2NQHA

High resolution crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 4
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 107
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqhA00
3IUIA 2G0WA 3AALA 3BANA 3BZJA 3GNXA 3TVAA 4X61A 4W4QA 1XISA 1XYCA 3UU0A 4K1GA 2XISA 4PFHA 3AYVA 5TNVA 4A8RA 3UVAA 4YTSA 3VNJA 5FA5A 4YTUA 3XIMA 1O1HA 3NGFA 4GLEA 4G56A 1S5NA 5J8LA 3C0SA 3P14A 1YX1A 5B7YA 1XLCA 2HK1A 1XIJA 2GYIA 1A0DA 2NQHA 3CNYA 3CQHA 3M0MA 4GQBA 4HNOA 3AAMA 4QE1A 1K77A 4A8NA 1GW9A 5XIMA 2NQ9A 3C0LA 3KCJA 4LNCA 3IUHA 4OVXA 4US6A 4XISA 4ZBCA 4DVOA 1DXIA 2QW5A 3BDKA 3OBEA 4QE5A 4YTTA 3VNKA 2Q02A 1QUMA 3M0VA 1XLHA 3XISA 2NQJA 1MNZA 3KBVA 3UA3A 3ITOA 4X63A 7XIMA 5B7ZA 3ITTA 2GUBA 4EAYA 3KCLA 4J4KA 3QYSA 3KBMA 1XLDA 2X7WA 3U3HA 2XINA 1XLMA 5EMJA 1XIDA 1I6NA 3VNMA 3QZAA 3ITYA 3KCOA 9XIMA 1XLJA 2QUNA 1XLEA 3M0YA 3C0QA 3IUDA 3KTCA 1D8WA 1BXCA 1TZ9A 3CWHA 1A0CA 1XICA 4A8LA 4YTRA 5XIAA 2J6VA 3DBNA 3M0LA 5EMMA 6XIMA 3KBWA 1XLIA 2X7VA 3VNIA 3XINA 3UA4A 4QDPA 1BXBA 4A8IA 1XIMA 4XKMA 3FVMA 4HHLA 5EMLA 3BZGA 1QTWA 3DX5A 4X60A 3KBNA 1XYAA 1XIFA 1XLBA 3JU2A 3BWWA 3QC0A 8XIMA 1XIIA 4Q7IA 2OU4A 4GJJA 4KW2A 4EACA 2G4JA 2HCVA 1XLKA 1S5MA 2HK0A 5EMKA 5H1WA 3UXIA 4K3ZA 3ITLA 3CQKA 4PGLA 1XP3A 4HGXA 4XIAA 1DE6A 3U0HA 1XYBA 2QUMA 5AVHA 1XIHA 4HHMA 4XSLA 2GLKA 4YTQA 5XINA 3TC3A 5AVNA 3LMZA 1I60A 1XIBA 2QULA 3M0HA 2I56A 3L23A 4XIMA 3AYTA 3ITVA 1XLLA 5I7GA 1DIEA 3VYLA 1A0EA 4QE4A 3QXBA 3M0XA 6XIAA 4ZB2A 4XSMA 2I57A 3N4AA 2ZDSA 4ZB5A 1XINA 1XLFA 1CLKA 3ITXA 9XIAA 2ZVRA 3KBSA 3CQJA 4E3VA 1DIDA 1XIEA 5H6HA 3P6LA 4GJIA 1XIGA 3CQIA 1QT1A 3KWSA 5C9ZA 3VNLA 5B80A 4QEEA 1DE5A 3KBJA 1XYMA 1MUWA 3WQOA 4QDWA 8XIAA 4QEHA 4ZB0A 2XIMA 4DUOA 1XYLA 1XLGA 2GVEA 1OADA 1XLAA
chains in the Genus database with same CATH superfamily
2OEKA 3GNXA 1V03A 2OJPA 4Q4PA 4CCZA 1M41A 3SJNA 2TSYA 2BWGA 1JCJA 3NSXA 2CHNA 3C0SA 3JUGA 2X8RA 1K9TA 2ZRZA 5D9OA 3DEQA 4YCOA 3UCQA 3WENA 1QW7A 3V3WA 5XIMA 1Q7QA 1GKPA 3IUHA 2AMXA 2OZ0A 3VZZA 4LRTA 3H2EA 1GVRA 4RK8A 1WZLA 5LIWX 1DHPA 3P74A 1ZLPA 1YXDA 5DLCA 1PL9A 1J0YA 1NFGA 3GR8A 3A24A 3WLNA 2YXGA 1Q6RA 1RLDA 4PMDA 1TCDA 3R2GA 1E0TA 2CWNA 1SSDA 1UWSA 4FF5A 1IYXA 1RY8A 4M5PA 2HEJA 3VX1A 4QM1A 2XSBA 3GHSA 3EKZA 1UD2A 3DESA 4E5TA 4GD0A 4JICA 1EEXA 3WBAA 3MT1A 3AXHA 2R82A 2Y61A 3LPFA 2BVWA 4ZSTA 2NLYA 4ZFMA 3EWCA 1IT7A 3VIOA 1EC7A 1A0EA 2D20A 4BEUA 4OU1A 3H2CA 3HM7A 5LSMA 2DORA 4JTLA 3HGJA 1VYSX 3TC6A 1XDMA 4UMCA 1VBUA 5HMEA 3P6LA 3NZ1A 1W3NA 3P8IA 1H50A 4DUOA 2G3FA 1JI2A 3GUWA 2JKEA 2E6YA 4REQB 3N19B 1XISA 1R3TA 3SQMA 1ZALA 1HO4A 3AYVA 5TNVA 3SCTA 4GNKB 4PB5A 4A3HA 4NP7A 4FOKA 1PUDA 3NL5A 5TF0A 3MUZ1 4A2RA 4KFOA 3W74A 2Y4SA 2V3GA 3P81A 2OR2A 2YB1A 2P50A 5TAOA 4A21A 1VBJA 1AW1A 2A7RA 1YTDA 1M6JA 4QCFA 3RYSA 5FJIA 4IPLA 1KM2A 1Z69A 4O10A 3W86A 1C92A 3V5CA 5H8MA 1UMLA 3TP4A 3BGJA 2JKPA 1UZ1A 4EVZA 1Q6CA 4DI8A 1HFBA 4ACZA 5F4XA 5MHBA 5AC8A 1J0JA 3TSDA 3FGCB 2H9AB 4HMDA 3VM5A 2V5LA 4CU6A 1O1ZA 3PFRA 1BQCA 1VGAA 7ENLA 3M0IA 2WBGA 5A8QA 4GRSA 1H41A 2CIPA 3PZUA 3RITA 1NM9A 4DBEA 4F66A 5AVNA 3W7GA 3LA4A 2Y8KA 3DCPA 4H83A 1UR4A 2CLKA 3GH5A 4LVFA 5DRCA 3BAXA 2QVNA 3VIGA 3IJLA 2PP3A 1UW9A 2RJHA 3W7KA 3EWWA 3UJRA 3CL6A 1GVSA 1Q13A 2ZBTA 1EBHA 1OY0A 4XUGA 1X1NA 3QQWA 4PMRA 5JQ9A 1KWKA 2G96A 3MMUA 5BWAA 5D2YA 1E4IA 4NAEA 4IFKB 3WQEA 4GI6A 3RX3A 4WKAA 1OZQA 3NSMA 3MSDA 1LUCA 4GH1A 3N4EA 2NVDA 4GY7A 4FNTA 3C3NA 3TW6A 1TE6A 2OEMA 1ZNNA 3T09A 1AJ2A 3BURA 3W1RA 1SVDA 3MWAA 4KCUA 1KFWA 4OFCA 4D9PA 3IJQA 3ZWTA 4H00A 2UWFA 2RKXA 2V3DA 1KNWA 4DIAA 1FCBA 3CO8A 3OHIA 4QLLA 5D2XA 3I65A 4IZGA 4QX4A 3TV8A 2HBVA 3RNDA 1W0MA 3WK1A 