2NQHA

High resolution crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Endonuclease 4
total genus 107
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqhA00
4X61A 1XINA 2J6VA 1I6NA 4X60A 3C0LA 4E3VA 4Q7IA 4PFHA 3M0LA 2GVEA 3FVMA 4XSLA 1XIGA 3KBSA 1XIHA 3UA4A 4XISA 1XLDA 3DX5A 6XIAA 2G4JA 1XLHA 1XISA 2QUMA 3ITYA 3AALA 5EMJA 5XIAA 3BZGA 1XYLA 3VYLA 4YTTA 2Q02A 3BZJA 1XIFA 3ITTA 2I57A 1XYAA 3CQHA 2I56A 3LMZA 8XIAA 4GJIA 1XLIA 3KCJA 3M0MA 4PGLA 5B7YA 1XLMA 1BXCA 3ITXA 4YTQA 5C9ZA 3XISA 1XYCA 3UVAA 4K1GA 2GYIA 2GUBA 4X63A 4YTRA 2ZDSA 1XLEA 1QTWA 4ZB5A 4A8IA 1XLBA 1XLAA 5FA5A 1XLJA 4XIMA 5EMKA 3WQOA 3ITOA 1DE5A 3IUIA 8XIMA 3VNMA 1DE6A 3M0XA 4QDWA 1CLKA 5XIMA 3TVAA 3UU0A 4QDPA 2XISA 3VNKA 3OBEA 4OVXA 4ZB0A 4GJJA 3VNLA 3AAMA 1BXBA 2NQJA 1D8WA 3QXBA 1XYMA 4YTUA 1GW9A 1XYBA 1DIDA 2OU4A 4ZBCA 1DXIA 3CQIA 3CQJA 3KWSA 3QZAA 6XIMA 3JU2A 1DIEA 1TZ9A 3M0YA 3GNXA 3BANA 3U0HA 1XLCA 2QW5A 1K77A 3BDKA 1XIEA 5XINA 4HHMA 1YX1A 3UXIA 4G56A 2NQ9A 4A8RA 3P6LA 5AVHA 5B80A 4QE4A 3M0VA 4XKMA 3N4AA 2G0WA 3VNIA 3QC0A 3CQKA 5EMLA 3ITVA 4DUOA 4LNCA 4QE5A 4ZB2A 1A0EA 3QYSA 5B7ZA 3VNJA 1XICA 1XLKA 5I7GA 1XIMA 1QT1A 3U3HA 5TNVA 2HK1A 4GLEA 4QEEA 3XINA 1O1HA 3XIMA 2NQHA 1XIIA 1OADA 3DBNA 2XINA 3KBMA 3KTCA 4K3ZA 4QE1A 4EACA 4XSMA 1A0DA 5J8LA 4GQBA 3AYVA 4US6A 9XIAA 4HGXA 1MUWA 2XIMA 1XLFA 1I60A 1A0CA 3CWHA 1S5NA 3KBJA 4HNOA 4XIAA 1XP3A 4EAYA 3C0SA 5H1WA 7XIMA 2QUNA 2X7WA 9XIMA 3UA3A 3C0QA 3IUDA 3KBNA 3NGFA 1XLLA 4KW2A 4DVOA 1QUMA 3TC3A 1XIDA 3P14A 3KCLA 2HK0A 4HHLA 1S5MA 1XIBA 3AYTA 3KCOA 1XLGA 3KBWA 3ITLA 1XIJA 2QULA 5EMMA 5H6HA 2HCVA 2X7VA 2ZVRA 4A8NA 4YTSA 2GLKA 5AVNA 3IUHA 3L23A 3BWWA 1MNZA 3CNYA 4J4KA 4W4QA 4QEHA 3M0HA 3KBVA 4A8LA
chains in the Genus database with same CATH superfamily
3VIOA 3TFXA 5A69A 4JTJA 1QPQA 3TN3A 2ABBA 5HJLA 3S9YA 2QF8A 2G4JA 2VFIA 4GZ7A 4AZCA 3PG8A 4NZ5A 3W9ZA 3T55A 4M0XA 3W7PA 2ZUTA 1VFOA 3J7HA 2FPVA 2J62A 3UZWA 2VEMA 3IGXA 4JQ2A 1EGZA 2D20A 3IAPA 3WH9A 3W02A 1MZRA 3VVGA 2YXXA 1MI3A 3ONCA 1DIOA 1R3RA 4XO6A 4M6QA 3VD7A 1TA3A 1TZ9A 1OYBA 1RP9A 1TJ2A 3ALGA 5DELA 4NJKA 3S6TA 1B54A 1MW0A 4QROA 3MWAA 3M6DA 5AKQA 1TWSA 5GNYA 1SO5A 1I0DA 3UXAA 2Y8VA 1X6UA 4AD2A 1H61A 3UCQA 4CNOA 2H90A 4B3ZA 1LDCA 3ARTA 3LG3A 1F4AA 4OGZA 5CKSA 4W88A 1PX8A 1YRRA 1XH2A 3GUGA 5FL0A 5HA7A 3AC0A 3QHOA 3GXMA 5LNWA 1P5BA 2WM1A 3C6CA 3CTTA 5T8GA 3QMSA 3PBYA 2OQYA 2A3BA 4GE8A 3TJ4A 2DIJA 2PWFA 3TTEA 4HA1A 2HVNA 4PRTA 1XUUA 3PZNA 1VCGA 2BY2A 4H4IA 1XIFA 1TFVA 3O0KA 1S1PA 4NY2A 4DF0A 2YB4A 4K8GA 5DLCA 5HWMA 2Z2AA 3F5KA 4QX4A 3MDUA 3M5YA 5I79A 3FA5A 4GJJA 1D8WA 4B5TA 4QP0A 3APGA 4HNVA 3TZFA 3WUFA 4MVAA 1DIEA 1VBGA 3T2QA 1H7PA 3QVQA 5FJTA 3OLEA 4PMXA 4I5XA 3ZVIA 1FWEC 2DZUA 1AQ0A 4DLMA 5A95A 2ZZ1A 3VGBA 3QKZA 2E6YA 4FIRA 4GYFA 3PUEA 3UP8A 2E09A 2Q8XA 5HUPA 3W81A 3VIKA 5CBIA 3DFSA 3HZ3A 5HPOA 4MB3A 3U4FA 3IV3A 1O4UA 3NO1A 5AFDA 4DXXA 3LGDA 2F84A 3PFMA 2V38A 3KBNA 5K9CA 1J0IA 5FKYA 3PB2A 1I2NA 3UWVA 1WNOA 3GW0A 4I3GA 1ADDA 3MA8A 1NFPA 5LHEA 3IWPA 3Q37A 3EX4A 1D3GA 1W1B1 1YDOA 1NWTA 3GHUA 3ZSSA 5DMLA 1OY0A 1IT8A 1XCFA 1VF8A 4IUGA 3W75A 2XGBA 4GYPA 4N42A 1XGEA 4KWUA 2WKGA 3T0DA 2O92A 1WOAA 5D2XA 3R13A 2Z7GA 3H2OA 1ISVA 4GX9A 1GOOA 4U2YA 1CXHA 3BMXA 5CPTA 3WBAA 3EDJA 3OYZA 3L4VA 4L4PA 4O13A 5DANA 3ZR5A 4IT1A 4NU7A 5M5DA 1DTUA 3LRLA 3WIJA 3RO6A 3LA4A 3N4EA 3L5MA 4ZBCA 2O55A 2TAAA 3RX2A 3BCDA 3KOWA 2YW3A 1OC6A 2ZUUA 5FIPA 3M64A 1UD6A 3GXFA 1DWAM 5LXXA 4A8RA 4BI6A 1IEIA 1C8XA 3AS3A 3C86A 4AD5A 1WP6A 4FB7A 2QDHA 3THAA 1H11A 3P61A 5A5WA 3NSMA 4P7QA 1M41A 3PBUA 1H5VA 3NFUA 4E2VA 2CC0A 1V6VA 4XZMX 3DKLA 1ZPTA 2YW4A 5BXSA 2UY2A 3AUOA 2DJXA 4IPNB 1HJQA 1XLGA 5LIUX 4AMAA 3EOUA 3IUHA 1MNZA 4DELA 1AH0A 4CQDA 4CQ8A 2EKGA 1GTHA 4KEVA 4LYRA 1LQ0A 3TWBA 1IGWA 5FACA 5GJPA 1MXDA 4TU1A 4J5NA 3ES8A 4IMDA 1ME7A 4GI8A 2OSXA 1TWDA 2INZA 4PEKA 4LV4A 3XISA 1A5UA 1JQXA 1LQ2A 2V2HA 1N82A 4AIUA 1T40A 3VIJA 5ABFA 4LUSA 2EBNA 4Q4PA 4ZB0A 2ZADA 3N25A 4KWOA 2FB2A 2P5NA 4AZIA 3BSGA 5TIMA 1E0WA 1ZB5A 1UOZA 2O7QA 4MNKA 2J8TA 1TCDA 4GIRA 5HNRA 2NQ5A 3UXIA 1U33A 2VO5A 1EKOA 3C56A 1QRQA 2VTFA 2Y88A 3DYPA 1UP0A 4YNGA 2VFHA 2ACRA 3O2LA 4HT3A 4QHRA 5JUVA 3DDMA 3F03K 1WQ5A 2Z00A 2WVTA 3PJUA 3WFLA 3RF9A 1HKKA 5K4ZA 1TVPA 5D2VA 5GJMA 5T9BG 2G50A 2PGWA 4ZQPA 1SYTA 4GA8A 3LBMA 4KIEA 3WF1A 3TC3A 4HU0A 1OB0A 2FTWA 3PNUA 2C16A 1A5BA 1FBAA 1FWHC 2XFFA 3VKKA 4Q8NA 4PBGA 3QPZA 2NT1A 3FYYA 4UCFA 1BYCA 5D2YA 1FRBA 4E4FA 2FDSA 1MW3A 3G3MA 4WQ6A 4DF2A 4MLRA 3LU2A 3S1UA 3A64A 1S46A 1F2JA 3KDOA 5EYWA 4YYFA 3UGVA 4N9DA 1K3UA 3W2JA 3W88A 5FD0A 2EPOA 2DGAA 4DBDA 4F0HA 3CHFA 2J77A 4UZSA 5HMDA 1CLKA 1BG9A 1IWBA 3OBEA 4P8WA 3G2GA 1OCJA 2DPEA 4A3QA 1G01A 4QM1A 3UWEA 5DY2A 2A3AA 4R33A 1Z8AA 1HW6A 1GCYA 3SSJA 2Z28A 4OUEA 3ARWA 4DUOA 1H7XA 1XICA 2X0SA 4QTGA 1YPFA 2C1IA 3V16A 3L4YA 3B9EA 3EBVA 1GYNA 4ACYA 4DO5A 4REQA 3NZQA 1ZJHA 3KL0A 1WDSA 3HO8A 3LM3A 1W3HA 1TIMA 2H3DA 3W7QA 3DI0A 3DFQA 4JTHA 2OPJA 1YEYA 2WJFA 5TAOA 2C3ZA 2OR2A 3W1QA 1TV5A 6TAAA 1J6PA 4W5UA 3CJPA 4PUMA 1O66A 4YTTA 3VGHA 