2NQHA

High resolution crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
b'MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 4
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 107
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqhA00
4EAYA 4QE1A 1CLKA 2XISA 3C0QA 3DX5A 5AVNA 4HHMA 5H1WA 4YTTA 5C9ZA 1XLHA 3KWSA 3QXBA 3JU2A 2I56A 1XIIA 2HK1A 1XIHA 1XLIA 3KBVA 3ITVA 4HGXA 4X61A 4PGLA 3WQOA 3QC0A 5EMKA 1XLDA 3KBWA 3XINA 9XIAA 3ITYA 5EMLA 1XLCA 1XLLA 4DVOA 3VYLA 4K3ZA 1XIJA 4A8IA 3BANA 1QUMA 4XISA 4K1GA 5AVHA 3P14A 4QE4A 4QDWA 1K77A 5XINA 1S5NA 3DBNA 3M0VA 2NQHA 3KBMA 4A8NA 3BZJA 3FVMA 9XIMA 3ITOA 3XISA 1XLBA 1XP3A 5B7YA 3BWWA 3KBNA 4US6A 4ZBCA 4QE5A 6XIMA 3CWHA 8XIAA 3VNKA 3GNXA 3IUIA 2GLKA 3M0XA 4GJJA 1O1HA 2GYIA 3ITXA 2QUNA 4E3VA 2G4JA 3CNYA 3IUHA 3XIMA 2NQ9A 1XINA 4ZB5A 3M0YA 5J8LA 2HCVA 1XLJA 3KCLA 3TVAA 4A8LA 4GLEA 4Q7IA 2QULA 3AYVA 2G0WA 3UU0A 3ITTA 1QT1A 4HHLA 2Q02A 4X63A 3NGFA 5EMMA 3UA3A 3CQIA 1I6NA 1TZ9A 3M0MA 3CQJA 3C0LA 4XIAA 3OBEA 4KW2A 3LMZA 4YTRA 3UXIA 4YTSA 3CQHA 1DE6A 1XLMA 1XYBA 5B7ZA 1XIMA 3VNLA 5XIAA 3AALA 3C0SA 1XYLA 3KBSA 1XYCA 4OVXA 4ZB2A 3IUDA 1MNZA 3VNJA 3KTCA 1BXCA 4EACA 2J6VA 3QYSA 4PFHA 3UVAA 3U0HA 1A0DA 2ZDSA 1MUWA 1XIEA 2ZVRA 5TNVA 3P6LA 2XIMA 1S5MA 1A0CA 3AYTA 3M0LA 2X7WA 4LNCA 4W4QA 1DE5A 1XISA 3BZGA 1GW9A 3KBJA 1OADA 4J4KA 3M0HA 4QEEA 3BDKA 6XIAA 2NQJA 4QDPA 1D8WA 2I57A 1XYMA 4QEHA 3VNMA 4A8RA 5B80A 1XICA 4X60A 1YX1A 1QTWA 1DXIA 1XLEA 2GUBA 4XSLA 3U3HA 3UA4A 8XIMA 2X7VA 1I60A 2GVEA 3KCJA 2XINA 3CQKA 3ITLA 1XLAA 4ZB0A 2HK0A 1XLFA 5H6HA 5EMJA 2OU4A 4XIMA 5FA5A 1XIBA 3QZAA 1XIFA 3N4AA 5XIMA 3VNIA 3L23A 1XIGA 1DIEA 4GJIA 4DUOA 1A0EA 2QUMA 4GQBA 1BXBA 4G56A 4YTQA 2QW5A 5I7GA 1XIDA 1XLGA 3AAMA 1XYAA 1DIDA 4XKMA 4XSMA 3TC3A 4HNOA 3KCOA 4YTUA 1XLKA 7XIMA
chains in the Genus database with same CATH superfamily
2QJMA 5H1WA 1ONWA 3HQNA 4B4FA 2CLEA 2XN1A 3LQLA 3BLLA 3W27A 4LV4A 3MUAA 3M7WA 3WQOA 2VGIA 3LB0A 2IUZA 2VELA 2A4AA 2OB3A 2ZXDA 4ALDA 4BWLC 2CZVA 5HMSA 4AWUA 1TA3A 3ARPA 3THUA 3CEPA 4BEUA 1R47A 4TV5A 4ATWA 2JBMA 3NZRA 5G5IA 2FH8A 5K9XA 3EWXA 4QE5A 1RAKA 3GIPA 5I07A 3LDVA 3FCPA 3PNUA 4C6QA 5CKSA 2IXVA 2CLKA 1YNPA 3CO4A 1YPFA 3GSMA 4JDYA 1QJWA 5CCZA 4HA3A 1CXEA 3H7VA 3RN6A 5BXPA 3WH7A 2DQXA 4OVXA 3KTCA 4MDOA 3B40A 3VILA 3M5XA 1AQFA 3UPWA 2GVJA 1JPKA 1JVNA 4GYPA 4QIUA 4Z1BA 5IDIA 1XYMA 1NOFA 2HS8A 1XICA 1HKMA 2PEVA 4KEVA 3GVRA 3RLHA 1XLAA 3HURA 4HMCA 1YYAA 4BJHA 5XIMA 3W7NA 3OIHA 3P5YA 4PMVA 2ZZ7A 1UKQA 1UR3M 3NTYA 4XZHA 2P76A 3TA9A 1HKWA 4GIRA 3RM8A 3SO7A 3I4EA 1G7VA 1P6BA 1A50A 1WDPA 3MBDA 5CPTA 3EMZA 4FK9A 4FXSA 3S5OA 3IJLA 3R0KA 2IW0A 4LRSA 4C1KA 1JYXA 2X0YA 4J3XA 2BVDA 1YLVA 5KSWA 1VFSA 2PPGA 5JBEA 1S5TA 1XX1A 1QW7A 3GKFA 4RDZA 3GTNA 5EMUA 4F2TA 4KETA 3WJYA 1Y5XA 4M56A 2Y88A 3SRHA 4P7NA 4QJ5B 4IMCA 4US5D 4MAZA 4MWAB 3GU2A 1TV8A 4I9AA 2R1MA 2WVVB 4JBRA 3GW3A 1CIUA 1A5UA 5F2IA 3RILA 3P2VA 2DPEA 4XAFA 4R53A 3UR2A 3RMEA 5EYWA 2I57A 3WF4A 3PWIA 1XSKA 2HVMA 4JTCA 1VRDA 4UTLA 5D38A 3VGDA 1ZZMA 3KLKA 4BQ2A 1M5WA 2MNRA 1VH7A 3E49A 2XIQA 4D8LA 3OZYA 1MEIA 4MKVA 3S2NA 4K1WA 3DX5A 2VNCA 3BAXA 4UR7A 5DQPA 4GVIA 3PG9A 3CT7A 2PBGA 1TWIA 3PPGA 4IGNA 4XZ9A 5TF0A 4L7ZA 4WOZA 1XL9A 4F0HA 2PB1A 3E74A 4UZSA 3GUWA 4RXGA 3Q94A 1M1BA 1EF2A 2OQHA 1A5MC 3GG7A 1DHKA 3KXQA 3BK0A 4CCEA 1Q6GA 3GXMA 4DUXA 4Q8NA 2WNNA 2RDTA 3PTMA 5F7UA 4LEQA 5A6BA 1TJRA 2BHZA 1L6YA 2W6RA 3TN6A 2B81A 4GJJA 3ARSA 3ITXA 4L80A 1BXNA 3E0FA 1E1EA 1XV8A 3ERPA 1KB3A 2AKZA 1WOBA 3DIPA 2JIEA 2EF9A 4O18A 1SPQA 4UB9A 4AVOA 3S6OA 4I9MA 4UTHA 4LUSB 1J93A 4RZBA 3SECA 1B4KA 3NGJA 2H6RA 2PWFA 2P0OA 4HCLA 4QCFA 4DXVA 1Q85A 1IZKA 4H7VA 1W56A 3M0LA 1NWRA 3T0AA 5A8PA 2PDBA 3P67A 4ZL1A 3CV7A 3M5YA 3RG6A 4AYSA 3TC6A 4RDVA 4B9ZA 4J3WA 2JE8A 2OZ0A 2Y63A 4KF1A 4H9XA 3L68A 3UT0A 1SYTA 4J3UA 2POTA 1B54A 2BXVA 3E3HA 4ZXLA 1JXKA 4HZ7A 1G5AA 2PWHA 3T81A 5C6MA 4O8RA 1LOQA 4XZLX 1EQPA 1N8IA 1H61A 4F48A 4HPHA 5BXTA 1NWTA 4NHVA 3DBNA 3L4WA 3XISA 3SJNA 1VFHA 1QK2A 4DBUA 3C86A 2PD5A 5IFPA 1VFTA 3MI2A 3OBAA 2NT0A 4PL2A 5A2AA 8XIAA 4H3DA 3VKDA 1VPQA 1XJBA 5H8MA 2MANA 4HA0A 3NQVA 4Z17A 4GI6A 5I3JA 4OE7A 5CPNA 5FJOA 3A24A 3T08A 1PKMA 4B5NA 1MMFA 5C5YA 5JH1A 3MSDA 4V28A 1YHTA 4ZSTA 2XH2A 2AQWA 2OT0A 3UU0A 3V4BA 3F4DA 1PZ2A 1KC7A 1GVQA 2QXWA 3AXKA 3W4RA 1PTAA 4GO8A 4C7DA 3AALA 1QNRA 2W4XA 3AMKA 3WMBA 3THDA 2YBVA 4MWAD 1IGSA 4ZQOA 3CASA 4DXXA 1U2YA 4JN6A 1L2UA 2Y2WA 3QHMA 4JZ5A 1JL8A 3QGVA 5A6LA 4D9PA 3OPSA 3WBEA 3CIXA 1QBBA 2QCHA 1YKWA 2ZYFA 4DQWA 3W2JA 2VDGA 3AZSA 3C8NA 5IBXC 2VR2A 3IV8A 1V0MA 2A3BA 4M82A 4MY9A 5FF7A 2C13A 4KGJA 4U2YA 4EX4A 3W76A 3LCIA 3GC4A 4W7WA 5F2LA 2VFFA 4HGXA 1UZDA 1QMLA 3ARTA 1V3KA 3G1HA 3URBA 4C90A 1H62A 5AYBA 2X1TA 1BD0A 1TE6A 4DO7A 1MW0A 2EJ1A 4PSPA 2C18A 4FEZA 4M8UA 1UP0A 3V5FA 2WLYA 4J35A 3GKAA 3H6OA 4MKSA 3S9IA 2HNHA 3CJPA 4M51A 3TXZA 2D69A 1B57A 4J3SA 4WGHA 3VC6A 2PDIA 1XBYA 2YZRA 4IX2A 1XLJA 4ZVJA 2D3NA 5HJYA 3A64A 3FYOA 5M17A 2R91A 1SO5A 5FJIA 1DWAM 1PX3A 3H55A 3A4JA 2CBUA 3IWPA 2HXUA 3SB0A 4MJMA 4NZ1A 