZZ A;  3G5R A;  4HPN A;  1PDH A;  3N6H A;  1DJN A;  2YG4 A;  3ALJ A;  5FS9 A;  1QJD A;  2W3R A;  4AP3 A;  2IVE A;  3BI4 A;  2X99 A;  3IJQ A;  4IL0 A;  1F3P A;  1ECQ A;  3NK0 X;  1N4W A;  3KD9 A;  4J36 A;  1V97 A;  2RGO A;  1PS9 A;  4LII A;  2ZZB A;  3UKK A;  2F5Z A;  3N4F A;  4IP5 A;  1SJD A;  2AAQ A;  2QJN A;  4OPC A;  4U8L A;  3V3N A;  3R07 C;  2C4C A;  2C75 A;  3NN6 X;  4NWZ A;  3MZN A;  2P3Z A;  3P9U A;  3EAO A;  3R1Z A;  3BNU A;  4JN8 A;  3ZVH A;  4K22 A;  2A87 A;  5EBK A;  2C76 A;  1GEU A;  1XHC A;  3CND A;  3NTA A;  2E3T A;  4C74 A;  4BK1 A;  3NVV B;  2GGJ A;  4IT1 A;  1S3B A;  1FOH A;  4IHC A;  3AD8 B;  2WOI A;  4DSH A;  1TKK A;  1YQ3 A;  2TPR A;  1LVL A;  2DW6 A;  5M0Z A;  3B3R A;  2R0C A;  3DA1 A;  4MMW A;  1LQT A;  4RG4 A;  4LU6 A;  3UOV A;  3AMZ A;  3NK2 X;  5IPY A;  3AEG A;  2P88 A;  3ENL A;  3DH9 A;  3TTE A;  2C3C A;  1ZDL A;  3EAN A;  4K8G A;  1GRE A;  3P3B A;  3BNM A;  3EKG A;  4B63 A;  3DES A;  5BRT A;  1EC7 A;  2CUL A;  3CPJ G;  2XDO A;  3UTG A;  2GR1 A;  3T14 A;  4YSH A;  5KNL A;  1VDV A;  1PDZ A;  1F8R A;  3GC2 A;  2WDQ A;  3AE3 A;  2OG9 A;  3P1W A;  1JPM A;  4Y4N A;  4J56 A;  1M64 A;  4Z1Y A;  2POD A;  3P4R A;  1CC6 A;  3VR8 A;  3S61 A;  3AE4 A;  4NEW A;  1NHS A;  2GVC A;  1Q9I A;  4H4Q A;  2WQY A;  3T31 A;  3ZLG A;  2YQU A;  2XFO A;  1ZK7 A;  2OLO A;  4DSG A;  2JB2 A;  4I58 A;  3CGC A;  3UJF A;  5EB5 A;  4A7A A;  1S3E A;  4B68 A;  3FV9 A;  3N6J A;  2GSH A;  3NIX A;  2YLZ A;  2H89 A;  2DW7 A;  4U8P A;  4ROP A;  3C96 A;  4A35 A;  1L9E A;  3TJ4 A;  4HB9 A;  2C64 A;  2OZT A;  3CYJ A;  4LA1 A;  4BJZ A;  4II2 A;  5KMQ A;  2ZZ0 A;  2EQ7 A;  1BWC A;  3B6D A;  2R4E A;  4NNJ A;  3RP8 A;  3R9U A;  4CY8 A;  3T9P A;  4KPL A;  3AEA A;  3UKF A;  2OKT A;  5DBJ A;  3DIP A;  3HW2 A;  1ZOY A;  4C5O A;  2OX4 A;  5KOX A;  4IZG A;  4GUV A;  3NTD A;  2WS3 A;  1UKV G;  1AOG A;  1ZMC A;  1N60 C;  1DOB A;  3RIT A;  1ZKQ A;  4H4P A;  4ZCW A;  2YLX A;  1E1K A;  1LV0 A;  3UCC A;  3NRN A;  3SZF A;  4H7U A;  3KU9 A;  1CJ3 A;  4EMJ A;  1W4X A;  3H4K A;  5G5H B;  3TJI A;  1PBB A;  2GGH A;  3DJD A;  3IC9 A;  4EMI A;  2VVL G;  4H4T A;  1EC9 A;  1Q1R A;  4H4Z A;  1X2H A;  1N4U A;  1NU5 A;  1IUV A;  