2NQHA

High resolution crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
b'MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 4
molecule tags Hydrolase
source organism Escherichia coli
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
total genus 107
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqhA00
1GW9A 1K77A 4QE5A 1XINA 2QUMA 4ZB2A 3VNMA 3TC3A 3ITXA 5C9ZA 9XIMA 3QZAA 3VNLA 4QE1A 2G0WA 3M0XA 4GJJA 3M0LA 4HHMA 4GJIA 4QDPA 8XIAA 1XLHA 3XIMA 3KBWA 3UVAA 3XINA 1XISA 5XIMA 1BXBA 2NQHA 3M0HA 3VNIA 1XLLA 1I6NA 4PFHA 4X61A 5H1WA 2NQ9A 1MNZA 3P14A 3VYLA 4EACA 1XYAA 3UA4A 3TVAA 1XLAA 3AYVA 4YTUA 3NGFA 2Q02A 3M0MA 5J8LA 5H6HA 4A8LA 3VNJA 1XICA 3QXBA 2QUNA 4G56A 1DXIA 6XIMA 3P6LA 4US6A 2X7VA 3KCLA 1XYMA 2GLKA 4XISA 3BANA 1BXCA 1XYCA 3UXIA 2J6VA 1CLKA 3ITLA 1A0DA 3KWSA 2HK1A 3VNKA 3CQJA 3BZGA 3ITYA 4OVXA 4YTRA 4ZBCA 4GLEA 4K1GA 3WQOA 3JU2A 4EAYA 2NQJA 3ITTA 5EMKA 1XIIA 4YTQA 3ITOA 1XIJA 3BDKA 5EMLA 3U3HA 1XLFA 4X63A 1YX1A 3IUDA 3N4AA 2ZVRA 7XIMA 1XIMA 4W4QA 1XLJA 4K3ZA 5EMJA 1XIHA 2I56A 5B7YA 3KBMA 6XIAA 1OADA 1XP3A 2XISA 3AALA 2GUBA 5XINA 3BZJA 3KCJA 1A0CA 1XLBA 1XLKA 3KBNA 1XLMA 2GVEA 3FVMA 4YTTA 3QYSA 1O1HA 2XINA 4QDWA 4XIAA 3KCOA 1XIDA 1XLDA 3UU0A 4KW2A 4PGLA 2QW5A 4LNCA 4A8IA 2ZDSA 3CQKA 2GYIA 4E3VA 1XIFA 5TNVA 1XIEA 1XLEA 4X60A 1QTWA 3LMZA 3C0LA 1XLIA 3IUIA 1XYBA 4QE4A 3BWWA 3GNXA 4ZB5A 1XLGA 8XIMA 1XYLA 4J4KA 3AAMA 3U0HA 4HNOA 3KBJA 4XKMA 3KBVA 3L23A 4A8NA 4QEHA 2QULA 1I60A 3M0VA 3KTCA 5AVNA 4XSMA 1XIGA 4A8RA 3XISA 4HGXA 4GQBA 1XLCA 3CNYA 5B7ZA 2G4JA 1QT1A 2HK0A 1S5MA 4XIMA 3OBEA 1A0EA 5EMMA 3M0YA 1DIDA 2XIMA 3CQHA 5I7GA 4HHLA 1MUWA 3DBNA 1QUMA 3IUHA 9XIAA 3C0QA 3DX5A 5XIAA 4DVOA 3CQIA 1DE5A 5B80A 4QEEA 3ITVA 5AVHA 2HCVA 5FA5A 1S5NA 3UA3A 1DE6A 1XIBA 4ZB0A 1TZ9A 2X7WA 1D8WA 4YTSA 4XSLA 2OU4A 1DIEA 3KBSA 3QC0A 4DUOA 3CWHA 4Q7IA 3C0SA 2I57A 3AYTA
chains in the Genus database with same CATH superfamily
3CUXA 3T0TA 3KM8A 1UOKA 5J5RA 1J5SA 3RUBL 1JZ2A 4NRRA 2HNHA 4JEJA 3E0IA 5DT7A 5C8BB 1B4EA 4C91A 5BXRA 4CD5A 4JDYA 4NHVA 2QGYA 3TP4A 1WOBA 2XN1A 3V5OA 4X61A 3ZS4A 1JCYA 3N2XA 4WLCA 3WQEA 3W9ZA 3TCEA 3KOZA 4ZQRA 1OF8A 1ZJIA 3UR8A 1V02A 3UY7A 2XJ7A 4IFRA 1SGJA 1UIPA 3NM3A 1W6TA 2D2JA 2J74A 3R0UA 1XC4A 3QGKC 4IMDA 1E6SM 3CWNA 1XCWA 2YDRA 3WN6A 4GI6A 1TJ1A 2V9DA 1SFJA 4MTVA 5B7YA 1S1RA 2XISA 3AHTA 2PDYA 2YCJA 4AMCA 3B8DA 1BTMA 3FVMA 1TTQA 1Q2RA 2PI6A 4XIAA 3U5UA 3T2PA 4Q32A 3N6JA 2QW5A 1RP8A 1AFSA 2PS2A 1H50A 4BFAA 4MY8A 4HZ7A 1W1B1 3FA4A 3UWEA 1P6CA 3BAIA 3Q65A 4GZEA 3N15A 3GIQA 4KCWA 4E5TA 5REQB 3ZLGA 4BWLA 5CGTA 1EUAA 3NGJA 2PDXA 3ZMRA 2ZVIA 1HJWA 3RG6A 1E5NA 1S5NA 1W9BM 4GISA 3TWAA 4HTBA 4XX6A 4DN1A 3B9AA 1MFVA 3LS9A 2D24A 1VLIA 3CIWA 2JKPA 2FTWA 1FRBA 2C15A 5DBUA 4M6PA 3W7IA 1EF2A 1SJDA 3LPGA 5BRQA 3PBWA 2PFHA 3W82A 4Z2IA 3C2RA 4HZMA 1OC5A 3VNKA 3ITGA 3GB6A 5JH2A 2GGEA 3G6MA 3ALFA 1AD1A 4OBSA 3N4FA 3PPCA 3SGGA 3GXMA 1FWWA 3WCZA 3ARVA 2GJRA 1V8EA 2RJHA 2VDIA 4J3VA 3V7PA 2PCEA 2AQVA 3PZ9A 2YPIA 5E93A 4UTFA 2DIEA 3SUTA 3ORWA 1ADSA 1UUMA 2VXNA 3PUDA 1Q8JA 2ZDSA 4UOQA 3W01A 1DJQA 1X8CA 1V6XA 1QR7A 3MKCA 1AZ2A 4E8CA 2NT1A 5A8NA 4RDVA 3HN3A 5DMYA 2WB5A 3F4NA 3SDOA 2DSUA 2QAPA 4QAWA 3W6MA 2W6RA 1AZ1A 1IEWA 4HSOA 9XIAA 3FEMA 5D9PA 4WUIA 1HKWA 4P7QA 3R5EA 3M46A 1R38A 3ZWSA 2SFPA 2VCBA 5IDIA 3P67A 4B9YA 3LDVA 5F1UA 2RGMA 4AG0A 4CQAA 2P3EA 4PZVA 4BF5A 2W27A 2FKPA 4GNVA 4IHCA 4WJ8A 5ECUA 2P5NA 3PFRA 1CENA 3WENA 3FYPA 4H9TA 3QHNA 4GXMA 2ABAA 4Q8WA 1K7XA 3WBEA 4JQ4A 4LYPA 3MSRA 1TZZA 1LL6A 1KFEA 1ECEA 1KXTA 2V5KA 4C6NA 4XO7A 1TKKA 4LJ3A 1HP4A 4R88A 2R1LA 4D71A 1BVZA 2BNJA 4F9DA 4E2DA 1A5LC 3SRFA 4YTTA 2Q6ZA 2GK1A 1AQ0A 1QHPA 2CLEA 1SZRA 2YLLA 1E9IA 3APTA 3KRZA 1J10A 3W1PA 3W1MA 4CD4A 4E38A 1PPIA 2G4JA 1X6NA 5EMUA 4US5A 1DORA 3TQ0A 3W1NA 3OP2A 3R7MA 4AIBA 1UG6A 1KNWA 4KFOA 2Z4GA 2VJXA 4V2XA 4PEKA 2HSAA 4CU7A 2VWTA 3POHA 3IGXA 4AHPA 2XGIA 5DRCA 2PTDA 3PJUA 4ZGYA 2QCEA 1ZBVA 3M0LA 4XZIA 4XAYA 3NZ1A 2J8FA 5BXSA 3UEQA 4XZLX 2V38A 4TQTA 3G1FA 3GIYA 4AZCB 4ADUA 1CGXA 1WXZA 4AXKA 3LHTA 2VP8A 2RKXA 2XIBA 4XISA 2FMOA 1TPUA 3N3MA 1BLIA 1SMDA 3UCDA 3CUJA 1QJWA 4CNPA 3HMJG 4LNYA 5CBIA 4C6BA 2YL9A 4C6KA 3HG3A 4DAFA 1NQKA 3P84A 3B06A 1ITQA 3NIYA 1QI0A 4F3HA 2VFDA 3CH9A 4DF1A 2C1IA 1MVYA 2E8YA 2OWCA 1SO4A 1L6GA 1XV8A 1PZ3A 2NV1A 4DO4A 3WQWA 3VXGA 3TV8A 4GO8A 2Q8LA 2FHCA 3SCTA 4LV9A 1UQZA 3LUTA 5FD0A 5AVNA 1T99A 4KBXA 1UJQA 3T44A 2YYUA 1N7KA 1TMHA 4GUHA 1Q66A 3M4HA 5FJTA 4PRTA 3B05A 4KWVA 4GUFA 3SRDA 4AZBA 2HPMA 2I9EA 2VTFA 3ARTA 4H8VA 1GW1A 3SRKA 3GTNA 4AZ7A 1MEHA 1L6YA 3SGZA 2WVSA 4NJJA 3RK8A 1DTNA 2QF7A 3KOWA 3QW4B 2BZNA 4DJFD 1RQEA 1TA3B 5CZKA 2IUZA 4MNJA 3OVGA 1C29A 4NXSA 2PDFA 2EBNA 3STGA 3VNJA 1DQXA 1UR0A 4HNUA 4ZODA 4LYKA 4R5EA 2Y1HA 3MU7A 3NOEA 2Y61A 1XX1A 3DAQA 1V93A 3EMCA 1OGSA 3PK7A 1NP2A 5HANA 1E0TA 2A3HA 1R7OA 3SZ8A 1OZQA 2XFWA 3PJXA 3LNPA 4UTTA 1U83A 3GAKA 5LNVA 1KM5A 4ZXLA 3L4VA 3MT1A 3PSVA 3BLPX 1KW1A 3W73A 2YA0A 4AHQA 1ZFJA 1K4HA 3PG9A 1Q63A 2R1NA 3AO0A 3THQA 1KM2A 2W3ZA 2NX1A 4B9ZA 3AAMA 3ABXA 4N42A 