1FY6A 1TJPA 3W2MA 2A3LA 2ZRZA 1DE5A 3MVTA 3MP4A 4QEEA 4DUVA 2BP1A 3QV9A 3WFZA 3R43A 6REQB 3ZR4A 5CSSA 2BY2A 4C6BA 3WJSA 2XFYA 3O6YX 2YBTA 1EOMA 3W2NA 1PB0A 4NASA 1U33A 2QCFA 3QH2A 1E70M 4I7VA 1S1PA 2CHOA 3MHGA 2RDUA 4I7WA 4IQDA 3S9ZA 3GR8A 5GJMA 1QFEA 4K6AA 4WD0A 1KRBC 3UJ2A 3L5LA 1XLLA 5M1TA 1XIJA 3W84A 4QE4A 3SY5A 2C71A 1JXJA 2WC4A 1WPCA 1K7XA 1EGZA 2X09A 3AS2A 4ZENA 3C3NA 3QN3A 2ISVA 4ZA0A 4IWWA 1GQLA 2XG9A 2P8CA 2BDQA 1XRFA 1RK6A 2P50A 4LB3A 2VEPA 2XN2A 2FLIA 2FGLA 4IZGA 3HO8A 2ABAA 1JYNA 5A8OA 3UJRA 1XPYA 3G1YA 4H41A 3GZ3A 2VR4A 1XIMA 3QY7A 4W7VA 1KFKA 5G2HA 1BSIA 2EPOA 4IXHA 1VLIA 1E1CB 1KFEA 2DH2A 4Q4RA 4PBFA 4DB7A 4UNLA 1L6SA 3DYMA 2PDLA 2XINA 1LQ2A 4UFJA 1LRQA 2WHLA 4IIBA 2VOTA 3HIJA 3QKZA 4WZHA 5AYZA 1Q5MA 1F05A 3LU2A 2ZE0A 3D3FA 3AIBA 3AYSA 4LCQA 1OEPA 2D2JA 1IZJA 1X8CA 5DMLA 1CLVA 3STCA 1S38A 4DX3A 1DHPA 5CZSA 1TO3A 1O5XA 2OFJA 1OJXA 3NQ8A 3OYXA 1WDRA 4F66A 2C15A 2YCKX 2OVLA 4HB7A 2WBGA 4WSKA 4L6DA 3KHJA 1XG3A 4IJBA 4Z2GA 1LYXA 4MUPA 5HR6A 4O1AA 1YPXA 1JIBA 1TREA 3L66A 3A4AA 1GOKA 3TSMA 3FLUA 3AXMA 3LTSA 1F9CA 3CTLA 2IQTA 4OIFA 1EJRC 4A8LA 3MWCA 3QQWA 3RITA 3B8WA 4MYXA 4GI8A 1I9CB 2BY3A 1KRCC 4IMDA 5D9NA 2E77A 2O4MA 1R3VA 4GY1A 1XLMA 3UJFA 2D3LA 3URQA 1NU5A 1GVFA 3GXIA 2C19A 1FBAA 1Q66A 4JL1A 2VT0A 3IK4A 4KERA 3B05A 3CYVA 2YPIA 3L4UA 4AHPA 3KZSA 4D6JA 4RV8A 1G4EA 5CZ0A 4E6MA 5C9RA 5HUOA 1M9HA 2JF7A 3UZJA 3VGGA 2J74A 1F4HA 1FHUA 1ZBWA 1CGXA 1WOAA 1TV7A 2DIKA 3OVPA 1TMHA 3OHIA 1C8XA 2ZRXA 4G56A 1TR1A 3H4XA 3LSBA 2YW3A 1Y8BA 5J04A 1TPWA 5KTLA 1V6VA 4LGXA 5AYIA 4GNJA 4NQ1A 4PTXA 3M5VA 1B31A 4WJXA 4X2RA 3ZXWA 5AVHA 4MWAA 1SFJA 1DJIA 4Y8FA 5CZKA 3S1VA 1XCWA 2WVVA 1CZ1A 1F8IA 4X3ZA 3G6LA 2DY3A 3WD3A 2YCIX 4OGZA 2YDSA 3F03K 4YCOA 4D6EA 4L1WA 1ZRQA 4OWGA 1VJZA 2OEKA 5D32A 2QJIA 3LCGA 4GXWA 3VTRA 3UZYA 5I00A 5LGZA 3FA3A 3LV6A 4ZZ9A 4AXNA 2VWSA 1QWGA 1J01A 1H0GA 5B7ZA 1JJKA 3BE7A 4ZQPA 1CGWA 2F8QA 3SW6A 1TPH1 2O7SA 3N2XA 2OMAA 2J6VA 1G9HA 3LBCA 1FFQA 2Q09A 1MFVA 1ITCA 1DPMA 4P8UA 4GACA 4H83A 1ZP3A 3QJAA 2DZWA 1JYVA 4JQ4A 4DJED 1DP0A 3EWBX 3BOFA 1WE5A 1L8PA 1AJZA 2WSPA 5D8ZA 2OGYA 3BTNA 3GR7A 3FJNA 1TTIA 2FGZA 3BLDA 3CUFA 3BLKA 2PF8A 5T9BG 3AS1A 3CB8A 2HS6A 1K7EA 5CG0A 3JU2A 4GIEA 4JTIA 4KWUA 1R38A 4ERAA 3TN4A 2NX3A 1WZKA 3QV6A 3C2YA 4LUSA 4PMDA 1QWKA 4AZHA 1K6AA 3O3RA 3PC0A 4QDWA 1AD4A 3LX9A 3H2MA 5KZMA 3LGGA 4XBSA 3W1PA 2XH7A 3ZJ7A 2E0PA 3ZO9A 4EPEC 3NEHA 2YL6A 3N11A 3EB2A 3USBA 3E38A 2JK2A 1NTHA 4PMRA 1RLDA 1XKJA 4H7CA 1E5NA 4YU1A 2YDRA 1R2SA 1RJPA 1E6PA 3BVJA 2ZTKA 3HG5A 4KRTA 4LYRA 4S3DA 2BASA 1EGVA 2R1LA 4KIEA 4O13A 2DZBA 2PF0A 2P0IA 2V68A 4QXIA 1S1RA 2VL4A 1TYGA 3M9YA 3R0DA 1O5QA 3BSMA 1OCQA 3WX7A 4TX6A 3PNZA 1P4CA 3OVQA 1HVQA 4D71A 5CGMA 1UH3A 3ONCA 3ZT7A 1Y5WA 3MUY1 4NL1A 2YGYA 3BMXA 4NU7A 2D73A 3WK0A 1UA3A 2OZ3A 4CN4A 2INEA 3U2OA 2J13A 4RCXA 3PR2A 4A2RA 3BOLA 4IUGA 3R10A 3HG3A 3P0XA 1XLDA 1OFEA 1XS2A 2C0HA 3EKLA 2R82A 4FMVA 3WLKX 1DJWA 4S23A 4OQVA 4XB3A 2VENA 4AWEA 2ALRA 1KLYA 4S3KA 4JYFA 3NSXA 1J96A 1UWTA 3T55A 1H5YA 4LSBA 1H49A 4C60A 1Q7MA 1QI2A 4ZQCA 3NWRA 3QOKA 5FSEC 1J6OA 1JGMA 2PD9A 3NVDA 4U10A 3PJTA 1RLCL 2VEMA 1DWFM 1E51A 3WLHA 4E8CA 1W5PA 4HQVA 1MYRA 3ARWA 3GH7A 3JZEA 3IAPA 1MQQA 2V3FA 2XIMA 2EPLX 3UZ5A 3LTPA 2R24A 2Z6IA 3OHMB 4XVEA 4GI9A 3WMLA 2EJAA 1RQEA 1ZALA 3W25A 4MG4A 1LM1A 1XPGA 2OSXA 1QTWA 4PN2A 4CQ8A 3WJWA 4LAKA 2E9LA 4AZBA 1R85A 4HPXA 5AECA 4C6OA 3CXOA 3P0WA 2DH3A 2O9OA 4CD7A 1LL7A 4A3HA 4FB7A 1VBJA 4L4LA 1WAWA 2YXGA 4O14A 1EX1A 3VM7A 3N18A 3T0BA 2X16A 3P60A 3RGTA 1W1PA 4YPJA 4N6EA 2GVYA 4OU1A 1MXSA 5A2BA 2OODA 1IXOA 2BXZA 2WJFA 5L6UA 5JH2A 3DFTA 3STEA 3PZOA 4AZCB 4V15A 3TTQA 3LZ5A 3WLIA 4N6FA 2XSAA 3S5ZA 3CAQA 1S3TC 4AH7A 2DUZA 5CC3A 2ASHA 3TQ0A 4CN1A 3CUGA 3DEQA 3KCLA 4UMAA 2BSLA 3LGEA 4AHQA 3VUPA 1KLZA 5JMUA 4F0KA 3BMVA 3LPOA 2PLCA 4I7UA 1TUFA 4DHGA 1OWQA 3OBEA 3AZTA 4I8DA 2OZTA 2ZRVA 3ARQA 1I45A 4WDTA 2FDSA 4RE3A 1AMKA 1XYCA 1M7JA 2XZ7A 1U30A 1GOXA 3MDUA 2O4QA 4UOJA 3W7DA 1RPKA 3BGAA 4UQAA 4AEOA 1O66A 4NIRA 2ACQA 4S38A 1YX1A 1FDJA 4N9DA 2OO6A 3KCJA 3NPVA 5PTDA 4KWSA 3W38A 3NQDA 1R46A 3DFPA 5FA5A 3QHNA 4ZODA 1KGWA 2V2HA 1XIGA 1A0EA 1KCKA 1W1TA 1UH2A 2WZMA 3PSVA 3UZZA 4PULA 1XIDA 1P0KA 2GGHA 1RA0A 5LHFA 2ESCA 2CHRA 1F7BA 5AVNA 1TR9A 4NZ3A 5ABEA 4YWIA 4KPLA 3PVFA 1TWWA 3JW7A 5M5DA 3MO4A 3IJDA 5F2GA 1QDSA 1JPMA 1SR9A 1A49A 4DPQA 1NARA 5CZJA 3QKEA 4DJEA 3T44A 4RNJA 1E1CA 3G18A 4CEXC 3GM8A 3W53A 3VNKA 1BTCA 2XTKA 2Z1XA 2QIIA 3KOXA 3BAWA 2X2GA 3Q65A 3MBFA 3GY1A 1UB3A 2BODX 4Q4OA 3VK5A 3LHTA 4B91A 1ISXA 1I1XA 5IXEA 2W0UA 2G0WA 4DAIA 1TJ1A 2VZUA 2PC8A 1IWAA 4EVZA 3W2LA 4L64A 1GT8A 2UY4A 3GDBA 1PVNA 2V2CA 1OT1A 4GI4A 3IIXA 1VEPA 4KT2A 3CUXA 3EPMA 3DYPA 4I5UA 4J5NA 1FWRA 3MYPA 4FALA 1T40A 4G8TA 1HIZA 4HCDA 3TH6A 2W79A 1C7SA 4AIUA 3TQVA 1I8JA 1K9FA 2QJGA 1R2TA 4E2OA 1HL2A 4H8VA 4XKYB 1MO0A 1A3XA 2W67A 4PC8A 1H3GA 1X6LA 4XO7A 2HRWA 4XK2A 4AIBA 4L9ZA 3W9ZA 3W1MA 5EGRA 1A5SA 3RR1A 3FXGA 3TLLA 4OT7A 1SSDA 4QG8A 3ZLHA 3T4CA 3KVMA 1BHGA 4Q8WA 3KRZA 1AZ2A 4JTRA 2EPKX 2RUSA 1AZ1A 