2OFJ A;  3H7V A;  3T6C A;  1ZMD A;  3OZM A;  5J7X A;  3L8K A;  3CN8 A;  4K8D A;  2YG6 A;  3PVC A;  6ENL A;  3JSK A;  3OP2 A;  2AKM A;  1FO4 A;  3NGC X;  1EL5 A;  3KPF A;  3Q4D A;  1KD0 A;  4ZCC A;  2XFP A;  1E1N A;  1GER A;  4B64 A;  1ONF A;  2PTY A;  1R0M A;  1IJH A;  1FEC A;  1RP0 A;  4A9W A;  2W55 A;  1GND A;  1CJ4 A;  4TLX A;  5EB4 A;  1CC4 A;  3AEB A;  3ES8 A;  2OQH A;  3LZX A;  2GQF A;  2HXT A;  3B9J B;  5KMR A;  1KDG A;  3FBS A;  3IHG A;  3LJP A;  3TW9 A;  2AKZ A;  2R0P A;  3THU A;  2B9X A;  4G7F A;  1F8S A;  1FHV A;  1LPF A;  3NYC A;  4NZH A;  3GYI A;  3P93 A;  1KNP A;  4E5T A;  1B4V A;  5ENL A;  2BA9 A;  2HNE A;  3DK8 A;  3T37 A;  4GYP A;  2BYB A;  1JU2 A;  3AE8 A;  1RVK A;  3GWD A;  3FCP A;  2I5Q A;  5IQ1 A;  2XVI A;  4K5R A;  3UCL A;  2FJB A;  1N61 C;  2W54 A;  3C4A A;  3Q9T A;  2XVE A;  4K2S A;  4H4Y A;  1GT8 A;  3D47 A;  5CKU A;  2XLP A;  4J2W A;  4Y4L A;  5FMH A;  5LV9 A;  1YY5 A;  3AEE A;  5KVI A;  4J31 A;  3SX6 A;  3CK5 A;  1E7P A;  4UDQ A;  3SZW A;  4M6U A;  2AL2 B;  4G9K A;  1MXT A;  3RCY A;  1NDA A;  4GDP A;  4U2S A;  3FG2 P;  4FP1 A;  4E4U A;  4GF7 A;  1GRH A;  4WCT A;  2AL2 A;  3II4 A;  1T3Q C;  3IHM A;  2XLU A;  2OLA A;  2XH4 A;  4E6M A;  2W0H A;  7ENL A;  4H2N A;  4BJY A;  3NS1 B;  3T2Z A;  2A89 A;  2BXR A;  5FS7 A;  1K4Q A;  4GME A;  3UKA A;  4YKF A;  2GB0 A;  2GRT A;  2YVJ A;  3RGT A;  3VFC A;  4TM1 A;  3I6E A;  3TCS A;  3L5O A;  2Y6Q A;  5BVA A;  1KSU A;  3P0W A;  3UKL A;  3UKP A;  3RRA A;  2C72 A;  1E1L A;  3KUM A;  3CGD A;  1S2Q A;  3CAW A;  1H81 A;  3SN4 A;  1TDF A;  3UTH A;  5TR3 A;  4JNA A;  2OZ8 A;  2QDE A;  3I4K A;  3DGH A;  3JW7 A;  3LZW A;  3AB1 A;  2X8H A;  2DKI A;  3NYF A;  4WX1 A;  2JAE A;  5J60 A;  3SY4 A;  1W6T A;  3TWB A;  1KF6 A;  1HYU A;  2YLR A;  3AE7 A;  4H4R A;  4CRT A;  2Q7V A;  4HCD A;  2E5A A;  1CHU A;  1OJA A;  1Z6L A;  2B7R A;  4IVM B;  1XPQ A;  4A99 A;  4REK A;  1XDI A;  3UXL A;  3KPK A;  3ISH A;  4GGB A;  1JEH A;  3R25 A;  3CNT A;  3E1T A;  3UTF A;  3C4N A;  5GRT A;  4JY2 A;  2OQY A;  3EUB 3;  3UKQ A;  3DK9 A;  1H84 A;  1TZZ A;  3OPS A;  4U8N A;  3BI2 A;  4C3X A;  3G5S A;  2BRY A;  3HPF A;  1N5W C;  2MUC A;  3IF9 A;  1P2H A;  5BOE A;  