5F2IA 2X16A 3LCXA 3VK5A 3ARYA 2GQ9A 3N2MA 4M3PA 1XSIA 3BLKA 4WXZA 3TNOA 1XCXA 2WBKA 3QY7A 4C65A 2AMXA 2WZMA 3MSYA 5TF0A 4ZOBA 2DJXA 4XSLA 4BK9A 1ZHAA 4JTTA 3BURA 2OZ8A 2BVTA 3CUZA 2PF8A 2QZRA 3PZQA 1Z9AA 2J7CA 3DKJA 3B0UX 1E4IA 3V18A 3KS5A 4JN7A 3VIHA 4O0QA 1XH0A 2A21A 4XZNX 5GNZA 3C0JA 4S3JA 1GNXA 4LC6A 5MHBA 4YYCA 4DXVA 1EO7A 3P74A 4UFLA 1YPFA 2YL6A 5I24A 1JDAA 3GLCA 5LIYX 1ADOA 5HPOA 1LBMA 1SW0A 4NZFA 3NEHA 4HB7A 4DYKA 2E1WA 1XH1A 4XUGA 5AC7A 1X97A 3V4BA 5C6MA 1BSIA 5CZ0A 3AXHA 3LLFA 4DF2A 2OGJA 4F0MA 3SCPA 1C92A 3G1DA 1DJIA 4NILA 1XIFA 4GYPC 4MUZA 4FK9A 1JAKA 4H01A 5ABHA 2J9ZA 3LI1A 3BG3A 1JZ6A 4JYDA 1OFEA 5J04A 2IQTA 4HK6A 2ANUA 1L6FA 3DX5A 3ARPA 4Z0SA 3I3BA 1NOWA 4KGLA 4LQ1A 1A53A 3MJMA 3EGJA 1OCNA 5DEZA 1RH9A 3TR9A 2FH8A 2WC4A 4HYWA 3M64A 2FB3A 3VNYA 4H8UA 2FPTA 3QLDA 4NI8A 2EPLX 1J0JA 3HGJA 4IICA 4EACA 2J25A 4Z1BA 1O5RA 3FLUA 4NYUA 1AW1A 1VS1A 3R13A 1OGGA 1RCOB 3WLRA 4AAJA 4AD1A 3HPFA 4ZOEA 1HXJA 2QXWA 2QF8A 4L9XA 2IQDA 5HNTA 1GONA 2YFOA 3P8JA 3MV01 3NPXA 2QUVA 2P88A 2O0TA 5ABEA 3S3GA 7TAAA 1FXQA 1EX1A 1MUCA 3LCHA 1FUYA 3WLQA 1SJCA 1Q7QA 3DYMA 1WOAA 1M03A 1RJPA 4LU0A 4OFCA 5ABGA 3PZNA 3ZR5A 7PTDA 2X2YA 4JTAA 5C70A 4HA4A 2VZVA 1YDNA 4IJBA 1RLDA 1VFHA 5AHMA 3QR0A 2Z2BA 4BA0A 3NQ6A 1LOQA 3CHEA 1JPMA 2WXDM 3BWWA 5LHFA 3V0SA 4HNOA 1TVLA 2A2IA 2WHMA 2B7NA 3UJ2A 5FJUA 3RO6A 3FN9A 1KR1A 4MWAB 3UWYA 1SR0A 3UPMA 3ARZA 2R1KA 3VC6A 1UD5A 3A5FA 3ITVA 7ENLA 3NXLA 1I0BA 3LQLA 4DY1A 4J7RA 4D1IA 2XPKA 3OU8A 4PMYA 4XTIA 4J1OA 4L80A 3ERPA 4LWWA 4IQLA 1E0XA 2G41A 3WH7A 1SUXA 1RK5A 3BVJA 1VBUA 3MI6A 2QCDA 1J2WA 2XSBA 2VQTA 3MCOA 3SADA 3KDNA 3CMJA 1M5WA 5E6ZA 2VI0A 1B4KA 1P1MA 4PFHA 4M0XA 2NZLA 2D20A 3MVIA 4GKLA 1CZ1A 4A8LA 3H70A 3CUIA 4PN2A 3A9BA 1F5ZA 3RX2A 4N4QA 2EG8A 2PU1A 3B4YA 1F05A 3U4FA 3DGBA 1V6VA 3M0KA 5EFDA 2YIHA 3QZEA 5I07A 2H6RA 1UASA 3RU8X 1OFDA 1OF6A 2BP1A 3GW3A 3WQVA 1QXLA 4R7WA 4IGNA 3QOMA 2WKGA 1S3HA 1FHDA 2UWFA 3KBMA 3OO2A 1RY8A 1DWIM 5BWFA 2NXGA 5D2XA 3SUSA 3AUOA 3LCFA 4DQWA 4MGGA 3MYOA 5AYBA 1TE1A 1KD0A 4GQBA 3L0NA 3LY0A 4EPEC 1VGAA 5CC5A 4HHLA 3OQ8A 2HCVA 3DZ1A 5DELA 3T0AA 1YXCA 4C6LA 3HA1A 1TZ9A 2BGNE 3IJDA 4R9XA 4EWND 2YW3A 4DUOA 1I2NA 3S6DA 4A6GA 3OVRA 4NSBA 4P8VA 4FXSA 3TJXA 3Q58A 4ICCX 3IJ6A 1E6QM 2D0FA 4DJFA 3FIGA 5BXTA 5FL0A 3LMYA 1LOSA 1OT1A 1HTIA 1EJRC 2EGZA 3CUGA 4XK2A 2FHBA 1RLCL 3U57A 3H4GA 2EHHA 1CI1A 3GFXA 1AUSL 3QH2A 3B8TA 3UVIA 1EL3A 1NDWA 3TW6A 2DGAA 2PTYA 2QDDA 3DG3A 4HYRA 1BF2A 3UP8A 2VR4A 4AF0A 3TTSA 4DZ5A 1LJYA 2ZX8A 3DECA 5JIWA 1BSLA 1GVSA 3HBLA 1TIWA 3G0UA 4J2MA 1TJ0A 4C5ZA 4Y7EA 1KXQA 1JDCA 3IWPA 2QVHA 4PBFA 4FAMA 2JALA 1FDYA 1WX0A 4D2JA 3K8KA 4PA8A 1W5MA 4UR7A 1LUCB 3WLKX 3W1AA 4CD6A 3T9PA 1EKOA 2XU2A 3KBVA 4JIEA 4XZWA 4WVXA 1I1WA 4I8YA 4J35A 2OFJA 2Y8VA 2VKZG 1KA9F 3UNDA 4HIBA 5LIXX 3NAVA 4ICMA 5AB3A 1M6JA 2O9PA 1VB9A 1GKRA 1JAEA 4JKLA 1D8WA 4JFTA 1GOOA 1FWAC 5CSYA 1GHSA 5D37A 3REQA 3ANUA 2B81A 3W85A 2GL5A 1FWHC 4DHGA 2AAMA 2QR6A 1W3NA 3T81A 4KMQA 4PH6A 1Y8BA 3FV9A 1DHKA 2WZHA 4XBSA 3EA2A 1DVJA 3UJRA 3BTNA 2P8CA 2FPYA 2BHZA 4LY8A 2PD9A 3T0DA 4M5PA 4H2CA 1QK2A 1AQMA 1LRTA 3FJ4A 5I06A 3QXBA 4ORMA 4KFNA 3G3DA 4C7GA 3AMCA 4DYJA 2XH4A 3W86A 4LS2A 1LL4A 5AC5A 4LT9A 2YSWA 1BF6A 4Q6XA 1US3A 1EJUC 1J0YA 1JCTA 3TX9A 4JTRA 5K9DA 4MZYA 1QOPA 2V68A 1WYIA 3W22A 2QIWA 1EF3A 3AHXA 1XP3A 3BZJA 2A79A 4A05A 4PGLA 3CTLA 1J0ZA 2A3BA 2E9BA 3GNOA 2WJEA 1XKJA 2ZQ0A 3VGDA 3S47A 1UWTA 1X1ZA 4GFIA 4QSFA 4JIQA 3G0XA 1WP6A 3SY5A 2WAGA 3W71A 1GOIA 5AVHA 1HO1A 3GNDA 3QTPA 3VIKA 2DP3A 1XF0A 2OODA 1L9WA 2CESA 4PC8A 2CERA 3EWWA 4IIBA 1LROA 4JBRA 4O1FA 3GNNA 3QM3A 2WO5A 1MNZA 5C71A 1V3LA 4LVFA 3AYVA 3NZPA 1UD6A 1WCGA 5JQ9A 1L0PA 3LRLA 2J6VA 1S5TA 1VEMA 2ZZ6A 4M7SA 2D3LA 5I00A 1WQ5A 5CKSA 4MYXA 2HVMA 4ZBCA 2J6XA 3VX0A 3JU2A 3E0LA 2EKGA 3LHWA 4GINA 4RW5A 3QBUA 4HPNA 3ITTA 3T08A 1Q4WA 4KIRA 1DQWA 4HOWA 1V0NA 3UJFA 3ABQA 1FH7A 3R8HA 1K1DA 3RLVA 1FWJC 3SQLA 2ON3A 4CCCA 1Z3NA 2Y7FA 3BV4A 1NSJA 1PIGA 1WPCA 3W25A 2MANA 2C79A 1S3TC 3SJNA 1FH9A 2ICSA 2YZ5A 1VFTA 5A2CA 1YXYA 2PLCA 4AC7C 1B5TA 3A3XA 4HGXA 1MRQA 3VDCA 1S5MA 4WCJA 1SU5A 4IPJA 4ZXOA 3NQFA 3C52A 3CZKA 2I1OA 3B04A 1E0WA 5KZDA 3N29A 1CXHA 2ZRVA 5FACA 1RBOB 3W72A 4XD5A 4REQB 5FIPA 3LERA 1VFSA 1NEYA 1GEQA 2OYLA 5CQ1A 1E15A 1TZ7A 5CGQA 4NNBA 1OY0A 3ZJ6A 2CBUA 1E1CB 4MG4A 1QMLA 4CU6A 3GS6A 5BOEA 3ABOA 5JBDA 4AIOA 3OBAA 5JXQA 4Y2WA 2YXXA 1JIBA 4CNTA 3A13A 2WJZA 2ACSA 3HO8A 5KTLA 5EU9A 4LUTB 2NQLA 3ANVA 4ZFMA 1Q6GA 1WDPA 4CEUC 1B3WA 3KVLA 3REQB 4GCXA 5A69A 4OV9A 4ZMGA 1MEWA 4PL2A 1Q4NX 2XVPA 3U3HA 1V3JA 5FEZA 3WKZA 4RNJA 5FI8A 1B30A 1XIHA 3IRSA 1BRLA 1XQKA 3AALA 3LG3A 1KC7A 3KE0A 2RH9A 4Z1CA 1WDSA 3IAQA 1X6UA 1GOKA 4MYAA 3UZYA 4IPIA 3VIGA 1FFRA 3L5LA 3N12A 3LHUA 3MYPA 1Q85A 1E6XM 4RZBA 1R5YA 4QEHA 5CGMA 4Q8QA 3QC3A 4KCTA 1TPVA 4H6QA 1KRBC 1UH2A 3A9IA 1U1HA 3H7RA 1S2VA 1YE6A 2WWCA 3GKAA 2VGFA 3M7SA 4U5IA 1S46A 3GU1A 5F2LA 5LZLA 2PTZA 4KGJA 4DPPA 4W85A 2JIEA 1I1XA 4NZ4A 2OZ0A 1EP3A 1DJGA 1ESWA 1B31A 3HG2A 5CAHA 3TA6A 1REQB 4UTJA 4MY1A 1A50A 3C3NA 3HPAA 3UVAA 4XAGA 