3AUOA 1BVWA 1KCXA 4O53A 3QOMA 2CLOA 4WDXA 5I3FA 2GJLA 2ABBA 4TXEA 2OLHA 4H8HA 1IHIA 4IG2B 3SCUA 4PUUA 3SQSA 3VKBA 3F2DA 3WQEA 4JTLA 1VCGA 2CKSA 4V33A 4GKTA 1E0TA 1XDLA 1Q6CA 5LHEA 4R9XA 3HPZA 5HWJA 1TPC1 1Q6QA 1IEXA 1E6XM 1O95A 1YW1A 3SCSA 3LNPA 4CCZA 1IWBA 2PTZA 2YLLA 4LJ3A 5E0KA 4FIRA 1MNZA 1F6PA 2PDWA 3STFA 3AYTA 4Z2KA 4WR3A 2HISA 3ABXA 3ATZA 1JGIA 4HK5A 1TUXA 3WH8A 1JCJA 1MRAA 2FB2A 3CQ0A 3LHVA 2HSAA 6TAAA 1MQPA 4PFMA 1M6JA 1LF1A 4XUGA 5EFDA 4HHHA 1F6YA 1XXXA 4LUJA 1XKYA 4CQCA 3ITGA 1JFXA 1SO3A 3NCOA 2BBFA 1HO4A 1F61A 3AHZA 3RRXA 4JIQA 5AHLA 1OG6A 2OO0A 2FZ8A 4F2BA 3II1A 2FVLA 4Q6JA 3PBMA 3WD2A 2P8BA 2ZZ1A 3SCOA 3OGVA 4A8IA 3P14A 3FKKA 2W63A 1HNYA 3KVJA 4NJKA 1VD6A 4MB3A 3OP2A 2BS9A 1EBHA 2YFNA 1JZ6A 1KWKA 3BXWA 3PSWA 3E2QA 2ZDRA 2CZEA 1J0IA 4FOUA 4EF9A 5HPOA 4JAWA 2XPKA 3GB6A 2WVSA 3CPUA 5AZ1A 3E0WA 4GLEA 1UASA 5GQBA 3PP7A 3E96A 3LI1A 1PAMA 2VZSA 2NQZA 1UWAA 6ENLA 1J0YA 4EPDC 2V5JA 3KRUA 3UXAA 4AY8A 1X1OA 4S3BA 1DJZA 1TTPA 2BLEA 1LLOA 1W31A 3W24A 2G97A 5JXQA 3U0HA 1FA2A 1ODZA 3TROA 4L4MA 4WKAA 3MCMA 3BURA 2R1NA 2PP3A 1X1ZA 1NFPA 2C8NA 3F4WA 4Q8VA 3VCCA 3VGEA 3H2EA 2V69A 1FVPA 3H7RA 1FXQA 3AXHA 3QTPA 1GWJA 4NJIA 3NFUA 1GEQA 1XM3A 3UESA 4KESA 2O9TA 1BF6A 5DN1A 4HNOA 1FWAC 4GNVA 3W1AA 5G1TA 2VWTA 4W87A 3ZIZA 4JDBA 4J27A 4OV4A 3LBMA 3M6YA 4M29A 3BG3A 2VO5A 3WBAA 4JEQA 3IVSA 2FFCA 4DWSB 4H9TA 1E5JA 1AVAA 1V0NA 4ILSA 5M3WA 3DG3A 9XIMA 4PRWA 1ML1A 3KZPA 5A6TC 4NRRA 1DIOA 1R9YA 2Y24A 1TV4A 4FXFA 1R3WA 4UNKA 2VKZG 1G0CA 3IJIA 1BG4A 3FX4A 1V3JA 5AYYA 2J62A 4HU0A 2HE8A 2Z7KA 4Y9AA 1UPPA 4KH2A 1JZ7A 3MJMA 3FYPA 1W0MA 2VC6A 4YTRA 3VFCA 4GQRA 2D20A 3MB9A 4UWMA 2JQXA 1DIKA 4R85A 1PBGA 4E2BA 2CLLA 2QCDA 5A8QA 4XBKA 2ZADA 1GJPA 3H2FA 4Z2JA 3PZGA 1OC5A 3OQ8A 3TXVA 3OZPA 1W5OA 3L23A 3OLDA 3TCSA 4IFRA 1EJUC 1Z41A 1BXBA 3MTWA 3AAMA 1EJSC 2VP8A 2UWFA 1C3FA 1O12A 3AXXA 4Z0SA 3UXKA 5DCDA 3RCNA 4DBEA 1Q6FA 1OQFA 3PANA 2WMJA 3HPAA 5BW6A 2ZUUA 3S1WA 1GYMA 4BFAA 3W72A 5CPLA 1W3JA 3BUVA 1PL9A 3K5XA 3T07A 2C14A 4X0VA 3CNYA 3GTHA 1O68A 2EGZA 2AL1A 3TJIA 4HPNA 3VCNA 2Z4GA 3PZQA 4PEKA 5HAOA 3LLFA 2GPTA 3O8AA 3W73A 1EPVA 2DP3A 5ABFB 1CENA 4QDMA 2E09A 2Y5JA 4NAFB 3T4WA 3BAJA 1BYBA 4KRUA 4UR8A 4YHEA 2X7WA 3HGOA 3DKLA 1LQAA 4LU0A 3AJXA 4GINA 4TU1A 2EG7A 1E3XA 1F4AA 3UA4A 1HQTA 2A5HA 5D9MA 5CC6A 2G3JA 1CPUA 1ZU8A 3ZSTA 5C9XA 3W70A 2Y7EA 4FX7A 1R3SA 3RJYA 4UC5A 3TYDA 1UZ4A 4O11A 4AC7C 4BZYA 3LHYA 1UROA 4FSAA 2VGBA 1J4EA 4NF7A 5G2WA 3PG8A 3LHWA 3I4KA 5EMYA 4YWSA 4C1NA 4MZYA 2FTWA 4FNSA 2ZX7A 4UCFA 3SBFA 4EPBC 1Y7VA 5A95A 3GG8A 4TTUA 1E0WA 3KE0A 3E5PA 2QF7A 3VD4A 3LMYA 4FHAA 3VNYA 3F7JA 3FVMA 1UKSA 3WLNA 4Q4KA 4DWSD 3BJFA 2ZRWA 3NM3A 3WUEA 1HFBA 1TPB1 5DEZA 4DJFC 1NP2A 2QF8A 5M2FX 2GQ9A 4NRSA 2PI6A 3U8GA 3TVAA 3KRBA 3P8JA 1OBAA 1R86A 4NZ4A 1GG0A 5BOEA 1QXLA 1M04A 4UQBA 2O9RA 1IR2A 3IK2A 1TV3A 2E28A 5A6MA 4DO5A 1XCFA 4YTSA 3SSZA 1Z48A 3ATYA 4U5IA 4OJYA 3LCHA 3WQGA 3NAVA 2CFFA 4HNLA 2IQ0A 3NURA 1GEHA 3MZNA 3PB0A 1TSIA 4UQEA 1WZAA 3EWUA 1MWOA 3PK7A 3FDGA 4MM1A 4N9EA 3SGGA 3WH6A 4LS0A 3UQNA 5GNYA 4BY3A 1WZMA 4O1BA 3QY6A 4RNHA 1FCBA 2PRMA 2R94A 4CNUA 5LGXA 1TELA 1I0BA 2PRHA 4GH3A 1GW1A 3F1QA 2W27A 5A6AA 2J78A 3WNMA 1WXYA 1T8XA 1FXPA 1CT5A 4IPNB 4AF0B 4NJJA 3W82A 1KXVA 1TVLA 2FQIA 2HBVA 1KFWA 1TX2A 2A3CA 4RUBA 2KX9A 1FCUA 1WX0A 5CQ1A 3ZT5A 4LF1A 1T7LA 3A4WA 1K77A 4C6LA 3QC3A 4RK8A 5H8UA 1H2JA 4Q8OA 1KKRA 4H7ZA 1SO6A 4AWSA 4B16A 1UH4A 5LNWA 5TBOA 5D30A 4A3RA 4LC8A 1LL4A 4GUGA 3XIMA 4KQNA 1UHVA 2QGYA 4DF1A 3NQ2A 1WDWA 3M0ZA 3CC1A 3HQOA 2RAGA 4UTWC 2WK2A 1EP2A 5CXPA 4HMEA 3UBPC 1KKOA 3BGJA 4XKYA 4NX5A 1LOLA 1UQZA 1OK6A 3CT2A 3NQBA 3GR4A 3NO1A 4MTVA 4K36A 3WDPP 1MUWA 3WLSA 2J8GA 1E6SM 4GRSA 3LOTA 3WCZA 1FWIC 1ICPA 2BG5A 3WEZA 3F4CA 4ZQRA 4MF4A 3NYZA 1ZQ5A 2OG9A 3EEGA 4D6FA 4IIHA 3LBOA 3FHQA 4D6DA 1N2VA 2JEQA 5H6HA 3TR9A 2BZNA 1M03A 2EG6A 4XD5A 4ATDA 1T5AA 3M43A 1RVKA 3TC3A 1WCGA 1N7KA 2BNJA 3VMOA 3W2UA 1CXFA 3HM7A 1E4IA 2PURA 4DY1A 1OZMA 3EWYA 2GJXB 4B4HA 2CNCA 5CSYA 5E09A 2LLEA 1OVDA 3NL5A 4WJ8A 1U1HA 1W54A 5CGQA 4M80A 4KS0A 3C2OA 1AJ2A 5BRBA 2FTPA 4BS0A 1LCOA 2OWXA 4WQ6A 4ADTA 3GYEA 3WN6A 1NVMA 4Y96A 4UQ9A 3IS4A 3PHAA 4B3KA 3DFSA 4P2VA 3L21A 4XZBA 5LA2A 4AC1X 4YLWA 4AAJA 4Y9PA 3W28A 3BW4A 4NZFA 5EMMA 1I6NA 4ACZB 3ZZ1A 1QPNA 1VJSA 2FVMA 1UPMB 3CQHA 3P61A 1TWSA 2WQDA 2NSXA 5DBTA 3SQMA 1WA3A 2ADAA 1VHNA 2QAPA 2REQA 3O2LA 3N2OA 4UTJA 3S42A 1R0MA 2ZTJA 3M46A 4RNFA 5AC5A 1Q6EA 1JDFA 3UGVA 3T42A 1ZJBA 2XIOA 3HA1A 3B97A 3FKRA 4UTFA 3EWWA 1YXCA 5C55A 1XCXA 3VX1A 5JIPA 2YXXA 4WOQA 3AMCA 2CCRA 1HX0A 1Q2RA 5T8GA 5FEZA 3INPA 1W1B1 1US2A 5K9DA 4Q32A 3UXDA 4TMCA 1GYLA 1GJWA 1QHOA 1YBQB 5EFFA 4DYEA 2R1KA 3I6TA 3GXNA 3ME3A 1BWKA 1DQXA 5F4WA 1VCVA 4JHOA 5C2XA 3ARYA 3UG4A 2RFGA 4E8GA 4GH1A 2NQLA 3H7UA 4NXKA 3U2CA 4J7RA 4AD1A 2QS8A 4HSOA 3SDOA 4DBDA 4JICA 1JUKA 2QPSA 1SGJA 2EPHA 4ASTA 1SJCA 3A23A 5C70A 1SZRA 3W7EA 4B92A 4TVCA 4L1XA 1HN1A 2RJHA 5EL1A 1SMAA 3H24A 3LHZA 2Z24A 3AYVA 3CAVA 3ITTA 4OZOA 4E4UA 4NP7A 3GX9A 4QBXA 1YTDA 2F6UA 1I2RA 3DHDA 4DF0A 3GG1A 