3B9OA 7ODCA 1HVXA 3C0LA 2QAPA 1T8QA 4C1LA 1V02A 4ML4A 1XC6A 4PTNA 4AY1A 1W54A 3OLGA 4OKDA 3W1LA 1KCZA 4CLMA 2PRLA 1A53A 3FIGA 3ZO9A 4O19A 3TONA 2F6UA 3ITXA 3BGGA 4H6RA 2YJQA 1UQZA 4Q33A 3WQWA 3GAYA 3N14A 5CGTA 5I77A 3IANA 2BWGA 2BXVA 3COTA 4DPQA 1OCNA 5A6SA 3Q45A 1K6WA 2I9UA 2NXHA 3CYJA 2IQ0A 3WELA 4E6MA 4U2ZA 5AVHA 4D6DA 1OHLA 4QE4A 2E8ZA 3WFAA 4QXIA 3O7UA 4GH1A 1B1YA 3ICJA 4XX6A 1A0EA 2X09A 1CB2A 3MWCA 4KIRA 3HB9A 3RRXA 1VCFA 3W2KA 4Y6GA 3R8GA 2E6DA 1G5AA 2R1KA 2NWRA 3W2LA 1US3A 2DEPA 1PTAA 1KQYA 1FWJC 1EP2A 2FPYA 3V1HA 1MSSA 3WUGA 4JTRA 5C7HA 4I7VA 3KBVA 1CTNA 1WDRA 4FEZA 3AS1A 5E0FA 5LNUA 2DUXA 3GQYA 1BSLA 3P5YA 1NEYA 4XISA 3VZXA 4JTUA 1LLWA 2VDHA 3W4RA 4RNJA 5MF5A 5DCBA 4YJ5A 4D2JA 4LW7A 2FFCA 3UETA 3A3WA 2BOEX 4IICA 4F0KA 1VGAA 3LZ3A 5C9ZA 3GH7A 4LYKA 3G8RA 3WJWA 3DHUA 5FA5A 2YLAA 1J93A 4I5RA 2D24A 3VNKA 3HQ1A 5IBXA 3LPFA 4N4QA 4W7WA 4NJGA 4CD4A 1PE1A 3CU2A 1QATA 4Y9PA 2J8GA 4A35A 4ZXLA 1AW5A 2OU4A 4CNUA 5FJOA 2WMFA 4C91A 2I5GA 3C3NA 3LBCA 4B4FA 2PDQA 4NYUA 3EWBX 4DO6A 2PDYA 3BMVA 3RRAA 5A6JA 1XCWA 1BG4A 2YYTA 3PTQA 2VR2A 4ES4A 3HFYA 4MDPA 4EX4A 3HPFA 1GVOA 2V63A 4PTVA 3VIGA 2QJJA 3W53A 4H7VA 2RGLA 3AYVA 5A2CA 4E5TA 2ZBTA 1IWPA 2PP1A 1PKLA 2XHYA 3LPOA 4QFUA 1Z48A 3BAXA 2OT0A 4PB4A 4ADUA 2CWNA 1QI2A 1QWKA 1PB0A 2GUYA 3EEGA 4H9ZA 3L66A 2OLSA 3CPRA 3ZLFA 1MEWA 1QOXA 1OM0A 3OGRA 2G37A 3QMRA 3LNPA 4GZEA 3KBSA 3AS0A 2VDIA 1TPFA 5XIAA 5H8MA 4UR8A 2OB3A 4S3FA 4UOQA 4O1BA 2ZZ7A 1YMYA 1W5PA 1XYCA 2DSZA 1GONA 4XUYA 3G1SA 4W84A 4NT0A 4B3KA 2EGZA 2R82A 4L6OA 4HPNA 1EUNA 3URBA 2CLPA 1EJVC 2DSWA 3G0SA 1SU5A 2DT3A 3V18A 1UOKA 4O0KA 3PZMA 3EX1A 3GG0A 2VX4A 2J4GA 3T8QA 2JEQA 3VZZA 2V9DA 3GU1A 3DI1A 4GLEA 1G0CA 3WD0A 1HG3A 4HPXA 1MMFA 2Z2UA 2Y62A 3BGAA 4YL2A 2OYKA 1UG6A 4V1YA 1ICQA 3R4IA 3ID7A 4C1NB 5CZJA 3KCOA 1S38A 2BY3A 4WK9A 2HCVA 1EP3A 3NYZA 3D3AA 4OZOA 4W4QA 4DUWA 1V3JA 2WMIA 4DUVA 3OVQA 4K37A 1V6TA 1REQB 3T05A 4GOAA 5L9FA 4W93A 4UZUA 3QOKA 3TNOA 5G2HA 1G7VA 4PMRA 3CB8A 1Q85A 2GGIA 3QH2A 5CPNA 1W5OA 1Z42A 4QLKA 1GPWA 2PU0A 1WCGA 3N2TA 5IFTA 3UVAA 3R0KA 4TVUA 5BCAA 4BFAA 3VDCA 2BBFA 2PU1A 1LL7A 2DDXA 1FKXA 5CGMA 3S5NA 3VCNA 4BK9A 3NQMA 4B3LA 2D73A 4LYPA 1B30A 1CI1A 4MKVA 4OWGA 2VDGA 4PMJA 1TUXA 2X1RA 4OOUA 3PSVA 1NELA 4Q4OA 3WDPP 3DXIA 4OE7A 3UXKA 4GD0A 2VNCA 4UQDA 3VIPA 1CECA 4M7TA 4MM1A 4JYDA 2EG8A 1JPIA 4N6EA 2XDFA 1OFDA 2PDJA 1HKMA 4DJDC 1XG4A 3DHPA 4QS5A 2XZ9A 4Q6XA 2B7PA 5B7ZA 3M16A 3R0UA 1Q6OA 5D9MA 1EEXA 1TV4A 3GXPA 4HK6A 2WKLA 1OZQA 2GJNA 2VUYA 4UR9A 4C6FA 1JF5A 5AYXA 2BHYA 1CLXA 1W2VA 1EX1A 3TKFA 5AYYA 1VH7A 3S83A 5D4YA 3BW2A 1QUMA 1LZOA 2V6AA 4B5UA 4QG9A 1Q6FA 1Z3NA 3DFNA 2MUCA 4L64A 5HMFA 4M3PA 2VWTA 1HJSA 4IXHA 3WQ5A 4FALA 1EO7A 3EEZA 3QR0A 4OBRA 1VFTA 3GU2A 2AL2B 4N9BA 4IP7A 2Q6ZA 2WMJA 3GKFA 3KVMA 1RY8A 3HJEA 3TNBA 3G5EA 1IV8A 1TMQA 1TRIA 3H21A 3M7WA 2W6RA 1LT8A 3W1NA 1E5JA 3E6EA 1YTDA 2OZ3A 4UTTA 2QJNA 1NFBA 1JG9A 3FKKA 4W86A 3RMEA 2V67A 3AOFA 2H9AA 1EYWA 2JKAA 3RPMA 2C15A 3CT7A 1SGJA 3MHUA 5A8QA 4ROQA 1EBHA 1XYMA 4LANA 4YCPA 4XZHA 1I1XA 2PRHA 4FNPA 1DXIA 1JYNA 4IJCA 1HNYA 1QJWA 3OB8A 2ZRXA 3P60A 3SCWA 2AQOA 3ZWSA 3NM3A 4KS0A 4AAJA 4PMNA 1IWAA 2A21A 4LOCA 4LEFA 2D2OA 3O6DA 1OCQA 3W7NA 4KETA 4BEUA 1UJPA 1KGUA 4GIYA 1Y5WA 2I7GA 3S8HA 3BTNA 2X2YA 4D8LA 2OGYA 3AMDA 1XDMA 5BOFA 4U10A 1LWJA 3R7MA 1P7TB 4K1WA 4GI9A 2BLEA 4JYFA 4HHHA 3WQFA 4AB4A 4GJ1A 4A8LA 1LOQA 1LBMA 3TIMA 4BF9A 2GGHA 3NIYA 1NDZA 2PCQA 1R7AA 4S3BA 3TYZA 1A3WA 4X2PA 3DIPA 5LA0A 3OYXA 2E9BA 8XIAA 3FN9A 1WKEA 3CB3A 3GD6A 4RE2A 4RZ5A 3F5LA 2J78A 1CWYA 3G1FA 1LG1A 9RUBA 3B3DA 2QCFA 3LCHA 3K4AA 4LTSA 3VKCA 5D9OA 1KBLA 3MO7A 5EU9A 3GFZA 4K8HA 1GZJA 3ZXWA 1EIBA 2E6FA 2WNZA 4RNFA 1MUCA 3PFRA 1E72M 3VOGA 1W17A 1EJSC 3M47A 3R89A 3SCTA 3R8RA 3KLKA 2GSJA 3RFAA 3EX3A 2VELA 1V0NA 3WLNA 1HF6A 2HTMA 2FFIA 3MV11 4O53A 1KXTA 2V81A 3MSDA 3L7RA 1FHUA 3MBDA 3SUTA 4US5A 5KETA 3A21A 1XV8A 2EG6A 3TCSA 2IMRA 4JGDA 4XUGA 7TIMA 5I0DA 4TXEA 2EKCA 2X8RA 4LAOA 1EB3A 1JL8A 2WWDA 3N6HA 4HQVA 5LGXA 1C8QA 2HISA 3EWUA 3MKCA 4UMCA 3NEVA 3S9IA 3ZR6A 4O11A 3N9SA 1PZ0A 3WDQA 3N17A 3UERA 2XU2A 3FOKA 2GK1A 4P2VA 4IXXA 2Z29A 1OFAA 1A49A 1H1ZA 2I56A 1UMLA 1FWWA 3VMOA 3R0DA 2NVCA 4ZA0A 2DJLA 2PP0A 1BFNA 4MDOA 4UOJA 3DEQA 1EJWC 1LT7A 3VOIA 1OGGA 1U30A 2J7FA 3WNMA 2AAAA 3QV9A 1OWQA 2A7NA 3W86A 1L8NA 4H41A 4JCMA 4MKSA 1RCQA 5MKGB 4XKYA 1F6YA 1WZLA 3LZ5A 1V77A 2VZOA 4WJXA 4WY0A 5BZAA 4DUXA 5D05A 3XINA 1N7KA 4ENLA 3DBNA 1SR0A 2WAGA 2BASA 3I7RA 3BUVA 1MXGA 2WM0A 4EACA 2PA6A 3DKJA 5I23A 4UC5A 2RDXA 5D02A 2A5HA 1J5TA 3PPGA 1B2YA 3ZS4A 4M5PA 4F4RA 2HS8A 6REQB 1PYFA 3U5YA 1OF6A 4FR6A 3BWWA 5D32A 3MV01 3WG6A 1NQ6A 3WY1A 4KESA 1VLWA 3S6DA 2VRKA 2F61A 3GS6A 3G1VA 2BOGX 4FNSA 1DPMA 3U9IA 4N02A 1VCVA 4PBEA 4H6KA 2Q02A 3EB4A 4TTGA 4PMUA 3WMCA 1XRFA 1FY6A 4B4HA 4BQ4A 2VEGA 2R8WA 1FH7A 4ZXOA 4NX5A 3R2GA 4UTIA 3C2FA 2OELA 3CHVA 3RR1A 3BVJA 4BQ2A 3O16A 3Q58A 3E02A 3FAXA 3TH6A 1SR9A 1JCJA 5I3JA 2PDKA 3S2LA 4XVEA 5FSEC 2BXZA 4Z1YA 3CQJA 1R3WA 3FYOA 1PL9A 1T41A 1ONEA 1RJPA 3RM4A 