4JIRA 3RLGA 3BE7A 1WZAA 3KS6A 4I5UA 1MDLA 4H1ZA 4NQ1A 3P14A 3SFWA 3TR2A 4OUIA 3BO9A 2Q09A 1KRAC 1XYMA 3BANA 1EXBA 3MP5A 4AH7A 2Q8XA 5LIWX 3OGSA 1DBTA 4B5TA 2X40A 5HUOA 3U5YA 1TR9A 2IPGA 5HR7A 1TWWA 1UR4A 3W23A 2GJPA 3L4UA 1V3MA 3NQGA 4K7VA 1VH7A 2OCZA 4N2YA 4AEFA 3TXVA 4IUGA 2E8ZA 2XIOA 1PKMA 3COTA 3LTPA 3OIHA 3Q4DA 3R10A 3RYSA 4C7DA 3PJTA 3TOPA 3TW9A 1WDWA 3QSRA 1XLBA 2E1DA 4DO5A 2V5BA 4DLMA 1UWSA 4QCEA 5DCEA 4GG9A 1CGUA 3BAYA 5H91A 1A5BA 1JCJA 3FXYA 2ISVA 5BMWA 3H54A 4TX8A 3CV1A 1N55A 3CYJA 1T0OA 2EO7A 1PV8A 2W63A 2A6LA 3C2EA 1CGWA 4M6QA 3DN5A 1FOBA 2Z1KA 3R8GA 3E2SA 1F6KA 2INZA 3MHFA 1TX2A 4QISA 3PM6A 3T07A 2GVYA 4M19A 3V0TA 5EB8A 4DRSA 4Z2JA 2G8ZA 4OQVA 4IJRA 3W2JA 4XZBA 1MW0A 2GZXA 3XIMA 1JGMA 3B9NA 2OZTA 1V6UA 1TO3A 1PZ0A 1XLLA 1W5QA 2NT0A 4HBKA 3TN4A 1W2VA 3WLIA 1ZSXA 3RM4A 4AD0A 1MQQA 1XRFA 3ARRA 1Z48A 1CLKA 1I0DA 2GGGA 4WY0A 2BGQA 1UWUA 1LYXA 3VPLA 4EXBA 3KLLA 3BDKA 4H9MA 3IUDA 3WDJA 1OBAA 5H8MA 1OYAA 1HL2A 3GG8A 6XIAA 2YBVA 1VEPA 2WLYA 1IEXA 4K8HA 4O16A 4MF4A 5GNXA 3LTYA 2J79A 3GTHA 3H21A 4DNHA 2YX0A 5D4YA 1PTGA 4BF9A 3S46A 2RGLA 1QW7A 2C14A 1VPYA 3PG8A 4FOKA 3RLHA 1FDJA 3C2OA 3RR1A 4IMEA 1EGMA 5EPDA 1RVKA 4DO6A 1EWEA 4DUWA 1NDYA 3S9YA 1DJZA 1BKHA 4ASTA 3GAYA 5I3KA 4BJHA 2FZNA 3W2KA 1RBLA 3BGJA 1QHOA 2YXOA 3CB8A 2D2OA 4ZOAA 1W8SA 1Z42A 3KLKA 3IV8A 4YVVA 1W8GA 1H63A 5AC8A 4Y9NA 4WDWA 3AS3A 3G6LA 1LWHA 4MAVA 3W1TA 4PSPA 1EC8A 5LGXA 3SN4A 3LCWA 3MPGA 4NF7A 3QV9A 5CH9A 2AKZA 2OWWA 1IWAA 1VPQA 3T78A 3NQAA 3TJLA 4GD0A 4D72A 2NUXA 3V36A 1DJXA 4IIDA 3BH4A 4BEQA 3EKGA 2DZTA 1UKPA 4HP5A 4NRSA 4IIFA 4UIOA 1XH2A 2TYSA 3LGEA 4PMXA 3CV2A 7XIMA 3G1YA 3BLEA 4EF9A 7CGTA 5IFTA 3FVDA 1E5JA 3L65A 1Q5MA 4AUBA 4FLOA 3SCNA 1IIGA 3FYYA 3M9YA 3MY9A 2J7BA 2BWGA 2FQIA 3OA3A 4AVNA 2X09A 1F8MA 1T96A 3LZ5A 5LNRA 2X0YA 1ZTVA 1UR9A 1TX0A 4UTUA 1B1YA 2BG5A 3AMLA 1EJ7L 4F79A 3C0QA 3CPGA 3WYZA 1PJ9A 5G5IA 3WIJA 3KWXA 3I7RA 4QQ3A 1W9PA 3KEHA 3O1NA 3DIPA 4NZ5A 1SSDA 3WL0A 4I7UA 3UCCA 4AD3A 4LS0A 5HMSA 3R43A 5EY5A 1HUVA 4RLIA 4AF0B 3OZOA 2NSOA 2QCLA 3LBCA 4JHOA 3GR7A 3Q67A 3N6HA 3VDBA 3RPMA 1X1NA 4Q4RA 3JUGA 3TXZA 4WSKA 3H8AA 3GDKA 3OA5A 4JY8A 4O4WA 1XDJA 1H09A 2BB0A 1G4EA 4IIEA 4RUBA 1UA7A 2A3AA 3UWQA 1HNYA 1KV5A 2QHAA 4K68A 1NP0A 3RLUA 4LRSA 4EAMA 5A8GA 2C18A 2YBTA 1GQLA 2YL5A 3QPEA 4AWUA 4GOAA 2ODOA 1KM6A 2Z7GA 4GQGA 4ZQNA 3R6IA 1QNQA 2B7OA 3AXKA 1C9WA 1M01A 4OBTA 3ITCA 1ZNNA 4IX0A 2ABBA 5F4WA 4WY0F 1EA9C 1XW8A 5FAGA 2WSQA 4NJKA 4N02A 3CAVA 3AYRA 3IRDA 4C6QA 5DY3A 4DWSD 2Z29A 3WLHA 5LYRA 4DVOA 3EOUA 3TH6A 3H4WA 4FXRA 5D9MA 4OU1A 2DORA 3QVQA 1WDRA 5HA7A 2VELA 3L2LA 2WMGA 3B8SA 1E51A 8XIAA 5E5CA 2KX9A 3OIXA 4UTMA 2VDGA 4F66A 4WY0B 4O12A 1UA3A 4LTSA 4B2DA 3VVGA 3EX2A 4MDPA 1IYXA 1ZS2A 4GXPA 4ZO9A 1AH4A 3S1GA 1R3YA 2CBJA 4L4PA 3MI3A 1P5BA 2O7SA 4LUSB 5CZSA 2PB1A 2FMNA 1LL7A 4Y9MA 1OFBA 2GSHA 2O9TA 1DP0A 2Y62A 1GVOA 1VPXA 1RJRA 3C8FA 4HCHA 3CS2A 3EEGA 2ACUA 1YNPA 3VA8A 2QCHA 3T6CA 3E2QA 4C6CA 1U33A 4UQBA 3UU0A 2DQWA 5M03A 2XGZA 3VOGA 2OT0A 4UUIA 3L0KA 1W1VA 2ZUMA 4Z1AA 4B15A 4KWSA 3DFQA 4K2SA 3EBVA 3B0VC 2JKAA 4AD5A 5A6LA 2VHLA 1MXGA 2VFEA 1MUMA 4ZZ9A 5K4ZA 1IZJA 2O9RA 1EA0A 5FAJA 4OGZA 1LP6A 2BX7A 5A2BA 3CM4A 1A3XA 1M7XA 4DEFA 3QRHA 2F2KA 1AK5A 1A80A 3ME3A 3TJ4A 1YXDA 1BGGA 4BKNA 1RD6A 4W5ZA 2NXHA 1ZAIA 4DUVA 4TMCA 1XLHA 1VLWA 4GZIA 4W84A 2IKGA 1KRCC 1H4PA 2C1HA 1F76A 1RJQA 1G9HA 3BLIA 4OOUA 5L6UA 5I3GA 2XG9A 2D23A 2PWHA 3G5EA 2Z25A 4RJEA 1AG1O 1DXIA 4MFDA 2B4GA 2ISFA 4UMBA 4CN6A 4RV8A 1ISXA 3Q37A 2Z6IA 4HMNA 3TW7A 3CHDA 3CQJA 1EJWC 2BLEA 1BQGA 1CXIA 4JN8A 1Q3NA 1P0NA 3CPRA 4PMZA 3S1XA 4Y8FA 4GC3A 2UZ9A 3UY8A 2WZTA 4K37A 4HK7A 3PP7A 4DI8A 2VC6A 2WJFA 4PTWA 1O1HA 2CLHA 4X9SA 1H3GA 4GHRA 3AHZA 3M07A 4HJFA 3O6AA 3C2YA 3RR4A 2RDWA 6REQB 4RZ5A 3THUA 1ZCCA 1A5OC 3ZSTA 5FJOA 3P5YA 1H51A 2DPEA 1OFPA 3MUIA 4UNIA 4S3BA 4BHYA 5GNYA 2VYOA 1D3CA 1JFHA 2VZSA 5CJMA 3VIIA 5HXMA 4BQ2A 4DJDC 4FNRA 3W83A 3AROA 2CETA 4AHOA 5GPRA 5JBEA 2VM8A 4YTSA 3ZJ8A 2OU4A 3QC0A 3ZLFA 4AX7A 3VGHA 1UZ1A 5HWNA 4FF7A 4KF1A 4QGCA 2TAAA 3PAOA 3BCJA 3S0CA 3B0XA 2B0MA 3WF1A 3EDKA 3H26A 5M3WA 1G5AA 4NJHA 5AKQA 1S39A 2J9YA 3I3EA 3L4WA 3WUBA 1MO0A 2ADAA 5EBUA 1HJXA 1ALDA 3M5YA 3MW7A 4JEQA 4OV4A 4R7JA 2XIIA 4GH3A 1PVNA 1T7LA 5FEPA 4GIEA 3EPMA 1E0VA 1BG9A 1HF6A 3VD3A 1OYBA 1D8CA 4UTKA 4JNYA 4GJ1A 2A7RA 4GYKA 1M53A 4NX0A 3AMDA 4ACZA 4YHEA 2EF9A 3JVAA 1XBXA 1JF6A 1IT0A 1KBLA 3FJNA 3FKKA 1RP9A 1ZGDA 4O14A 4W89A 1Y7VA 2BXYA 1WXYA 4QE4A 4XUYA 3A4AA 4D6JA 3MANA 1WKDA 4JCLA 1PTAA 2WHLA 1JDDA 4CGTA 5M2FX 4XIMA 4P7LA 2XZ9A 3LQGA 2XIMA 1WUEA 2VEFA 1B3ZA 2W62A 4NYYA 4Z2GA 4MB5A 4AY7A 2VEMA 1KFJA 1HP5A 2GGJA 5TAOA 3ZT6A 1GVRA 4RDZA 3VTRA 1HFBA 4LRTA 1TV8A 3WQDA 5FJPA 4E8GA 3LN3A 2CHOA 1U5HA 3QW3A 4PUKA 4B3KA 4UB9A 3NDOA 4AD4A 4P8XA 1QVBA 4ZR8A 2G0WA 4DZIA 2DY3A 2Y5EA 2C71A 2EXOA 1R9XA 2PPGA 3EA3A 1H5YA 2HTMA 3RILA 4YTUA 2QJNA 3H7VA 3HMCA 1XSKA 4N0RA 4GIAA 1K8ZA 2XIJA 2BY1A 4KEMA 4AW7A 1E6NA 2XFYA 3B03A 3RM9A 3MKVA 1RCQA 3LXAA 1OD8A 3GFZA 1CB7B 5HBFA 1YQ2A 3BL3A 4QRNA 4KWOA 3TYEA 4K3ZA 