3C3UA 1ISYA 4XTIA 1F3EA 3ZJ8A 2WJEA 3TCEA 4HU8A 4F3HA 2QIWA 1CW2A 1VCFA 3I10A 3R11A 1UIPA 2O92A 2VXNA 2OQYA 5G4EA 5KITA 2G41A 4DWSA 1K8YA 3L9CA 1ONEA 2R1PA 3M07A 1V8EA 4A6GA 3NDOA 2XGBA 3OG2A 2OU4A 2GWGA 4H00A 1TMLA 1BGGA 3AIQA 1FKXA 2X2YA 1RP8A 4L4PA 5D2XA 5C8BB 3MMDA 4XSMA 3A9BA 5D05A 1V5XA 2H3DA 3W7IA 5K3VA 8A3HA 4LT9A 3GD6A 2I5IA 3NDZA 4A05A 1D8CA 4XTDA 2AMGA 2F9RA 3NO5A 3G0SA 3LA4A 1QATA 3E5BA 4ZOBA 3F2CA 2C79A 1J0KA 4PCPA 4EOUA 1F2JA 4LVAA 1BYDA 4J28A 1VHCA 3KLLA 2EG8A 4AWTA 5CPQA 1M53A 4JS3A 2A7NA 4P5UA 1BQCA 1MXDA 2E4TA 4DLFA 5E9XA 4O57A 3R79A 2P10A 1NEYA 3MPGA 3QR3A 2A21A 3BCDA 5J5DA 5LIKX 3VZYA 3UA3A 3O0KA 4M6UA 4H2HA 3ZR6A 3DFHA 3A5FA 5I77A 3WL0A 3LQGA 3MW7A 3QGAC 3PBWA 4JCLA 3GE7A 1PUDA 2DZVA 5HNNA 3MU7A 3PWAA 1JZ3A 3OQEA 3Q4DA 3U57A 1D8WA 1XQLA 4HA4A 3B8DA 3WELA 1V93A 1AG1O 4X60A 8XIMA 3M41A 3PULA 3GW0A 3WLOA 5A8NA 2WOQA 1EPXA 4F9DA 2JKEA 1SFLA 1ZY9A 3QMTA 2NV1A 4B90A 4TX9A 2CETA 3C2RA 5I7GA 1EB3A 1XH1A 3ANYA 3SAZA 3A5VA 1P0DA 3DG7A 1LLWA 4Y9OA 1EL3A 1KM0A 2ZVIA 1QOQA 2YA1A 3BCFA 3R2GA 3SRKA 3W7OA 1ZSXA 2Y1HA 3VU2A 2QCLA 3WSUA 1HW6A 5KETA 4LBRA 5ABFA 2W91A 1CXKA 3MO7A 4MIMA 4FNUA 1G4SA 2DT1A 1W3LA 3N17A 1OX4B 2WB5A 4XX6A 5JBDA 4AFYA 3IJ7A 1NM9A 5AOUA 2PWUA 4HTYA 3I68A 4JKMA 1UW9A 4URIA 5JVLA 3SCRA 2RGLA 2Z2AA 3KBSA 4ZB2A 1HP4A 2FTYA 4GO9A 1BXCA 3GHTA 1IF2A 2PRLA 3VI2A 3CAKA 3UWZA 3W1RA 3BLOA 1VQTA 2E9MA 4CNOA 3PBVA 1JZ2A 5LIUX 4GMEA 4JKKA 2DSKA 3CZKA 3W01A 3N29A 4JL2A 1P1XA 2CITA 1GQIA 5EA9A 1YRRA 4GIAA 1I0DA 3TW6A 1RALA 3RHGA 2VR5A 3LEPA 1SSGA 3GUGA 3NVTA 4GCXA 4HIBA 3NYDA 1OFRA 1MDRA 4LC6A 3V1PA 3TAKA 3RLUA 2ZX6A 5DCBA 2G50A 4JGDA 2FJKA 2QV5A 2GUYA 1KR1A 2NQHA 3GXFA 3V5CA 1HKIA 3IIVA 4LFYA 1PDZA 1SZGA 1ITXA 2UY5A 2ZZ2A 2XZ9A 2XJ7A 4DJDD 2YA0A 4V1XA 3IUIA 5TAOA 3MJYA 3SCTA 3K13A 3QY8A 2Z25A 2BV9A 4EANA 1CXHA 5J8LA 4HOZA 2PDQA 4QLLA 3ES8A 3WD1A 2QZRA 2GOUA 3AISA 3N14A 1OD8A 3CTTA 3MDWA 5ECUA 1TWZA 2E40A 4Z42C 5BOOA 1JI1A 2ZZ5A 1XD0A 1E0VA 3G1FA 2ZX5A 3U2EA 4AF0A 3VKKA 3QYSA 5GJPA 3VIGA 1WUEA 1ZL1A 3C6CA 3UWVA 1BKSA 2PMQA 3POCA 1JR1A 3WEMA 1J12A 1OFBA 2Y62A 2V63A 2WVTA 3ARZA 1XGEA 3MKCA 5CPOA 2HVOA 4FLQA 3MC5A 3SIMA 6TIMA 1GKRA 4JTFA 4EAYA 4CKQA 1TQXA 2Z1WA 1FDYA 4MZ8A 1CGYA 1HF6A 1W17A 4CLMA 4AZ6A 5RUBA 2V5BA 3IANA 1KCZA 1T99A 3ARRA 5CG7A 2GJNA 4P7OA 1CXIA 2W61A 4D2JA 3EDFA 3KOFA 3PZNA 5CJ5A 4G7EB 1UCWA 1OFDA 3FFSA 1VKFA 5HBFA 4GK8A 1RR2A 2ONEA 4GABA 5AN7A 4IJRA 1S2WA 4BQ4A 3NQAA 3TN3A 2DZTA 3VOHA 3D6NA 2J77A 4RKAA 4W8BA 2I9UA 4N9BA 3T2OA 1TZ9A 4ECLA 3L2IA 1X1NA 2XWEA 3RUBL 2V38A 3WDHA 2V6AA 3EA1A 3F5JA 2PE4A 3P84A 4DYKA 3CLMA 1XIEA 3W7MA 3M7SA 1EFZA 1E15A 3H54A 2GJXA 1BF2A 2DIEA 3E9AA 1Q65A 2KAUC 5B80A 4DO6A 3U2ZA 3MHFA 5IHRA 3SADA 4MADA 2C3ZA 3G1DA 2B7OA 2OEMA 3QR0A 2DT2A 1EXBA 1ME7A 4R27A 4ADUA 1PPIA 3LYEA 1MNSA 3DDMA 3R8RA 3A12A 4YYCA 4K7YA 5CEWA 4B3ZA 3GNPA 3OODA 1GOWA 1WXZA 1NOUA 4TR9A 2CEQA 4DI9A 1RP9A 3RXZA 4ACZA 4FX8A 3NQMA 3OB8A 3TYBA 2WMFA 1CGTA 1IT8A 3UWEA 1E9ZB 4NNBA 2F2HA 3GNXA 4PMYA 3M0XA 1F6KA 1Q6OA 2QVHA 4NG3A 4HNTA 3L2LA 1IE7C 2NV2A 1ICQA 3W22A 4FPSA 1D2KA 2ZRUA 2CERA 2ZUMA 4RW3A 1ODUA 2XFWA 4R34A 3R58A 1H09A 3N6HA 1SZFA 1OC7A 5LA1A 3QPZA 4D8ZA 5HR7A 4S2BA 1VBGA 4LS2A 4P7LA 3VFLA 2QCMA 2DT3A 1SZEA 3DG6A 1AJ0A 2EEXA 4YN5A 1OT2A 3N2CA 1XUZA 3EOSA 4HOXA 1UKOA 3LPPA 1B30A 2DVXA 3B8VA 1QRQA 1VIZA 4H1ZA 1FWTA 4ZGYA 4IUOA 4JTAA 4EKJA 1XLKA 4JEJA 3N9SA 4KGLA 4ZR8A 1XDJA 3OGSA 1DXEA 3QGKC 1AUSL 1EXPA 1IEQA 2PTXA 4AD3A 1UMLA 4MWAC 4AZ7A 1H7RA 5DCEA 1XF0A 2VD9A 2WYSA 3WY1A 1ZCOA 3AI0A 4QLJA 3VDAA 4EE9A 1XLBA 2F38A 4KEZA 3UG3A 4S3EA 1UR4A 4BCEA 2YBUA 3L5AA 1POJA 1UIOA 3LCWA 2G4JA 3CPGA 4IPJA 3CEUA 3SURA 1EX5A 1RCOB 2D2OA 1VGAA 3VE7A 3ARVA 2YX0A 5FI8A 3FAXA 2A85A 3S1GA 2GSHA 2KZHA 4TVDA 4XVDA 1KFCA 2OYMA 4Z1DA 4GXPA 4CQAA 3LTYA 4O4WA 7ODCA 3K4DA 1KM6A 2DQWA 1GOQA 3QSTA 3BDKA 2NQJA 2PLJA 3SI9A 1R5YA 1RCQA 1TIMA 3V0SA 3WNLA 5M03A 4JHMA 4GC4A 2QHAA 4DJDA 3ZWSA 5E6ZA 3UJEA 4HZ6A 3QZAA 2Y5EA 4PUNA 3WQDA 2E7FA 3CYJA 5BNKA 3TYUA 1KR0A 1T8QA 3HG4A 4PMXA 1S2VA 2BWGA 4FA3A 1KFBA 4XSLA 2J7FA 4M7SA 2IPJA 4TUFA 5FAGA 1HP5A 4GQGA 4MNKA 3I7QA 2WWDA 1UWQA 1UR0A 3RDKA 3EAUA 3WLPA 1VFOA 5C71A 3G3DA 4LY8A 5T91A 2QT3A 3EMCA 4YHGA 1K1DA 3I3EA 2VTFA 3OO2A 1ISWA 3HV8A 2V82A 4US6A 1W5MA 1FUYA 2VX5A 3PTDA 3WBWA 2C0AA 3BMWA 4XBJA 1A5OC 3MYOA 1EH9A 1VEMA 1PDYA 1J0ZA 3GWQA 1PHWA 3TTEA 1OFPA 1E9LA 3TV8A 4PCSA 3EKGA 1JCMP 3WJXA 1V6YA 1HVXA 4IMGA 4X0NA 3RO6A 4QHRA 4DZIA 3G77A 3UFYA 3RPMA 1H50A 3WDQA 2X0SA 1VLWA 2V9DA 2V5DA 1ECEA 1YNQA 4LX4A 1CI1A 4QJ3B 1Q8JA 3ZLGA 2PDUA 4DM1A 2DGAA 1WNOA 2G3FA 3TW9A 4OBTA 3STPA 2BVYA 3ORWA 4JNYA 3PY2A 4IFOA 4LAZA 1TPVA 3GS6A 1OX4A 4A3QA 1XIIA 4MJ2A 3VIHA 1VAHA 3BV7A 3IGSA 5MKGB 2ODOA 2VEKA 4ZFCA 1YEYA 1T6MA 3VC5A 1XLCA 2F84A 4AYGA 1AODA 5A3HA 5LIWX 4RR4A 5K4ZA 2G5WA 2BGNE 1X6NA 1KXQA 1LG2A 1V0LA 1ZJHA 5I3DA 2IPGA 4ZSUA 1LBMA 2FZBA 1H41A 2DSWA 4UTUA 1O6IA 1OFOA 3LRKA 4NNAA 3N9KA 1Y5VA 1LOSA 3PZMA 1UD4A 4QJ4B 3WF3A 2QJJA 2QV4A 4Q8TA 5TD4A 3LHUA 3GNOA 4L65A 4FX6M 2CBIA 1UR2A 