1YYAA 4C1KA 5F1VA 5KITA 3T4CA 2CZVA 5C70A 2DVUA 3YPIA 2D3NA 3DCPA 5D9PA 4A2SA 2YL9A 4JIQA 4LV9A 3DG3A 2DP3A 1QI5A 2D69A 1A5NC 1ISWA 4UTKA 4RZ6A 5DBUA 4G2DA 3IIXA 3U7VA 4YS1A 2DZSA 4DWSA 4FXJA 3TR9A 4DWSB 2XM1A 3IIVA 1DQWA 4LY4A 1KBBA 2VXNA 3W7JA 1HZYA 4Z2LA 1TZZA 2BZNA 3H53A 2XGIA 1FHVA 5F2MA 3PAJA 2YDSA 1M7PA 1P6WA 2ASHA 3BO9A 3ABOA 1JQVA 5KZ6A 1Q6QA 3SN0A 1OFQA 3SFKA 3PSWA 4V1XA 3AHVA 1X6LA 4PEEA 3MYOA 2DZAA 4R9OA 3HF3A 2GQ9A 4O50A 3TTSA 3HOJA 3IUIA 3LN3A 3CUGA 1ZNNA 3DUGA 2E5DA 5HNUA 5LIXX 3EMQA 1TJ0A 4EPKA 1NM9A 1AG1O 3C4UA 2CLKA 1KWKA 4GGHA 1K8ZA 1K77A 1UHVA 5XINA 3ZZ1A 1R2RA 3S47A 1RA5A 3TYEA 2GOKA 1I0BA 1SFSA 4J3UA 4KCWA 3BJSA 3AMGA 1QO5A 3UY8A 2O0TA 3C5QA 4PRWA 1UD4A 1FFQA 4PRRA 1W5NA 4ZSUA 2F6KA 4L4MA 1NWUA 2CLMA 1U5HA 4Z2JA 1OCBA 3N2OA 1LTDA 3F2CA 3UQNA 3NXLA 3K4WA 1ZLPA 1VPQA 3QGVA 4JIIX 1R85A 1E4IA 4TO8A 3P80A 2OFJA 3GR8A 1OD0A 1KLZA 4GKTA 1TE6A 1E0TA 2H8XA 3LLFA 4LT9A 1L9WA 1Z9AA 2JBMA 3ABZA 1FOBA 1M6JA 3SCSA 1M7XA 3OIXA 3WBXA 2H6RA 4DJEA 2WZHA 4FIQA 1ISYA 4HP5A 5CBJA 4WXYA 3O07A 2NVAA 2A3EA 4KRUA 3W1PA 4P7LA 1CW2A 3SGUA 3RN6A 1MQPA 1UD8A 2ESCA 2V68A 3O05A 2O9PA 5IRPA 4UQEA 4RDWA 1A4MA 1QNSA 4Q4MA 3NQVA 2XIBA 2HBXA 3IS4A 1S2CA 1PKNA 1QOQA 2VR4A 5F2LA 4Z1BA 1YW1A 2X42A 4B2DD 2C19A 1V3IA 1ONWA 2GVGA 4LF1A 4RV3A 3UJSA 3CQKA 3BLPX 3A22A 1AW2A 3OGSA 2QCNA 4HTYA 4HKPA 1RJQA 4IIGA 1KFEA 3LOTA 5DT7A 3FCPA 1IXOA 1PX4A 2HVOA 3N12A 1XH1A 2VGGA 2P88A 1PUDA 1PZ2A 3TYCA 1ZBWA 1V6WA 2QQ6A 3CZKA 4BEQA 4KWSA 1SW7A 5J04A 2REQB 1CXFA 2HXTA 1TPWA 5G4EA 3L5AA 1JD9A 3W37A 2GVYA 1XINA 3ARVA 4NIRA 4S38A 4WGXA 1DTNA 4LJ3A 4BY3A 4I8YA 3BXWA 3LV6A 3M5XA 3H2NA 2XN1A 2Y7DA 1NH6A 4CKQA 3ITTA 3OZYA 4WKAA 1A50A 1KLYA 4JIRA 1XLMA 2CBIA 4ZO8A 2E68A 3M07A 1V3HA 2YDRA 2PLCA 3LCXA 3A5VA 3F7JA 1GEQA 3TSMA 4M19A 4LVFA 4JY8A 1LQAA 3GY1A 4FLSA 4HNNA 2J7CA 4ZOBA 4FSAA 3FA3A 2ZTKA 4IWWA 1ZZMA 1X96A 4UWMA 1RZMA 3DOPA 4MZ1A 1L6YA 3NQDA 4P8UA 3QKEA 5HNTA 3F2DA 3JU2A 4J3XA 1QW8A 4DNMA 1EOKA 1H09A 1PIGA 3LI1A 4DJED 2DIEA 2ZRZA 2R94A 4MPKA 2QGYA 1TPUA 1F74A 3KL5A 2L5HA 4D1IA 3UWYA 3PTDA 4TMCA 4ZOAA 4WVXA 5E70A 4G8TA 1JUEA 1ME9A 2EHHA 3C0QA 5G1YA 1ZBKA 5JBEA 3Q94A 2Y8UA 3EZ4A 3FFSA 4PTWA 4JTFA 3SI9A 5AHLA 2X1SA 1ISXA 3W1UA 1S3HA 3CIVA 2J75A 1THFD 5HBFA 3VX1A 4X61A 3VO0A 2J6VA 1OFEA 2CYGA 3W84A 4IPLA 3W01A 4B9ZA 3RAOA 1O12A 4GIAA 1F3XA 2VGBA 1WDQA 4GVIA 4ECLA 3GTHA 1UKQA 2PDFA 1NOUA 4QSHA 3VCCA 4IX2A 4MIMA 3WJZA 5I5RA 1PV8A 1IIHA 1TPEA 3W1XA 1JXKA 4C6OA 2PF8A 3W82A 1W1A1 3PWGA 5F1UA 2ALDA 1GOIA 6XIMA 3HA1A 3DFYA 3TC7A 1YXDA 1M68A 1M7OA 4HA4A 4LB4A 3T78A 2J79A 3SZ8A 4GNKB 3L0NA 5BMWA 3K8KA 4XZNX 3WD1A 1JCYA 3GIQA 2ZRWA 2OOGA 3NURA 1LWHA 4DYJA 3AQUA 2VWSA 4XTDA 4JN6A 4EVZA 1W6TA 4IUOA 4LC8A 1GQJA 3OVRA 4BWLC 3STGA 3K1GA 4UQAA 5IFPA 2J7DA 1VFMA 3CUHA 4KCUA 3ANYA 2W9MA 4M8UA 3WFZA 1D9EA 3GNOA 4NJJA 2XYLA 4Q8MA 1UPMB 3IAQA 3KDNA 1MDRA 4FI4A 2HV5A 4I5UA 1HGYA 5EPDA 2VQTA 3UG3A 4EXQA 1EGMA 2RAGA 1NOWA 3VX0A 3W7OA 4MNLA 4AXNA 2ZZ4A 5DMMA 3M41A 4UTLA 3GDRA 3WLPA 2C1HA 3KEHA 3BLDA 2DT2A 4K68A 3S2MA 1R2SA 3I7SA 5FF7A 1EDQA 1KQZA 5HR7A 1KW1A 1JUKA 1DWJM 4H7ZA 3FA4A 1GTEA 4A4AA 3TJIA 1SSGA 1BKHA 5BOEA 3F4CA 4MWAA 2YFOA 1SJBA 1KB3A 4YXGA 1DWFM 3OG2A 3W87A 2YBTA 3BSMA 3UZZA 4ICNA 5I7GA 1UC4A 5FF4A 3KVLA 4Q8TA 3EWYA 2J7GA 4E4UA 4S3CA 4GGBA 1KWGA 4HYRA 1Q6CA 1VRXA 5HANA 4XIAA 1ZCOA 2AQWA 1J18A 2D3LA 4J2MA 3WLQA 7XIMA 1FHDA 2ZE3A 3NVTA 1BGGA 5F2GA 1FWFC 5F7UA 2CXGA 3CUJA 1WA3A 2P76A 1D3HA 2G3MA 1NOFA 1Q66A 1ITCA 3G1XA 3VDGA 3CHEA 3K5XA 3PJTA 4JCLA 4A2RA 5CZTA 2WZEA 4PCTA 4JFTA 3DU0A 1IQ8A 3PULA 1SPQA 1J11A 2X0HA 2W66A 1FWBC 4Z2KA 3SQLA 3HMJG 1RJRA 2VEFA 3AIEA 4HYWA 3HQPA 3BC9A 5CAHA 2WHLA 3T40A 3VGEA 2V3GA 3M0MA 2EPLX 2ZXBA 4DNHA 3P5ZA 4IGMA 2Z6IA 3L9CA 1CXLA 4FLRA 1RLDA 2W91A 5K9XA 4H9VA 1WBJA 2I5QA 4A22A 4O4VA 3KLLA 2XH0A 3OA5A 4D6EA 3S1WA 1AFSA 3SN4A 4EWJA 3CAWA 4PR4A 1X1ZA 4NKCA 4DXVA 4MNJA 1XIMA 1H0GA 1D7KA 5CPOA 3WLIA 3D6NA 1EHAA 2PTYA 1UW9A 3PWIA 3SCRA 4RPQA 1HKVA 1Q13A 3UJRA 1MUWA 1QI0A 4N9EA 3LXBA 4C6KA 1PWLA 2DIKA 1FTXA 1DHKA 1KTBA 1NP2A 2CHOA 4OV9A 1P0BA 3H2CA 3GXDA 1G69A 4F40A 3VM7A 1TTQA 4A8NA 4AEOA 3RILA 3GTNA 2VL4A 1OFOA 1XBVA 4Y7EA 1JPHA 4FMVA 1XX1A 3ZJ6A 1E9ZB 1EJ7L 2RH9A 2C91A 3PS7A 1E1EA 3P84A 4Z2HA 4GQGA 4AVOA 4YPJA 4GUIA 3MDWA 3K46A 2CCRA 2PZNA 1XR2A 1GOMA 4I90A 4JXCA 1ZCCA 2PDPA 3LCWA 1G7UA 1XF0A 1TWZA 3GO2A 2ZDSA 1QTWA 1VEOA 4F48A 2YCKX 3FVDA 4BCEA 3AI0A 3L4TA 1XM3A 4UNIA 2V3DA 4HPGA 4LBRA 2GDQA 2VEIA 3ALFA 5C2XA 3JR2A 3USZA 3OZMA 1LF1A 4GMEA 1C29A 3GDTA 1FFRA 1FWDC 4HCHA 2HE8A 3T44A 2HZGA 5EMLA 4QRNA 2X0YA 1TJPA 1OT2A 3WEOA 4C6EA 2X1IA 4WDTA 1YXCA 3IIOA 1V93A 2VYOA 5HUOA 3QY6A 4OBTA 3I6EA 1IF2A 4XAGA 4AVNA 4UMBA 2CBUA 3RPDA 3HM7A 3APYA 3QQ1A 4ADTA 3AO0A 3GTFA 4P7RA 5H6HA 1UCWA 3VILA 5JBFA 3NQ7A 3L23A 1J5SA 3UESA 1GQKA 3IVTA 2P3ZA 3EWCA 1UZ4A 1C3FA 2XSXA 2NLYA 2YB1A 4IPIA 2VJXA 4DB7A 1AL8A 4GG9A 3BZGA 1P4CA 6PTDA 4O54A 1Q65A 2PRMA 4NZCA 3CLMA 4H8NA 4W7VA 1W1TA 3V5OA 3H6OA 3ARQA 5AYIA 3N15A 4DBUA 1KBJA 4XD5A 4YVPA 