3H70 A;  3MSY A;  2YLW A;  4YSY A;  5FS6 A;  1JRY A;  3UOY A;  1N1P A;  5BOF A;  1PJ5 A;  3AYL A;  3F8R A;  3AE5 A;  1O94 A;  3DFH A;  2BK5 A;  5U25 A;  3UJS A;  4BV6 A;  2XVJ A;  1VRQ B;  1NG3 A;  1DNC A;  1Y56 A;  3GMC A;  4TM3 A;  3S5W A;  1K0L A;  1PJ6 A;  3AYJ A;  1MDR A;  1YEY A;  1F8W A;  2B9Y A;  3JZU A;  4DX3 A;  1L8P A;  4YT0 A;  1PBF A;  3K1G A;  4KPR A;  1PHH A;  1FFV C;  4AOX A;  2C7G A;  2VVL A;  5IDZ A;  4BUR A;  2C3D A;  2ONE A;  3ES7 A;  4NEV A;  2YM1 A;  3Q6J A;  2YWL A;  4H2H A;  1E1M A;  4DHG A;  4JN7 A;  3IWA A;  4GR1 A;  1D7L A;  1L9D A;  1VDC A;  5KMS A;  2BCG G;  1NEN A;  4OCG A;  4KT2 A;  4ADW A;  3T8Q A;  4EMW A;  4E8G A;  5G5G B;  1ELI A;  2CFY A;  1LQU A;  1TDN A;  3DJE A;  3K7Q X;  1TDO A;  4USQ A;  3DME A;  1CJ2 A;  1CBO A;  1TYT A;  3STP A;  1GRB A;  2PHH A;  2V3A A;  2YLT A;  4Z2U A;  4OPL A;  2CDU A;  2GR0 A;  2VOU A;  4Z2T A;  4TVW A;  3A7R A;  4D03 A;  3R0U A;  2ARD A;  3ICT A;  1TYP A;  3FJ4 A;  3QN3 A;  1B37 A;  3COX A;  4ZN0 A;  4Z17 A;  4CBQ A;  2YR5 A;  1JRZ A;  1NAA A;  1JPD X;  3KKJ A;  4Z26 A;  1R6W A;  1P43 A;  4X2P A;  4U8J A;  2JBV A;  1GRF A;  1H7W A;  4H83 A;  3GYJ A;  4OPG A;  3FIM B;  4IV9 A;  4JN9 A;  4AP1 A;  1D4C A;  4IVO B;  1JRP A;  1GTE A;  2WBA A;  3MQT A;  4DYE A;  4H4X A;  4FI4 A;  1H86 A;  1VG9 A;  2PMQ A;  3EEZ A;  1KN0 A;  4MKS A;  2E4G A;  3H12 A;  4A79 A;  1S7M A;  4U2T A;  4XXG A;  2POZ A;  1GRA A;  2NPX A;  4J3Z A;  3F8P A;  4X9N A;  1F9C A;  1M6I A;  2QVH A;  2FJA A;  4PAB A;  3DGB A;  4NTE A;  1Y0P A;  2Q6U A;  3P4P A;  4YTN A;  1MRA A;  1JOA A;  3U4F A;  2R9Z A;  2JB3 A;  1PN0 A;  2WU5 A;  4HCL A;  4HCH A;  3SJN A;  4X9M A;  4B67 A;  4YSZ A; 
#chains in the Genus database with same CATH homology
 4CCR A;  4TLZ A;  2XLR A;  2FJB A;  2Q0K A;  4H4V A;  3C4A A;  3Q9T A;  2XVE A;  2X50 A;  4CNJ A;  4H4Y A;  1GT8 A;  3AYI A;  5CKU A;  1MOK A;  2XLP A;  3M0O A;  4J2W A;  4Y4L A;  5FMH A;  3ZYX A;  5LV9 A;  5JCN A;  1YY5 A;  2VQB A;  2WP9 A;  3FMW A;  4JY3 A;  2BS3 A;  4YTM A;  3AEE A;  3CIR A;  5KVI A;  4H2Q A;  4J31 A;  2RAB A;  1TDE A;  4UDP A;  3SX6 A;  3V3O A;  3VR9 A;  1E7P A;  3PO7 A;  4AT2 A;  4C77 A;  1JRX A;  1GET