3VOJA 2YIHA 3CAWA 1GCYA 4I5XA 2ACSA 1OB0A 3HQ1A 2ZRYA 2QJNA 4G9PA 4IQEA 4RJEA 2RHGA 4W4QA 4ATLA 5L9FA 3TIMA 3V75A 4XAZA 5HMEA 2PP0A 4BK9A 4IP5A 3TSBA 1CBGA 4AIOA 1QI0A 5DANA 3VX0A 2HE5A 2ZZ3A 4S39A 4IPPA 5AHFA 3F2BA 2PLKA 1IXPA 1QOXA 1PKYA 2WW5A 1FKWA 3RU8X 5E6YA 1HO1A 2JF6A 4O4VA 3W7KA 1CECA 4GYFA 1HGYA 1WV2A 4MPQA 4LW7A 4E2VA 5AFDA 3CMFA 1H5VA 3VE9A 4LYQA 4FF5A 3QEZA 1WXJA 1TPDA 1PCKA 7REQB 4JQ3A 3V7PA 1A4MA 3IACA 3WLLA 3WK1A 3AOFA 2HXTA 3MSYA 1VRXA 1EWDA 5C0QA 3R89A 5CSUA 3IJ9A 1UR9A 1KXTA 4E3VA 2YCLB 3W71A 1HKKA 3R13A 3QV7A 4F79A 1QT1A 4DXKA 3AIUA 3MMUA 3PBGA 3RK8A 3W7QA 3MUZ1 4B5WA 4KIRA 4IOTA 4JFTA 3BLFA 3N2BA 1PZ3A 4C6PA 3EDJA 4PMJA 1O5RA 3N3TA 1P0EA 6ALDA 1JDEA 1KV5A 1WKDA 4ZCWA 1EO5A 1BQGA 2IXUA 4M6VA 1CEOA 3KTXA 4ZQMA 3SUTA 4KCWA 4P61A 1QNQA 2CXEA 1Z44A 5EY5A 1VBRA 1J18A 4WLCA 1HKVA 1MI3A 3CMGA 4ZB0A 1O7AA 5E0CA 3PZIA 1FWGC 4O52A 3H2NA 1ONXA 4XAGA 4G7EA 1L2QA 2JGQA 2C7FA 1AD1A 3HOJA 1OFAA 1OGBA 1FWNA 2XISA 1ZBCA 4AD2A 2EBNA 1S2TA 1WKYA 1HKJA 2PLMA 4GUJA 4GBUA 5HWMA 1J79A 3S6DA 1VJIA 2YSWA 1E71M 4QM1A 5ABGA 4DJEC 5BWFA 4GZIA 1BEUA 1ZJAA 3QZEA 2DZXA 4DUWA 4PYSA 2QJHA 4FR1A 1SW0A 1F3XA 4O19A 3KL5A 4GA8A 4F0MA 3RCMA 3WBXA 4KBXA 4R9OA 3G0UA 4TX8A 1JQVA 2IPFA 1V7AA 4KCTA 5KEZA 4PTVA 4JY8A 2BOFX 3B4YA 3PTKA 3DFNA 1UA7A 3WLJA 1NDZA 4RE0A 1G4TA 4HZMA 3NGFA 1QPKA 3DGBA 1YADA 2J9ZA 3T0CA 5EU9A 2XIBA 2ZA3A 4ZO7A 4UOQA 3N34A 4NVTA 3W23A 5FEWA 1ZS2A 2GUUA 1JEZA 1MQRA 1A5AA 3D3AA 1OGSA 2CLIA 3KS5A 6PTDA 2NXIA 3UCDA 4ZQNA 1W5NA 3VNMA 3IEBA 4QROA 4LRTA 3E0IA 1JUBA 3AQUA 4IL2A 2HK0A 4L61A 2XVKA 1EP1A 2CU0A 3CWOX 5GJNA 2CBJA 5CZTA 4L6HA 5GPRA 3L0NA 3UF9A 2Q3OA 4A3YA 3T9PA 5CAKA 4LOCA 3T2PA 2E6FA 1VF8A 1FDZA 1CDGA 4H9ZA 1GYNA 3E02A 4E8DA 3PF3A 1FHDA 3L5MA 5HXMA 3ZMRA 3LM3A 4RX0A 4K68A 3I3BA 2VMFA 1TJ2A 3G1VA 3TNOA 2WZEA 3MUXA 4YVPA 3BWWA 4EXQA 2TMDA 1FQ0A 1XDMA 2BOGX 3IJ6A 4S3CA 1DJQA 3SZ8A 1EZ2A 4JTUA 4C7GA 3T0DA 3K1GA 2WKLA 3SJ3A 5MHBA 1JD9A 3RM4A 2QULA 3SUWA 2X40A 3IRSA 3DCPA 4PUDA 3EOLA 1UBPC 5LNSA 3WDRA 1FH8A 1A5BA 2C1HA 3D46A 3QSRA 4PBGA 4AQLA 2QVNA 4MFDA 3B9NA 5CLWA 4Z1AA 3H8AA 3N2MA 2XSXA 3A9IA 4JCMA 3DKJA 3M0HA 5FOOA 4QDPA 1D3CA 6A3HA 1GOMA 3LD5A 3TTYA 5C54A 1S5WA 3C8FA 4R7JA 5GNZA 4ONVA 2X7VA 1QCWA 3VGFA 5LIXX 4Q8MA 3BL3A 5E5CA 3GTFA 1J11A 3BLPX 2CZDA 4CU6A 4MWAE 2PDNA 3ZVHB 5MF5A 1K3UA 3L7RA 2ZZ6A 1LLZA 3QMRA 3WUGA 4MUZA 1TTJA 2X0HA 3GHRA 4HP5A 3TMQA 1TRIA 1DQUA 1W3IA 4AG0A 3A3XA 4PCTA 4AY7A 3JR2A 2VFDA 2Y89A 3CZ8A 1F07A 2UZ9A 3YPIA 5H91A 3TK7A 3EX4A 1W8GA 1UWSA 5REQB 1W1YA 3HFYA 5F2MA 3W3OA 1HJSA 1ZFJA 3CL7A 3W1UA 1IZCA 6XIMA 3TQPA 5FJUA 3V3WA 4XQ6A 3E2VA 1WB0A 1VYPX 4LUYA 1TE1A 3RPDA 1KM4A 1UC4A 2DUAA 2G95A 3GK0A 2JIWA 5D4YA 1UP3A 4X2PA 3V36A 2UV8G 3MUIA 2XVGA 4JN7A 5FL1A 1B3YA 4F9JA 3LSCA 1D7KA 4US5A 1AH4A 3KBJA 3DGRA 2XVLA 1X96A 3ABZA 1E73M 3TOPA 1QI3A 2YL8A 2EQDA 3W83A 1OIFA 2E67A 1IGWA 4XUYA 1ICSA 2FHFA 4QG6A 3HU7A 3A6OA 1VBHA 4PZVA 1PIIA 4JIPA 3WH9A 5C7HA 4S1FA 3DENA 1W37A 1W1IE 1LP6A 5IFTA 3L4ZA 5AHEA 3EX2A 2DJLA 4M1BA 4R5EA 2VYOA 1ZAJA 2Y70A 5EKYA 3SCNA 1PX4A 3MP3A 1C92A 3MUCA 1BVNP 1FH9A 2YCJA 4WIWA 5JQ9A 3NL2A 1R9ZA 3WG6A 4B5TA 3GAKA 5CBJA 3GC2A 4Y8EA 1V02A 4LQ1A 3LNMA 3DZ1A 3TAOA 5I03A 4NSBA 4ZB5A 1Q45A 2HCVA 1UOZA 3KS6A 2ZQ0A 3FJ6A 2B0MA 5BROA 3LPGA 5D2WA 2WHJA 2WMGA 4Q4QA 1OG0A 2Q8ZA 1HJUA 2HPMA 1S2UA 4LAMA 2E5DA 4P8VA 3TLQA 3G1SA 3NZPA 3A13A 4JFWA 4LXFA 2EAWA 4M19A 2ZA2A 2Z00A 1DJYA 1VS1A 3RMJA 5MKGA 1H1YA 3PM6A 1REQB 2J7DA 2G8ZA 4AU0A 2CYGA 2CLMA 3EX3A 4Z1YA 4TO8A 3LN3A 4UOZA 2ZUNA 2BY1A 5GNXA 3PBUA 1C9WA 4YTQA 2ISWA 3UGRA 1ZNNA 1OF8A 3UG5A 3WNNA 1EDQA 4M81A 4WF7A 5F1UA 1DJNA 4JIIX 4FNQA 4KRZA 3PUEA 5LA0A 5EPDA 2VEGA 1DOSA 1KRMA 2Y6ZA 3M6DA 1AA1B 2CPUA 4K1GA 4CVWA 1CYGA 1V3LA 2GJRA 1ZP4A 2GSEA 3HZ3A 1E6NA 3H12A 3O63A 4JY9A 1B3ZA 1Q8AA 4GVGA 3W6YA 2J9XA 4Q7NA 1DJGA 3BLIA 2VQTA 1H0IA 3BICA 3LERA 2ZZ4A 1ZCCA 1MZHA 4CCCA 3KDNA 2O7QA 1L8NA 4UBPC 3UXIA 3FYYA 2QGHA 3VNLA 4AZGA 2XM2A 2VHLA 1SJDA 5I3KA 5D02A 2PU1A 2FMOA 2HVNA 4DEFA 5I02A 3OU8A 3EB3A 1JAEA 1OK4A 2OWCA 1N82A 2OKOA 3Q37A 2I5QA 4GYJA 1KBLA 5BXRA 4C6IA 7REQA 1DEDA 5AHMA 1OD0A 1I60A 2J7HA 1E6ZA 3LCFA 1K9DA 3GVVA 3PN8A 3BGGA 1ITQA 4MB1A 3N4AA 3CZLA 2ZFAA 3WUBA 3G5EA 3GTXA 2ZBTA 1QOPA 3BPWA 2V3GA 2BOEX 2FZDA 3I6RA 4YTUA 4P7QA 4AISA 1CLKA 1GVIA 3P81A 3WLRA 2OT1A 1QR7A 2YCLA 4JIHA 3OJGA 4C5ZA 3HQPA 2A2IA 3KVLA 3ELFA 4DI8A 3WBYA 3XINA 3KOWA 4ZO6A 4DVOA 3L0KA 3NOYA 1DKWA 2RKXA 4JPGA 2AGKA 3M0VA 4PMUA 1PYMA 3FNDA 3NQCA 1HZYA 2NX9A 2QCCA 1PIFA 4O54A 4Y9MA 4M1RA 4BEQA 4CD8A 4ORIA 3UG8A 3PB2A 3MCOA 3G0XA 2P53A 4Q33A 3IGUA 3GH4A 3M64A 2NXHA 3B9DA 1QO2A 1UOKA 1H1NA 1PE1A 4XZWA 2NWSA 1FWSA 2PP1A 2X30A 3EPOA 2C91A 2Z6JA 4UTKA 4P8XA 2Y4SA 4D6IA 1KTBA 4UIOA 3W37A 1PKNA 2QDHA 3AIWA 1KGUA 3S3GA 2V3EA 3V35A 3WNKA 2PU0A 2TRSA 4Y9NA 4QAIA 4HMDA 2CXGA 1YXDA 2RDXA 3I6EA 4O1FA 3C2FA 2ZWYA 2WKGA 4HNNA 4OECA 4XD4A 4UFIA 1OCNA 2VURA 3B04A 5LIYX 4DNMA 2IKIA 3QW4B 1V6UA 4H9YA 4DIAA 5BMXA 3TA6A 3PJWA 1V79A 5FF0A 1EKOA 4MJZA 3A22A 5CPMA 1EZWA 1M7OA 4GC3A 