3UT0A 3CUFA 3SJ3A 3C2EA 8TIMA 1HTIA 3UWWA 3AU6A 4EKJA 2WSPA 2ZDRA 1R38A 1W2PA 1KFCA 2PDIA 5GJNA 4JZ5A 1O6IA 1XBZA 3TUUA 3W2MA 1HKWA 1ZJBA 3NQEA 4H3DA 3EPOA 4WSHA 4HD5A 2FVLA 3FEQA 5DN1A 2ZTJA 5BRPA 3NO5A 1SVDA 1V0MA 2PS2A 4URIA 1GORA 3KOFA 3B8VA 2ON3A 4ZB2A 3FSUA 3C2VA 3LHVA 3GHRA 4QITA 2X1TA 1YE6A 3PPHA 3MZ2A 3S1VA 4U28A 4IFOA 4XQ6A 1XP3A 3ISIX 4U33A 5D9NA 2JE8A 3KS5A 2AGKA 4HHLA 1TTJA 1S3TC 1XIJA 7CGTA 1K4GA 3W7DA 3N3TA 2GLKA 3G1RA 1QK0A 3CNYA 3VD4A 1GK8A 3KM8A 1W9BM 1BYDA 3G0XA 3KUMA 3POHA 3LQLA 1U22A 4HZMA 4N4PA 1W32A 4NHVA 4ZMGA 4JKKA 1A5KC 2F9RA 2VFGA 2XH4A 4FO4A 2VR5A 2ZC1A 3ATYA 3H7VA 1MQQA 3OEXA 4N0RA 5KEZA 1FCUA 1JPDX 3R79A 3TVAA 4Y9OA 3U8GA 4WGHA 5HR6A 1CGXA 3MI2A 5DF0A 4ATWA 3M0YA 2Q8ZA 1KCKA 3GU9A 3IRSA 1WYIA 3E5PA 4LCRA 1JYXA 1E55A 3L4XA 3LHZA 3Q65A 2QCCA 4JFUA 3ZJKA 2QPUA 2GJRA 4B16A 1BAGA 1C8YA 1TPC1 1U1UA 5TNVA 2B4GA 1UBSA 3OP2A 1ITQA 4RW3A 4O1DA 1MEHA 3FEMA 4Q8VA 3NPXA 1KTCA 4H2HA 4GXPA 3U57A 1NDWA 3IUDA 3TJLA 3ZQ9A 4L4OA 3BJFA 4FNTA 4DWSD 3NO3A 1OGSA 5EMUA 3H70A 4Q22A 4HZ8A 3GHSA 3E38A 1M7JA 3TTOA 4JYEA 1FWCC 4NXSA 1JPKA 4TX6A 3ZJ7A 1XYLA 3HIJA 1A47A 4IGHA 3U48A 1E9LA 3CQHA 1CGUA 3VAVA 5DXXA 3W2UA 3QGKC 1SO4A 3JW7A 1PCKA 1GGOA 4AD1A 3WJYA 3PF3A 3RM9A 4ERAA 1XRTA 4ML9A 2D2JA 2IKHA 2OSYA 2WB5A 1RR2A 2X1UA 3INPA 4QNEA 3MCOA 1MNSA 3IGSA 1AH4A 1L0PA 1V0LA 3E2RA 1UZDA 1YDNA 4IHCA 5CZSA 4GY7A 3NQ6A 3KOYA 3RIKA 4HNTA 2G8ZA 2VQUA 1OZMA 4QJ5B 1J4EA 2IQDA 4XBSA 1W9VA 3FJ4A 1W3LA 3WF0A 1PIIA 2ZUWA 1W5MA 4R88A 3DFOA 4B90A 3I4KA 1V3MA 4G7EA 4AX6A 1MFUA 3OZPA 1JXJA 2UWFA 4NZ1A 4EOUA 1WDPA 1M9HA 1VBHA 4HOXA 3N2XA 2CNCA 3TCEA 3K13A 1ODUA 3MSRA 5C9RA 2YBUA 1YBQA 4XG1A 1XXXA 1VFLA 4IZGA 3VDAA 4ZFMA 2E67A 2J7EA 3VGDA 4M6PA 2PDCA 4PB5A 2WVVA 4HBKA 5KMYA 3UJ2A 2PLJA 1ZU8A 1VBRA 3TC6A 2FZMA 1RY0A 2OLHA 1H7WA 5C8BB 1XLDA 3OBKA 1FUYA 2NV1A 3BQ6A 3T07A 2YX0A 3CV1A 3IGHX 5CLTA 2XH2A 4ZCWA 4O1AA 4KERA 1V3KA 4LAMA 2VZVA 2Z1SA 2GVLA 1J6OA 3WLSA 3BH4A 1L2UA 1XGZA 3MP4A 4MLJA 2WNQA 2W63A 1ESWA 1SJDA 2QJGA 3WH7A 1DXFA 4GYPC 5LNSA 5E6ZA 1V3LA 3KW3A 3OOQA 3SEPA 1C9DA 1FWNA 2V5LA 5JXQA 5K7JA 2WV8A 4GK8A 3EB3A 4XAZA 3CMGA 3SCNA 3V0SA 4IISA 1W3JA 3PJWA 1XFCA 5E1QA 3PR2A 2WJEA 1JAKA 4TR9A 2G3JA 4GNVA 2V3FA 4H7CA 2XSAA 2J47A 3W7GA 3CL8A 2ZRVA 3VNJA 2DUAA 1JCTA 4UBPC 4JEQA 1VS1A 5T9CE 3LRKA 3E0FA 3PPFA 3OVPA 1UWRA 5ECVA 3DENA 2QCHA 2PC4A 3EB2A 4NAEB 3ARSA 4S3JA 3S2JA 4ZZ9A 2GJXB 3VXGA 1B4EA 1ZP3A 4AC1X 4WEVX 5E6YA 3UG5A 2PWHA 4O17A 1YQ2A 2YA2A 3M1ZA 1MYRA 1QW9A 5JMUA 3GVRA 4L5ZA 5D2WA 5I3HA 3A6OA 3OO2A 4TX9A 1KBKA 3ARUA 1NWRA 3QHMA 3LENA 3L68A 3LLXA 1VYSX 2PODA 5CSSA 4KBXA 3DERA 2BHUA 5C54A 3VNYA 1E6PA 2VGFA 1W1VA 2VZSA 1CXIA 1US0A 2OX1A 2WCSA 2GGJA 4MWAD 3EWWA 3CZEA 1QHZA 1FWIC 1CB7B 2D2GA 3M0KA 3QXBA 1I1WA 1O7AA 1R86A 1MRQA 4H9YA 2JIWA 1JGMA 3BANA 4O28A 3SCPA 3S0CA 3QFEA 4FOKA 1RVGA 3NPUA 4CCEA 1DHPA 4G1KA 2Y5JA 1SW3A 2KZHA 4JTIA 4NJHA 1YNPA 4AD0A 1RUSA 3LK6A 3SADA 2V5KA 2OZ0A 1OT1A 5CC7A 1R3YA 4FLOA 3UXDA 2X2GA 4RX0A 3M6YA 3LSCA 2P0IA 5I3DA 4AY8A 1ZTVA 5BU6A 4W8AA 1L6SA 4O1CA 1LORA 3W85A 3ZYZA 4AW7A 2WJDA 4UFKA 4O8RA 2ZYFA 1YLVA 2V30A 3B05A 1Q8AA 3A4JA 4JQ4A 1QCWA 2WHKA 2E7FA 2DY3A 4H6QA 1KFWA 3LCGA 4MB1A 4D6HA 5LZLA 4NASA 5HMEA 2J9XA 3WMBA 1WXZA 3TV8A 3AS2A 3MS8A 2GJLA 1VKFA 4XTIA 4LCSA 4YHGA 1TJ1A 1K9TA 4HOZA 2W61A 2RUSA 3EWZA 3P74A 1S5WA 4OIFA 3AIWA 1XJBA 5CBBA 1DXEA 3OVGA 3N11A 3LX9A 4BS0A 1E3XA 4LB3A 3LQGA 1XQLA 1OK4A 2ZWYA 3WEMA 3VE9A 3RCYA 3GDBA 5A6AA 1M1BA 2O9RA 6ALDA 3KWSA 3E0LA 2HMCA 3S2NA 5GNZA 3H55A 4Z08A 2DQWA 3SCVA 2BMBA 1TIWA 5B80A 3BOLA 1CGWA 2F7FA 3VMPA 2YCIX 3FHQA 4KCTA 2G3IA 3NOYA 4DPPA 3O9NA 1D2KA 3RO8A 4HMCA 3KTCA 3U2OA 5DO8A 3BLIA 4GVFA 1ZQ5A 1V0KA 5LXEA 1YE4A 3CLWA 4JDYA 1H0IA 3LS9A 4MUPA 1EZ2A 4S1FA 5LIWX 2XIJA 4GY1A 4NX0A 4JFVA 1BF2A 1P6CA 2ZZ5A 4AIEA 2ZUSA 3GXNA 3TYBA 4FNRA 1RBLA 3ZT7A 1B90A 1IEQA 1UWUA 3N19B 4XKYB 4D6IA 1GOWA 2J25A 1X97A 2HSAA 3QBUA 4BQ3A 3STPA 2AAMA 3LPPA 1YBQB 1FQ0A 1LOLA 3E12A 4MFEA 3SUUA 1HO1A 4HSHA 6CGTA 2YA0A 4J40A 3WLRA 1ISZA 4D72A 1KV5A 2FGBA 4P8XA 2J7BA 3QLDA 2Y5SA 4OU1A 4YCOA 3VD5A 3U2ZA 2D22A 1NIUA 3W28A 3W26A 4UQBA 3W72A 4PB3A 4US5D 4KEZA 2A0NA 1EF3A 3UEQA 1YX1A 4D1JA 2B31A 3GG7A 1KM5A 2A7PA 3LYEA 3ABRA 4PTDA 3THCA 2E9MA 3W76A 5HOSA 2HJPA 1GUVA 2PEVA 2CZDA 4H9TA 6TIMA 2UY5A 1BTCA 1J0YA 1UP2A 1TPB1 2ZXAA 3CH9A 4JR5A 2QCDB 2QUTA 4L1GA 4QGCA 1S5MA 1FDZA 3V1PA 2IPWA 3ITLA 4PMYA 3I7QA 4MPQA 2VD9A 1QR7A 2D2HA 2UZ9A 4RE4A 3EMZA 2CW6A 3QHNA 1CXKA 4TV6A 1RCXB 4WHBA 3T6CA 4E2OA 1QAPA 1MQRA 1UD5A 2FIQA 3ZSTA 1OINA 4RUBA 1R3TA 1K9EA 3QRHA 4WUIA 5AY7A 2HROA 4RPPA 2I1OA 1WAWA 1OYCA 1RAKA 4AZ6A 4LX4A 3DH7A 3WJXA 1XYBA 4ADSA 1QW7A 1KGWA 4H8HA 4ZQMA 4M82A 5MKGA 3HG4A 1UYQA 1XW8A 4MYAA 4F0SA 4FA3A 1RK5A 2PMQA 1FKWA 2GJXA 4G56A 1EEPA 1R3SA 4FX7A 3WNOA 2P3EA 3PHAA 5IBXC 3W27A 1KFJA 4RXGA 3MANA 5JU6A 1EIXA 2CIPA 4Q3MA 5JH1A 4ZENA 1T99A 3SQSA 4YYCA 1FCBA 1UWIA 4J1OA 4JQAA 4GZIA 4OT7A 2E1WA 5A6MA 3KOZA 5K2ZA 3GFYA 4A6GA 4ZTYA 3N34A 5CEWA 4R85A 1PCWA 4RLIA 2R24A 1LUCB 2OODA 