3U7VA 4BF9A 3AUJA 3DX5A 3S2MA 5LNVA 1E6QM 4DJFA 4IJCA 3CH0A 2BXVA 2WHMA 1QBBA 3S2NA 4NXKA 2VGGA 2V5DA 4AD4A 2CZ5A 5K2ZA 4A6GA 2WMIB 2HZGA 1UKSA 1TFVA 2NSXA 2J25A 3DFPA 3IWPA 2YBVA 1B90A 4KPLA 4C5ZA 1KW1A 6CGTA 1KC7A 3JW7A 5HMDA 2QF8A 4XX6A 4FHAA 1BRLA 4EPKA 1UOZA 2ZCGA 2X2GA 3FJNA 1OC5A 2FZNA 1CPUA 1HJUA 4AXNA 3CLMA 1OT2A 4FA3A 3W85A 1YLVA 1WDWA 3PPCA 2FH6A 1FFQA 3OJGA 3TTYA 3W27A 1WDQA 2VUYA 3CM4A 3WLHA 1FWHC 2QCGA 1EOKA 4ERAA 1ZL1A 1LTDA 1WOBA 3ZOAA 3FEQA 3H2AA 1Q6GA 3IK2A 3UY8A 4HMNA 5HINA 4X9SA 2I5GA 1YX1A 3WJXA 4N4PA 3ABSA 3PZTA 3U48A 2FDSA 2HS8A 3F2CA 7ODCA 1V02E 3KOZA 2YDSA 2FB2A 2QPUA 2QQ6A 2BNJA 3WJSA 1F73A 1GQLA 3S3GA 2D24A 2OZ8A 3GW3A 1XCFA 4O14A 1Y65A 3IUDA 3SCWA 4YTRA 1JR1A 2XVGA 1RSCA 4XV0A 3N11A 4GIRA 3SY5A 2JF7A 2ZX8A 4GVIA 2Y5SA 4PBFA 4F40A 4H04A 5AC4A 3BSMA 3J7HA 1DTNA 2PTWA 2PLCA 3W25A 4ZOBA 1XDLA 3AZTA 3UD6A 4NI8A 4GISA 2VCCA 3TYUA 2VQUA 3SCSA 3TAOA 4QISA 1CW2A 3FV9A 2JBMA 2YZ5A 4B5UA 5KTLA 4MY9A 5C70A 1QT1A 4HZ6A 2Y8VA 3IARA 1QNRA 3E12A 3GX9A 2BVDA 2Y5EA 3RCYA 5AC5A 2C79A 3GXTA 3EMZA 2BSLA 3BAYA 1A4LA 2A3CA 4J3UA 1ZQ5A 3DHPA 1UBSA 1HZYA 1X98A 2A3EA 3MUY1 1HKWA 1I1WA 4I7VA 1PEZA 2XIBA 3D47A 4MZ8A 3O7UA 3OGVA 2AKMA 3MI2A 4QE1A 4U5IA 2VKZG 5REQA 3AU2A 2W4XA 4LNCA 2ATSA 4RLIA 4ZQRA 1P6BA 3DG3A 1BKSA 2OKTA 4EAYA 1YTEA 4I5XA 2XTKA 3WL0A 4GYKA 4FO4A 2OB3A 3RFAA 2OZ3A 2XH4A 5I78A 2GUUA 3T4WA 2QCDB 2PDXA 1S39A 3LBCA 1SZNA 4P2VA 2VX6A 3M16A 3PJXA 3TXVA 2GGJA 3G18A 1P7TA 2B7PA 3ITLA 3JZEA 5FKYA 3FSTA 1XYBA 4H41A 4C1LA 3C52A 1JPHA 4PSPA 4PRWA 3WD0A 4PTDA 3TQ0A 3H2FA 3SECA 4BI6A 3TYDA 1AVAA 1T0OA 2BXZA 4JKMA 3RILA 3CIXA 4Z17A 2FGLA 4QXIA 4GUIA 4HPNA 1XYMA 5LIYX 1RQHA 4MY1A 2BB0A 3UCDA 4FS9A 3WD4A 5I03A 1R2TA 2CYGA 4HNTA 1SZRA 1WYIA 3W02A 3TN4A 3TNBA 2V9DA 2XFFA 2YYUA 2E6FA 3UG8A 3AROA 1YPIA 3GR4A 1E0UA 1O5QA 3L5AA 4Y8FA 5EKYA 2HXTA 1ZY9A 1GW9A 1OWQA 3PG9A 3EKGA 2H90A 1A80A 4I9MA 4ASTA 3SIZA 2QDEA 1IWAA 3NQCA 1HNYA 3TW9A 3GH7A 6XIMA 3ZSTA 4CNOA 2CBVA 1L6SA 4NAFB 4W87A 4PUDA 1ZFJA 4N9CA 3WBWA 5AB3A 1JULA 4KGLA 1FCQA 5AHMA 4EX4A 5AYYA 1G4EA 2BZNA 2QDHA 2RDUA 4LS0A 5AVHA 1QJWA 1W5NA 3WF1A 1G94A 3W83A 3FEMA 3WLMA 2CEQA 2ACSA 4D8AA 5CBIA 4REQA 3LG3A 4ML4A 4Q8VA 3NQ2A 4GZ7A 3GG8A 2OVLA 1DWAM 4JNYA 2DIJA 4HA0A 1ALDA 4S2BA 1OADA 1XLAA 2GVYA 1Y7VA 2Q8XA 3GQYA 4HJWA 4HOZA 1WX0A 4OV9A 4DHGA 4MNLA 1XD1A 3T08A 3NXLA 3UZWA 2V8ZA 1T5AA 3A47A 3WQCA 1SSGA 1DWHM 1F6PA 3R12A 4B4HA 3E5BA 5BXRA 3LHVA 1JYXA 4IX0A 4ZBCA 4N9DA 3SCPA 3TNOA 5RUBA 3XISA 3CZJA 2BX7A 4OIFA 1I1XA 2C1IA 4ROQA 1T8XA 2E8YA 4K8GA 3BG5A 4GYFA 1HGYA 1T96A 2HJPA 5BYWA 1C29A 1PHWA 1HN1A 2BOFX 3LERA 4H9UA 5HMSA 4IOTA 1UP2A 1FH9A 1XIMA 2YB4A 4PMQA 1R85A 3NL3A 4E4UA 4OUEA 1QK2A 1OK6A 1XHGA 5IM51 1XIIA 1WDRA 3S1XA 5E9AA 2CLIA 1E3ZA 2X30A 3DXIA 3GIYA 4HGXA 4YYCA 4GWEA 5XINA 3T4CA 2G3MA 3W1AA 3PK7A 3WNKA 1I2RA 1MI3A 3S9YA 1OG6A 5D32A 1F3EA 2D3NA 1ZCOA 3OQEA 4EAMA 3LXCA 2GQ3A 2H6RA 5F2LA 2X41A 1CGYA 3KBJA 5KZMA 2QHAA 3GBDA 3BZJA 3WQGA 6PTDA 4KWSA 1BWKA 1W3TA 3V1HA 1EUAA 1UD6A 3GBEA 4G5DA 4MDOA 5JXQA 1NTHA 3W6MA 4DXKA 2TODA 1LBMA 3GVWA 1RV8A 2DVXA 1MDLA 4XG1A 3PUDA 1GORA 3L4TA 3W82A 5C7VA 3VKJA 1RBOB 4GO8A 2Z1WA 2X40A 3QYSA 3PC0A 5FJJA 3ZQ9A 5HR6A 4UNLA 4HT3A 3THAA 2XN0A 1EHNA 3M0YA 4A8LA 1LL7A 3DBNA 4HOWA 5HPCA 3QTPA 5DEZA 2X7VA 3C0JA 3BZGA 1XSKA 2BHUA 3GG7A 3WLRA 1QI0A 2XFWA 1TMHA 5DY2A 4P8WA 4PZVA 1QMLA 4FR1A 1M9HA 4HCLA 1SO4A 1TPC1 5I6SA 3QZ6A 1B3ZA 3PZMA 5ABHA 1Q6EA 1EIBA 1BG4A 1OG0A 4FXSA 4FLOA 3GU9A 4PC8A 4E6MA 4PSRA 1KB3A 1OC7A 3IGHX 4B3KA 3CBWA 3NO5A 5K3VA 2EEXA 1UYQA 4YN5A 3M0KA 2EG7A 3ARUA 5I23A 4GZEA 4AC1X 5H91A 1K3UA 5A8PA 2W61A 