3ZS4A 1FWBC 3N9RA 4GZ7A 4Q8PA 3CM4A 3UYIA 4Q8QA 3ZJKA 5KZDA 1E9YB 3SY1A 1J9YA 1UWRA 3NUKA 4Q7IA 2NXGA 3PJXA 4FXRA 3R94A 4X63A 2NSOA 3VIFA 3IARA 1LL6A 3UYCA 1ZTVA 3LXCA 4HKPA 4WUIA 4M0XA 1OX5A 1C91A 4W89A 1J0JA 3SFKA 3O6CA 4GUHA 1C8YA 2AKMA 4PL1A 2NVAA 4C6MA 5DFAA 3W7RA 4IISA 1MZRA 1C9DA 5E70A 1NQKA 1HXJA 1M3UA 2VFIA 7ENLA 5I79A 4DF2A 2QCDB 3UCCA 4ZO9A 3BLEA 3VNZA 3UP8A 3GQYA 4I3GA 3APYA 3W26A 2CLFA 4ML4A 3HPFA 3DI1A 4Q4PA 5JIWA 2PCEA 5HPCA 3ECQA 4H04A 2H8ZA 2WWCA 3B8IA 1H4PA 4GX9A 2A7RA 4NY2A 2TSYA 4REQA 3VOGA 3P74A 3AS3A 3C0QA 4R7OA 4GGBA 1JZ4A 2QPUA 3KOZA 1KBKA 3APGA 4IPLA 2P3ZA 1TPFA 2WM1A 4XISA 4IGMA 3ZOAA 1XGDA 3S2MA 1GGOA 2VZTA 4Q4SA 4L4OA 4BA0A 3CV2A 1V08A 2PWGA 1TWDA 2QUTA 2E8ZA 4DAFA 4O8AA 5D2VA 3VZXA 2J25A 4U3CA 3V0UA 2WPGA 2OYKA 3AU2A 3I7RA 3A47A 3GDRA 1YE4A 3TSDA 3EWCA 1E6RA 1EJWC 1AH3A 1KM1A 3DUGA 5BU6A 5KZ6A 3UEQA 3ZVHA 3TNBA 4GISA 1TX0A 3SCVA 1PEZA 5AC6A 2IPWA 1A0CA 5ECVA 1OADA 3GHSA 3M16A 1NELA 4S3GA 4LH8A 4QEHA 1LROA 5F1VA 1ZJIA 2DDXA 1R3YA 4M7TA 1FWWA 2PGEA 3LLDA 5DMMA 4ZXOA 1L6GA 3GAYA 2OOGA 2ANUA 4RPPA 1UZHA 5REQA 2BVTA 3D5HA 3OIXA 4HTBA 3USZA 4KEMA 5FEXA 3N19B 3FN9A 3HTWA 4HSHA 1EA0A 2V81A 4C1NB 1ZGDA 3LGDA 3SRFA 3MI6A 1XBXA 1NQ6A 4FIQA 4JIRA 1UD3A 3FGCB 3PBYA 4QQUA 4IT1A 3GFXA 2GGIA 5XINA 1Z89A 4FS9A 1O4UA 3SUUA 3S1UA 1PYFA 1GQNA 1GVSA 1BFNA 4YVVA 1NY1A 3CWHA 1EYEA 2R14A 3BG9A 1VPXA 1FCQA 1GHRA 3VIKA 4RV3A 1JZ5A 3OLIA 4IGHA 2VX4A 4H6EA 3GXTA 2DSUA 2R9RA 4EK7A 2VJXA 4AEEA 1EC8A 2YJQA 3RFAA 4YS1A 2PDGA 4JIEA 3UWUA 1XD1A 1VFUA 3E1F1 3DAQA 3QHOA 3G1AA 1FFRA 5HJXA 3RLGA 1Q7QA 1B90A 1B4EA 4KWOA 1R7AA 3O16A 4DWSC 4M3PA 3RAOA 1NIUA 2W62A 4AX7A 3V5OA 5C2CA 4GUIA 1A80A 1CTNA 4GVHA 3L4VA 4CCDA 4HK6A 4ZEPA 1H7PA 1ELSA 3U6WA 1C29A 2Z1SA 9CGTA 1J5TA 4U33A 3MI3A 2WMIA 4B5UA 4XZIA 3WQFA 4WY0B 2XN0A 1XYFA 3TZFA 1I4NA 3RX3A 2GVGA 1T41A 3KCOA 4QS5A 1ISZA 3ABQA 4XWUA 2SFPA 3CH9A 1KBIA 2QUVA 1LBLA 2J75A 2TAAA 4PGLA 1G6CA 1BRLB 2OOFA 4KKXA 4DN1A 1WO2A 2BVWA 2B7NA 1Z9AA 3BANA 1XUUA 1A47A 3BAIA 4W93A 3PZ9A 4RZ4A 4YYFA 5HDRA 4JX4A 2TPSA 1GVYA 3VD9A 4MKNA 4PE8A 1BGAA 3DERA 4LWWA 2WHKA 1G1YA 2OCZA 2F6XA 5HQLA 2QCGA 3PJUA 4GZJA 5JUVA 5I24A 1K9TA 1REQA 4YMZA 2ZC8A 2Q71A 4NT0A 1TB3A 1V3IA 3GVWA 1EA9C 4NJGA 2XSBA 5C7VA 2OELA 3WK3A 3UPMA 1W3KA 4QCEA 2A79A 2D1ZA 2J27A 3AJ7A 3B03A 3D47A 5I5RA 1AH0A 4W84A 1R3QA 4ZOCA 4RE2A 1YTEA 2DW7A 1JCYA 7CGTA 3W6LA 4YCPA 1BVZA 2C1GA 3KP0A 1DXIA 1K7FA 3U3HA 1RVGA 1OY0A 4NX0A 1GPWA 3EDKA 7PTDA 4J2PA 1UC5A 3NZ1A 3T6CA 3P80A 5CH9A 3CH0A 2JALA 3GTIA 1XYAA 3BOXA 3ID7A 4LPCA 2FZ9A 4E5TA 3EA3A 1EWEA 2Q3RA 5K4XA 4ZOEA 5C9ZA 1LJYA 4PCFA 3GG0A 1FWHC 4EXAA 2CZ5A 1QASA 3UNTA 2BY0A 5C2GA 4OHQA 4L9XA 4GFIA 4YNGA 4MOZA 1QUMA 3UERA 1IT0A 4C6DA 4FP1A 4B2DD 3TWAA 3WLMA 3DC0A 3FHAA 4GIYA 3JZUA 3B9OA 1U22A 3KBNA 3G8EA 2BMBA 1X39A 3CLWA 4J3TA 3FDKA 3PUOA 3L4YA 1VYSX 1GJUA 4HT3A 3AC0A 1TPUA 2YL5A 3GDTA 3E6EA 3CBWA 3U9IA 2JGYA 1O5KA 1CWYA 3LK6A 4OKDA 5D33A 2OR2A 2QNEA 4EIVA 4QRNA 2ZX8A 5E1QA 5DX7A 3CK5A 1XR2A 2PGFA 1GPFA 4QAWA 4FR6A 2E25A 1IXQA 3QLDA 1BAGA 3GU1A 3NDYA 3S2CA 2V2DA 5BU9A 1LT8A 4PTMA 4LVGA 1W1A1 1NWSA 3SFWA 2REQB 4LVDA 4IICA 4QTGA 2QMKA 1IEWA 4OFCA 3I65A 1E0XA 1OF6A 2OQLA 1NJJA 4A21A 2HJPA 4PCNA 1A5LC 1EUNA 3C61A 4PUEA 1XIBA 4PUMA 3FSUA 4YJ5A 3JRKA 3WKZA 4OBSA 5FESA 2W3ZA 2IMRA 2OKTA 3TP4A 3O05A 4GJ1A 2W5FA 1DIDA 3POHA 3BARA 5TQLA 3N1AA 1V6WA 4NZCA 1UBSA 1NFBA 4FI4A 3AHYA 3ABRA 4OTKA 3K4AA 4H6KA 2GZXA 1LORA 3VDHA 4DYJA 1U83A 1GK8A 3L4XA 3QYQA 3BV4A 1KFLA 2QAFA 3W2KA 2ISDA 4PUWA 2UBPC 4AY1A 5HWNA 2GDVA 5T9CE 4LAUA 1OABA 4RZ5A 4IX0A 1MUMA 4IFKB 4EAMA 1R9XA 4S2CA 2WAGA 2NQ5A 1GUVA 2Z1VA 3E12A 4XAYA 1G7UA 1NSJA 2G3MA 2QKFA 5I3IA 1NAL1 4HPJA 4I8YA 1A5KC 3LXAA 1R8LA 4PTNA 1QNOA 1B3XA 4NKCA 2FFIA 4QX4A 4JX6A 1V3MA 4MYAA 4WX2A 3ZVIA 1NDWA 3W81A 2YOCA 2HTMA 4W8AA 3OOQA 1H51A 9RUBA 1SFTA 2Q6ZA 1DV7A 1KM3A 1JD7A 3M0IA 4LUIA 1W9PA 3EOOA 3WUFA 4QS6A 3DFOA 3TUUA 3CQKA 4GQQA 3HPSA 4MJ4A 3N15A 1GZJA 3FA5A 2A7PA 1ME9A 1K8ZA 4ICCX 4GJIA 3Q67A 4DUOA 1Z3NA 3GH5A 4PUKA 4QNEA 3VGHA 3MA8A 3L12A 4GFSA 7XIMA 1SO4A 1QNPA 4E0CA 3KVKA 3GBDA 3R12A 2C1IA 2J6XA 1EHAA 3UR8A 1JFHA 3MVIA 1LG1A 2WV8A 1CCWB 3KBMA 1JNDA 1MW2A 4MB5A 5IOBA 2ZWZA 2ATMA 2UY2A 1UKTA 1YMYA 3C5QA 3A4XA 3BCJA 4YVXA 1ADDA 4ZOAA 1SM9A 1ZLPA 1SZNA 4J1OA 4G5DA 3UJSA 5HULA 3D0CA 4OOZA 2Q02A 4CQ9A 2PFHA 3STGA 2WSQA 3AO0A 3SUSA 4QSFA 3P7YA 1EYWA 3C2EA 2ZUWA 3EWDA 2INZA 3GVGA 3S46A 3QPYA 3IUDA 3TC7A 3JUGA 1AFSA 4KFOA 1LTDA 1OSEA 2PA6A 3BW2A 5DELA 1UWIA 1J8VA 4K8HA 1BWLA 3EX1A 4GBDA 1W2VA 1ISVA 2Z7GA 3LM7A 3WIJA 2FPTA 4DZAA 1GZGA 2ZUTA 3BSGA 5G4WA 2Y8UA 2PTWA 3KDOA 4JR5A 2D2HA 4AD4A 4TQTA 5ABTA 3K8KA 2NLYA 2J7BA 3TU9A 3M5ZA 4MY8A 3SCQA 3V18A 4Z0JA 4CEUC 4UFMA 2YCEA 1W1VA 4MMWA 5I78A 3T78A 5E93A 3KBWA 1V4YA 3AYRA 2WNQA 1SFSA 4JHZA 3ZFHA 3AICA 3W7JA 1DXFA 5BRPA 1XP3A 3IPWA 3ARUA 1US3A 3WQ5A 3VCRA 3FW6A 7TAAA 3DFQA 4W5UA 4NZ5A 3KTSA 3N04A 1WYIA 1WAUA 4J3ZA 3DFYA 1KM2A 3QRHA 2W92A 3VVGA 3BQ5A 3MP5A 3ANUA 2WCAA 2YR1A 3REQB 3PZUA 4AVFA 3SCWA 1XW8A 1EEXA 