1UZHA 3GNRA 1PIFA 3NVDA 1E70M 3KAOA 4I7VA 5AYIA 3K13A 1T8XA 4O8AA 1HJSA 3CJPA 2E6DA 2XWDA 2VCAA 2VC7A 3HFYA 2ZC1A 4WF7A 4C7FA 3EB4A 2J8GA 4J4KA 1JPKA 3RHGA 4RE4A 2Q71A 4NT0A 1WO2A 5CXPA 3R11A 4LAOA 3SAZA 5REQA 1GTEA 4MB4A 3W4RA 4CD7A 5JIPA 1FH8A 4X9YA 1OD0A 2HMCA 2GSEA 1OFQA 2J13A 3JZUA 5D02A 3U48A 2VZOA 1FWDC 1FHLA 4O1EA 4PL1A 4JYEA 2CLFA 1UWIA 2F6UA 2X7WA 5CG7A 3AWNA 1PCKA 2VVSA 2GQ3A 1IT7A 3WNNA 1K77A 1Q7MA 4D9PA 5C9ZA 4V15A 3GM8A 4PMNA 2V63A 3UYCA 3IVSA 3URAA 3E74A 2QMKA 3DFOA 1DV7A 1KM0A 3VNIA 1B9BA 1IXOA 3ZVHB 1ITXA 4LH8A 1S2CA 3L2MA 4YIWA 1K8CA 3PB2A 5EFFA 1XGZA 2MNRA 4F9JA 2AGKA 3WF0A 1WKYA 4CKQA 1I75A 2VNCA 4MB3A 2XVKA 3W1LA 2ZBTA 4O18A 1EBGA 1JDFA 2NSXA 4PFMA 2PBGA 4PR4A 1J2BA 2IPJA 2BY2A 2Z27A 1BWVA 3GYCA 4JTCA 3S6OA 3WH5A 1XLJA 4IPPA 2V81A 3MJYA 1J79A 1VR6A 2J7EA 4JTLA 3LX9A 3OG2A 1GJPA 5A6BD 1KRMA 4E3VA 1VHCA 3IJ7A 2AMGA 4IG2B 3MKKA 5LGZA 4C6DA 3VKJA 2Q01A 3AIWA 2Y0FA 3KTCA 4ZOCA 3R89A 1YPIA 3VO0A 4FOUA 3HPZA 3APGA 3K8LA 1PXGA 4ACYA 4TU1A 4JKKA 4UCGA 1E55A 4NL1A 4F40A 3H22A 4O1DA 4I5XA 3PUGA 1QNPA 4TVUA 5TIMA 2DIJA 2E6FA 3WNPA 2DZVA 2JFEX 3VOFA 4EWJA 5LSMA 1LLZA 5DX7A 3M44A 4HVXA 2CLLA 1XGDA 1B0IA 1LUCA 1TWIA 2VT0A 4M82A 3WY1A 3BC9A 1UKOA 1P0DA 2E6AA 3MHUA 3FS2A 1FDZA 1VAHA 3CIXA 3FDKA 4G56A 1CT5A 4RNHA 3O07A 1A0DA 5LHEA 1C93A 3GX9A 3DXIA 1AODA 4EOUA 2W5FA 4GVIA 2FZMA 4BI6A 5EMKA 3WG6A 4DXXA 1XIJA 3OODA 2RFGA 3UXDA 1YX1A 4XG1A 1EP1A 3I6RA 2XFFA 4PMVA 2D2HA 3QLLA 1OADA 4C1NA 3RX3A 1R0MA 4ATWA 1QCWA 2WKLA 1JXKA 5DXXA 5HWJA 1L8NA 1Z41A 1R30A 4PUDA 2CEQA 1BPLB 3SSJA 1C8QA 1OC6A 1CPUA 4LUTA 3E12A 4U10A 3EYPA 4MJZA 1LCOA 4W8BA 2ZUNA 3TZFA 3DG6A 4MLJA 1TV4A 1J18A 3IUHA 3HV9A 1THFD 4KEZA 3TTEA 1PKLA 1CXKA 4ZVJA 5G2HA 1KWKA 3UESA 2RAGA 4O19A 4A3RA 2ZRWA 2WMHA 3N25A 3URNA 4O54A 3ITXA 4ORIA 4FIRA 3LLXA 3B40A 3VNZA 5AHFA 3LPPA 2QAFA 4CVWA 5XIMA 3T05A 2I7GA 1OQFA 2X0HA 4NNCA 3W1QA 2I16A 3TTOA 2FJUB 3WLSA 1BKSA 3CZLA 3LCGA 3W81A 3BW4A 4P7OA 4Y9AA 1ZAJA 4UQ9A 3LTSA 2F38A 2YCIX 2E77A 4ZA0A 1EUNA 4HSHA 3UZWA 3ABRA 1QO5A 4I9MA 4UOJA 4LUSA 4QJ1A 1AL7A 5FOOA 5FESA 1QPKA 2PMQA 3W6YA 3F4VA 1ZBCA 5AY7A 2QCDB 3TWBA 1JG9A 4FNUA 1XRTA 6TAAA 3AZSA 1BQCA 1O6IA 1DIKA 3BSHA 1TE6A 3G8EA 1A47A 1WZKA 4EXAA 3EB2A 2B7PA 2AQWA 3CMFA 4FPSA 3T55A 1VJIA 1HL9A 4GX9A 3EWDA 3NPUA 3PS7A 4K8EA 3ATZA 3K5XA 3PWIA 3B8WA 1EJSC 3MBDA 1W9XA 1ISVA 2WBGA 4C1NB 3B0PA 3A64A 5B7ZA 4A2SA 1JPIA 3MTWA 3V0UA 3W7OA 4IMFA 2G5WA 5C9RA 4R9OA 3QFWA 4HJWA 4PRRA 2V5DA 3WFZA 2AQOA 1K02A 3O9NA 2PZNA 4JYFA 4QS5A 3FAWA 1UZDA 4NP7A 4MJMA 2FLIA 1IXQA 4GVFA 4E3TA 1BVNP 3AMGA 4PCSA 1OM0A 2X8RA 1UKSA 4LSBA 1LF1A 1MW1A 2BODX 4JX5A 1YMYA 4JHZA 1XBZA 3SR7A 2QYGA 2X41A 3O3RA 1UJPA 4D6EA 1FXPA 4R33A 3VCRA 2P50A 3STFA 5BU6A 4Q8OA 1KCKA 4ZE4A 4A3QA 3AMKA 4L1GA 3THCA 3GXTA 4FR1A 5F1VA 2JF6A 2X30A 3P6LA 5CPLA 2CLMA 3UETA 3L67A 4Y6GA 3UERA 3ZOAA 1ME9A 2YOCA 1PL9A 2CWXA 2A3CA 1E9LA 3G1VA 3AXMA 3GU9A 1G4SA 1SPQA 4AIEA 1RA0A 4Z2HA 5K3VA 3UWWA 1CLVA 4H8NA 3RU6A 4CCEA 1Z7AA 4QDMA 2R94A 3UZZA 2HRWA 3BMVA 3VKKA 2V6AA 1TPWA 4LANA 4M81A 3V3WA 4AVOA 3KVKA 3ZLHA 3SO7A 1KFKA 3TUUA 4NZJA 2WYSA 5BOFA 4HZ8A 4K38A 2J7GA 4R7OA 4XWUA 1O12A 3CGTA 4JQ3A 2WPBA 1PS9A 3FA5A 1SR9A 3T09A 2E25A 3SCOA 3M0JA 3WJSA 3SN0A 1V0KA 4LX4A 3KZSA 3LPOA 4O57A 1QI4A 3PSWA 3WF4A 1EQCA 5B80A 3FXGA 3TONA 2OSWA 3VOHA 2ZZ1A 3GVGA 2UV8G 4MWAD 2PTXA 3U4AA 1QPNA 3N2BA 2WZEA 2CBIA 2ISWA 3WQ4A 5CBJA 1MW3A 4A3UA 1Q8AA 4NAFA 3L7RA 1FWTA 1JYNA 4FA3A 2GJXA 1VKFA 1R6WA 4CQBA 5H1WA 3VOJA 4Z1YA 3NQ2A 4C1KA 1CWYA 4QNWA 1U30A 1GEHA 3L4ZA 4WK9A 5I6SA 5JVLA 4DJED 1R7AA 2A0NA 4JTQA 4G7EB 1QASA 3WQ5A 2C6QA 1TFVA 3KL0A 3RNDA 1R85A 4FEZA 2A7PA 1W31A 3MHGA 1DWJM 3NSNA 4IP5A 4KRUA 1LTDA 3CL6A 2DVXA 1MW2A 1WDDA 3KL3A 2J47A 3RFAA 3FX4A 1OFRA 3Q45A 4KT2A 1JEZA 1Z69A 3A12A 3UXAA 3L23A 3VINA 3FHAA 2QEZA 1M3UA 1EEXA 5FKYA 1PYMA 3ONBA 3G8RA 3I4EA 1VRXA 1LWIA 4PB4A 5ABFB 1R9YA 3BAXA 3W76A 3WLNA 3WJZA 2R9RA 3FYOA 3CV7A 3PZGA 3AS0A 5TQLA 1EEPA 2CLOA 1IWBA 1CECA 5K7JA 3CUHA 3IIVA 4BF7A 1SZNA 4Y9OA 5EBAA 3UYIA 4TO8A 3HJEA 1W1ZA 1UR3M 1KFLA 1G1YA 2FH6A 2QUUA 3N1AA 4KESA 1QK0A 4JGDA 2OKOA 1J01A 3KOYA 3QHMA 5DCBA 4XZHA 4C6FA 4JFUA 3GZ3A 3NGFA 3WQPA 3L12A 2QUNA 4J3SA 2ESCA 1O5KA 3VGFA 3WQ8A 1G4PA 3UGRA 3UG5A 4UTTC 1BGAA 5HK4A 4DWSA 5D33A 4B91A 3M0ZA 1NWTA 4GYFA 1BHGA 1EYEA 1XR2A 4LAZA 3UG3A 1QBAA 3W37A 1M41A 4ZQOA 4UC5A 3GSMA 4OOZA 4RDYA 3FKRA 1C9DA 3KBNA 1I2OA 4MKSA 5AC6A 3ZZ1A 5K9CA 3QSTA 3GDLA 3BW3A 3UW6A 1WAUA 1HO4A 5A1AA 5KINA 3UR5A 3WQ6A 1Q2SA 4HTYA 4YS1A 3PF3A 5DCDA 1GPFA 2ZRYA 1H41A 5T8GA 3NQCA 1I60A 4XSMA 1V4YA 4IPNB 1RV8A 4CLMA 1H0GA 1WZMA 3C56A 3W1RA 2XGBA 1VFFA 2AAAA 1ZP4A 4XZ9A 3H53A 1OCJA 4JIPA 4D6DA 1W1A1 1H62A 1XFCA 3URBA 1C7SA 1K8XA 4ZQMA 3DFHA 5A6JA 3TYUA 3TYBA 4O1CA 3CAWA 4GQQA 2WNZA 5EKYA 2Y8KA 4HNNA 1IQ8A 2NX3A 2OEKA 3TN3A 2PDJA 2E40A 4IGSA 4F2TA 1O5XA 1SZEA 3SCQA 4IMCA 3NOYA 3LU2A 2YYTA 3BGGA 1EDGA 1FP9A 2AL2B 2OOFA 4PMJA 3C2FA 1GQJA 1X96A 1GQKA 1O7AA 5DANA 4LPCA 1GZ1A 2PWUA 1J93A 2ZDRA 1E1FA 2QDEA 1XLFA 2FZDA 4WX2A 2GK1B 2YB4A 