4CCCA 1J9YA 2PODA 3MQTA 4Q6JA 4HZ7A 4QFUA 3T2QA 3W00A 3B4YA 4W7UA 5I06A 3THUA 1V08A 2WMKA 3DI1A 3V0TA 1E6ZA 2Z1KA 4LVGA 4AIUA 5H2ZA 2PD5A 3K8KA 4LC6A 4ZR8A 3UJSA 1U83A 4CD8A 3BAJA 3PY2A 4RE0A 5IBXC 3DU0A 1HL9A 2VC5A 4Y9MA 2ATMA 4IMFA 1YMYA 1B3VA 3QY7A 3U9IA 2VZSA 3LV6A 4ICMA 2VZTA 1MYRA 4LV4A 1UH4A 5A6LA 4JR5A 4Q6XA 4TVDA 2Y7FA 5EYWA 4O50A 5LA2A 4JN7A 4R88A 1M7XA 4KWUA 5BW6A 1H5YA 3AS0A 1HKIA 4RPQA 4G1KA 1SZGA 1KFCA 3R5EA 3AMDA 1TWDA 3N2XA 5E1QA 4XAZA 3AIVA 5I5RA 1MQRA 1TVLA 2WNQA 4WQ6A 4J7RA 4AISA 1YQ2A 2X16A 3NQVA 4FOJA 1XLFA 3HPAA 1Z7AA 4D6JA 3O6AA 4KEUA 1ME8A 3MV11 1TPFA 4B16A 1I2QA 1IGWA 4UFLA 1DE5A 3WQOA 2Z1VA 1V3JA 1X7FA 4LALA 1XI3A 1H7RA 4PUKA 4V2XA 3WMBA 4LVAA 3RM8A 4D8ZA 1XYCA 2CZDA 4S3AA 4BWLA 4CNPA 4KWOA 1TV4A 3N4FA 4DM1A 3APGA 3NQ6A 1PKLA 3RCNA 1D3GA 3AMLA 3FN9A 2BY0A 2UY4A 3ERPA 4DZAA 3DZ1A 2YW3A 4B92A 2ABAA 1XPYA 5GPRA 2QCDA 3UNTA 4OHQA 3WJWA 4Q22A 3ZXWA 4ICNA 2ZRUA 1H51A 5DBUA 3SUUA 4IGNA 2QCCA 3CL7A 3HFYA 3ZJ8A 3SSZA 2EPKX 3UGRA 4H9VA 2B0MA 2Y85A 1EJWC 4Z0SA 5I3JA 2OLHA 3BARA 3W70A 4DO7A 3OYZA 1N7KA 2Y5JA 1GZ1A 2IQTA 1AD4A 2ON3A 2F7FA 2XZ7A 3ATZA 3KTSA 4PBEA 2XDFA 4BKNA 1U2YA 1V0KA 2ZIDA 5AYXA 3DUGA 4QITA 5F4WA 4UR8A 3GFXA 1NDYA 4NSBA 1VHCA 5CH9A 3S5YA 1MXDA 3B8DA 3CHEA 3QXBA 1EXBA 4GNVA 4JQ2A 1LL4A 3M64A 3VE9A 2E4TA 5E6ZA 4LRSA 1LORA 3TUUA 2VZUA 3A13A 2AAMA 4ATLA 4EOUA 4JTUA 2AL2B 5F2MA 1V3KA 1GUVA 3ZFHA 3AWOA 2UY3A 4DBUA 2FIQA 5FEZA 1EB3A 3OVGA 1JCYA 3VDGA 1X38A 3BLOA 4HNOA 2CZEA 4LVBA 2J24A 2DUAA 3E96A 1GG1A 2YCKX 4EPBC 2ZVIA 4AD5A 6ALDA 4IT1A 3FDKA 1HG3A 2G50A 4N9EA 2WKLA 1H5VA 1EO7A 2J4GA 2O4MA 3CHVA 1GJWA 3A9BA 4YIWA 1LCOA 4AF0B 3GU2A 5BRQA 3OZPA 3W75A 3SUSA 5J5DA 4NZJA 1OC6A 2FVKA 3GLCA 3BWWA 1AMKA 3HJEA 5FI8A 4C6MA 2VX7A 3CMGA 3THQA 3NQAA 5A6SA 4O1DA 4FNSA 4KT2A 3R6IA 4FAMA 2A3LA 1FWTA 4Z2LA 3TJLA 4YMZA 3G77A 5DCBA 1Z44A 5CC7A 3GKAA 3WLLA 4XIMA 3LY0A 4HZMA 3G22A 2IW0A 1ZENA 4IMDA 2OYLA 1W9UA 3AXKA 4ZB5A 1O94A 1A3XA 2WO5A 4ZO9A 3TTEA 2W27A 2PDFA 4Q8MA 3ATYA 3NZPA 3EEGA 2DUXA 2E3ZA 4WY0B 2WNNA 3W7QA 3R4IA 2OO0A 5FA5A 3MC5A 4MB3A 1XKJA 4BQ3A 3VMPA 2J8FA 4B3LA 2G3NA 4I6KA 3VKDA 2GUYA 3EDEA 4BR1A 3ZIZA 2Y0FA 1J79A 2QW5A 1QBAA 2DQXA 4OTKA 3QKZA 4EPEC 3OEXA 2Z24A 4IJRA 1I45A 1QOXA 2PSNA 3SCNA 5I2UA 2BGNE 5T8GA 5AZ0A 2EXOA 5HPOA 2PGRA 5CAKA 4G8TA 2WZMA 2ZUTA 1VPQA 1YDOA 3MV01 2QLYA 3B4UA 1F74A 2J8TA 3WF2A 3BQ5A 5BCAA 1W9PA 3OIHA 5DMYA 4H9XA 1F7BA 1R38A 2CXEA 2G4JA 4IM4A 4ATDA 1G9HA 1B3XA 3SQSA 4KCWA 3SEPA 1GQNA 4GINA 6ENLA 2IKJA 5LNSA 2F2KA 1JPDX 4CEUC 1BTCA 3UWEA 2XGIA 1XGDA 1E0XA 3I7SA 4CQ9A 2VM8A 4UOZA 4XTDA 4Q4OA 2PDQA 3U57A 5G5IA 1ZBVA 4DEFA 3MO7A 1WKFA 2C18A 4MWAC 1TJ2A 4Q4RA 1EF2A 4HHPA 4AIBA 1C9DA 2Y7DA 5HNRA 3TR9A 3MVIA 4A8RA 3G2GA 2Q6ZA 2DT1A 3FA3A 3F1QA 2WJFA 4M8UA 1XRSA 1YYAA 3NEHA 3IIOA 3V36A 3WFAA 3FLUA 1P6WA 3WUFA 1K77A 1TJ0A 4EPDC 4P5UA 3BXWA 4XISA 3GDTA 1Q6QA 2Q02A 1WBJA 2WVVA 5E09A 1OVDA 4TV5A 5IFPA 3MUIA 2MNRA 3FXYA 4I9TA 3LENA 3H6OA 4H2HA 1M53A 1SO3A 4C65A 3NNTA 1VEPA 5A6AA 3NJ3A 3DYOA 4O15A 5F2GA 4M6PA 1UOKA 4PBGA 2DP3A 3BCFA 3PB2A 1ZTVA 3NWRA 3GDMA 3WNPA 1HTIA 1OCNA 1KO0A 2EG8A 4LFYA 3IJ6A 1X97A 5IDIA 1FWJC 3S83A 3ARXA 4HSOA 4XIAA 1H7PA 2QUMA 3DFQA 4IX2A 1KD0A 2QMJA 1VBGA 3GB6A 3LGDA 2GJLA 1EHAA 4W86A 1TUFA 4LH8A 3GTIA 1PAMA 3UY7A 3CJPA 1U1HA 2PRHA 3RUBL 3YPIA 3N4AA 3H23A 3ITXA 3HIJA 4JAWA 3CUIA 2POZA 3HB9A 3V75A 2W91A 3B8UA 2ZWZA 4R9OA 1J96A 1E6PA 1GOXA 4JFUA 2VWTA 1SJBA 3I10A 4TXEA 1A5OC 3HGRA 3Q65A 2G3JA 2WHKA 4D8LA 5KEZA 1YADA 5FCZA 2FVMA 4YTUA 2Q8LA 1XWYA 3EB3A 1XDJA 4OKDA 4QJ5B 1BYDA 1RALA 3SJ3A 4JQAA 3D5HA 2OWXA 5CGTA 1NWUA 4GI4A 4M81A 1H7WA 