A;  1D7Y A;  4B69 A;  4UDQ A;  1NEK A;  4JQ9 A;  4K7Z A;  3SZW A;  2OAL A;  4APN A;  1EL7 A;  2WEU A;  2XLT A;  3NG7 X;  3KVE A;  4E0V A;  3GRS A;  3DJJ A;  4Z2R A;  4CCQ A;  4C3Y A;  3NYE A;  4A6N A;  4G9K A;  1MXT A;  4IA5 A;  1L0V A;  1NDA A;  4GDP A;  2OAM A;  5HYM A;  3QVP A;  2WPE A;  3ATR A;  4U2S A;  2BXS A;  5U63 A;  3CTY A;  3FG2 P;  3HYX A;  5U1O A;  1MO9 A;  2GH5 A;  2BC0 A;  2YAU A;  3M12 A;  3RHA A;  4GF7 A;  2HQM A;  1DOD A;  1GRH A;  2FJE A;  4WCT A;  1BGN A;  1S2Y A;  3II4 A;  3BI5 A;  3CPI G;  3IHM A;  2XLU A;  2YR6 A;  2W0H A;  2EQ9 A;  3HYW A;  4G6H A;  5JRB A;  2E5V A;  3NH3 X;  4GAP A;  4O5Q A;  4U8I A;  3SGL A;  4Z43 A;  1BZL A;  3K30 A;  1EL9 A;  2AR8 A;  4H2N A;  2WP6 A;  2RGH A;  4BJY A;  5JCL A;  1Y56 B;  3T2Z A;  4YXD A;  3LB8 A;  2A89 A;  1TDK A;  1BKW A;  3ALL A;  2BXR A;  2QA2 A;  5FS7 A;  1K4Q A;  4FDC B;  2OA1 A;  3UKA A;  4YKF A;  3VRB A;  5IQ4 A;  1D4D A;  3SZC A;  2V5Z A;  1NG4 A;  4FK1 C;  1CL0 A;  2GB0 A;  1FEB A;  2GQW A;  2GRT A;  2YVJ A;  1CC2 A;  4H4W A;  4TM1 A;  2R45 A;  3CNS A;  3L5O A;  5JCK A;  2UZZ A;  4H2P A;  2Y6Q A;  3G5R A;  5BVA A;  1KSU A;  4OPD A;  1OJD A;  4UP3 A;  4ECH A;  1PDH A;  2WDV A;  2YG4 A;  1DJN A;  3GD4 A;  5KWF A;  3D9X A;  3LOV A;  2C72 A;  3UKP A;  3UKL A;  3ALJ A;  1ZX9 A;  2FBW A;  4NTC A;  5FS9 A;  1GTH A;  1QJD A;  5KXJ A;  2V60 A;  4X4J A;  1E1L A;  4AP3 A;  1PXB A;  1DOE A;  1K0I A;  3CGD A;  2IVE A;  3BI4 A;  4Y4M A;  2X99 A;  4G73 A;  4EIQ A;  1OJT A;  3NK1 X;  1S2Q A;  1F3P A;  1H81 A;  1ZOV A;  3O0H A;  4PAA A;  3NK0 X;  1N4W A;  4B1B A;  3KD9 A;  4J36 A;  3D1C A;  1TDF A;  1BF3 A;  1E39 A;  3UTH A;  5TR3 A;  2C70 A;  4NTD A;  4JNA A;  2RGO A;  1E6E A;  1FCD A;  1PS9 A;  2WHD A;  2V61 A;  4LII A;  2ZZB A;  3UKK A;  2F5Z A;  2YG7 A;  3DGH A;  4B66 A;  3LZW A;  2AAQ A;  3AB1 A;  4GDE A;  4OPC A;  2X8H A;  2DKI A;  4U8L A;  1GRT A;  3V3N A;  3KLJ A;  3NYF A;  4WX1 A;  1KSS A;  2JAE A;  2ACZ A;  5J60 A;  2E1M A;  2C4C A;  3SY4 A;  4RG3 A;  2C75 A;  3AE1 A;  3NN6 X;  4AOS A;  1KF6 A;  1GRG A;  3DGZ A;  4NWZ A;  1HYU A;  3EAO A;  3P9U A;  3BNU A;  2XCG A;  2YLR A;  3AE7 A;  4Z25 A;  4I59 A;  3VRA A;  2EQ6 A;  4H4R