2WMJA 2QQ6A 3SY1A 3KCJA 1EOMA 2CHNA 3QHOA 2X42A 3MB9A 1V77A 4B4HA 3OZMA 2J77A 4Q3MA 4X60A 4XV0A 3ARUA 5CPMA 3IJLA 4AXNA 1KR0A 4PUUA 3QR3A 1UW9A 1V3KA 2XH2A 1W5NA 1Z44A 3W28A 4J9JA 4QJ3B 2FVKA 3BJTA 3CZ8A 2PEVA 1KM4A 3ATYA 3P2VA 3PBYA 3WX7A 4MM1A 4QE5A 3ABSA 1W3TA 3UJSA 5CLWA 1QFEA 1B54A 3FJLA 4D6FA 5AHLA 3GU2A 5AHIA 1E56A 4QHRA 4E0CA 4GQ0A 3FDGA 2OSYA 3W53A 1RA5A 4HU3A 5I2UA 3GVWA 2B31A 2QJHA 4UTIA 2D0HA 2BHUA 3WBWA 4L56A 4DYEA 4LF2A 2JE8A 1FA2A 4TMBA 2YGYA 1HJUA 1F8IA 4IOTA 3N2TA 1XDMA 3ABZA 3TN5A 2L5HA 4C6EA 5E0CA 3JRKA 3VD4A 4IP4A 3TIMA 5XINA 1AJ0A 1UQYA 4UFMA 3LZ3A 1A0CA 3T0CA 1XUZA 2XINA 3P8IA 1H60A 1NOFA 1RALA 3CB3A 4JPGA 4LNCA 4I6VA 1JQVA 1EHAA 2GYIA 3GDRA 3INPA 2DVTA 4HA0A 1IT8A 1PO9A 3RPTA 4WD0A 3HJZA 2VUNA 5DMNA 3WL1A 1SO3A 4RXGA 2IQ0A 4XVEA 3ZFHA 3GR8A 2O7QA 3WLTA 1Z8AA 1W17A 2I14A 4W8AA 1NELA 1B57A 1GQNA 5BOOA 4Z42C 3LK6A 4Z17A 3LI0A 2Q3RA 3MI2A 1C8YA 1F61A 1EOKA 1KTCA 3BAKA 3V5CA 5C5YA 4L4LA 3GXFA 3V1PA 1V5XA 4AY1A 2VX7A 3WQFA 1YPXA 1EX5A 3NQVA 3SCWA 1D2KA 4S3DA 1BD0A 1SQ7A 5DQPA 3BMWA 2GQAA 1PHWA 3GYEA 4OECA 2G3MA 4QAIA 4QSHA 4CQ8A 4IP7A 4MZ8A 3IGUA 4JXCA 3M16A 2OVLA 5CBBA 3QPZA 4OVXA 4OWGA 2R8WA 2ZZ7A 3RN6A 2NQJA 4O1BA 3A24A 5A8QA 3GHUA 3OW1A 4Q8MA 1KQYA 3JZEA 1E71M 2J78A 2J88A 2CLKA 3BQ5A 3FK4A 1JUBA 3TTYA 4O17A 2TRSA 4WR3A 5KETA 1EJXC 4AVFA 5U7SA 3LD5A 2E09A 3DERA 4W9TA 8RUCA 5HWMA 4XAPA 3WNOA 4I8DA 2X0SA 1O66A 1NFPA 1V0LA 1Q6FA 4I5RA 4HSNA 1T41A 5IHSA 3ZT5A 2J62A 2CC0A 3GHTA 4ERAA 1IR2A 1OG6A 4AEEA 2F84A 2W67A 3F4DA 2OLAA 4PTVA 1TWSA 3S5ZA 4X0NA 3WFAA 1QPOA 4GNJA 2BGSA 4ZB2A 2WHJA 2Y85A 4PUEA 2OZ3A 1J8VA 1L2QA 3WDQA 3A23A 1VRDA 1SFLA 3USBA 2WVTA 2HE8A 3DEQA 1XXXA 1FBAA 1Q65A 4V27A 1EQPA 4ZSTA 2VX6A 3CO8A 3U2ZA 3TOYA 1CW2A 2P8BA 4EPBC 1MFUA 5CPOA 3NXFA 2MUCA 2ZCGA 4HPJA 3AXXA 4EKJA 3IV3A 1NDVA 5LIUX 4LOCA 1C8XA 3CAQA 2X05A 3B4UA 3RITA 1W3JA 4O53A 4TUFA 3NL3A 4LVAA 3AJ7A 2VRJA 4X63A 3EWCA 4MWAC 4H2HA 4V1YA 4PTXA 2QMJA 3SECA 4W7VA 1I2PA 1OSEA 1R87A 1N8FA 5T9BG 4A4AA 5LNSA 1AH0A 1C7TA 3UPBA 4H3DA 1IV8A 2A6NA 3WSUA 4U2YA 4KWUA 4QG9A 4YPJA 1GUVA 2C8NA 2V3EA 2QV4A 3NR0A 1WZLA 1E1EA 1W3HA 3PPFA 2BHYA 4KETA 2CFFA 1A5NC 1KBJA 5DMMA 1Q6EA 2ZIDA 4JFSA 4JQAA 2KAUC 3EDFA 2ZUWA 4JFVA 4WQ6A 5ENLA 4PMQA 3S5NA 3BLOA 3L5MA 3K8MA 1R86A 3C0SA 3AYTA 4FB7A 4M51A 4LYQA 3PTMA 4MNMA 1KQZA 4QE1A 5EMYA 3G2GA 1G6CA 1J0KA 4Q4MA 4M7TA 3OLGA 4R27A 3LSCA 2NV2A 5A6MA 4O0ZA 4LYRA 2ZA2A 3LM3A 5E0FA 1F6YA 5I23A 2EPKX 3HF3A 1TVPA 4WGXA 4ZCWA 3C61A 2PBOA 2EPOA 4E4UA 1OYCA 3AHVA 1HKMA 3TROA 3T4WA 3O15A 2ZTJA 3AQUA 2X1IA 3HQNA 1L6SA 3LBMA 1FCUA 3C3UA 5EL1A 3PBGA 1EH9A 2QJIA 2NVDA 4S2BA 2OQLA 3VD9A 3JW7A 3IK2A 3N4EA 4OIFA 4EP8C 2G50A 4B90A 3ZQ9A 4AZGA 4H8HA 3EWYA 3U2OA 2DW7A 4PRWA 3OG3A 4YWSA 4RW3A 1V7AA 7TIMA 2REQB 3S2MA 3TMLA 2PTWA 3U7VA 2XN0A 1UP2A 3A22A 3TMQA 1QUMA 3ZO9A 4CN4A 3PNUA 4IT1A 1RUSA 5GJNA 3IPWA 4FR6A 2VX5A 3MP4A 1YDVA 4GVGA 3KBSA 4B92A 2QNEA 3I6TA 4IFKA 3UA3A 1KBKA 1GTHA 3P61A 1JVNA 1LOLA 1P0KA 2RDTA 5AYZA 1RHCA 1V7YA 3GHSA 3PR2A 4GI9A 4MFEA 3MMUA 3EX1A 3UZJA 2PDMA 3EX6A 4JAWA 3GH5A 4UQCA 2A3EA 4LB4A 2GUUA 1I2RA 4RPQA 2NLYA 3A4WA 3KCLA 4MKNA 1VC4A 1QDSA 4H7ZA 4U3CA 1A5CA 4UBPC 2OPJA 2FTPA 1N2VA 4AD2A 4Q4OA 5DN1A 3H4XA 4UNLA 2ZRXA 3ARWA 1GWJA 2O4MA 5IM51 4NZCA 4HCDA 2ACQA 3WLMA 1DWGM 3M0IA 4O28A 1R9ZA 4RDWA 1VIZA 3S2NA 2QIIA 5F2GA 3CQ0A 9RUBA 1XLDA 3N14A 2OJPA 3MUY1 3H55A 4QS6A 1VHNA 5FJJA 3LMZA 3MMDA 4M6VA 3N04A 2EQDA 2CZVA 4A35A 4CCZA 2OB3A 5KZ6A 1KTBA 1P6BA 2J66A 5LNUA 1FWRA 3PBVA 4GX8A 4RE3A 1A5UA 3AC0A 3OBEA 3BCDA 1G4TA 1VEOA 3U8GA 3AIRA 4Q4PA 1SW3A 4ZTYA 2ZICA 4ADSA 4R34A 1H1NA 3CEUA 4MWAA 4O1AA 1MI3A 1W2PA 5A6AA 2I57A 1CNVA 4LUJA 1T5AA 3EXTA 3M0XA 1ICQA 3IIOA 2R82A 1P7TA 3F1QA 1VYSX 3QQ0A 4PTMA 5AYXA 4DBDA 2Z1VA 3EZ4A 4RV3A 3STPA 3VZZA 6TIMA 4L65A 3M6YA 4IM4A 4UQEA 5HR6A 3S83A 2YBUA 1RQHA 1ZBKA 1K8YA 3NCOA 3FOKA 2E28A 3W7NA 1QO2A 5I77A 3ES8A 3I6EA 2E0PA 4NASA 3HGOA 2A3LA 3AIBA 3LGGA 3T7VA 4D1JA 1EFZA 4YTQA 3L2IA 3WMBA 3OVPA 4FNPA 3W7MA 1U22A 3VD5A 5DRIA 1K9TA 3TFCA 4PTNA 3BG5A 1UCWA 1H1ZA 5FF3A 3W29A 4FIQA 2R14A 1CDGA 3HIJA 1FCBA 4PBEA 4RZ6A 4KCUA 3BOLA 2PWGA 2D1ZA 1BFNA 1DWAM 1M04A 1OCBA 4DBWA 5JU6A 1VFMA 1R3RA 3UNTA 2Z2UA 2VENA 3V75A 2OLSA 2JIWA 3LPFA 1DPMA 5BMXA 1XBYA 3R8RA 1QBBA 2RJGA 4JTIA 2E3ZA 1DE6A 1Q7ZA 1TREA 2DSVA 1AW2A 3SUVA 3W7EA 3DHFA 2ZX6A 2C16A 4WDXA 5KZEA 3WMCA 1KV8A 3VIOA 3O05A 3MMTA 4S39A 4GI8A 5LXEA 3NZRA 4QLLA 4U31A 1DTUA 4HT3A 5D2VA 1S2AA 3SBFA 1J12A 4L6HA 1HN1A 4US5D 2HJPA 4TX6A 5BYWA 5I3HA 2F7FA 3DC0A 8A3HA 3CAKA 7A3HA 2O9OA 1GPWA 2WC7A 3N4AA 3LBOA 2NLIA 1K9FA 2R24A 1LORA 1OVDA 1AVAA 1T8QA 4WRHA 3S1VA 1H5VA 1PBGA 1XS2A 5CPSA 3ARQA 1UD3A 2HEJA 3VDAA 3H2EA 2GGHA 3DYPA 5D2TA 4H9VA 5IXEA 4FO4A 3BLFA 4G9PA 4LVDA 2YCKX 5F4XA 3MC5A 2PGWA 3URQA 1V3HA 2XVNA 1U1JA 1EC7A 1MUWA 1L6WA 2PE4A 2BVWA 1FTXA 5LA1A 5D2WA 3GDTA 1JDEA 2VDHA 2DUZA 1B9ZA 3K1GA 3TSDA 1R2SA 1A5MC 3FSUA 4Q7BA 2QPSA 4DAIA 1U5VA 2FHFA 3VOCA 1UHVA 3NZGA 2XWEA 3O8AA 5HQEA 1HJQA 7REQA 1OK4A 3N6QA 3OLIA 2QS8A 1PDZA 4DLFA 4PEEA 4P8WA 