3LUTA 4XO7A 3WKZA 4CQCA 4ZEPA 1GHRA 4HHPA 1TKKA 3PUOA 4ZQRA 2WANA 3DZ1A 3T7VA 3GTXA 4BZYA 5E9AA 2A6LA 1QPKA 3DESA 3GVGA 2CBJA 2VEKA 4W8LA 3ZVHA 3WH6A 6REQA 3TW9A 4C7DA 4K1GA 4LVBA 1KXQA 1TR1A 4UTMA 1B9ZA 3WUEA 2ZUNA 1SZEA 3PTMA 3B0PA 4JQ1A 4RW5A 1XUZA 1PS9A 3C0JA 4KH2A 3KXQA 4MNMA 3B8WA 1JCLA 1IEVA 1WDWA 1ITXA 1QHOA 3AIRA 3RLGA 4AIBA 4CN1A 2CU0A 3CTLA 4HHMA 1OX6A 4YVVA 2E25A 4JHOA 1VRDA 3B8TA 4ZVJA 2R14A 2VOTA 2YPIA 1GOXA 4YU1A 2WK2A 4AHPA 3U3HA 2IW0A 1GJUA 4DEFA 4C6JA 2NXIA 5E9XA 3BG5A 3GSMA 4FNUA 4C6LA 1ZUAX 5CLWA 4C65A 4AYGA 4HCLA 1NF7A 1BYAA 4KRTA 3K8MA 2WBKA 3BG9A 1UUQA 3GRIA 4GCAA 1V6XA 2TPSA 3E0WA 2RJHA 5C9UA 3VCRA 1PHWA 5G4WA 3LERA 3MO4A 1OEPA 3BJTA 3U5UA 1NVMA 3GNRA 4Y90A 4C6PA 4DO4A 4WXZA 5K9DA 2P10A 2QEZA 4JX5A 3K1DA 1PKYA 4GC3A 1WOBA 3SRFA 4Q6JA 4HZ6A 3GKAA 3R25A 2OZTA 3SRKA 3QY8A 5U4NA 1IXNA 2Z24A 3A4AA 4C6IA 4AC7C 2J9ZA 2PB1A 3WUBA 3TEVA 4NJIA 3UU0A 2CKRA 4NRSA 4ERGA 3O0FA 1RQBA 1TPVA 4JNMA 4RJEA 2QV4A 4UFJA 3K2GA 1OX4B 4Z17A 3EOEA 3TAKA 2X40A 1XLCA 3UYCA 3JVAA 3ZJ8A 3VNDA 4AU0A 4FLQA 3MPGA 3L0GA 1MUMA 2NLIA 4FS9A 2W62A 3PZUA 1BKSA 1PKMA 1X38A 3MUCA 2Y8KA 3GAKA 3AFBA 2ZVIA 1AA1B 2BDQA 4UTFA 3BARA 4EAYA 4LBUA 3H54A 2NT0A 4PMZA 1HKJA 5EA9A 3OHIA 1B9BA 4AWTA 3KFTA 1H1NA 3HTWA 4NZJA 1GVSA 2DZVA 1KM2A 4JHMA 2VCBA 3TOPA 4QLJA 4X9YA 1R9YA 3G3DA 5CZKA 3AZTA 1UQYA 5JIPA 3NGJA 4Q7NA 3N3MA 1TQJA 4N2YA 1B3VA 4S3DA 2BVYA 5LNRA 3AYSA 1KM4A 1P7TA 1X39A 3OLDA 4OHQA 2Z26A 4HSNA 2I16A 5DX7A 2R1PA 3IARA 3EGJA 4JBRA 1O5KA 2V69A 4JTLA 1GG0A 1NJJA 4S3EA 2WJZA 3CV2A 2VFEA 2QUVA 1IZKA 3SGZA 4FXFA 3TQVA 5EL1A 1WV2A 5C55A 3F4NA 5I3IA 3ZVHB 2D23A 2WLYA 3GLCA 5D8WA 3MHGA 3WQCA 2Y7EA 4QISA 3V5CA 3QC3A 5CG7A 3W25A 4RK8A 3L4WA 1B3WA 3WNPA 3K30A 3UCDA 2HWGA 4LNCA 1V02E 3GR4A 1WAUA 2ZICA 3IACA 4S2CA 4OBSA 3BLFA 4B9YA 3IV8A 2FHFA 4XB3A 4O10A 3O8AA 4Q7BA 3WQ4A 1A3XA 9XIAA 2HXUA 4CNNA 2RJGA 2ZE0A 1I9CB 3C0SA 3SJNA 2X7WA 1F9CA 3SUSA 3UR5A 1AZ1A 4NNBA 3ECQA 1TQXA 3T1GA 3WLJA 4E8DA 2R91A 1TELA 3RUBL 4J3WA 2NUXA 4H9MA 2F2HA 4EE9A 3B0VC 1UASA 1HO4A 4NAEA 4Y8EA 3QR3A 4DYEA 7TAAA 3DX5A 4EANA 3N2MA 4FOUA 5BU9A 5A8OA 1A80A 2IQTA 4QJ1A 4J7RA 4FOJA 2YL5A 5DCEA 2NX9A 1KXHA 4LF2A 5H91A 3TTQA 1JVNA 4HU3A 3DYMA 2RKXA 4MWAB 3SY8A 1UR4A 4A21A 5C2GA 2BXYA 3E3HA 3LMYA 3GNDA 2QIWA 4LVAA 3NXFA 2XFYA 3MUIA 3W7KA 4J2PA 2X16A 5D8ZA 5I02A 1JCMP 4PUNA 1JNDA 2ZX8A 2VOMA 2WCAA 2FTPA 3AIBA 3HPZA 4GXWA 3ANVA 1AJZA 1W31A 1ZENA 3GZAA 1J2BA 4R27A 4LC6A 1JZ4A 1N55A 2GGEA 3AXKA 4M7SA 4HZ7A 4QR6A 5HULA 2VZUA 3GR7A 5AHEA 3I6RA 8CGTA 2FVMA 1E9IA 1M03A 2W27A 2WCGA 1A0CA 2DT0A 2Y5EA 1L6WA 4JIEA 1EUAA 2NX3A 4NI3A 1UR3M 4ZQOA 5I3FA 2ZX5A 1UPPA 1F6PA 1H2JA 3SAZA 3JZEA 2XTKA 1H62A 3CAQA 1SO6A 2Y7GA 4R34A 4MJMA 1UR0A 4GUFA 1Y0EA 1JD7A 4YTQA 3DN5A 4JNYA 1UR1A 4X63A 5D33A 5GPRA 1JZ5A 2XWEA 3STFA 4LNYA 2QR6A 2E28A 1J01A 3RU6A 3FS2A 3VD9A 2OEJA 1YPXA 9CGTA 2AQVA 4HNUA 1LL4A 3CPGA 4I8DA 3G6MA 4L80A 1M53A 3GNXA 1LYXA 3QYQA 3UVIA 2ZCGA 3URAA 2O9OA 4MMWA 4HMEA 3VFCA 1NFGA 1JRCA 4O1FA 3S5OA 3RK8A 4WZHA 3W1MA 2OGJA 1UR9A 5EBUA 4QG6A 1Z6KA 4PYSA 5AHFA 1U83A 2WC4A 1GZGA 1IZJA 4TMBA 4PC8A 1V03A 3P14A 5I6SA 1EC8A 3RLUA 1FH9A 3APTA 3QV6A 3W1AA 2Y6ZA 4GYKA 5DMNA 1ODZA 2DZXA 3T0AA 3LRMA 1RLCL 1QO2A 4LS1A 5CPSA 2FYMA 2IXVA 4X22A 3WENA 1UD3A 1XWYA 4DAFA 1ICPA 3NEHA 1KM0A 2G95A 3HBLA 4XD6A 1H1YA 3W0KA 1NF0A 2PF0A 3B4UA 7ENLA 1X98A 2ATMA 2NX1A 2QMKA 1SZRA 3LMZA 2Z1BA 2ICSA 3MJYA 3VZYA 1RCOB 2J66A 2OWWA 3RX4A 3MYPA 3T08A 1PJ9A 3QJAA 4MADA 1JZ7A 2XZ7A 5A6KA 3GDKA 2EQDA 4MKNA 3CQ0A 4KFOA 3G77A 2CETA 2EO7A 3V0TA 1E6SM 3TYAA 2XG9A 5H2ZA 4J35A 3T2PA 4HNCA 3GNNA 4PCNA 2YZ5A 5DY3A 1NWSA 1V79A 1W37A 3S46A 8A3HA 2HE5A 4OJYA 2C8NA 1OJXA 1C92A 3AHZA 2CLFA 2ABAA 3WF4A 3QPEA 4K3ZA 1W9UA 4JTCA 3TE9A 4RZ4A 3REQA 4O4WA 2POTA 3IVSA 1Q4WA 4E4PA 1VBJA 1BVZA 2NVDA 2GK1B 1BQCA 1XIDA 1RD6A 3AYTA 3WLHA 3KBWA 2J7HA 5HDRA 4FPSA 1YNYA 1DORA 1JZ2A 4J4KA 1RQEA 2ZX7A 1I4NA 3RJYA 1WKFA 1VLIA 5CSUA 5AN7A 4E3VA 3SRHA 2XH7A 3PVFA 2JIEA 2X41A 3D5HA 4L61A 5BWAA 3TDFA 3LY0A 5FJJA 3RU8X 4EPDC 4GC4A 4QCFA 4PGLA 1OABA 1R6WA 1ITUA 3P67A 4TVDA 3TW6A 2V2DA 5TQLA 3KS6A 5AB3A 3RYSA 1YNQA 3H2AA 5T26A 1V8EA 2J24A 3HPSA 2WC7A 4KWWA 3IJLA 4IIEA 4OVXA 4ALDA 3CAVA 1WKDA 1J96A 3W6LA 2TODA 4IL2A 1F07A 3A24A 3WMLA 2YGYA 3HJZA 4DZ5A 4MG4A 3QV7A 1Y65A 4QQ3A 1GVIA 5A1AA 4DM2A 3PNZA 2ZOXA 1MXSA 2XFRA 5KSWA 1LCOA 1MDLA 3AISA 4EWND 1G4TA 4AY7A 2J13A 1G6CA 1PIFA 4ZR8A 2QUUA 3UA3A 4PZVA 2A79A 3FDKA 4AHQA 2PDWA 3OBAA 4NSBA 2C7FA 1QDSA 3R12A 2CITA 2JGYA 4LUTB 4N6FA 4KMQA 3MCMA 1CZ1A 5I00A 2AGTA 4AZ7A 1IEXA 4O8AA 1JEZA 3S4TA 2HNHA 1YKWA 5FEPA 1CX9A 2B7NA 4UFLA 3TMQA 1DEDA 3AICA 1AMKA 4UTJA 1E4LA 3MMDA 1IT7A 1MVYA 2XGZA 5B7YA 1F3EA 3B40A 2Q71A 3EDDA 4GX8A 5HWJA 2OYMA 4F9DA 3S6OA 5CSRA 2QV5A 4L9YA 1E6XM 1I8JA 3CASA 4DJDA 3SRDA 2R6OA 2PTXA 3E2QA 5DXYA 2CESA 3GFXA 2Y2WA 4Q8OA 4U4MA 3P7YA 4KGJA 1KM6A 1RQHA 4EIVA 1VJZA 4W5ZA 2WPGA 4JOMA 4JTDA 5AZ1A 1KTNA 1UA3A 1PTDA 3NA8A 3OZOA 4L9ZA 4FX6M 3T81A 4PH6A 2XIMA 4GI4A 4H8VA 3KBJA 4YVXA 1P0EA 