1EWDA 3VUSA 2PBOA 1TWWA 5KINA 4JL2A 3BJSA 4JOMA 3V18A 3LHWA 2O7SA 2V67A 3FJ6A 1W3IA 1EYWA 1CX9A 4NZ4A 1EYEA 4WOZA 2J7CA 3WF3A 1L2UA 1BGAA 1FBAA 1YXCA 3THCA 3WD3A 1R5YA 3TZNA 1G67A 4KFPA 2EJ1A 4JS3A 2ZUNA 7TIMA 1DQUA 3FK4A 2DH2A 3IPWA 3ITGA 5PTDA 1Q4WA 1AK5A 1GTEA 5ABEA 1IEQA 3FA5A 5FIPA 4UTFA 2GSHA 2VL4A 3G1AA 4JIPA 4AEFA 5LIXX 4WIWA 5ABFA 5LHFA 1ZP4A 1XSIA 4HTYA 1LQ0A 1RA0A 3RX4A 3Q58A 4GBDA 5JIWA 2HPMA 3G0XA 2QPXA 4OBRA 2R91A 4ES4A 3U5YA 1V6TA 3L21A 2OEJA 1EJSC 3BLPX 4WUIA 4TR9A 5E70A 4PR4A 4BEQA 5AC6A 3LBMA 3NXFA 4EIVA 2VJXA 4UFKA 5J8LA 3KVMA 2ZRWA 3STGA 3DFNA 1XW8A 3MHGA 1UR0A 3LEPA 2XUCA 5DANA 4BQ5A 1YXYA 4OVXA 4MZYA 3WELA 4U5KA 1EGZA 4JQ1A 1F3TA 3V0SA 5BXTA 1L6YA 2PPGA 5LA0A 1J8VA 1XLDA 4IMAA 4QNEA 1KXQA 3HQNA 3NVTA 4ZO8A 6TAAA 2FGBA 3T78A 4IMEA 3QV6A 1KKRA 5CPMA 3W26A 3GNRA 1CI1A 1WO2A 2MUCA 1LOLA 1R8LA 5BZAA 3P0XA 1PKNA 3GVQA 1E9IA 3VI2A 4CNUA 4MJMA 2H8ZA 1QPOA 1KBLA 3CQKA 4FNPA 3BV7A 1JZ5A 3IGUA 5DXXA 3WQPA 3MJYA 4W8BA 3L67A 5DELA 1VFMA 4MWAA 1UR8A 4FIRA 4LUTA 3AIUA 4S3EA 3A4WA 1H11A 1M5WA 1VEMA 4LAUA 3P0WA 5EGRA 3CZEA 1H49A 2VEPA 3R0KA 4RE4A 4KESA 4KF1A 2WQPA 4UTTC 4DO5A 3QZEA 1W5QA 1JAEA 1K7XA 3TVAA 3EPMA 1VCFA 4ZL1A 1KKOA 5A6MA 1EP1A 3WY1A 4DRSA 2ACUA 3L4UA 3VIFA 2VELA 3NL6A 2GOKA 1A49A 3UP8A 3TLLA 3RPTA 4OJYA 1W54A 1RCOB 4G9PA 2J66A 1TZ7A 3VCNA 4JTAA 4W88A 5HK4A 2BVTA 3K30A 3TFXA 2ODOA 4U2ZA 1S5TA 2NT1A 1C7TA 4RW5A 3GUGA 1FA2A 2V3FA 2XVKA 1UROA 1SR9A 1XICA 4B3ZA 4WJXA 1DJIA 3RLVA 2BHYA 3SR7A 1DV7A 3P61A 5FF3A 3CV7A 3NM1A 4QROA 2EKGA 1WAWA 1UUMA 2NXIA 3EMQA 1KV5A 1OBAA 4FXRA 4GX9A 4J3VA 4NZCA 4O17A 4DO6A 3GXMA 5ECUA 1VIWA 3VIMA 1VZWA 5AHEA 2O9PA 3ITVA 2AOSA 3LCIA 4O57A 4H7CA 4S39A 5CPQA 4PEKA 2C1GA 5A6TC 1RK6A 2CBUA 1TPDA 2REQA 2V30A 5JVLA 4H2CA 4IXXA 4N2YA 4NF7A 1UP3A 1PZ0A 4GJ1A 1AQHA 3S8HA 3MB9A 1W91A 5T91A 3UR5A 4PFHA 4AX7A 2CKRA 2YPIA 2VEIA 3ZR5A 3PZGA 2HBXA 4KBXA 2DW7A 1P4CA 4ZTXA 1QCWA 4H8UA 1TG7A 2QNEA 4Z42C 1IZJA 1QWKA 4PCTA 4HPGA 4X63A 4F2UA 4U2YA 5JBFA 1WOAA 3E0WA 2VFFA 1GQIA 5J5RA 4ZXLA 3POCA 1F3WA 2WMGA 4UQBA 1XQLA 2GK1A 1XYAA 2JIWA 4NJIA 1EF3A 2R6OA 3M0JA 1J2WA 4KS0A 2WCAA 1C8VA 2ZX6A 1H0GA 3CWNA 2YFNA 4UB9A 5LYRA 1QPKA 5DT7A 3ANUA 1NF7A 4L9YA 1N8WA 1M01A 5C2CA 1RHCA 4HPJA 1JZ8A 4XSLA 2GLKA 4LBUA 1XM3A 1S2UA 4DLMA 1XSJA 3FW6A 1R7OA 2E0PA 4B2DD 4A22A 3DERA 3TMQA 3FIGA 3VIIA 4HSHA 2FZMA 4W93A 2DW6A 3CLWA 4B5SA 4OECA 4NRRA 3R25A 3MHFA 4P8UA 3N9RA 1JZ3A 3TYZA 3F2BA 4XZBA 3VIPA 1WPCA 1K70A 4L1WA 4QRNA 2PTYA 4WHBA 1Q3NA 2A3HA 4RKAA 4W4QA 3N9SA 1E3XA 1ZU8A 1KR0A 1V3IA 4PA8A 4AWUA 1MEHA 3AICA 3M0MA 1UWTA 3W22A 3T9PA 4GACA 3QW3A 4MADA 2ISVA 1HKJA 3D46A 1GEQA 1RR2A 3UG4A 4JFSA 1NOFA 2XHYA 3LM7A 3UA3A 3WJYA 1BG9A 2WVSA 1M03A 3UXLA 1Y5XA 1IGSA 3OGSA 5FJUA 3DHFA 1E73M 5T9CE 4CNNA 3GYCA 4K39A 2WNWA 1QWGA 3NIYA 3BG3A 1WDSA 4AW7A 5AHIA 3HQPA 1H7OA 1GK8A 4ZCWA 3GHUA 2X09A 3I4EA 4GZJA 1T99A 3HF3A 2GZXA 1CGTA 4JXCA 3FYOA 1DJHA 1F8MA 3U2CA 5A3HA 3WEZA 3HPFA 3W0KA 5IRPA 2EKCA 3NDOA 3TC3A 1GCYA 1DIEA 1GOQA 3ZJ7A 4S3CA 2ZVRA 4TQTA 4LUJA 4HU0A 2HVOA 4Y96A 1SZEA 1J93A 2G95A 5AYBA 1V0LA 3U2OA 3CZKA 1KTCA 3WD1A 2I9UA 3UG5A 5EBAA 4NNBA 3EMCA 3U4FA 2CC0A 1MW0A 1BD0A 1DWFM 3PB0A 3TE9A 3R10A 3IRDA 4L1GA 1AFSA 1FCUA 1C93A 3I6EA 5ABGA 2ZTJA 3PZQA 1FXPA 5A6JA 5FF7A 3EZ4A 3GHRA 5FF0A 4CVWA 4GZIA 1R30A 5D2VA 1XLHA 3VFCA 4C6LA 1Q6LA 3QHOA 1R2SA 2J7HA 3QFEA 2GUBA 4LAKA 3UGVA 2F6XA 1XGZA 3KBMA 3LZ5A 3VNMA 3ZYZA 3FCPA 4IMGA 2BODX 1J01A 2XG9A 4C6IA 3ENLA 1EOMA 2HDJA 3T55A 3HN3A 2FZBA 3V4BA 3GW0A 1IEWA 3C6CA 4AZCB 1W32A 3HPSA 5CZJA 2DQWA 4ZMGA 1TPB1 2X1IA 4NJKA 1Q5MA 1XL9A 2RDTA 2CLEA 2IKIA 1SJCA 1HJXA 