1S2WA 2GLKA 1E72M 3ZR6A 2OR2A 3MQTA 3DFYA 4LVBA 1Y5VA 4P2VA 1M65A 1Z32X 1R2TA 2Y5JA 2VC5A 2BVYA 3CZJA 3O6CA 2OGYA 1RK6A 3L5AA 1P43A 4LGXA 5HMFA 1TTIA 4GI4A 1EO5A 2PWDA 3GG0A 2YA1A 1Q6DA 5D8ZA 4G5DA 1FWSA 4M24A 5IOBA 3GBDA 3A4JA 2J8TA 4LUYA 4GRSA 4CQ9A 3K4AA 2ZA1A 1ZAHA 1F3XA 1AA1B 4JD4A 3BXWA 1W3LA 3IJIA 4AU0A 2BOFX 3C6CA 3M0VA 1PUDA 2QJGA 3EWZA 1XLCA 1RQBA 2RDUA 3HG5A 1ITCA 3NZQA 2QCFA 2ZFAA 3QMTA 1GVIA 1CGYA 4AZ6A 1B90A 4QEEA 1UBPC 3W2NA 4F4RA 2WNQA 3CWHA 3IS4A 4LBRA 4MB1A 4U5KA 1GKPA 2WNNA 1PE1A 4GXWA 4J27A 5BRPA 3RGTA 2XH0A 3VOIA 1UPMB 1ZCOA 4HZ6A 2C1GA 1OINA 1C91A 3F4CA 5FL1A 4UZSA 1JD7A 3P80A 6ALDA 1GKQA 1O94A 4HQVA 5H6HA 4EXQA 1V03A 3HQOA 4H9ZA 3G1HA 1KXVA 3QF0A 3DHDA 3RCYA 2Z1XA 3UJEA 1DL3A 3BCFA 5AYYA 3SRHA 1TPC1 1T40A 2VGIA 2DW6A 3QZ6A 3EKZA 4K6AA 3PANA 5I79A 1AL8A 3THDA 3BAJA 1QWKA 5EYWA 3GXDA 4BI5A 5CC7A 1N8IA 3MO7A 1LRQA 1CCWB 1SO5A 1W5OA 2O55A 2GVEA 2FJKA 4LEFA 1RAKA 4LV4A 1IZKA 1KO0A 1CXEA 1ICPA 1JUKA 3WLPA 3QR1A 2J27A 5E0KA 5BNKA 1EB3A 3OGRA 2ZZ3A 1QOQA 4BI7A 3NWRA 3SN1A 3BMXA 5HATA 4AWEA 4K8GA 4GPNA 3W02A 3CHCA 1X38A 3A5VA 1AMYA 3IACA 1FWIC 4CUCA 3TYCA 1HVQA 4B5WA 2J9XA 3DENA 4IFOA 4C6JA 4XBKA 1FX6A 1DHPA 1Q45A 3T42A 2G95A 3W6LA 1S38A 5IBXA 3M0HA 4A2RA 4AZIA 1IGSA 2GPTA 1P4CA 4IUOA 1REQA 4UR9A 1E6ZA 1XKYA 3PVFA 2YXGA 4S3EA 1RSCA 3L4TA 3PNZA 4FALA 2QJJA 4YTRA 3ARSA 4ECLA 3D3AA 3T8LA 2E4TA 2C13A 2TMDA 2XSAA 1H7NA 4AYGA 3S5YA 2C3ZA 4W7UA 3KL5A 3AHYA 2X1SA 3TQVA 1XLMA 5C9XA 1ITUA 4DUXA 3E5BA 3DG7A 3H24A 4WSHA 4FXFA 1QRQA 2QGHA 1H0IA 1VCGA 2XVGA 1XYLA 3RJXA 4QX4A 4I9TA 3TE9A 4KEVA 5I3JA 1E73M 1WB0A 2Z00A 1XJBA 2VOMA 3FFSA 5HNRA 2INEA 3R4IA 4BZYA 1LT8A 3SGUA 3CHVA 3R25A 3D5HA 2DZSA 3TYAA 2V3FA 3APYA 3B8IA 2CU0A 3HB9A 3BLLA 1NF0A 1QW9A 3V16A 1IHIA 2Q3OA 3D47A 4NU7A 3D46A 4LAMA 3TZNA 2OSXA 3RM8A 1RBAA 2OTDA 5DFAA 3TAOA 4Q7IA 4Q8UA 2QUTA 3U9IA 1BYCA 4N9BA 1MWOA 3IARA 5T91A 3U6WA 1XHGA 2XZ7A 4KQNA 1W5PA 3RO8A 1TV5A 5A6TC 1YBQB 3W7DA 2XYLA 4REQA 5AN7A 1M7PA 4HU0A 4IJCA 2C7FA 4EF8A 2VFHA 1ODUA 4E2BA 3UG8A 1VFOA 1UZ4A 3TCSA 4IL2A 2GOKA 1E6RA 3OBKA 4GY0A 1MXSA 1PWLA 1FFQA 4Q8NA 1EDQA 1YW1A 3GE7A 1QOXA 2GUBA 2F9RA 4DO7A 1X1OA 3OEXA 4JTHA 5A6SA 5AC4A 2PF0A 4KWWA 4PCNA 9CGTA 1U1UA 2P1FA 3W7JA 4M8UA 5AZ0A 1XLEA 1QTWA 1D7FA 2X1TA 1GG1A 3GNXA 2ZKMX 3CL7A 5A2AA 3F2CA 2O56A 1GJWA 3DH7A 4A8NA 4RCXA 5CPQA 1KBBA 3BICA 4HN4A 4GQRA 1UC5A 4YLWA 3LV5A 3SB0A 1TMQA 4MADA 3A3WA 3MSDA 4IX2A 2DUXA 4PYSA 5HJLA 4LBUA 1SZFA 2ZRUA 3GTIA 3VX1A 3MWAA 4ROPA 3D0CA 2OYMA 3S6TA 4BQ3A 1XUUA 5DO8A 1PWMA 1UP0A 4GFSA 3HU7A 4LW7A 3PPGA 2ATSA 9XIMA 1VJSA 2ZUVA 1AQFA 4IFKB 3UFYA 2QPUA 4L4MA 3R94A 4CD8A 3FY1A 4JX4A 4TVDA 3MV11 1EIXA 4LS1A 3GVRA 5FEXA 1US2A 2JGQA 4FLQA 6XIMA 1TV3A 3P7YA 1ZP3A 5A8MA 2QT3A 4GK8A 5DXYA 1ZPTA 4HNCA 3KZPA 5FSDC 3BOFA 4L64A 1E3XA 2ZA3A 3C4UA 4OT7A 3NYDA 3LA4A 1M7OA 3TDFA 4F2UA 2EPMX 4QTGA 3WZ0E 3QQWA 2QCGA 2PLKA 5DMLA 4DWSB 4JHMA 2WQDA 3WF2A 3G1XA 1W3IA 4Z2KA 3TC6A 4PCPA 4MOZA 3ZM8A 3F5LA 1PEZA 3N73A 5CLTA 4C6IA 3B8VA 5TD4A 5CSRA 1K7EA 1MQRA 1VIWA 2C0HA 2CZ5A 3DKLA 3CQKA 5HNNA 4HA1A 4NVTA 2CLPA 3UPWA 2XM2A 3RXZA 3BUVA 2CKRA 1QPRA 4W5UA 1H7XA 4H9YA 2DUAA 3UXLA 4G8TA 3EB3A 4E2OA 1V6WA 2VCCA 3DUGA 1N8WA 1AD4A 3YPIA 1BVWA 5D04C 3NNTA 2XSXA 5SWUA 3QOKA 5IDZA 3NJ3A 1ELSA 2DZAA 4KKXA 3KUMA 3LXCA 3DBPA 1TYGA 3VABA 4TX9A 3VM7A 1JNDA 1QWGA 4LEQA 2AOSA 4GJIA 4J40A 2P3ZA 4JKMA 5FCZA 5CEWA 3DHUA 1ICSA 1V6YA 1XYAA 3UA4A 1K4GA 1GHRA 3GH4A 4OUEA 2BBFA 1AJ2A 1O5QA 3ANYA 5JUVA 4MAZA 1EGZA 5DY2A 2VD8A 3STCA 2FDSA 5TBOA 2CZDA 1XIIA 4YL2A 4PCFA 1IEVA 2V67A 2DV0A 1IE7C 1KB3A 3EXRA 4W4QA 4S38A 1UPPA 2Y4SA 3E96A 4WJXA 3PZUA 1EGVA 3ZSSA 3RDKA 3GBEA 1CGTA 4JCMA 3T40A 3CHFA 4D8AA 1JCNA 3O0FA 1UD8A 1MZHA 2OQHA 1DJWA 3DFNA 2Y7DA 3QV8A 1V08A 4NAFB 1AW5A 3P93A 3LENA 3T1GA 1JZ4A 3ZXWA 3QY6A 3KHDA 5LKYA 2X1UA 1F4HA 3UWVA 3A4XA 2QKFA 4OHQA 3W00A 1HZYA 2OXNA 2DT1A 3UQNA 2VVNA 3BV7A 2P10A 1WKEA 1I8JA 2EPNA 4WOZA 3WO8A 2NUWA 5I02A 2TODA 2PWEA 1GQIA 4U33A 1SJAA 1W32A 3NFUA 4JNZA 2QDHA 2VWSA 3VGGA 3QKEA 3N9KA 3TSMA 3SI9A 3TVAA 1TA3A 3GO2A 3F2BA 3OLDA 4US6A 1SJBA 4B2DD 3TQKA 4BR1A 1NJJA 4WKHA 4GACA 1ZUAX 1GOXA 4Q8TA 4QITA 4JL2A 1G0CA 1GYMA 4EVZA 3FCPA 4ICNA 5LXXA 3S1UA 3C8NA 4L4OA 5L9FA 3GY1A 5IFPA 3WUEA 1JUEA 5HULA 3IVTA 1V02E 4XAZA 5DLCA 2VO5A 3AISA 3EXSA 4PMUA 4S3CA 5D09A 1PX3A 4WSJA 3HPXA 1GYLA 1E9ZB 1JD9A 2ZE3A 3W7CA 3NUKA 3OGVA 3VUSA 1GOQA 2P0IA 3LYEA 2ZWYA 4PULA 5I03A 3GC4A 2PP3A 4KIEA 4UQAA 8XIMA 3M1ZA 2CZFA 1UH3A 4D6GA 4XAFA 4XKMA 1GOWA 4UFHA 3SUWA 1IZCA 1QHZA 1FWNA 3GH7A 1XPGA 1J96A 4IMGA 4J28A 2WM1A 1LG2A 3W7RA 3W27A 5FA5A 3VDGA 4QNEA 4X22A 5F7UA 3W7PA 4FX6M 3VIJA 3GDMA 4B5VA 4N9CA 1LBFA 4MLRA 1XINA 4O52A 1F4AA 5G4HC 4ATLA 1UUQA 1KLYA 1GK8A 2PGRA 3WD1A 1W9DM 3QKZA 3XINA 5HPCA 4W8LA 3AZRA 5F4SA 3MO4A 1XD0A 3QYQA 3K46A 1DXFA 2WSPA 1LBLA 1JQXA 3RIKA 4B4FA 3PUEA 4LAKA 3UWZA 3VGBA 5AZ1A 3B97A 4JTFA 1RXOB 1A49A 3H2CA 5D03A 1GT8A 3ICJA 4Z1DA 1ZBWA 1ZY9A 4QBXA 3F2DA 1HGYA 4MUPA 2HV5A 3W88A 3P82A 4WXYA 1OB0A 5A8OA 1XIMA 2OMAA 4ZENA 4J3TA 2BTMA 