3GIPA 1VHCA 3MUY1 4G7EB 3GBEA 4YTSA 4NF7A 1QNVA 2ADAA 1PPIA 3MU7A 3CK5A 3WD4A 4WIWA 5ABGA 1X1OA 2WSQA 1HVQA 3CZJA 3FJLA 4FR1A 1REQA 5EMJA 2OKTA 5LNVA 1MW2A 1KRCC 1RHCA 3UR8A 2FLIA 1O94A 1XG3A 1P0NA 2OEMA 3NPVA 7REQA 2DZPA 3N73A 2YCJA 1KV8A 3GHTA 1DJHA 3ABQA 5AHNA 1TMHA 4MWAC 1UROA 1FP9A 1IHIA 3GW3A 3TQKA 3SECA 2QCGA 2HRWA 3UG4A 4IF2A 5F4WA 4ATDA 2WMHA 3CBWA 3F1QA 4UOZA 5HATA 3UZ5A 4F8XA 3UZXA 1DL3A 3OLIA 2CBVA 4C5ZA 2LLEA 4P5UA 2FGZA 1XIEA 1FA2A 5KINA 1EC7A 4PODA 1PO9A 1EBGA 4NG3A 3P6LA 1R47A 1OG6A 1EX5A 3WLLA 3CUIA 3M0IA 4D6JA 5GNXA 4I7WA 2AOSA 3FDGA 2FZ9A 3WK3A 3WO8A 3WEZA 3WLOA 3W6MA 2XVPA 3TA6A 1GG1A 4U3CA 1F6KA 1DVJA 4NZFA 3ZM8A 2WSRA 1HJUA 3QTGA 4F2BA 4IPPA 3N6QA 3IJDA 3A4WA 1AD4A 1M65A 4GFIA 3IK4A 5HQLA 2Z1VA 2ACQA 1RBAA 1EZWA 1RPXA 5EY5A 4AH7A 3MJMA 3BOFA 1RXOB 2PP3A 1AW1A 4DLFA 3TSDA 4IQDA 4M24A 1ONRA 5C2CA 4F3HA 3H2FA 5HQEA 3SO7A 3T9PA 2BY1A 3D0CA 4K2SA 3W22A 5DMYA 3Q4DA 1K02A 4HOWA 1VEMA 4GVHA 1N8FA 1J79A 1RP8A 3DG7A 4M51A 4C6DA 2G3NA 2QJMA 4NNAA 2OKOA 4GBUA 4FF7A 5E5CA 2F2KA 1X1NA 2PI6A 4WD0A 3WQPA 2PTZA 4PMOA 4RR4A 2Q09A 4IGNA 4U31A 1UR2A 2BVWA 3VC6A 3BE7A 1D7FA 4NI8A 1KKOA 3QQ0A 3UJFA 1EXPA 2JALA 1EDTA 1YTEA 2YDAA 3MKVA 3EYPA 4HPJA 4WOZA 2Z1XA 2WNNA 1DWGM 1SSDA 2A6NA 3KVJA 4ZOCA 3PB0A 3VNIA 3CYVA 2YOCA 3QMTA 3NQCA 1ZFJA 1B5TA 1SFTA 3SQMA 3GXTA 3SGGA 5FEZA 3H7UA 5CPQA 2BOFX 1GVRA 1GT8A 5H1WA 2GZXA 4ACZA 1HN1A 3W1RA 2YYUA 4JTQA 1TWIA 3CZGA 2YCLB 2P8BA 2XWDA 3UR2A 4Y9MA 2VGIA 3AYRA 1SZGA 3A9BA 3KE0A 3W7CA 1TR9A 3PZGA 1IZCA 1XDJA 6A3HA 4AZGA 3T2OA 4PFHA 2B7OA 1NTHA 4ACZB 6XIAA 1KCLA 3MT1A 2FDMA 1XSJA 1PWMA 2NSXA 1CCWB 1GVQA 1TV2A 4WR3A 5DEZA 3RHGA 4G1NA 2YBVA 3TAOA 2ZA2A 4BJHA 3PM6A 1TTPA 3W29A 3WNKA 4ZQCA 4A3YA 4YWIA 2A1YA 2DT1A 1XLBA 3POCA 1W3NA 2A7RA 3WQOA 3I10A 3VOCA 4LRSA 1FWTA 2WSKA 1FHLA 3DAQA 4C6QA 1GNXA 1XS2A 2NQZA 5CC5A 1ZGDA 1DQUA 4WKFA 5E0KA 1NDVA 1W3KA 2XVNA 4S39A 5AC4A 1JDCA 2BSLA 1JCNA 2B81A 2IUZA 3H4GA 3OQEA 4GO9A 3M7SA 4WX2A 1VP5A 2EEXA 4MUZA 5H8PA 3V7PA 2FJUB 2E8YA 3RG6A 3MI6A 5CCZA 2FHCA 1F3TA 2BGSA 2MNRA 2VURA 3EOLA 1WDDA 3RMJA 4DVOA 3PWAA 4LU0A 3WLTA 3MMUA 1PYMA 4FX8A 3BAIA 2QPSA 3WH8A 3RXZA 5FAJA 5FF2A 4IMGA 3CC1A 2RFGA 3R8HA 3ZT6A 5CJ5A 1Q7ZA 4JX6A 3E2VA 1DJNA 1JULA 3QSTA 3THUA 4QIUA 1C93A 4PUEA 4J3TA 3H8AA 3WF2A 1TMLA 5GVJA 4Y96A 4WRHA 1RD5A 2Z7KA 3M5VA 3PPCA 3VMNA 1EXBA 1XLAA 3PZVA 1XPYA 3UW6A 4H00A 3AXHA 1HQTA 5FJRA 3WCZA 3KX6A 2NQJA 5CPMA 2W5FA 4KKXA 2PUZA 5BRBA 1OVDA 2GDUA 2PDNA 1FWGC 4C90A 4MTVA 1GJWA 2P8CA 1UWTA 4TVCA 2WVUA 3C2OA 1XD1A 1CENA 1US2A 3VABA 1Q6GA 1PEZA 4XZIA 3W23A 3B9NA 3SY5A 1XIIA 4W9TA 4C6BA 2OMAA 3PK7A 1P6BA 4HA3A 3F4WA 1SZFA 1FDYA 1GVEA 4A29A 2WMKA 4RCXA 5IXEA 1Z44A 3LNMA 3GTIA 4X9SA 1R3QA 4DY1A 1GWJA 2DQXA 4NAFB 2E40A 4GACA 4IPJA 2A3HA 4RE0A 3LLDA 1UKTA 3O1NA 1MFVA 4WDUA 3BAJA 3LPGA 1K9FA 2AL2A 3W7RA 4DJDD 4LUYA 2X05A 3GDMA 5CJNA 4MOZA 4X60A 3CMJA 3MY9A 5AC8A 3WQ6A 3NQ2A 1JI2A 3A47A 3CT2A 3TLLA 3UYIA 1JIBA 3S42A 1ENUA 5CZ0A 4HIBA 1XLIA 1T8XA 3MUAA 3E49A 3WLKX 3MP5A 5EB8A 4GY0A 4CCZA 3MP3A 3AIUA 1C91A 1K8YA 3BLKA 1CXEA 1VPXA 1AZ2A 1PDYA 2UV8G 1HJWA 4L56A 3KZPA 3NPWA 1E6NA 1LL6A 3VE7A 3GIYA 3CV6A 1X6NA 1LRTA 3VINA 4B5SA 3NQ8A 4KEMA 2FZBA 2Z6JA 3NZPA 1X7IA 3MVTA 1C90A 3LB0A 3C8FA 3XIMA 1OADA 5J8LA 3R43A 2OJPA 4CVUA 2BP1A 2WHMA 4GVGA 3SR7A 1YPIA 4Z42C 3QQWA 2QAFA 1V51A 2XFWA 2XIQA 1X7FA 3FJNA 3NQAA 2QULA 2OLAA 3SFWA 4YLWA 1A5LC 1OIFA 4GIEA 3ABXA 1OG0A 3L0KA 5IHRA 3PC0A 2AL1A 4DRSA 5DCDA 1JDAA 1R30A 2CZEA 4KGLA 2DORA 3AIVA 3L12A 1EP1A 3NL6A 1R5YA 4ICCX 1J2WA 2DSUA 3QTPA 2DZBA 1V7YA 5CPLA 1TZ7A 1TYGA 5DRCA 4M6VA 1I2QA 4E8CA 1BVWA 2ZZ2A 2WHJA 1AVAA 4JTSA 7PTDA 3TSBA 1C9WA 3KHJA 5F2IA 3CM4A 2Y61A 4O15A 3VUPA 1R7OA 1VIWA 4HCDA 4BKNA 1GW9A 1UWQA 3EA3A 1XRSA 1DOSA 1SZNA 4KCVA 2QVHA 3ME3A 4XZBA 4U5KA 1FDJA 2Q01A 3AHTA 1CGVA 5C0QA 1G9HA 4RV8A 1BTMA 1FCQA 1W8SA 4R7OA 3CPUA 1BQGA 2O4QA 3LCFA 4Q8WA 3IPWA 1XKYA 4OTKA 4Z1DA 1GHSA 5AC6A 2VKZG 2ZUVA 3M9YA 3STEA 2ZWZA 1MW1A 3GX9A 1RVKA 4KW2A 4BI7A 1IR2A 3C61A 3T8LA 3LDVA 1SFJA 4EXBA 4XZLX 2SFPA 2GL5A 1ZL1A 3I65A 1BWVA 4Z2IA 4GISA 4X2RA 4MZYA 4LRTA 1B31A 3HGRA 1IT0A 3BURA 1ZRQA 3MSGA 1QVBA 4HN8A 3JUGA 2P53A 3FXYA 3W70A 4YIWA 2V2CA 2OSWA 4PULA 2CKSA 3ZIZA 4GYJA 5RUBA 1E6ZA 3MI3A 4AEFA 2VC5A 1ADOA 4W87A 3VNMA 1P0DA 1FCVA 3Q2DA 5REQB 3W83A 4CUCA 3VA8A 1E70M 3V0UA 3M44A 3R94A 1BGAA 3N1AA 1C7TA 1VJIA 1A3HA 1H7OA 3FGCA 1AUSL 3M5ZA 2Q3RA 3CHDA 4OUIA 4LXFA 1PDZA 5FJUA 3BMWA 4I9AA 4BA0A 4TV5A 2NQ9A 2IKGA 3W7EA 1RPKA 1SJCA 1ECQA 2G0WA 1F61A 3KWXA 3QR1A 4ATLA 3BGJA 3VD3A 1SMDA 4CGTA 1XGDA 4DZIA 1SM9A 1AL7A 3P93A 4QSFA 2GWNA 5ABEA 3SUWA 1V08A 2BS9A 4J27A 3LEPA 3VDHA 5HJXA 3B4YA 3WZ0E 4J28A 1JGIA 1W0MA 3F5JA 1BF6A 3GWQA 5ABFB 1LOSA 1JAEA 1BVNP 1XLLA 4A3RA 1LBFA 4GH3A 4LEQA 4QDMA 4TTUA 4D8AA 3IJQA 2TRSA 3UPBA 2ZC8A 3FV9A 2HS6A 3STCA 2WWCA 5G5IA 3MTWA 3NJ3A 1H7RA 3K8LA 2DW7A 4IL0A 4QJ3B 1PX3A 1OQFA 1OC5A 1ZJIA 4XD3A 2PSNA 1OYAA 4UIOA 1VD6A 4FZIA 4B5VA 2PGFA 4NAFA 1J8VA 3O3RA 1P1MA 1W5QA 1Q6EA 2GYIA 3AZRA 4K36A 