A;  1YQZ A;  3EPT A;  4K22 A;  2A87 A;  4U8K A;  1EL8 A;  4CRT A;  5EBK A;  2C76 A;  2Q7V A;  1GEU A;  1XHC A;  1CHU A;  1OJA A;  1Z6L A;  3CND A;  3NTA A;  4K2X A;  2EQ8 A;  4C74 A;  2APG A;  5ER0 A;  4YSX A;  2B7R A;  4IVM B;  4BK1 A;  2BS2 A;  1S3B A;  1XPQ A;  1K0J A;  2C65 A;  5C3J A;  3UTE A;  4A99 A;  2AQJ A;  1FOH A;  4REK A;  3SQP A;  3AD8 B;  2Z5X A;  2WOI A;  4DSH A;  3T2K A;  2GAH B;  1YQ3 A;  2TPR A;  2IVD A;  1XDI A;  1LVL A;  3KPK A;  1BGJ A;  3ISH A;  5M0Z A;  1H6V A;  3B3R A;  2R0C A;  2VRL A;  1JEH A;  3CNT A;  3E1T A;  2RGJ A;  2VQ7 A;  5GRT A;  1KFY A;  2XLS A;  3C4N A;  3DJG X;  1LQT A;  2X8G A;  1H83 A;  1TRB A;  2XYO A;  3DA1 A;  4RG4 A;  4LU6 A;  1EBD A;  4II3 A;  1IUU A;  3GWF A;  2GEW A;  1OJ9 A;  4JY2 A;  3UOV A;  4B67 A;  4J33 A;  4TM0 A;  3SM8 A;  2XFQ A;  4YSZ A;  3NK2 X;  3UKQ A;  3DK9 A;  5IPY A;  2C73 A;  3AEG A;  1H84 A;  3EF6 A;  3RP6 A;  2WOW A;  4O5U A;  4U8N A;  3DH9 A;  3GMB A;  2C3C A;  4EQR A;  3BI2 A;  1ZDL A;  4C3X A;  3G5S A;  1RSG A;  3EAN A;  4B65 A;  2BRY A;  2XVH A;  4YWO A;  3RNM A;  2R4J A;  3ABV A;  3IF9 A;  1COY A;  1GRE A;  1P2H A;  1QO8 A;  3RED A;  1YQ4 A;  2YLW A;  3BNM A;  2Z5Y A;  4YSY A;  3LXD A;  1IUX A;  3CNP A;  4B63 A;  5FS6 A;  3HZL A;  1JRY A;  4KX6 A;  1DXL A;  3UOY A;  1N1P A;  1PJ5 A;  2CVJ A;  3AYL A;  5BRT A;  2CUL A;  1RYI A;  3F8R A;  3D8X A;  3CPJ G;  2XDO A;  3QSM A;  3UTG A;  2GR1 A;  3T14 A;  4DGK A;  4YSH A;  3AE5 A;  1O94 A;  1PBE A;  5KNL A;  2YG5 A;  4OVI A;  3UKH A;  2BK5 A;  2BC1 A;  3UTF A;  4EIP A;  1F8R A;  3SXI A;  5U25 A;  3I6D A;  4XWR A;  4BV6 A;  2WDQ A;  2XFU A;  2XVJ A;  1VRQ B;  3AE3 A;  3G5Q A;  3QSE A;  3P1W A;  3UCL A;  1NG3 A;  3BHK A;  4Y4N A;  4J56 A;  1DNC A;  1M64 A;  1VQW A;  4BK2 A;  4M52 A;  1Y56 A;  1P2E A;  3GMC A;  3SFE A;  4TM3 A;  2V3B A;  2XFN A;  2ZZC A;  1PJ7 A;  3P4R A;  1CC6 A;  4MJW A;  2WOV A;  3VR8 A;  3NHO X;  3S61 A;  1QLB A;  2C66 A;  3AE4 A;  3GSI A;  4NEW A;  3WE0 A;  1NHS A;  2GVC A;  1Q9I A;  1DJQ A;  2FJD A;  2V6O A;  3ICR A;  4H4Q A;  2WQY A;  3DK4 A;  3T31 A;  3NT6 A;  3S5W A;  4USR A;  2YQU A;  1K0L A;  1PJ6 A;  3AYJ A;  3CGB A;  2BAB A;  2WDR A;  3AEF A;  