4TXEA 3UR2A 3N3TA 2G96A 3WDHA 3O16A 1SM9A 5KITA 5LIKX 3F5JA 2ZOXA 4C1LA 4Z2LA 3U2EA 4L1XA 4K36A 3PTDA 2EJAA 4QFUA 5EA9A 2PRMA 3CT2A 1VBHA 3LHVA 3W3OA 1ISZA 1W91A 1QT1A 5JMUA 5KZMA 3WBXA 4NJGA 4NXKA 1K9EA 4XKYB 1MNSA 4YCOA 1DE5A 2XM1A 2Y70A 3R79A 1V3IA 1G94A 1MZRA 2W66A 5BROA 1P0BA 2XDFA 3B3DA 2OT1A 3WK3A 2IKJA 4CNSA 3KOXA 1KWGA 1C8VA 2JK2A 3CLMA 4D8LA 3K4WA 4IXHA 1GVYA 5I3DA 1CEOA 4JTKA 3KTXA 2DSZA 3SSZA 1I6NA 4AEOA 3V1HA 4GYJA 1JI2A 1VZWA 3FJ6A 3PTKA 5A95A 1SW7A 3MDWA 2GVJA 3TTQA 4AWSA 2CWNA 4D6HA 2W0UA 3ITOA 3L68A 4W93A 1E1CA 1TRDA 4Q4KA 3LRKA 5A6KA 2W91A 4JQ1A 1TV7A 2VEGA 3POCA 3SCSA 4YWIA 2DSKA 3VM5A 3IJQA 1DJNA 2PDIA 3ZJ7A 3Q94A 3WEZA 1F2JA 3NM1A 2OX1A 4DJEA 1YIXA 5G2IA 4EE9A 4DB7A 3LRMA 5ABTA 2YCEA 3XISA 3PAJA 1C3FA 2PDCA 1JL8A 4CU8A 3W07A 4J2PA 2DU2A 3VIMA 5E9XA 3CBWA 1LQ0A 3TKFA 3OHMB 3SCRA 3VC5A 3N9RA 2ATMA 2Z24A 3NL5A 1ZB5A 4LUIA 3ECQA 1U5JA 2WCAA 3UZ5A 1PX4A 2E7FA 1O68A 4GKTA 4Y9PA 2WANA 1GYNA 1UD2A 3LXBA 2OWXA 3UBPC 2E9MA 4LFYA 2R1MA 4URIA 3AJXA 3M0MA 2VZUA 3ISIX 2OELA 4QLJA 4R85A 2O92A 1QU4A 1D3HA 1UR2A 2DT3A 4Y90A 3QJAA 3ENLA 3WQOA 4ZE5A 1TWDA 3NQBA 3G1SA 4LAUA 2E67A 3ALGA 5G1MA 1TPDA 1PZ2A 1SFSA 3KP0A 4DBSA 3N11A 3WD2A 4IWWA 4NUWA 4C6PA 4MZ1A 3IANA 4QLKA 3WELA 2VFIA 4A3HA 3HG4A 1B3YA 4LY4A 2BY3A 2IW0A 2ZZ2A 2CBVA 3QV7A 4DBUA 4X3ZA 4CVUA 2HXUA 2PDHA 3FSTA 2YZRA 3WDPP 2JKEA 5LA2A 1A5SA 1TR1A 4OBRA 1KBIA 1XIGA 3N19B 4FOJA 3EPOA 1F73A 2YDAA 4M1BA 2DZUA 3WDIA 2WM0A 1TJ2A 3QQ1A 2VFFA 4J5NA 1QNSA 1GOMA 3ZVIA 4UQDA 1TCMA 1R3QA 3O06A 3W26A 4H6KA 1W3KA 2IKHA 2WHKA 3GC2A 3G3MA 2RDXA 3BK0A 3VNLA 4DJEC 2Y7EA 3SQSA 3N2CA 4RE0A 4O8RA 1TIMA 2XUCA 4H6EA 4F0SA 1X6LA 2DSWA 4RX0A 4ZO6A 3NVTA 1VQTA 2CNCA 1NAL1 1MQPA 1NM9A 3A47A 1KCLA 1UD4A 3GWQA 3CT7A 4NJIA 3IIPA 1XRSA 4UWMA 1WKFA 3M6DA 2F6XA 3I65A 3E49A 3RMEA 3RRXA 3NPWA 1R3SA 4ERGA 4YXGA 5J5DA 4AIUA 2WK2A 5GJMA 3QEZA 2CYGA 1IXNA 2PP1A 1DIOA 1Z6KA 1HVXA 3VCNA 3LB0A 2PDBA 3LCLA 2V5LA 4QP0A 2D0GA 4IIGA 4N7QA 3L4YA 2OQYA 1UMLA 2JEQA 4TTUA 4KW2A 1ZENA 4JY9A 4O15A 3S8HA 3J7HA 1MYRA 5M5DA 1BWKA 1XLGA 4L7ZA 1B3XA 4KFPA 4JL1A 5AFDA 1JFXA 4UTWC 1AMKA 4IQJA 2PD5A 2EG6A 1H7RA 5G2WA 4HNTA 5D9NA 4RR4A 5BRBA 4GIYA 1LLWA 4JDBA 1NF7A 3D6NA 4QQUA 4NZ3A 4N9EA 3HQ1A 3EPNA 4YJ5A 3W24A 1FQ0A 1OFAA 2WWDA 3TC3A 2TPSA 1TG7A 4AX6A 4AZCA 2OEMA 4B5SA 4HHPA 1J0IA 1WBHA 2RUSA 1QNOA 1XISA 3TYZA 3NDZA 3NA8A 4P7NA 5A8PA 2ZC8A 4BQ5A 5E09A 4A21A 1XFBA 1YADA 3FHQA 3VILA 1WXJA 3PZOA 1M9HA 2J7HA 2X1RA 4JS3A 2HK1A 4C6OA 4DJDD 4XD6A 1TPEA 4H6RA 4DJDA 1GORA 4W87A 4E4PA 1QI3A 2CLIA 2AGTA 2GDVA 2WZIA 2PWFA 6ENLA 2J75A 1PZ1A 2OOGA 3EDJA 3TEVA 3W7LA 1FWGC 4UCFA 1VF8A 1WNOA 3QMRA 3W75A 4NNAA 4XTDA 1EJTC 4GZ7A 1O60A 2QCMA 2J7DA 4JN6A 2IXUA 2POZA 3AU2A 3GRIA 1OJXA 2W4XA 4JTJA 1POKA 4B5XA 4M56A 2E6YA 2C0AA 2C91A 3G24A 3MS8A 1IXPA 1J5TA 4C6MA 1T6MA 3CU2A 3CQHA 3CPUA 1K3UA 4B3LA 2FGBA 2OO6A 1GVEA 3WH9A 1V0MA 3EA1A 4ZB0A 2WPGA 4Y8EA 1YEYA 3K1DA 1OC7A 3E0WA 4ILSA 3WQCA 3MBFA 2PCQA 5I0DA 1FWFC 1EPXA 3RF9A 5D9OA 1RY0A 4IXXA 4B16A 3VYLA 1NFBA 2HDJA 1NIUA 4UFKA 3WQGA 4AMAA 3EX3A 3QPYA 2E68A 5D32A 1F3EA 1XCFA 1TPH1 1DXEA 1Z89A 2VZTA 1PX8A 1YRRA 3GG1A 3TU9A 4UXDA 3EDEA 3S2LA 4CNUA 1H7PA 2PC4A 1XBVA 4PE8A 2I56A 1P1XA 3GDBA 2F61A 3CK5A 4IL0A 1Q13A 3SIZA 2H90A 1OX5A 3UF9A 1OX6A 3O0KA 4IGMA 2E5BA 2BDQA 4BCEA 4GGHA 3WF3A 4KS0A 2WSYA 1LQAA 3MMWA 4P7RA 4ZO7A 3CNYA 3EMZA 1Y5XA 3AIQA 3T4CA 4GGBA 3TC7A 4IMAA 5CAKA 3VNDA 4BY3A 2F8QA 4UFJA 3FEQA 2ZADA 1LG1A 4WEVX 1TUFA 3VAVA 4WZHA 3RMJA 2Y2WA 4GC4A 2WNWA 3AXIA 1M7JA 1CB2A 3KRUA 2FGLA 3NURA 2H8XA 4NIRA 1BXNA 3RAOA 1YTKA 2YCLB 1G7VA 2PRLA 2H9AB 1IWPA 2PC8A 3GTFA 5MKGB 1JZ5A 3UR7A 3SM0A 2ISSA 3LV6A 3E2VA 4ES4A 1HX0A 4YVPA 3PHAA 3W2UA 4I3GA 2PODA 3IGSA 3QY8A 2PU0A 3TQPA 3LEPA 3P0XA 5GQBA 4KH2A 3NQ7A 1E4LA 2JBMA 2Y5SA 4TOQA 5G4WA 3TA9A 3H2MA 3GFYA 1WA3A 3OB8A 3SQMA 3R0DA 2BS9A 1UWRA 2QCNA 3K2GA 1SYTA 2ZVRA 4H7VA 4F8XA 3MUXA 4MDOA 1AJZA 3UXKA 2IS7A 1XC6A 4XD3A 2W79A 4GNKB 2REQA 4LCSA 2VGBA 3IIZA 3IJ8A 3QYSA 5T9CE 4J3XA 4RL3A 3SURA 3OZPA 2HS8A 3DCPA 1UROA 2UY4A 3W38A 1LT7A 3CZEA 1A4MA 1CGVA 4INFA 3CH0A 4XD4A 4P5UA 3M7WA 3UD6A 4DWSC 3O6DA 1HKIA 1A3WA 2GVGA 4M6UA 2YB1A 1W1YA 2HWGA 3IJ9A 2DH2A 1Y65A 2YFNA 3GXPA 1X98A 4ALDA 1GCYA 3NTYA 1BXBA 5C9WA 4CQDA 1LRNA 4I90A 4DBEA 4JICA 5T26A 2QPXA 1JYXA 2VR2A 3E1F1 1UB3A 3JS3A 4I6KA 4O4VA 3OOQA 2WV8A 4GE8A 3ZIZA 1I45A 5HJXA 1MDRA 1JULA 1X39A 3M5XA 3VMPA 2HXTA 1UR8A 3PZTA 3HGRA 4GBDA 4XBJA 4PSRA 1F07A 4MKVA 1CIUA 1MRAA 4JFWA 2D73A 1N82A 2H8ZA 3H2FA 5C7HA 2HPIA 4D6CA 1JZ7A 1ZLPA 1F6PA 2VGGA 3GQYA 3W2MA 5JBFA 2WCSA 5K4XA 3R1ZA 1V6TA 3IVUA 4IPLA 4WJEA 3MWCA 1E4NA 4ZFCA 4DI9A 1R46A 4QM1A 2YKKA 4Z08A 1XIEA 4DM2A 2QDGA 2ZX9A 1AQHA 1FWEC 2QJMA 3Q2DA 4MJ4A 3OHIA 1W0MA 5H8PA 3RCNA 3G1AA 3L4XA 2CXEA 2XHYA 4LC8A 2V5JA 1JF5A 3MUZ1 3TLLA 1TB3A 2Z0IA 3G18A 3M5VA 4GUIA 5CSUA 1HJVA 2Z7KA 3GK0A 4DWDA 5CPNA 3PBUA 4OJYA 1TELA 4DZHA 2XTKA 2G97A 5EGRA 1S5VA 4K39A 2PDNA 2DT2A 4JTDA 5C2GA 2I9UA 3LHYA 1CLXA 4O50A 3W1UA 1OK6A 1ONWA 4LBSA 2DZBA 4WOQA 4Y96A 2ACRA 4M1RA 1XLAA 