3KAOA 1HGWA 1K6AA 4C7GA 4DWDA 1GVFA 3FKRA 4IMAA 5J5RA 3CIWA 4WY0F 3BPWA 1YHTA 3KTXA 4YHEA 1UB3A 1JFHA 2ZFAA 2ZZ3A 3FGCB 2E5BA 2HQAA 3UNTA 3AXMA 3SB0A 4PTMA 4W8BA 4LFYA 1HFBA 3ZLGA 1QPOA 3SM0A 4NYYA 5KZDA 3GZ3A 2CFFA 1J0KA 3UBPC 1H60A 3ITCA 4LYQA 3UWUA 1V6YA 1O95A 3OQ8A 1S2VA 5EMYA 1UP3A 1B3YA 2PWEA 1LBLA 3RJXA 1DJGA 1NU5A 5LIKX 1D8CA 4GI6A 3B0YA 4WOQA 3V3WA 4WDWA 4AWUA 5D09A 3TLQA 4REQB 5G4HC 3NDZA 3QFWA 4R7WA 3WF3A 4EAMA 2Y24A 3MCNA 2QUMA 2DSVA 5SWUA 3OPSA 3IVUA 4O12A 5JVLA 4JDBA 4NXKA 1W3IA 4PUUA 3NL5A 2FQIA 3S5YA 1O5QA 1TV8A 3P81A 4F2TA 1DE5A 2C14A 3M0XA 4MFDA 3WDRA 2YKKA 2A2IA 1OGBA 4MJ4A 2VCAA 2UY4A 3H2MA 3DHFA 5G2WA 1KKRA 1J0JA 1ZBVA 1ZP4A 3CQIA 4LUIA 1BHGA 4J3VA 3QV8A 1GEHA 1R87A 4ORIA 1J10A 5FJIA 2Q8LA 4POCA 4XD4A 1VB9A 3L65A 1QMLA 4UB9A 2NUYA 4P8VA 1WB0A 4ERIA 1IXQA 4CU6A 4V2XA 2C6QA 1W9PA 1E0XA 3CIXA 1YTKA 4US6A 1JRBA 1BPLB 2OWCA 6ENLA 2DZTA 3D3FA 4EF8A 2UY3A 4HNOA 2EJAA 1VQTA 1TE1A 1KFKA 4JL1A 5AZ0A 4IIDA 4LGXA 2EPMX 1TRDA 2AKZA 2G96A 2WOQA 3PBGA 2OTDA 1JFXA 1XC4A 4QEHA 1K1DA 3W7HA 1DJWA 1KGXA 3K4DA 4W7UA 3W7IA 3HGSA 2ZX6A 5BXRA 1AQFA 3ERPA 3KZSA 1ICSA 3GE7A 3AALA 4M56A 4ZODA 4MJ2A 5G2IA 4UFMA 1JUBA 4AX7A 1L2QA 1Q7QA 1ML1A 4JIPA 5KZMA 5HXMA 3TWAA 1E43A 3DHDA 1QBBA 2F38A 1DP0A 3QLLA 4P7OA 1WBHA 1VAHA 1XLJA 3MBFA 2QGHA 3VGGA 1WXJA 4QDWA 3S5ZA 5XIMA 3W7LA 2ZQ0A 4FXRA 1QK2A 4L9XA 1P43A 4ZQNA 3MQTA 1K7EA 3FLUA 1EA9C 3AMKA 3GG1A 2WVVB 3BLLA 3EPMA 5A8NA 2XUCA 5CQ1A 1DJQA 5D03A 3L5LA 1UWAA 1S5VA 3GVWA 3II1A 4S23A 5F4SA 4X3ZA 1N2VA 4DXKA 3AZSA 4H1ZA 3WQDA 4BR1A 4GBDA 1GPFA 2KAUC 5FOOA 2QNEA 4DI9A 3NZ1A 4XAYA 3PJXA 3U6WA 4E0CA 1CIUA 3G0UA 3G1DA 5AC5A 3WD2A 2PURA 2ZXDA 2Y63A 1QASA 3CEUA 4GUGA 5FF3A 2QUNA 3LHYA 4EF9A 4ZSTA 2E9LA 3E2SA 3E5BA 3ANUA 5I3GA 4QJ4B 1GKRA 3GXIA 1EWDA 5D04C 2Q3OA 4O0ZA 3NL3A 4WJ8A 4X0NA 2ONEA 2OOFA 1NARA 1F5ZA 1Q4NX 3G8EA 3B8IA 3P2VA 4WJEA 4QBXA 1JCXA 3N18A 4PCSA 5C9WA 3CZLA 1BRLA 4JS3A 5EFDA 4CD6A 1JI1A 5LHFA 5HAOA 5FESA 1TO3A 2PCEA 3DFHA 4MAVA 3NYDA 1JZ8A 1CEOA 5M17A 4OOZA 3N9RA 1K9DA 2VX6A 3EKLA 1JYVA 4DI8A 3VNLA 2QCDA 1W1IE 1O5RA 4D8ZA 3VM5A 3ARYA 5K3VA 4YTUA 2BY0A 2WW5A 3NTYA 4A3UA 3VI2A 4R53A 4Q4QA 2Y85A 4H83A 5FCZA 3KOXA 1BXNA 2ISDA 1LM1A 1V6UA 3HURA 3ITVA 3TROA 4OV4A 4AG0A 2PC8A 2W67A 1VBUA 2ODOA 4QE1A 3V36A 4S3GA 4LCQA 5CC6A 4ASTA 5EBAA 2WMIB 4HGXA 4ZL1A 4JD4A 3A4XA 4V15A 4F0RA 2PE4A 2V3EA 1WUEA 3LI0A 3FAWA 3V5FA 2OG9A 1O5XA 1TPDA 3IJIA 1PBGA 2W3ZA 2J74A 4CN6A 2NWSA 4XSLA 4MB4A 4ZO6A 4NNCA 1Y7VA 1E6RA 1EJUC 5A6BA 1S2UA 2NV2A 1HUVA 2V5CA 1IIGA 3G1HA 3C8NA 1GKQA 2H8ZA 2ACSA 5GQBA 3ENLA 3ES7A 2QDEA 4IG2B 1KA9F 5E09A 5BWFA 3C3UA 1WE5A 1E73M 4UTUA 4M6UA 1G4SA 3WDIA 4MAZA 2HNEA 1QNQA 1KRMA 4WDXA 3G1AA 3M43A 1L6FA 1PVNA 3VUSA 2PDXA 1QOPA 2WNWA 3HPXA 4AZHA 3UD6A 2QYGA 1T0OA 2HDJA 1CNVA 2J88A 4MJZA 2E4TA 1FX6A 4J3SA 4F0LA 4BF7A 2RHGA 4EPBC 2OCZA 4KT2A 3H2EA 5K4XA 4O14A 2PWDA 4HTBA 2VX7A 2F6XA 4HU8A 1HT6A 1LJYA 2POZA 1VC4A 3EKGA 1ME8A 1OF8A 4JKMA 3FNDA 3WSUA 3SCUA 4C5YA 1CYGA 1TCMA 4L7ZA 4XK2A 2Y0FA 3CAKA 1DYSA 9XIMA 5AC7A 4WSKA 4PSPA 4UQ9A 1OFPA 2HK0A 1U2YA 3ABSA 3E0IA 3G1YA 4F66A 1UMYA 2Y89A 3U7BA 4HNLA 2OEKA 4Y9AA 3IJ6A 1HJVA 1AH3A 4NVTA 4ZTXA 5BXTA 2RDTA 1CLVA 2OX4A 2OO6A 1XLHA 1DJXA 3GG8A 1BEUA 3WX7A 3VNZA 1DJZA 3CGTA 2QDDA 1UKPA 2Y1HA 5LKYA 2VMFA 3IK2A 2EXOA 4E2DA 1B3ZA 2EPNA 1E0UA 4OECA 3TQ0A 4YTRA 1PZ3A 4KQNA 1JZ6A 2PDGA 1TUFA 3CO4A 2JKPA 5FF0A 2DU2A 3R6IA 1Q6DA 4XV0A 3NDOA 3PAOA 3QF0A 2C79A 1OSEA 1TB3A 1XBXA 3GVVA 3MC5A 3FJ6A 3O6YX 3QZ6A 5REQA 4XBJA 1KO0A 2GJPA 2CZFA 2XN0A 2GUUA 1DBTA 5A3HA 3LTSA 2WZIA 3TMLA 2VRQA 3NQGA 4PL1A 4HJWA 4HK5A 2O56A 1ADSA 4GQBA 3SCOA 1S2TA 3CWNA 4AISA 1H41A 2BGQA 2FMOA 3HGOA 1OX5A 1KR0A 1POKA 4GFSA 4RL3A 4MGGA 3VKAA 1GYLA 1RK6A 3BL3A 1J12A 1P1XA 3QW4B 3TYDA 4PUWA 4UNKA 2QJIA 4P7NA 4FP1A 3O06A 1EQCA 3ARXA 1EH9A 3A9IA 4M29A 2AMXA 2B7QA 2GSHA 3TX9A 4HMNA 4HA0A 3VKJA 1DWIM 1FWAC 4GRSA 1GQNA 2I5IA 1GOKA 2PDMA 2Z2BA 5I24A 2PBGA 4YMZA 3I3BA 3WYZA 3ZFHA 1LUCA 3UJEA 1ZAHA 1IYXA 4G9PA 3GK0A 3URQA 2GFTA 3SDOA 4L1XA 1FXQA 1AODA 4JTGA 2OQHA 3VOJA 1X8FA 3I3EA 1Q6RA 3W24A 3LGEA 5M1TA 3W71A 1O68A 2X30A 2C18A 3ARRA 3BW3A 1XSKA 3ORWA 1VFSA 2DVXA 3L21A 4JTEA 1U5JA 5FL1A 5FAGA 3HPAA 2G4FA 2C0AA 3B9AA 4GQQA 2NSOA 4TUFA 3LGGA 1ONXA 1TWWA 3QM3A 2DUZA 4L6HA 4M80A 4DBSA 1JR1A 3EDEA 3N4FA 5A8PA 1F8MA 2C71A 3RLHA 3RLVA 2PGEA 3TOYA 2FTYA 5KZEA 3C52A 4MWAE 3AROA 1A0DA 4D6FA 4DAIA 1WX0A 1I45A 3UGRA 1XLFA 3CWHA 1IE7C 1EFZA 2WXDM 3DFTA 3A12A 4W85A 1Q63A 1MO0A 2VT0A 1TX2A 2XJ7A 4O1EA 4AWEA 3R1ZA 4PMDA 3DC0A 4ORMA 2F8QA 3ZOAA 4C6MA 4XAPA 1PTGA 1CDGA 1T7LA 4BF5A 3A13A 4JAWA 3UWQA 4ZO9A 3B04A 7A3HA 3EWXA 1I2PA 1AMYA 4L6DA 4NQ1A 3BZJA 1F8IA 4MZ8A 1KFBA 4CEUC 3TXVA 3NG3A 3R58A 1F73A 5LA1A 1E1FA 3VIMA 5D30A 1BXCA 4B92A 1MRAA 3WBEA 2DFAA 3V35A 4HB7A 3MZNA 1LLOA 1OC7A 2VRJA 3SN1A 3AHYA 2WBGA 4DIAA 3P0XA 1BXBA 5HNNA 2O4MA 5BROA 3WQGA 3W00A 4Y2WA 5A6TC 5JBDA 1EJXC 4B5WA 1E56A 1OX4A 3I6TA 4FK9A 3EAUA 4F9JA 5HMSA 4G5DA 1FVPA 3S9ZA 3U2EA 2FPTA 2DV0A 3VOHA 3WNNA 2FH8A 3M46A 