1JNDA 4RZBA 1UQYA 5A8GA 3SCQA 4E2BA 4JTQA 2E8ZA 1UZ4A 1PTAA 1U33A 2Z6JA 3QF0A 4C7GA 1EH9A 3L4VA 1X8CA 5IFTA 2EG6A 3AYSA 2V38A 5LKYA 4A2SA 4BQ4A 1SZFA 2R1NA 1JUKA 4HP5A 2BBFA 3ARTA 2NUXA 4N0RA 3MCMA 3ARRA 2VHLA 3OU8A 4HNVA 1MNSA 3UJ2A 4NL1A 3S5SA 2IS7A 3C3UA 3VKBA 4YPJA 1J6PA 5M2FX 2PCEA 4QG6A 5E6YA 3PPHA 4OOUA 3QSRA 4GFSA 3EOOA 3TZFA 1SPQA 3L5LA 4WOQA 4AVNA 1OX4A 2PF0A 2ZE0A 1U30A 3GR7A 2XIJA 3OP2A 4JQ4A 4UIOA 4J4KA 3WF4A 3L4YA 1KFBA 3OG2A 1UWQA 3MYPA 2WSRA 4H4IA 4ZSUA 4GE8A 1Y5WA 4Q33A 3KLLA 4IG2A 1W2PA 2ZXDA 1LDCA 2E1DA 6A3HA 4H8HA 3KL5A 4WKFA 2XM2A 2IKHA 2XH7A 2UY2A 1TTQA 3QR1A 2JE8A 3JRKA 3CQ0A 3UXIA 4GUFA 2RH9A 1G5AA 4AQLA 5JBEA 3T0TA 1C8QA 3HQ1A 3PN8A 1X39A 3ABZA 1ADDA 3EWZA 4KFNA 1FP9A 2E9MA 3LUTA 2QIWA 2NQ5A 7REQA 3N9KA 3DFSA 2QXWA 1W17A 3GNDA 3SDOA 3K5XA 1CTNA 1V5XA 4R7WA 3AQUA 5EL1A 2BOEX 3CTLA 2FYMA 1FWBC 1SW7A 4XZWA 3EA2A 3O15A 2Z1SA 2A79A 3HG3A 4KCTA 2P0IA 4GXWA 2QKFA 1OB0A 3USZA 1BVNP 2QDGA 2HQAA 4N02A 4IL2A 5LA1A 1EC8A 5DCDA 4DN1A 1QPRA 1CGWA 3N6JA 2YX0A 1P6CA 4GXMA 1PS9A 5IHSA 2WJDA 3HZ3A 3ONCA 3H7VA 2R1PA 3QGKC 3PS7A 3PAOA 4Z1BA 4CD5A 2NXGA 4ZVJA 1O5XA 1PWMA 4DWSC 3MDUA 4AHOA 1S2TA 3GDRA 3WDIA 2XWDA 2OYKA 4A8IA 1UJQA 3DENA 3PF3A 3QMRA 1ONWA 1TPWA 2W79A 3JR2A 3V1PA 4L64A 1OYAA 4PCFA 1EZWA 3EWYA 1VENA 5EMKA 3TU9A 4M6VA 3SRFA 2VGIA 1J18A 1HJSA 3PZIA 4IIDA 2CZFA 2VWSA 3G1SA 3TA9A 4F8XA 3SQLA 2X1TA 3MSGA 1NP2A 4WDUA 1MUCA 2I14A 4BCEA 3O9NA 4MKVA 1FTXA 3AC0A 2X1SA 1J10A 1WV2A 4KH2A 3LX9A 4LEFA 2PDIA 3PWGA 2BGSA 3E3HA 3STCA 2ESCA 1V93A 1TKKA 3NZRA 3T40A 3K1DA 3GM8A 1KM6A 4ZQCA 4YTSA 5F4SA 1FRBA 1UR3M 3XIMA 3TEVA 3LHTA 1C7SA 2WOQA 3DGRA 2DT3A 5KITA 1XIJA 1A0DA 1OGBA 2ZZ5A 4ZOCA 4F2TA 4J3SA 1S1RA 2GFTA 3G3MA 2NQJA 2WCSA 4EK7A 4HZ8A 5C9WA 3DECA 4F3HA 5I77A 2I9EA 3ECQA 4I5RA 2OMAA 2OWWA 3T0DA 3WK0A 2PWUA 2J7EA 3IS4A 1SFLA 3NO1A 4DPQA 4WSJA 2J78A 1OF6A 4L61A 1THFD 3CUHA 5IHRA 4LOCA 1WBHA 3E2VA 3AIEA 4IXHA 1HUVA 1UCWA 3R7MA 2VURA 3N1AA 4UC5A 3TSBA 3AMCA 4X22A 1B2YA 1PKYA 4MWAD 1G4PA 2PZNA 2NVAA 4FNRA 1HP5A 4KW2A 2XIOA 3AHYA 1UZDA 3WQ8A 4YL2A 1K4HA 2Z0IA 1F61A 1O5KA 1X1ZA 4WRHA 4WXYA 1D7KA 3VDCA 2Q8ZA 4IWWA 1MW3A 5A2CA 1POJA 4YWIA 3KOWA 5EA9A 3BLFA 3AS1A 5D8WA 2ZXAA 1W56A 2QS8A 3VNLA 4FEZA 4FMVA 5A6BD 1OX5A 5AC7A 5EFFA 2BY2A 1J0KA 1TPEA 4LBSA 3KHJA 4IICA 3KDNA 2Q09A 2PWDA 3KXQA 4O12A 3M6DA 4L1XA 3N13A 3M47A 3MSYA 1ZAJA 1Q7MA 1KM5A 1E1CB 5CBBA 4LUSA 2GSJA 4CD6A 2PDNA 3S5NA 4UCGA 2VYOA 1PPIA 3TJIA 7XIMA 3CHCA 2VOMA 3GDLA 4JEQA 3C61A 4LGXA 2FJKA 3LCWA 3U3HA 1OFBA 5CZKA 1GJUA 3IVSA 2ZA2A 2Y63A 3MP3A 1VAHA 1OZMA 3E74A 1QO2A 3GK0A 3NO3A 4ZQPA 3ES8A 4RNFA 4XD4A 4UWMA 2DZBA 3UZ5A 1ITUA 1XF0A 1KBJA 4JFTA 3SZ8A 3TR2A 3URQA 5CCZA 3WNLA 3HOJA 2CZVA 5KSWA 3R79A 1S5MA 2D0GA 4QJ4B 3LCGA 3RM4A 1L0PA 3VD9A 2XFYA 2CBJA 3R43A 4JYEA 3LPGA 2X05A 1E43A 1EX5A 4BY3A 2CW6A 1CECA 4H9TA 4BI5A 1EJ7L 3T0CA 1QI2A 2OG9A 4MZ1A 2P5NA 3FAWA 4Q8UA 2A3BA 1IR2A 1FWSA 4C1NB 2Y7GA 4DZIA 1DP0A 1R3SA 3MS8A 1VD6A 3ZO9A 1OFDA 4F0RA 1OYCA 4I7UA 4BS0A 1UHVA 3NAVA 2VC9A 4JTGA 1PZ3A 2I1OA 3WQVA 5CG0A 1CEOA 3P5ZA 4HK7A 2FQIA 3QLLA 3VAVA 2D2JA 3WNMA 2V69A 4UCFA 4AWEA 4DWSA 1C91A 4EP8C 3O3RA 2G4FA 3MZNA 3VXGA 1X6LA 1DTUA 1W5PA 1UUQA 2OPJA 3SY8A 4AZCA 4PUEA 3LV5A 4HA4A 4NY2A 4XKYA 3KL3A 5G1MA 1V02A 5HBFA 4B9ZA 1YE4A 3SCOA 4KETA 3VC6A 1PIGA 4JTRA 3KP0A 4TUFA 3MUAA 3N73A 1Z32X 1NVMA 4UQEA 3PNZA 3UJEA 4DAFA 1QRQA 4C91A 3U4AA 2PBGA 3HURA 7A3HA 4ZE5A 2DZUA 1REQA 3B05A 1O7AA 4PMUA 5G1TA 4UFHA 3WNNA 1KCXA 5D30A 5EBUA 4C7DA 3KWSA 1O60A 5FSDC 1FHVA 2EO7A 3TCEA 1WKYA 1GVIA 1SUXA 2J8GA 1V6WA 2Z00A 1PV8A 1GNXA 2VFGA 4YWSA 5TD4A 4INFA 4A4AA 3C2YA 