3S9IA 4UFIA 2YDQA 3ZT7A 2X7VA 1PYFA 2E9LA 2CW6A 3HTWA 3WUGA 2BV9A 1PKNA 5AHEA 2G3IA 2WOQA 2H3BA 5BW6A 2GDQA 3WJWA 4UOZA 5RUBA 2DZWA 1J4EA 4JOMA 4TV6A 4XQ6A 1V51A 1LM1A 4DIAA 5BXPA 4M29A 3GHRA 3CO4A 3WK2A 1AH3A 4IQEA 1K70A 3NQDA 3WD3A 3C86A 4LVGA 1SSGA 1NDZA 5A6BA 3EKLA 1S2TA 2VC9A 4RE2A 1YNYA 3DHPA 1NWUA 1SFTA 3BARA 4DJFC 1ADDA 1FY6A 3EOEA 3HM7A 2FFIA 2P0OA 1OZMA 1UIOA 2XH7A 4JTUA 3MCNA 1RD5A 4NI3A 1F3WA 4U3AA 1HKVA 1B3OA 1QI5A 2PAJA 2UY2A 2HNEA 3GD6A 3QMSA 4GY1A 3VMOA 4MMWA 1ECQA 4UR8A 5C7VA 4W86A 3OYZA 1DWFM 4ML9A 2GJNA 4AFYA 4O11A 1PAMA 1EC9A 2YCLA 4HOZA 1GW9A 2QUMA 6CGTA 3QZAA 3SW6A 2FYMA 1JXJA 2CITA 4HYVA 4O10A 3UZXA 4FSAA 5HNUA 3OZYA 3WMLA 4JIHA 4E2VA 3DI1A 3KP1A 2FPVA 4Q4QA 3CTTA 2PDWA 2EEXA 4U2ZA 3GXNA 4KEUA 1HW6A 3UXIA 4X0VA 4IISA 2R1PA 2Y88A 2A1YA 1NU5A 4HOXA 1PCWA 4HU4A 2CZEA 5KSWA 5DT5A 7REQB 1KLZA 1SZGA 2WVVA 4FX8A 1MXDA 2GJLA 3G77A 4RZ4A 3MUCA 1YBQA 1DJHA 3NQEA 2Z1SA 3KCOA 4BS0A 3QFEA 3LLDA 4H19A 4V1XA 2AL1A 2WKJA 2ASHA 1W56A 4MIMA 4ROQA 3VUPA 2EJ1A 3EAUA 4H4IA 4JQ2A 1W1PA 3W74A 3OPSA 3UGVA 4HD5A 5LNWA 1YLVA 3ID7A 1TMLA 3PWAA 4RPPA 1JZ3A 2BSLA 4NAEA 3LCIA 3D3FA 3TLQA 6A3HA 5FEWA 1X8FA 2Z1WA 4DZAA 4JX6A 2V2HA 3II1A 3BPWA 3M41A 3AFBA 1WBJA 5CCZA 3NO3A 4MWAE 4UTHA 4CN1A 1YDOA 5H8UA 1JRBA 3GXIA 1XYCA 1ODZA 2GQ8A 3E2RA 3P3BA 3KVMA 2I5QA 3I3DA 1TTPA 4FF5A 1I4NA 3SEPA 6REQA 1VBGA 5CJNA 3CMGA 5K9XA 5F2MA 1P48A 2ZZ4A 1UYQA 3LGDA 2FFCA 3F03K 2EKCA 3KXQA 2VUYA 3LM7A 5G1TA 3CUFA 2C19A 1C90A 2EPHA 1CBGA 4ML4A 3HQPA 3PULA 2Y24A 4D8ZA 1JI1A 4LF1A 3S5SA 4WHBA 4DF0A 5CC3A 3DGRA 1O4UA 1KM1A 5D38A 2I5IA 2ISDA 1FKXA 5G1YA 1ZJBA 2WJDA 4ZEPA 4NG3A 3MSGA 4UTLA 3DFTA 3GC5A 2PZ0A 4J3UA 4ONVA 2NWSA 2GDUA 3ARXA 5U4NA 4FP1A 4GMEA 2Y6ZA 2OKTA 1EP2A 1EZ2A 2H9AA 4PMDA 3VNMA 1OWQA 4GY7A 4GJJA 4AC1X 3KW3A 3W7GA 4KPLA 1KM3A 1DKWA 5C9UA 4LCRA 3BOXA 1S2UA 3S1WA 1NFGA 1G67A 4RNFA 2Q02A 1YYAA 1Q6RA 3M43A 1HKJA 1KCZA 3L0GA 2PLMA 4TV5A 1EHNA 3WLJA 4DM1A 3V35A 4KRTA 3I7SA 4CEXC 3QV6A 1HQTA 1VBRA 3H2NA 4JTSA 5CZJA 1U2YA 1PHQA 1O1ZA 4S3KA 2GOUA 3FNDA 4MY9A 1ME8A 2VEIA 3EX4A 4S2CA 1NWRA 1XQLA 3N2OA 4FZIA 1E9YB 4FNTA 1K6WA 3NSMA 2D2GA 1PB0A 3U7BA 4F0KA 2OO0A 3CV6A 1TCDA 2WCGA 4PB5A 1KFBA 1ME7A 1Y0EA 1ONEA 1KTNA 2J7FA 1G01A 3LHZA 4GVHA 1LLOA 4RK8A 4AZHA 4TVCA 5AHNA 3HURA 4H41A 1VENA 3MZNA 4TR9A 2TSYA 1K9DA 4HK5A 3KHJA 1QAPA 3BSMA 3E38A 2DJLA 2DT0A 2Q8ZA 1J9YA 4HN8A 2I17A 3WD0A 2INFA 4EPDC 3OQEA 4N6FA 1LZOA 3DFPA 3E02A 1X7IA 1OIMA 2DQXA 2V5CA 2V69A 3STEA 4XB3A 1ZJHA 5BU9A 1EZWA 4YMZA 3VIPA 1UMYA 1F7BA 2ZZ5A 1I2QA 2IXVA 3AS1A 1QW8A 4DELA 4LXFA 1XDLA 4ZO8A 4F2BA 3KWSA 3S2JA 3ITYA 4S3FA 4K1GA 3B9DA 1TPFA 2ZXQA 3GG7A 3K4DA 5EMLA 3NYZA 2GSJA 1QATA 2QCCA 3G1RA 1WDQA 2Z28A 5FF7A 1ZRQA 4BWLC 1QPQA 1R3WA 4QDWA 3AYSA 3P5ZA 5HAOA 3IUIA 2G3JA 5K2ZA 2HVOA 3USZA 7ODCA 4LB3A 3H2OA 3CEPA 5GVJA 2BY0A 3O2LA 4P8UA 1P0EA 4GCAA 5M1TA 3S5OA 3WNLA 4P61A 1VYPX 3KRSA 4Q22A 1FP8A 3PFMA 4HPGA 1XL9A 4IIHA 1PTDA 1YHTA 4YVXA 3PBMA 1V79A 3VZXA 1ONRA 1WAWA 3S42A 2NVAA 2IMRA 5M17A 1XWYA 3F4WA 1POJA 2V2CA 1JRCA 1PDYA 2VEPA 3VKBA 3ONCA 3WNMA 3SY8A 4G7EA 4FLRA 1E6PA 2ZUTA 4KCVA 3IIXA 3L66A 2PSNA 2YDSA 3MA8A 3WBAA 4HNVA 3B8UA 4CNNA 3QGAC 3VE7A 3WMSA 4B5UA 2DFAA 3VZYA 3GZAA 4NX5A 4Q4SA 4N6EA 4KERA 2HBVA 2HQAA 1FKWA 2GJXB 4QJ4B 1H7WA 2UBPC 4C5YA 1HIZA 3NO5A 5DBTA 4DNMA 4PUNA 1J6OA 1JGIA 3QGVA 3VD7A 2D3NA 2WMIB 4L6OA 2X2GA 3W7HA 4A8IA 2PDLA 2V3GA 1FCQA 1O95A 1KXHA 1MSSA 3L9CA 5I3IA 2WVUA 3TSBA 5I78A 4HMCA 4G2DA 1UP3A 2QULA 2XIQA 3FA3A 3TNBA 2HK0A 3DYOA 3E6EA 3AIVA 1F3TA 2A85A 3QTGA 3L21A 3RCMA 3BW2A 3VKCA 2WSRA 4E4FA 5PTDA 3N17A 5C55A 5FJIA 1UKTA 3GTXA 1GVFA 2F6KA 3HOJA 2Z6JA 4AB4A 4PUMA 1LQ2A 3N18A 1CXFA 4QJ5B 2D69A 5KMYA 3PZIA 2Y89A 1E4MM 1SVDA 4J3ZA 3SCUA 1TUXA 4E6MA 2JQXA 2ALDA 4HPXA 1RPXA 3OVQA 3WK0A 3HV8A 4XKYA 4GYPA 3ELFA 2ZX7A 4JZ5A 5J8LA 1ENUA 3EOOA 1P6WA 1XICA 2W61A 1UH4A 2BOGX 1Y5WA 4AQLA 1HKKA 1MEIA 1BXCA 2YR1A 4FMVA 4JR5A 4LALA 4Z0JA 4N4PA 4G1KA 4GLEA 2VL4A 4HCLA 5HQMA 3GR4A 3NQ8A 2V2DA 2PUZA 1J6PA 1X7FA 3I10A 3MDUA 3EOSA 1FHUA 3UT0A 5GJPA 3AU6A 2VURA 5I09A 5A94A 4TIMA 3WUFA 1ONXA 4J3WA 3WFLA 4NY2A 2GUYA 5TNVA 4PUJA 4WKAA 1SO6A 2NW0A 5LA0A 3KBJA 4PUWA 1YDYA 3RPDA 5E6YA 4G1NA 5G4EA 4OE7A 4OTKA 4POCA 1HT6A 1OT2A 1Q6OA 5XIAA 4GUJA 1GZJA 1FCVA 3WEOA 3VI2A 2AL2A 1QI2A 2NX9A 2G37A 1NARA 3RJYA 2FVLA 3PY2A 3F5KA 5HQLA 1EWDA 4JNMA 3WH6A 2E5DA 4YHGA 4YNGA 1RVGA 3ES7A 1JCXA 1LWJA 2HS6A 2GWNA 4MHBA 3A21A 2ZRZA 3AOFA 5A3HA 1S5WA 2WMFA 1OCQA 3O63A 2FDMA 1ZJAA 2FGZA 3HFTA 1FVPA 1GJUA 4EAYA 4FI4A 5IRPA 1H7OA 4Q8VA 2NV9A 3BQ6A 1KKRA 2NQ5A 1VYRA 3CL8A 1F9CA 2I5GA 4H83A 2PA6A 2DDXA 3PWGA 3EOLA 4PMRA 2Z1BA 3RRAA 5DF0A 4EX4A 2ZWZA 2A7NA 3H2AA 4A3YA 2VOTA 1W1IE 4W88A 4AZ5A 3FAXA 2Z2AA 2V0TA 2XFRA 3W7KA 4QG8A 5CZTA 5D05A 5I7GA 1KCXA 2KZHA 1US0A 3TJIA 2VEKA 1R8LA 1KGUA 1H1YA 3EDDA 2O4QA 1TJPA 2WMIA 2W9MA 1OFOA 1Q6QA 5FJRA 3PTQA 3NPVA 2HISA 2VRKA 2CHRA 4AISA 2CXGA 4AYSA 3WD4A 3GVVA 1XYFA 3A3HA 4RXFA 4JIIX 3VMNA 4Q7NA 3BLDA 1ZALA 4Q33A 2NQHA 4PODA 2RHGA 1IGWA 3MCMA 1DWHM 3WK1A 1WE5A 1