4EM4 A;  2VZ2 A;  2XFO A;  3NKS A;  3T2Y A;  1ZK7 A;  2OLO A;  1Q1W A;  3ITJ A;  4ZCD A;  4DSG A;  1F8W A;  3GYX A;  2JB2 A;  3CPH G;  4I58 A;  2B9Y A;  3CGC A;  3V76 A;  2X3N A;  3AEC A;  4EM3 A;  1PXC A;  1S3E A;  5EB5 A;  4A7A A;  4B68 A;  1IUT A;  4YT0 A;  1PBF A;  4FX9 A;  3NIX A;  4K5S A;  2GMJ A;  2YLZ A;  2H89 A;  4KPR A;  4U8P A;  4H2R A;  3C96 A;  3PS9 A;  1L9E A;  2H88 A;  4P9S A;  4HB9 A;  2WPC A;  3SYI A;  1PHH A;  2BCP A;  2C64 A;  5GSN A;  3VRD B;  4CY6 A;  2WPF A;  1N4V A;  4OPT A;  4AOX A;  2C7G A;  2VVL A;  4LA1 A;  2B9W A;  3GDP A;  1YKJ A;  4GRT A;  4BJZ A;  4II2 A;  5KMQ A;  1IUW A;  4OPU A;  1GOS A;  4BUR A;  2ZZ0 A;  2EQ7 A;  1BWC A;  3B6D A;  2R4E A;  4NNJ A;  3RP8 A;  4XWZ A;  5JCM A;  2Q0L A;  2C3D A;  3SZ0 A;  3R9U A;  2GR3 A;  2X8C A;  4NEV A;  3RP7 A;  2YM1 A;  2TMD A;  4RSL A;  5KOW A;  3Q6J A;  3GDN A;  4CY8 A;  1PBD A;  3VQR A;  4A5L A;  2YWL A;  5CQF A;  1CJC A;  3P4S A;  1E1M A;  4DNA A;  2B76 A;  4H4S A;  3IWA A;  3FPZ A;  5BUK A;  2IID A;  3AE6 A;  4GR1 A;  5FS8 A;  1D7L A;  3QVR A;  1L9D A;  3AEA A;  2WES A;  1VDC A;  4Z24 A;  4U8O A;  5DBJ A;  3UKF A;  5KMS A;  2BCG G;  3AE9 A;  2C67 A;  1ZOY A;  1GAL A;  1FEA A;  4JNQ A;  4C5O A;  4YTP A;  1OJC A;  1NEN A;  5HXI A;  3QFB A;  4H50 A;  5KOX A;  4OCG A;  4GUV A;  4H4U A;  4GCM A;  3NTD A;  2WS3 A;  4ADW A;  1UKV G;  1AOG A;  1ZMC A;  4EMW A;  4G6G A;  2I0Z A;  4A6N B;  1DOB A;  1ZKQ A;  4H4P A;  4EQX A;  2BK4 A;  1ELI A;  2CFY A;  2YLX A;  1NHQ A;  1XAN A;  1E1K A;  1LV0 A;  3AED A;  3ATQ A;  5C2T A;  3NRN A;  3AD7 B;  3K7M X;  3AD9 B;  3SZF A;  5EOW A;  4H7U A;  4AT0 A;  3K7T A;  1O95 A;  4GAV A;  1FL2 A;  1LQU A;  1TDN A;  3DJE A;  3F8D A;  3K7Q X;  2R0G A;  3KU9 A;  4A65 A;  1TDO A;  4USQ A;  1CJ3 A;  4EMJ A;  3DME A;  1W4X A;  1CJ2 A;  2OLN A;  3H4K A;  1CBO A;  3UP5 A;  2YG3 A;  5M10 A;  4YKG A;  1TYT A;  2QCU A;  2XVF A;  3ZDN A;  3ALM A;  4Z44 A;  3GD3 A;  1GRB A;  1PBB A;  2PHH A;  2V3A A;  1IUS A;  1H7X A;  2YLT A;  2GMH A;  3DJD A;  4Z2U A;  3IC9 A;  1F6M A;  2CDU A;  2GR0 A;  3NLC A;  4OPL A;  1L9C A;  2A8X A;  4EMI A;  2BAC A;  2DKH A;  2VVL G;  3HYV A;  2VOU A;  1O5W A;  1X31 B;  2WET A;  