2OELA 3VM7A 3T05A 3ABQA 3ZVHB 4AU0A 3OBAA 1AL7A 4AXKA 1M65A 4FNUA 3BO9A 3LNMA 3NGFA 1UG6A 3C8FA 4LAMA 3P14A 5E9XA 5BU9A 5G1YA 3UWQA 1HKKA 4S3GA 1G7VA 2GDVA 3CT7A 1IV8A 5DRIA 1AUSL 2DU2A 1GTHA 4AB4A 3RGTA 1A3WA 3AJ7A 3CZ8A 2D1ZA 4D71A 1XS2A 3EBVA 3GZAA 5D03A 2HVMA 1A53A 2YSWA 3UZXA 4RX0A 3LHZA 4RDYA 1NARA 5HWJA 3AIWA 3URBA 3KDOA 1W3JA 1S2WA 1BFNA 3C2RA 3U5UA 3W87A 4V27A 5I3FA 1IR1A 2C13A 1FUYA 5CZTA 1UA7A 5CJ5A 1UR2A 4IQEA 4ZQOA 5E0FA 2WXDM 2WSKA 4V1XA 4UNIA 2P76A 3S1GA 5AHFA 3CHDA 2XH2A 3REQA 2FPYA 1WDPA 1EUNA 3TQKA 4NQ1A 5JIPA 5KZDA 1KM1A 2OX1A 3I3BA 4AAJA 4LYRA 2UV8G 1QI4A 3EX1A 4BFAA 3RR1A 4NZFA 3W72A 3BTNA 1TA3B 4DELA 4RNIA 4QSHA 4HBKA 2F61A 4DZHA 1OCJA 1I4NA 1Z9AA 2IPGA 4ZXOA 3W7JA 1Z41A 2J47A 3AXMA 2ZDRA 4B5VA 4F48A 2AQOA 4QSFA 4CD4A 1JUBA 4G2DA 3TC7A 4NVTA 1FXQA 3I6TA 4TTGA 3UXAA 3WBYA 4RZ4A 4LCQA 1JPMA 2OO6A 4HIBA 1CB2A 3GH4A 4KIRA 4N7QA 2GSEA 4JTEA 3EA1A 2X0YA 2P10A 2XINA 1E51A 1I6NA 2VENA 2WK2A 4R3UA 4CNSA 4BZYA 1W3HA 3KBWA 7CGTA 7TAAA 4JNZA 3LM3A 3W1QA 3Q67A 2ZX9A 5CSUA 4DLFA 3QV8A 3MP5A 3TW7A 3UVIA 4CD7A 1SGJA 2L5HA 1AH3A 1B5TA 1SQ7A 1I9CB 1VHNA 3SUWA 1DJWA 4FX6M 3TKFA 2CU0A 5G2WA 3OIXA 1JPKA 1XBVA 1JXKA 1EKOA 3G5EA 1C3FA 3TN6A 3LHYA 3A6OA 3RXZA 2DZTA 4LF2A 2VD8A 3B0XA 2P88A 3H7UA 4B9YA 1ZAHA 3WQWA 3QTGA 4EWND 1DBTA 2PA6A 3A23A 4QEHA 1ZBWA 1VCVA 3PZOA 1MFUA 2PGFA 1WP6A 1ITXA 2GGEA 4E2VA 1BXNA 2RJGA 4GQQA 1GONA 3BMVA 4JCLA 2R24A 1KBBA 3PZNA 4UTWA 5FL1A 3FHQA 1ELSA 3M6YA 2XSAA 4DM2A 2ZUMA 2IPJA 3LS9A 2RGLA 2QJGA 1YHTA 4GCXA 4FI4A 3AJXA 5C7HA 1W8SA 1GYMA 5F1VA 4JL1A 4H3DA 2KAUC 4PUMA 2RDWA 3F4CA 4CNTA 4LU0A 3TONA 3LTPA 4DJFC 2XIQA 3N29A 1GEHA 1N55A 3KE0A 4UOQA 1K03A 1KGXA 1IWPA 3MWCA 4C6EA 3MO4A 1LRNA 1X1OA 1Q6DA 3OHMB 3SCUA 1FKXA 4HHMA 4C6CA 1P0DA 1JZ7A 3W2LA 2OOFA 3GG1A 1KGWA 5K9DA 3VYLA 3W7NA 2A2IA 4Z1DA 3PHAA 4W5ZA 3UWZA 4CCEA 1Z3NA 3VGDA 3K1GA 5T9BG 2PI6A 3NQ8A 2VVSA 1EGMA 5B80A 4CQBA 4J5NA 2JQXA 2JIEA 1SFSA 2Z28A 5C71A 4H9ZA 3W23A 3W1NA 4FX8A 3W1LA 4HVXA 5FEXA 5M5DA 2OOGA 3FXGA 3ISIX 5I09A 3U6WA 4Q8TA 1IE7C 1IT8A 4LB4A 4AUBA 1YNQA 1OJXA 1ONXA 1VYRA 1NP0A 5HR7A 1H60A 3AUOA 3OPSA 3ITOA 3AHXA 3VGEA 5H8PA 3E0IA 1LQ2A 3EDKA 3QPZA 4DJDC 5E5CA 1H7XA 1I2OA 3SGZA 2QDDA 1B57A 3QC3A 4CQAA 4PUJA 3T2PA 2J6VA 2PE4A 1WZAA 1R3RA 3WDJA 1RVKA 3GVGA 2YGYA 2DZSA 5F1UA 1QPQA 3EOUA 1XIFA 3CYVA 1HF6A 2CFFA 3MKVA 1QI3A 3VC5A 3PUGA 4JZ5A 3K4DA 2Y89A 2PTXA 1OD8A 1JZ4A 4JBRA 4HSNA 3W7MA 4M7TA 5BROA 1KFEA 1XGEA 3R0UA 1S2VA 4GY0A 4AD2A 5FJPA 3ORWA 4RDZA 3W84A 4PB4A 1X6NA 1EP3A 5HNUA 4O18A 4RE2A 2PD9A 3ABOA 3C2OA 1PSCA 3W2KA 3IJDA 3K4WA 5LIKX 2VVNA 3OW1A 4GNJA 1OF8A 4O8AA 4JX4A 1FX6A 3EXRA 2W9MA 1W1ZA 1QNVA 1HXJA 3H22A 4D6FA 1ITCA 3A12A 4ZA0A 4HK6A 3U2EA 1AA1B 1PVNA 5B7YA 5I0DA 2E28A 2Y2WA 3BE7A 2I17A 4EXAA 3FX4A 3OBEA 2BS9A 2E25A 5LNRA 1D7FA 3WDQA 4HOXA 4MGGA 1GT8A 4QS5A 1TPH1 4Z2GA 4C6PA 4CEXC 3UEQA 4EANA 3VDHA 3WLTA 4AYGA 1MMFA 4PCPA 3RO6A 1ZJHA 3G6MA 3WBEA 4V1YA 3W38A 1XJBA 1V4YA 5CPSA 1VFLA 5HQEA 3PVFA 1K9FA 2PWVA 3OVPA 2ZRVA 4G7EB 3VIJA 2WV8A 1VYPX 4QQ3A 4MB1A 4G7FA 2C0HA 4PULA 2WQDA 4XAFA 1RK5A 3B06A 2ZUVA 3W2NA 3E02A 3WL1A 3CWOX 2NUYA 3RJXA 3LN3A 4ORIA 2JFEX 2CNCA 3CC1A 1Q8JA 4HJFA 4D6CA 1GQJA 4K7VA 1VFSA 1V79A 1GVQA 2PLKA 3UFYA 3H2NA 3A5VA 3SN4A 2CKSA 3BCJA 3I3DA 3B04A 4L5ZA 1OFOA 3ZWSA 1ISWA 2GVJA 4CUCA 1YBQB 1J0IA 1U5HA 4PTWA 4L4OA 1A5AA 2OT0A 4IJBA 4D1JA 1PXGA 1W3KA 4YVXA 3W7IA 1M7OA 2GDQA 2FTYA 3AI0A 3D0CA 1QUMA 1KA9F 4LC8A 2DSKA 4LY4A 3EX2A 5AFDA 2FZ9A 1CXEA 4E8DA 3STFA 2YL5A 5CC5A 5I3IA 1R87A 2ZOXA 3BMXA 3VDAA 3WFZA 1HIZA 1ME9A 1TV7A 3S4TA 2TPSA 4LYQA 4PL2A 4TV6A 4TMCA 2PP1A 1ZJIA 1XXXA 