2OQLA 5CJMA 3CO8A 1POJA 1T6MA 1EHNA 3E74A 4CQBA 1GZ1A 4INFA 1A4LA 3CUZA 3IJ7A 1W91A 3QY7A 1VHNA 2BB0A 3REQB 3S1GA 4I6KA 4AXKA 2W79A 3UF9A 2AMGA 4FF5A 2FB3A 1Q7MA 1E71M 2Z1WA 3NL2A 1JF6A 3FX4A 2R1MA 4CNPA 5TF0A 7REQB 4LBSA 5IDZA 2QPXA 3EPNA 4R9XA 1Q6LA 2FH6A 2NUWA 2O9TA 5JIWA 1HL8A 4UMAA 1XIHA 4FHAA 4YN5A 2B0MA 4TIMA 4XZWA 2JF6A 3NSXA 5ECUA 3KTSA 3SIZA 2INEA 1JZ3A 4JTAA 3PP7A 3HG3A 5EFFA 3I3DA 3ELFA 3ZMRA 3H4WA 1RV8A 1E0VA 2EPHA 4NL1A 3KRBA 2D0GA 3P8IA 5CGQA 3ITOA 3NR0A 2ZA1A 1OD8A 3GC5A 5A8MA 2V5JA 3C2RA 1UKOA 3BLOA 4JQ3A 2PD9A 2CPUA 1GQLA 3URNA 1NP0A 4J3ZA 3PBMA 1F76A 2DH2A 2Z1KA 2PBOA 4H9UA 3T4WA 2WQDA 1TVLA 5LYRA 2NV9A 5I2UA 4JY9A 2VI0A 1UH4A 2VP8A 3N04A 4H04A 1L6GA 1O1HA 3BLEA 3FY1A 3I68A 3VC5A 1QPRA 2IPGA 3CUXA 3VFLA 5IDIA 5BYWA 4E3TA 3UCCA 4KPLA 3PN8A 4CQAA 5E0CA 4Z0JA 4K38A 1VFUA 4Q4RA 3QPYA 2YXGA 1UZ1A 2Z0IA 2IKJA 4UTHA 3TJXA 4ZO7A 5LA2A 3WDJA 2VFDA 3FK4A 4IIHA 5BMXA 4UTTC 3AJ7A 1HJXA 3DGRA 3IGUA 3LCIA 2YIHA 4B91A 3B8UA 4V33A 4KFPA 3M0LA 1L8PA 1XIGA 2OO0A 1EO5A 1VIZA 4JHZA 1NDYA 1WPCA 3W38A 1HP4A 2ZZ6A 2FHBA 1AD1A 3FW6A 2Z4GA 3VPLA 3RNDA 3NDYA 4QLLA 4G7FA 1K03A 1XRVA 4ZB5A 3PY2A 2BV9A 2IKIA 1JYWA 1XFBA 3QSRA 3AWOA 2ACUA 4F2UA 3NWRA 2ZIDA 3OODA 4RNIA 4M1BA 3NCOA 2FGLA 2E3ZA 4I9JA 3NZGA 1E1CA 4IP5A 3CEPA 2IPFA 3MUZ1 4DN1A 3LBOA 3VOFA 3SURA 5T91A 4PSRA 4GNJA 3SBFA 1VFFA 2PDUA 5U7SA 2EJ1A 2D0FA 1R3VA 2YZRA 1OFBA 2DH3A 2G97A 4QE5A 3N6JA 4IGSA 2YCLA 1QT1A 2FKPA 2J6XA 2JEPA 3H22A 2QCLA 4J9JA 3UPMA 2JQXA 4JTKA 2NQHA 2BG5A 1QHPA 1UC5A 5CH9A 1OK6A 2PZ0A 3T42A 1EJRC 1Q2RA 4B5XA 4Q8QA 4JFSA 1W8GA 4PUKA 2FZNA 3NVDA 4XVDA 4DO7A 3OG3A 1EYEA 3KP0A 3KCLA 1G67A 2PLMA 3KRSA 1R46A 4W89A 1M5WA 1QU4A 2Y7FA 3GYEA 3RCNA 3RX3A 1B3XA 2HEJA 4AZBA 2W92A 4AEEA 1R9XA 2ZA3A 3B06A 1EPXA 4GQRA 1E3ZA 1RA0A 3MSYA 1VFHA 1S1RA 3R10A 3LHUA 3P0WA 1LWIA 4LSBA 2PDLA 1E6QM 2Y4SA 4ZE4A 2C1GA 3WL1A 1E40A 4KF1A 1Q45A 3OIHA 1FH8A 2I9EA 3G18A 3ATZA 1E9YB 3AAMA 1AQMA 4M81A 4UUIA 1TV7A 3BOXA 3QOMA 1XKJA 2O7SA 1I2RA 3MKKA 3THQA 3LM7A 3GYCA 3MW7A 4JIHA 3T0BA 3W6YA 4LS2A 3VKBA 1S2AA 3Q67A 1MEIA 3PUDA 1V7AA 1Y8BA 4AF0A 4H19A 1W1YA 3M0JA 4JX4A 4CNTA 2XINA 4UXDA 1A5CA 3H4XA 3H24A 5FEXA 5IM51 4ONVA 3OGVA 1GJPA 4RE3A 1ZBCA 1ELSA 1H3GA 1ECEA 4D9PA 4AZCB 3TA9A 1EF2A 4KFNA 3TQPA 5AHIA 1B0IA 2OVLA 5BW6A 1KM1A 2CWXA 1IR1A 5DRIA 1BD0A 4XBKA 4JEJA 3GM8A 4PCFA 1SW0A 2ISVA 1PZ1A 1EDGA 2BVTA 5LGZA 3DECA 1SO3A 3WBWA 2ANUA 2JFEX 1UKSA 3WJSA 3CZ8A 3HV8A 1XYAA 3CXOA 2HVMA 4GUJA 3V75A 1QBAA 2DSKA 3VK5A 5DQPA 1QI4A 3R11A 4AMCA 3WK2A 1W1ZA 4M1RA 5I03A 1SQ7A 4K7YA 3CL6A 3NQFA 3SSZA 3T0CA 4QG8A 2IXUA 4AQLA 1R8LA 4IOTA 2QDGA 1CPUA 3R5EA 4WKHA 1U1HA 4L65A 3EMCA 5CXPA 4WCJA 2WLZA 1CBGA 3QZAA 3SIMA 3EXTA 4GINA 2WPBA 3BDKA 3OW1A 3W3OA 4PN2A 1CGTA 1DIKA 3MB9A 4E38A 2IPJA 1KFLA 2E6AA 1IEWA 3PZIA 1QWGA 3E96A 1XLKA 2PTDA 1HX0A 4PUDA 1GVYA 4AHOA 4DJFA 4Z1CA 2GWGA 4UR7A 2TYSA 5ABTA 3BK0A 3VGFA 1KRAC 5J5DA 3EX2A 3DG6A 2INFA 3PTKA 2PWUA 2QT3A 4V28A 2IS7A 3CS2A 4RDZA 1ZAJA 1K8CA 3SUVA 2BFGA 4F0MA 3RCMA 2RGMA 4R7JA 2QLYA 4GO8A 1SJAA 4PMVA 3P3BA 4IFKA 2HPMA 3IJ9A 2G3FA 4Q4KA 2E0PA 4LY8A 2TSYA 1FWSA 1EWEA 4LS0A 4AYSA 3WK1A 4GCXA 5HWNA 4N7QA 3JRKA 3RR4A 2GUBA 3EOSA 3GUWA 3S5SA 4BI5A 1XHGA 4BQ5A 3L2LA 1BLIA 4FXSA 1AQHA 1G4PA 3LCLA 3B0UX 4PTXA 2E77A 3GVQA 1KXVA 3IIPA 5C7VA 1VZWA 3RPTA 1ALDA 3EKZA 4MSSA 3UG8A 4PBFA 3LSBA 4HN4A 4ICMA 2A85A 3F2BA 3B0XA 3N9KA 3P8JA 3DFPA 3OTRA 4DHGA 1DWHM 1H7NA 2ATSA 4GABA 4IIBA 1D3CA 3BV7A 3CMFA 3L4ZA 3B8SA 2QCMA 4EK7A 1BSIA 1W1PA 4U3AA 1Z32X 4GZJA 1H50A 4HYVA 1DJIA 4E2BA 2DZWA 3B8DA 1K4HA 4YWSA 3MHFA 4QS6A 4HK7A 2HBVA 3O63A 3OHMB 5CC3A 5CG0A 1J0HA 2GSEA 4Q8UA 3WLMA 1EQPA 1NQKA 2XM2A 4CQ9A 1BWKA 3BCFA 4EPEC 4EXAA 1DKWA 5CAKA 4C60A 1Y5XA 4I7UA 1HL9A 1O1ZA 2OZ8A 3PZTA 5I09A 2OXNA 4PL2A 4LUTA 2E5CA 4FNQA 5FI8A 4RDVA 3AMLA 4L4LA 2BVDA 3H26A 2ALRA 5D37A 1KRBC 2VVNA 2YFNA 4O0QA 1XPGA 4S3AA 1SUXA 1JJKA 1Q5MA 4NZ3A 2NW0A 4QNWA 3WD3A 1EA0A 4AWSA 4CEXC 2PDHA 5EKYA 1MZHA 3BQ5A 4GHRA 4L1WA 3A23A 2PWVA 3BG3A 4C7FA 1YDYA 3M0ZA 3NUKA 1TPH1 4DM1A 5I07A 4PFMA 2PFHA 3NNTA 4QDPA 4XAFA 1PSCA 5G1MA 4ROPA 2WZMA 4JNZA 2ZX9A 3TZNA 4G6CA 3D47A 5DBTA 1I2OA 1OFRA 5A2BA 4GQ0A 3H12A 5C71A 2QW5A 1W9XA 3FHAA 2BTMA 4I9MA 4PE8A 1TREA 2WZTA 2V0TA 3AMCA 4HVXA 4C6CA 2FVKA 2CHRA 2XIOA 4JN8A 1CGYA 4U5IA 2PDBA 3DYOA 2YDQA 3GC2A 4AUBA 3W73A 4AD4A 1HXJA 3QEZA 1XCXA 1YADA 3BAWA 3SY1A 2GDVA 4LAKA 1XDLA 1C7SA 1R9ZA 4Q32A 5A8GA 4GUHA 3BW4A 5E93A 1ZHAA 2R9RA 5EMMA 5D2TA 3G24A 2VFFA 3TW7A 1TA3B 3L4UA 3W74A 4AFYA 2V5DA 3EXSA 4OFCA 2CEQA 4IM4A 4DJEC 4JN7A 5HQMA 3NM1A 2YLLA 3USBA 3FVMA 1PAMA 5HK4A 3L67A 4PA8A 4AVFA 3GB6A 1VJSA 5IHSA 1E51A 4MF4A 1WO2A 4UNLA 1UBPC 5BOOA 4Y9NA 2VX5A 4GJIA 4IMCA 1UA7A 2DW6A 2QF7A 2CLOA 3WH5A 1QFEA 1XLEA 2XVGA 3DGBA 2PD5A 2WVSA 8XIMA 4O16A 1DE6A 1A5AA 1Q8JA 1H63A 4NZ4A 3C2YA 4DYKA 3QZEA 1UWSA 5A6BD 2GQ3A 5CSYA 5I06A 3N13A 4DJFC 2REQA 1SMAA 1VEPA 3U0HA 2YL6A 4WF7A 4GPNA 2JKEA 1Q2SA 1QNPA 3UY7A 1UR8A 2CLHA 1H5YA 4D6GA 1OBAA 2ISSA 4D6CA 2BHZA 3MMTA 3P82A 4B5NA