1LBFA 3QVQA 1S5MA 4WHBA 4CNTA 3ONBA 3WK2A 4B2DA 1BWVA 5G1MA 1UD5A 4PR4A 3B9AA 4MNJA 2DSVA 3NEVA 3VABA 2NVCA 2Z29A 3FGCA 2GGEA 3NPWA 2XGZA 2DVUA 2GDQA 5I3GA 4FNRA 1U5JA 4MZ1A 1RZMA 1VFLA 1UZ1A 3LS9A 4FOKA 5HOSA 1H7WA 2ZUVA 4JTEA 2QDDA 1KV8A 1XLGA 2QR6A 2B4GA 1MXGA 5AB3A 2DZSA 1OC6A 3T2QA 3QXBA 3TMLA 3PUGA 4BI6A 3QQ0A 3QFWA 3ES7A 1SW7A 2H9AB 1X7FA 3H2AA 4IQLA 2QDEA 4UFKA 3W74A 5T26A 5FAJA 2ISSA 1SW3A 3MY9A 4N02A 4JTGA 4BF7A 2FMNA 1JI2A 3NSMA 1ZB5A 1V51A 3WF2A 5D03A 3OA3A 1HGWA 1EC9A 1E3ZA 1OYAA 4I5RA 5FF4A 4LUTB 1T0OA 3CL8A 2GQ8A 4KCUA 4WY0A 4KW2A 4GG9A 3OZOA 3ARXA 2PDFA 2GQAA 2VRQA 4DBWA 1PWMA 1O60A 1PTDA 3TDFA 3R8HA 4PFHA 4S3JA 3W1QA 3UVIA 4H2CA 3P6LA 1YDNA 4J4KA 1IV8A 3MMTA 4PB4A 4GWEA 4OOUA 4DJDC 4UCGA 4DO4A 8CGTA 3ANVA 1BRLA 1ZHAA 2ZE3A 1XSIA 4GD0A 4JTHA 2GVEA 4DNHA 3VA8A 2GVLA 3SGZA 1XHGA 3C52A 3DYOA 2BB0A 2IKJA 1EIBA 4MFEA 5GVJA 4ZO8A 1XIFA 3C56A 3OLGA 5DXXA 3ENLA 4C7FA 3WNPA 1QBAA 1VYRA 4AEFA 5K9CA 2NV9A 4A35A 4CU7A 1RD5A 3N4FA 3H4WA 3QV8A 4GOAA 3N6QA 3PTQA 1EO7A 3KFTA 2YXOA 2E9BA 2BTMA 2GWNA 4I6KA 1GKPA 1OYCA 4CD5A 3N4EA 3EEZA 2ZXBA 2OX4A 3GYCA 4AD0A 1S5NA 3HGRA 4MNLA 4LBSA 3M0KA 1RBOB 3TEVA 4PA8A 2J8FA 3M44A 4HPGA 3CUZA 1J5SA 5HNTA 4POCA 3WF0A 1LWIA 2NW0A 1AL7A 2AL2B 1WKFA 4I9JA 3G1XA 1K8CA 3IAQA 3TYCA 1OFQA 1BKHA 2VDIA 4KWWA 1QW8A 3FV9A 1VZWA 1E43A 1YDOA 1H7OA 1A3WA 1HUVA 2OLAA 4K7VA 2O55A 3AHVA 3JVAA 4WDWA 3TE9A 1L6FA 5A2CA 1QNVA 3GFZA 4RW5A 3MSGA 2A6NA 2WCSA 5TNVA 1TV5A 3KL3A 1NFGA 3V1HA 1AQHA 3ABOA 5LNUA 4MLJA 3FS2A 4GCAA 1Z7AA 5D8WA 3OTRA 3FEQA 3AIRA 4QNWA 3IV3A 2EPNA 4M6PA 1IYXA 4EXBA 1WBJA 2FHBA 4R7WA 4JQAA 3CHVA 5F4XA 3WQ4A 1X98A 2PAJA 1H60A 4PEEA 2VEIA 3UR7A 2QW5A 1Q4WA 1GQKA 4D1IA 5CLTA 4LANA 4E4PA 1RBLA 4PBEA 5BZAA 1VEOA 2WLZA 2I16A 1I2PA 3IGHX 1B3VA 1A53A 1P6WA 3DI0A 4ES4A 4FZIA 3L2MA 4JOMA 5J5RA 2QQ6A 2HPIA 2FPVA 1SUXA 1B1YA 3IJ8A 2Y8VA 1X7IA 1TJ0A 4D6HA 1HL8A 1WDQA 4CUCA 1MFUA 1CB2A 3EWZA 5CC7A 3IUHA 3NOEA 3H2CA 1V0KA 5FJRA 3BG5A 1KBJA 3ZR5A 2YL9A 1IWPA 3NJ3A 3TKFA 2E8YA 2E3ZA 3WJZA 4HJWA 3W02A 3IIOA 3AROA 1R3RA 1QI5A 3M0JA 5FL0A 4WJEA 1A5NC 4EF8A 3VMPA 3VNJA 3WD4A 4W85A 2ZDSA 3W88A 4D72A 1P6CA 1QVBA 1M41A 3IJQA 3T09A 3S47A 3DHPA 2F61A 2J24A 1UQYA 2DORA 2G3IA 4A8RA 1W8SA 4FNPA 2E5BA 1H7NA 4P8WA 3T05A 5CPSA 4XIMA 2PBOA 5AC4A 5D9OA 4IIGA 4GQBA 1NH6A 3VO0A 3MWAA 4IFKA 1UUQA 3SSJA 1MW1A 3PS7A 1B3WA 1EBGA 3S83A 4WXZA 5FACA 3HJZA 1T96A 1VC4A 4HYVA 1A4LA 3CZJA 3H26A 2XH4A 2Z28A 3PAOA 4IJCA 1SR0A 2ON3A 4LAOA 1MVYA 4NI3A 2XYLA 4G7FA 4BWLA 1S39A 2EXOA 1SU5A 1VB9A 2PWEA 2NWRA 3UWQA 3M1ZA 1P43A 2C6QA 1FH7A 3VZZA 1EHNA 4WGXA 2YB4A 4W86A 3U4FA 1US0A 4F0RA 4UTTC 3QFEA 3U7BA 5K2ZA 4F4RA 1WDDA 4E2DA 5EBAA 4HN4A 2TODA 2YYUA 1F3TA 3G2GA 4H6QA 3FSTA 1V03A 3ITCA 2F6KA 1RQHA 1DORA 1M01A 1KA9F 2V5LA 4UQDA 1OCJA 1KGXA 3VIPA 1E6QM 4KMQA 2Y5SA 3VNDA 2VRKA 1G94A 1RSCA 1XLFA 4FAMA 5A6KA 1S3HA 3H4GA 4Y90A 1U5VA 1G4PA 1UJQA 4H6RA 1O94A 4LYKA 3WEOA 1TKKA 1B5TA 4A2SA 2I17A 4G2DA 4TTGA 2Y7FA 1LRTA 3FIGA 1AMYA 2HK1A 1XLIA 4M6QA 1ZUAX 2XWDA 3WYZA 4JQ2A 1C8QA 3V0TA 1YDYA 4CQBA 1HG3A 5I09A 2L5HA 2Z1BA 3H22A 3TJLA 4IM4A 5FJTA 3ITOA 1HT6A 2WSRA 3LRMA 1X8FA 1FWEC 1GTEA 1UWUA 2WC3A 2GLKA 1O1HA 2HMCA 2YKKA 1F74A 1FP8A 4AUBA 1MW3A 1RK5A 2PWVA 4O1DA 3A3WA 3TQKA 4GHRA 4NNCA 2VZOA 4HN8A 3OVGA 2WZTA 4HA1A 4WDUA 4PRTA 5HMDA 3O0FA 5DT5A 3F4VA 3MKVA 2YDQA 3QQ1A 2V3DA 3B8SA 1XYLA 1W3TA 2Q01A 1Z32X 3HGJA 1Z8AA 3SY8A 6REQA 5U7SA 1OIMA 3GC5A 1W6TA 4W9TA 2YFOA 1LWHA 5IM51 4N2YA 1DBTA 1AL8A 2WMHA 3MMWA 2NLIA 1W1ZA 4A3UA 1GONA 1ADSA 1Q6LA 5AC7A 2QLYA 4BF5A 2O56A 4AHOA 1X97A 3UXLA 4ADSA 4AX6A 3SN1A 4FLOA 3URAA 1XLHA 1SJAA 1KTNA 2Z27A 3HFTA 4RXFA 4EWND 2A3AA 1EUAA 3QR1A 1V6TA 2EKCA 2IKHA 1ECQA 3O07A 3REQA 4LBUA 3S5SA 4AXKA 2YW4A 2Y85A 2HDJA 3THAA 1RJRA 4NUWA 2DV0A 1PWLA 3NR0A 4PMQA 1E55A 3ZQ9A 3IIZA 3OA5A 1JF6A 1WKEA 3M0YA 1DWHM 3CHEA 1ADOA 1NDVA 3ICJA 4L6OA 1I2NA 4FLRA 3GRIA 1CB7B 2DZAA 1DE6A 4M5PA 4QQ3A 2OSYA 3TOYA 4YIWA 3AXIA 1YNYA 3BAYA 3OW1A 2R8WA 5EB8A 5IRPA 2VD8A 3RF9A 4FNTA 1E4MM 3MS8A 1PKLA 3QF0A 1UYQA 3W7GA 3HN3A 4LYPA 2B7PA 3RR4A 2H9AA 2FVKA 4AD5A 5DY3A 4NZJA 4O50A 3W1TA 1UUOA 1SMDA 4C65A 1W3NA 4U4MA 3GNRA 5DF0A 2Y8KA 1CLXA 4GY0A 4PMNA 5DRIA 5CGTA 1CNVA 1J0HA 2VGGA 3R25A 2JKAA 1M7PA 1HJVA 3BSHA 4OBRA 1K02A 2GK1B 3DH7A 4Y7EA 1HJWA 1ZAIA 3CS2A 2WNZA 3AMDA 1W9UA 2HEJA 1IEVA 1EJXC 1QNSA 1QO5A 3CZEA 3UETA 4R3UA 3OGRA 3O6DA 1B3OA 1L6WA 4LUTA 4MPKA 5DMNA 1W9BM 3TYEA 3B9EA 2NUYA 4LALA 2QMJA 3IGXA 1TVPA 1I1WA 2FH6A 2VC9A 3TX9A 3EPNA 2ACRA 3R4IA 1U1JA 4HU4A 1S2CA 2FDMA 5E9AA 1MEHA 1ITUA 5I6SA 2ZIDA 1XQKA 2ZKMX 4U2ZA 3HBLA 1ONRA 3KHDA 4C6FA 4EPKA 4CD4A 1YDVA 2J4GA 4XO6A 1ZBKA 3CQIA 3SN0A 3IVUA 2WVUA 4NXSA 1NF7A 4JTQA 3SN4A 5KINA 4DWDA 1BPLB 1XBZA 3QZ6A 1TV2A 1J6PA 4ACYA 3CUHA 3CUIA 5FIPA 3BZGA 1F3WA 1JULA 2DEPA 1H63A 3CUJA 5BRQA 3EB4A 8TIMA 1G69A 2VI0A 4GVFA 5BWAA 4S3FA 3G3MA 4JKLA 4XD3A 4HJFA 5A8MA 1ALDA 5CJNA 4U5KA 2B31A 3UPBA 2RGMA 2WJZA 1QPQA 2A6LA 4LTSA 4CN6A 2QUMA 3IRDA 1VENA 1X38A 2AQOA 4QSHA 4H9VA 1FWFC 4MAVA 4LCRA 1DYSA 