1SFTA 1R2RA 4C6NA 2BY3A 1U1JA 2HTMA 3BLEA 2VEFA 4HU3A 5G2IA 2ZADA 4FXJA 5IOBA 3NDYA 3CV2A 1QK0A 3DOPA 3L9CA 1CNVA 3JS3A 2ZICA 2CWXA 3S5OA 1P43A 1HL8A 2V68A 3GAKA 4WZHA 2VRJA 3QJAA 3DYMA 4GFIA 2F8QA 4IUGA 4B4FA 4WKHA 3ZT6A 1U22A 5LNUA 4PTMA 2C8NA 4XZLX 2XIIA 3ARQA 4DWSD 2OYMA 3WX7A 3LSBA 2IQ0A 1GYNA 1TTJA 3OLIA 5DF0A 3AXXA 2RDXA 3GG0A 4O1AA 3ANYA 3CMJA 3W7HA 4DJDA 1MXGA 2XGZA 2PDYA 3T07A 4Z2IA 4U3AA 2PDGA 3BDKA 3H53A 4JHMA 4YTTA 3VX0A 1XD0A 3HV9A 3WUBA 1PYMA 2YA1A 4MJZA 2QF7A 2X7WA 4MFDA 2I7GA 1BEUA 3M46A 3PJUA 1UC4A 1WE5A 5D04C 3P2VA 5MKGB 1PDYA 4O0KA 4MY8A 3EOEA 3R11A 1RCQA 2VFDA 3ZLGA 4GYPA 1BWVA 2Y6ZA 1TO3A 4MUPA 2WJEA 5GJNA 2NLIA 3VMOA 5BWFA 3S6DA 1XFCA 2ISSA 1JFHA 4PGLA 5DX7A 4IFRA 5BRBA 3H7RA 3IV3A 4J3ZA 3URAA 1DEDA 5HWMA 4IPJA 5KZEA 3S47A 1JRBA 3F5JA 2ZTKA 5AECA 2YJQA 5FSEC 2JK2A 1RJQA 3TWAA 3P67A 4OZOA 5HOSA 3PUEA 2C16A 3BOFA 4HN8A 2G3IA 5AHLA 2BVYA 3LSCA 4F0HA 1KGUA 5AOUA 3FKRA 4LS2A 2J7GA 3N25A 1XCWA 3UERA 1GJPA 3UZYA 1P0NA 3CNYA 3AHVA 1AQMA 1K4GA 2XYLA 3CEPA 3OGRA 1QOPA 2EGZA 1OK4A 1PE1A 3ARZA 1CGVA 5B7ZA 2C0AA 1MVYA 8TIMA 4Q7BA 4JIEA 4WSHA 2DT0A 1VFTA 4MYAA 5AN7A 3E9AA 1GOMA 2B7OA 3A9IA 3GAYA 2DZPA 5E0CA 1P0KA 1UH3A 4PUWA 3UJFA 5C8BB 3JU2A 1JDAA 5EMYA 2QCEA 1TIWA 4JTCA 1AH0A 4JCMA 1HX0A 1C9WA 3VKKA 5AZ1A 2A3AA 3TQPA 1ODUA 1FWGC 4X9YA 2OSWA 1LZOA 1ZHAA 3O1NA 4PN2A 3NQ7A 4MTVA 4NG3A 2R8WA 2B4GA 3GC5A 1PIIA 1QXLA 4AIEA 4JYDA 4E0CA 4U4MA 3AFBA 3B8IA 2Y24A 2EPLX 3AALA 3UR2A 4UFIA 4K1GA 1WCGA 3F5LA 5BU6A 1TMLA 1UPPA 3WDPP 1JCLA 1HO1A 4E3TA 4NASA 3I6RA 2B81A 1M1BA 3OLGA 4NX0A 5AKQA 2ANUA 1UWUA 2VP8A 3A21A 3FAXA 4K38A 2OCZA 5CZ0A 2A6LA 3RRXA 5DMLA 4DF2A 2R9RA 4PCNA 2NQ9A 3IV8A 4US6A 4GI8A 5DCEA 1JF6A 3DFYA 3VZYA 1PHQA 3ABRA 3RLHA 1ZCCA 1GPWA 3CZLA 2QUVA 3STEA 5LZLA 1W2VA 5I07A 2OXNA 5EMUA 4L7ZA 1C8XA 4K1WA 4PRRA 3M5ZA 2DZVA 4IH3A 1KTBA 4XAPA 3UA4A 2HSAA 4XKMA 2BASA 2C14A 5DFAA 1R46A 1J2BA 3PP7A 2D0HA 3HTWA 2KZHA 4DJEA 2Y70A 3GXIA 1B54A 1OM0A 2GJRA 4XO7A 4NXSA 5HULA 2J6XA 2DEPA 2VC6A 3TOPA 3V5OA 3BGGA 3LI1A 3LNPA 1ZBKA 1PTGA 4S3KA 4JTHA 4XD3A 3VGFA 4PEEA 5C9UA 1F4AA 1Q2RA 2F2HA 3G1HA 1DJQA 3S2CA 1TSIA 1B4EA 4ZE4A 3BLKA 4WGHA 2NV2A 3RO8A 4BWLC 2ISDA 4U3CA 3NYZA 1AODA 3SRHA 2ZKMX 3FGCA 3GNNA 2H9AA 4IL0A 4LJ3A 3DFHA 2INEA 1XBZA 1U1UA 3NA8A 3FA4A 4IP5A 4Y9AA 4ZGYA 2W66A 3GVRA 5HANA 1N82A 2ZFAA 1V3MA 4K36A 1Y8BA 1Y0EA 2NW0A 1ICPA 3GXPA 3LXAA 4GPNA 1AQ0A 4LBRA 2W63A 4ML9A 3LPPA 3TSMA 1FWAC 3ARWA 2WC3A 3LCLA 3RLGA 1QAPA 1KQZA 3T2OA 2QJNA 1TJRA 3ICJA 3W2JA 1XX1A 5KETA 1L8NA 1I0DA 4ADSA 3QV7A 3NZGA 2VTFA 5TBOA 2PU1A 1TWIA 3CT2A 3SAZA 4ERIA 2J88A 1JYNA 4IFKA 4M7SA 5K7JA 2O9TA 3DBPA 4KERA 2XH0A 3H2OA 1D3HA 1XLKA 2ZA1A 5DMMA 3TYEA 5D2WA 3PBUA 1IXQA 5CXPA 5ENLA 3LMZA 3UWUA 1KFKA 2QR6A 3M0HA 2DT2A 1J6OA 4S2CA 4FLQA 2NWSA 4XUYA 5FESA 1EJRC 3S1VA 1NIUA 3S9IA 2VR2A 3IJ9A 2X1RA 1HL2A 2CERA 2W3ZA 3T8QA 1TCMA 3WQ4A 3BW3A 4AWSA 2WSPA 2YCJA 4DI9A 2PB1A 3G1XA 4ACZB 2NV1A 1QHOA 4LYKA 3PSWA 4NYUA 3HMJG 2E5DA 1AZ1A 2XISA 3NQGA 5CLWA 2ZRXA 1YRRA 4J35A 4JPGA 2OKOA 1K7FA 1Z6KA 3BCDA 2A5HA 3R58A 3WH8A 3SSJA 1B3OA 2WMIA 1FWFC 3B8VA 1KWGA 1L6FA 3C0LA 4XAGA 1LRQA 3OYXA 3P8JA 4IIBA 4MFEA 3EPNA 4MIMA 4YS1A 6REQB 3GNOA 3ITTA 3UCCA 3UYIA 4WJ8A 1SW0A 1FP8A 2X0HA 3ZR6A 3JZUA 5J04A 2CCRA 3GTFA 3LQLA 3GFZA 5BMWA 4QQUA 3HA1A 7PTDA 1O4UA 4NAEB 1JZ2A 4OWGA 2D23A 5EMLA 5G4HC 4HHLA 4W8AA 3K2GA 1FHUA 1J4EA 2V2CA 2J62A 1VLIA 1JYWA 4W7VA 1AZ2A 4NNAA 5BOFA 1MFVA 4A3UA 3BGAA 1JXJA 4WSKA 1R0MA 3GO2A 4YHGA 2EPHA 1UP0A 2HNEA 2KX9A 2XVNA 4JX6A 1ODZA 4H19A 3EX4A 3GHTA 4O19A 2IUZA 4UFJA 4LUIA 3BLLA 1KM0A 2Z2UA 2Y88A 5A5WA 1V6XA 3WZ0E 3MHUA 