3M13 A;  3NNE A;  4Z2T A;  3GRT A;  4H4T A;  1ZY8 A;  4D03 A;  1Q1R A;  1H82 A;  2QAE A;  4H4Z A;  1GPE A;  1ZP0 A;  2ARD A;  1D5T A;  1N4U A;  3ICT A;  1IUV A;  3ICS A;  1TYP A;  2O9Z A;  3NN0 X;  3CNJ A;  1ZMD A;  1KNR A;  1D4E A;  4CNK A;  1B37 A;  3COX A;  5J7X A;  1B8S A;  4ZN0 A;  4CBQ A;  2YR5 A;  1JRZ A;  1NHP A;  1VG0 A;  5L46 A;  3L8K A;  3CN8 A;  4K8D A;  2YG6 A;  3QSS A;  2R46 A;  1NAA A;  2VRM A;  3PVC A;  3JSK A;  3T0K A;  2JB1 A;  3KKJ A;  2QA1 A;  4Z26 A;  3QFA A;  2YVF A;  5KRQ A;  4FK1 A;  2JK6 A;  3LAD A;  3NGC X;  3URH A;  1EL5 A;  3KPF A;  5HY5 A;  1GSN A;  3CGE A;  4U8J A;  2JBV A;  1GRF A;  1H7W A;  3ADA B;  3GYJ A;  3OZ2 A;  4OPG A;  1DOC A;  1LJ1 A;  4ZCC A;  3FIM B;  2YLS A;  2XFP A;  4IV9 A;  3UOX A;  4J57 A;  3P4Q A;  1REO A;  1E1N A;  4JN9 A;  2VVM A;  3UOZ A;  1GER A;  4ICY A;  2JKC A;  4AP1 A;  3OC4 A;  4J34 A;  1D4C A;  5KMP A;  4IVO B;  3I3L A;  4B64 A;  1GTE A;  1NPX A;  1ONF A;  3H8L A;  2YM2 A;  2WBA A;  1IJH A;  1FEC A;  1RP0 A;  4A9W A;  4H4X A;  1CJ4 A;  1GND A;  2YVG A;  4TLX A;  5EB4 A;  1H86 A;  1CC4 A;  5KVH A;  3AEB A;  3SFD A;  1VG9 A;  4IA6 A;  3LZX A;  1GV4 A;  2GQF A;  1KN0 A;  5KMR A;  4TM4 A;  4UDR A;  1KDG A;  2BS4 A;  3FBS A;  3KA7 A;  2E4G A;  4N9X A;  3L1R A;  2WU2 A;  2GF3 A;  3IHG A;  4A79 A;  1S7M A;  4U2T A;  3LJP A;  2WP5 A;  4EQS A;  5HHF A;  1PBC A;  2GAG B;  4XXG A;  3CMM A;  2R0P A;  4EQW A;  4G74 A;  1NHR A;  4HA6 A;  2B9X A;  2PYX A;  3AXB A;  1F8S A;  1JNR A;  1GRA A;  1LPF A;  2NPX A;  2J3N A;  2NVK X;  3NYC A;  3AE2 A;  4NZH A;  3GYI A;  3F8P A;  4X9N A;  1M6I A;  1SEZ A;  3BHF A;  1KNP A;  2FJA A;  4D04 A;  3PG6 A;  2BRA A;  4U8M A;  4PAB A;  2GR2 A;  4BK3 A;  5JCI A;  1B4V A;  2ZBW A;  2BA9 A;  3UP4 A;  4NTE A;  4U2L A;  2Y6R A;  3DK8 A;  1Y0P A;  1B5Q A;  1JNZ A;  3AWI A;  3T37 A;  2GV8 A;  5BUL A;  1CF3 A;  2Q6U A;  2YR4 A;  2BK3 A;  1H2I A;  2BYB A;  1PXA A;  3H8I A;  1JU2 A;  3P4P A;  4YTN A;  1JOA A;  4JDR A;  1GXF A;  2R9Z A;  3AE8 A;  2B7S A;  2JB3 A;  3GWD A;  1PN0 A;  2WU5 A;  3QJ4 A;  1LTX R;  4OPI A;  5IQ1 A;  4X9M A;  1GES A;  2XVI A;  4K5R A;  1V59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...