2V30A 2AL2A 4JNZA 4FOJA 1I75A 5IBXA 3HMCA 3GDMA 5HNUA 2CKRA 4K8EA 3DXIA 3VM5A 5FEPA 3LUTA 2FGBA 4UTMA 4HBKA 2XIIA 3RRAA 5B7YA 3QM3A 2ALDA 3MHUA 2VRJA 2R6OA 3GHUA 5A8GA 2WXDM 5I23A 1EP3A 1PHQA 1J2BA 3B0YA 3P62A 1NDYA 3O6AA 2NX1A 1RV8A 4LV9A 3E0LA 4YL2A 3WZ0E 1HJQA 1XBVA 3W85A 2ZA1A 1UD6A 2I1OA 1UKPA 2I7GA 4BF9A 2WQPA 1AQMA 4I6VA 5BYWA 4L56A 3KRSA 4Q22A 3HV9A 4JTTA 2E1WA 3NQ6A 2VOMA 4ERIA 1YXYA 2Y7GA 1RY8A 1QPOA 5FD0A 5HNRA 1VFMA 5HQMA 4XZMX 1UJPA 2ZOXA 1Q2SA 5DLCA 1M7XA 1K70A 1XH2A 1EF3A 4AZ5A 3TZNA 5CC5A 2VFEA 4LVBA 3NL6A 5LSMA 4XZNX 4W7UA 1XSJA 1FP9A 2VCCA 2ACUA 4QISA 4TMBA 2FZMA 4NI8A 2D23A 3R7MA 1LUCB 2D0GA 4GXMA 4R33A 1XGZA 2WJDA 2BX7A 3MCNA 4H01A 3B0UX 4D6CA 3WMSA 4GE8A 2QYGA 4HYRA 3GLCA 2O9PA 1DWGM 3NNTA 3VD5A 2PDCA 2WPBA 1QAPA 3EZ4A 1N8WA 3FOKA 1JCNA 3K4WA 3GFYA 2PC4A 1KW1A 4CU8A 3FXYA 3EDDA 5DBUA 2BFGA 1GVRA 4QFUA 4G1KA 3U5YA 3GBEA 1NOWA 3O7UA 2F2KA 4ICNA 1XINA 3ZT6A 2VUYA 3EXTA 3I7SA 3B0XA 3KM8A 5D09A 4A29A 3QPEA 2IKGA 1VFFA 1Q7ZA 3Q2DA 4C6KA 3N73A 4HMNA 4C1LA 1QW9A 3WMCA 1W9DM 1E56A 4EACA 1EDGA 2Z1KA 4LNCA 1FWJC 1JG9A 1YE6A 4A4AA 4OUEA 1C93A 4OV9A 3WFAA 3M47A 4RE4A 1ZENA 1GORA 5A5WA 3VMNA 1X6UA 1HJXA 2DFAA 4H8UA 4JQ1A 3UCQA 3VOIA 1FCVA 2DZPA 1XRTA 2VDHA 3B8UA 1QPRA 2FKPA 1XWYA 1RPXA 3RX2A 3PWGA 2INFA 2XFRA 3RPTA 2W66A 1D7FA 4FLSA 2I14A 1AW5A 3WQVA 4IIEA 1E40A 2WHMA 4IPIA 3AHTA 4FF7A 2IQDA 2PDMA 2VX7A 3NIYA 2HROA 3UR5A 1VP5A 5C9UA 4PB3A 1TPEA 2J8TA 1GG1A 1RBAA 3HB9A 4H9UA 3TWBA 3VKJA 1JYWA 5HATA 3URNA 3WL1A 1U1UA 4IIDA 4UXDA 5AY7A 2HNEA 4C6EA 4JTDA 3DECA 4J3VA 1IIHA 1TZZA 4TVUA 5I2UA 1JPIA 1JRBA 5LXEA 4MSSA 1FHLA 3CIVA 4ML9A 2XHYA 3AWNA 1THFD 4RDYA 1E4NA 2H90A 2QCNA 3M0MA 1E4LA 3KX6A 1WP6A 3TW7A 5E0FA 1V77A 5XIAA 5AHNA 3W7LA 1G67A 2D2GA 4IGSA 5FF3A 2OTDA 1ESWA 2X1SA 2VFGA 3GIYA 2ISFA 4J40A 1VIWA 1MDLA 1TZ7A 4UTIA 2GUBA 3H21A 7TIMA 1GTHA 3S2JA 1EGMA 1P7TB 2RJGA 2PCQA 2WO5A 1A5CA 5K7JA 4JYEA 4O15A 3K2GA 4HSNA 3KL0A 3PFRA 1Z69A 1U5HA 4Z2LA 4QITA 5FJPA 3PPFA 1FOBA 5HQEA 1KCLA 3GZAA 4B3LA 3UZWA 1JCTA 5FJJA 2E1DA 2CWXA 3RIKA 2H8XA 1RD6A 1XYZA 4LVFA 1EJVC 3O15A 3QW3A 4PB5A 4AZCA 3SGUA 2XM1A 2ZC1A 4F40A 3HGSA 4OUIA 1W9XA 1UD2A 3CIWA 1BYCA 2E6DA 3RLVA 2XVNA 3LLXA 3NL3A 3FK4A 1F73A 1IEIA 1K03A 2Y0FA 3IVTA 4O12A 4AIEA 4RZ6A 1OYBA 3LXBA 3PZVA 4IL0A 4RL3A 2EKGA 3LZ3A 1P0BA 4RPQA 4QG9A 2V8ZA 3U5UA 4LS1A 1JRCA 3U4AA 4Q4MA 3UWYA 3CWNA 3VOFA 4WKHA 1WDSA 3C0SA 1V6XA 1TRDA 3E2SA 4DZHA 1MEWA 1A0DA 4E3TA 1LDCA 2VUNA 9XIAA 3OZMA 2XIJA 3K8MA 4HD5A 1PXGA 3G6MA 3VDCA 2FB3A 3T8QA 5A69A 3NPUA 5G2IA 2YYTA 2BHUA 4DLMA 2FPYA 2CZFA 1MSSA 4CNNA 3EA2A 4NAEB 4E38A 4CQDA 2G37A 5DT7A 2PDKA 3SR7A 4N4QA 2FJUB 2QPXA 4J2MA 3N2TA 4O16A 4F8XA 4YTTA 2RDWA 3C4UA 3HJEA 1F76A 2DJXA 3VAVA 1AQ0A 1RA5A 1K9EA 4Y2WA 2J79A 1Q63A 2QDGA 5BMWA 1Y0EA 5EMLA 2DVTA 5D04C 3WDIA 3G24A 2AOSA 3H23A 4A8NA 3DOPA 3S1XA 4Z1CA 1NF0A 4D6GA 1GQJA 2PTDA 4PTWA 3R6IA 1EEPA 3TYAA 3S5NA 1CGVA 2YB1A 4XD6A 2DSZA 1RUSA 3FJ4A 3NQEA 3NSNA 5FKYA 4L1GA 2QEZA 1RCXB 3K8LA 5CJMA 5TIMA 4Z2HA 4BKNA 1W9VA 1PSCA 4HU3A 1XC6A 1PTGA 4TOQA 3CQJA 4AMAA 1IXNA 3VIOA 2OSWA 4Z2IA 3BW3A 2ZXAA 3TFCA 5LKYA 4O0KA 3KEHA 4IP7A 3RYSA 1ENUA 1D3HA 3EYPA 1IIGA 2A1YA 4C91A 2GK1A 2JEPA 3CB3A 2OWWA 3NPXA 2EHHA 4K38A 4H19A 4DRSA 1B0IA 1TMQA 5HA7A 3G1RA 2PS2A 3VIIA 5I0DA 1K6WA 2X1IA 3S8HA 4DELA 3CHDA 5I06A 5CBBA 1AW1A 4V1YA 2OPJA 1DTUA 3UWWA 5KMYA 1O1ZA 2V67A 4H9MA 3GO2A 1BSLA 3VD3A 1QHPA 1PIGA 4TIMA 4E4FA 2I56A 3VDGA 1JNEA 3W1XA 4ROPA 1F5ZA 3I3DA 1XH0A 5HINA 1Y65A 4IG2A 4UFLA 3ALGA 4XV0A 3FEMA 3T0TA 2J47A 4UTTA 1TTQA 3SQLA 4NYYA 3CL6A 1AK5A 1PCWA 4GX8A 4GYKA 4U28A 4NYUA 3WLQA 2OJPA 2BXYA 4IH3A 2VC7A 5AKQA 2P3EA 4ICMA 5HANA 1ME8A 2CBVA 1LRNA 1UR1A 3QTGA 1UR8A 3S9YA 4UUIA 1SQ7A 1MRQA 1OGGA 2PDYA 3B8TA 5I3HA 1DJXA 1GKQA 3NA8A 1TIWA 2VM8A 3GIQA 4BQ3A 2V0TA 4Y6GA 3W07A 1YIXA 4PSRA 3WD0A 3FA4A 1JPDX 4AB4A 3R0UA 2PODA 1XLEA 3MV11 4DPPA 1FTXA 1MUCA 3LV5A 3WQ6A 1FWCC 2G96A 4GYPC 3GDKA 1E1FA 4GPNA 2E6YA 4K2SA 3VIJA 3ZYZA 4C6JA 4O1EA 1OM0A 1B9BA 1EJ7L 2BHYA 3J7HA 4N4PA 3LCLA 3MSRA 1HTIA 2TYSA 3O1NA 2WM0A 3PPCA 1GOIA 1V02E 4GQ0A 3TYZA 1XIHA 1E9IA 1TCMA 5LZLA 2XUCA 4GKLA 2ZICA 4HOWA 1RQBA 3EXSA 5D2TA 3K30A 3SM0A 1YPIA 1E0UA 1JUEA 2PTYA 4CVUA 3UZXA 3SUVA 4CGTA 3OVRA 3F5KA 4F2UA 3BZJA 1M68A 3NQGA 2ZUSA 5HUPA 3WLTA 4MLRA 4AW7A 3NZQA 3LENA 1AW2A 3T1GA 4CNSA 4KEUA 2AMXA 2XFFA 1QK0A 2J7EA 1N8FA 4QP0A 3NZGA 4AZIA 2UY3A 2GQ3A 5HJLA 4WY0F 4HHLA 3ZSSA 3AZRA 4JN8A 3CHCA 5F4SA 5D2YA 3RU6A 2E6AA 2J7CA 3G22A 4NILA 3L4TA 2YDAA 2WZHA 3DHFA 2A3EA 1Q6RA 5CBIA 1XC4A 1LUCA 5IHSA 2GJPA 4ENLA 4IQJA 2OXNA 1YQ2A 4HK7A 4L9YA 4O0QA 1OCBA 3BJSA 1BTMA 3DESA 5EMJA 2NZLA 5FF2A 1OINA 3B4UA 3FJLA 1KBBA 2OLSA 1Z6KA 2ZCGA 3N25A 4UR9A 3ZJ6A 3TJXA 1H7XA 3QBUA 1H1ZA 1Z42A 3RM9A 3COTA 4GNKB 3HG2A 3VD7A 1XI3A 1PZ1A 1EJTC 3AUJA 3UD6A 3O06A 1OHLA 3KWSA 4G1NA 1I2QA 4P7RA 4REQB 3KAOA 1TQJA 1DWIM 4XG1A 1DWJM 4RNIA 1S2AA 3M4HA 1B9ZA 1R7OA 1ZAHA 4C6CA 5BOFA 1Q3NA 4JFUA 4JX5A 1KRAC 2X05A 2CHNA 5H2ZA 4B5SA 1H11A 4PMOA 5H8PA 1FWDC 2XDFA 3V16A 4I90A 3TONA 1