2XWEA 5DBTA 4Y6GA 4PTNA 4PODA 1SYTA 1W9VA 5K9XA 3WDRA 4M0XA 3K8MA 4E38A 2F6KA 3BV4A 4C1KA 1PKMA 1BSIA 4QCEA 4AIOA 3HFTA 2ALRA 3VNJA 5HUOA 1ZGDA 4H8NA 2WNZA 3WK2A 2DVTA 3HG2A 2IQDA 3PTKA 4U28A 4CU8A 1V0NA 5EY5A 4GQBA 1BQGA 4A8NA 1NDVA 3DKJA 4DQWA 4Q8QA 2PWEA 3WQFA 1ICQA 1HQTA 1BRLB 5H8UA 1JG9A 5C5YA 3GS6A 1AJZA 1S46A 2W62A 4BF5A 2P8BA 4GVFA 5XIAA 5EMMA 3VNDA 1YW1A 2PU0A 1EBGA 1PJ9A 3KBNA 2PCQA 1G4SA 1IZKA 1H09A 2V5KA 3D6NA 1VB9A 2VQTA 4AVOA 4LW7A 4QAIA 3DC8A 2V5JA 4DYJA 2R1LA 4GUHA 3LBOA 2V2HA 2NSOA 2E09A 2YDRA 3O0KA 2NUWA 1S3TC 5C2XA 3VNYA 3SO7A 2DUZA 2ZC8A 4JFVA 3KS6A 5EFDA 2POTA 4ZODA 1GYLA 3EEZA 2FGZA 1OFRA 4JYFA 1PIFA 4C6JA 4P7QA 2G0WA 3OB8A 4AZIA 2PRMA 4K8EA 4QAWA 4L4LA 3APTA 4DJFD 5AYZA 1NEYA 3UF9A 1AW5A 4R27A 3CQHA 2NQHA 2J7BA 4JN6A 1XUZA 3PTMA 2AGTA 3NURA 3QN3A 1EA0A 4IGMA 3B9EA 3ZJKA 2WVTA 4XO6A 3S1WA 3NR0A 3MZ2A 2W67A 1FWWA 4BA0A 1EEPA 3FJLA 1XYFA 3VK5A 2QCNA 1ADOA 1YNYA 2INFA 3FKKA 4GKLA 4H8VA 1SO6A 1E6RA 3BOLA 4B5WA 1Q7ZA 3TTSA 2RGMA 4R7OA 1F05A 3OG3A 2QCLA 3BUVA 3MCOA 4KMQA 2ZQ0A 4NHVA 5D9NA 1RAKA 1TWZA 1YIXA 5G2HA 3IVTA 1UKQA 4NU7A 2VI0A 4RXGA 5JMUA 2E6DA 1YEYA 1RVGA 2ZYFA 1W1PA 4C6KA 1EIXA 1VPYA 2P3EA 1B4KA 4Q4SA 4C6OA 3LLFA 1VBRA 2PMQA 4O54A 1JI1A 4BJHA 4GJIA 3W73A 1XRTA 4O52A 1RCXB 4DJDD 4UUIA 3B03A 2GOUA 1HJQA 3IEBA 2RHGA 4KRTA 4FIQA 4NAFA 1TUXA 1GVEA 3G24A 3SW6A 1F8IA 3BANA 3WLOA 2H3BA 3W7RA 1W9XA 4P7LA 1D2KA 4F0LA 3AHTA 2RUSA 2O56A 4Y9NA 1DJXA 2XFRA 1IXNA 1MEIA 4FR6A 1P7TB 1QNOA 1TB3A 1FHLA 2WSQA 4AEOA 4Q7NA 1WKDA 1DJZA 3DHUA 3GU1A 4M82A 3ZLFA 3MUCA 2YLAA 2QCMA 1K9DA 4K68A 2V6AA 4GK8A 1VR6A 3GE7A 4NNCA 5GJPA 5I79A 5A1AA 3CIWA 3OODA 1J5SA 3NPUA 3F4VA 4BI7A 1QNSA 3OO2A 2O9OA 3CUFA 4TX8A 1DJYA 3XINA 2EAWA 2E5CA 1ZSXA 5HQLA 1F5ZA 1OFEA 3G1DA 2P3ZA 4QP0A 1L9WA 2HNHA 1RZMA 1WAUA 4Q4QA 3NQFA 3W07A 4RZ6A 1DIOA 1TZZA 1MUMA 3RU8X 5FJTA 3DI0A 3UNDA 3KVLA 4GBUA 2INZA 2FZ8A 2VZVA 3HBLA 3E0LA 1R9YA 4XTIA 5A69A 3N2CA 3EWXA 3MY9A 1XBYA 3HPXA 2OWCA 4KKXA 3KZPA 5CG7A 3T7VA 4MUZA 4XZIA 3WQ5A 2DIKA 2FKPA 1KBIA 4TTUA 1BYAA 3HV8A 1TQXA 2B7NA 1NELA 2A7PA 2IPWA 3B0PA 1DIKA 1UKPA 3BVJA 1SO5A 3UU0A 3QBUA 1I0BA 2WVUA 1OSEA 1X7IA 3EX6A 1EX1A 5CZSA 3VFLA 1ADSA 3E2QA 3LGEA 2DY3A 4HK5A 4W7WA 1JNEA 1UB3A 3SIMA 1VQTA 3W24A 1AG1O 2D69A 3UQNA 1FY6A 3M9YA 3SB0A 3BOXA 3EWUA 4PH6A 2ZUWA 2PGWA 2QUUA 5HAOA 1L6GA 3KWXA 1JAKA 4F79A 1W6TA 1VPXA 1ZRQA 1HJVA 2Z27A 3TROA 4QG9A 2E7FA 4AH7A 3VIHA 1SU5A 2QMKA 2V63A 1YNPA 1NY1A 4F9DA 3IANA 4LF1A 3M44A 1H1NA 1W9DM 3TWBA 3LTSA 4MNKA 2C7FA 1FDJA 3SBFA 1X96A 2YDQA 1F07A 4TVCA 4AHQA 2QJJA 4HPXA 4R5EA 2Z29A 1KFLA 1EL3A 4QDMA 4WXZA 3VMNA 2I57A 1IEIA 1GGOA 2IPFA 4RV8A 3MPGA 4LNYA 5T26A 1KXTA 3PZ9A 3BAKA 2QEZA 2GDUA 3QEZA 3QM3A 2VRQA 3ZM8A 2DSWA 1K1DA 3M41A 4LAOA 4EE9A 2Y1HA 2PP0A 4IFOA 3UBPC 3UR8A 1UWIA 3AS3A 4MB5A 2BXYA 3G8EA 6REQA 1ZJBA 1VRXA 4PTXA 3MUXA 2YR1A 4KWVA 3LOTA 3GIPA 1QDSA 4HNNA 3QY6A 1V8EA 1DXIA 4J2PA 5LHEA 4I6VA 1S2AA 1A5MC 4NX5A 4CN1A 2ISFA 4GH3A 1UR9A 2A4AA 4DJED 3R8GA 3Q94A 3CK5A 5D2TA 3VE7A 1DL3A 2XVLA 4M6QA 2J75A 3CGTA 3KTCA 1ISXA 3PNUA 3VNIA 3Q4DA 1VJSA 2E6AA 3N12A 2PF8A 4IQDA 1RD5A 2W6RA 5FAJA 5FEWA 3N6HA 3W1XA 1XR2A 3N17A 5CGMA 3UPMA 3RJYA 1Q6FA 1TJPA 2FB3A 4E4FA 1N8IA 4KRUA 3I3EA 1EO5A 4RDWA 2HISA 3IGXA 3GSMA 3RPMA 1W1VA 1XIEA 3HO8A 1KCKA 3K8LA 3RU6A 3CQIA 4MHBA 2BV9A 4L9ZA 4QDWA 4ZB0A 4JIRA 4PMJA 2D3LA 3VUPA 3THDA 3TTOA 4LVDA 3WEOA 1FCVA 2BFGA 4I7WA 4B15A 1NH6A 2O0TA 5TIMA 4M19A 4RJEA 4B5XA 3B9AA 3N2BA 4UQCA 3SURA 5I02A 3DH7A 4RUBA 1Z42A 4WR3A 3QV9A 1C90A 2PTDA 1MNZA 2WANA 2AQWA 2FLIA 1H0IA 4Q8PA 2DH3A 4MDPA 1KQYA 2V82A 1FQ0A 1D8WA 4Q32A 3ARPA 5C9RA 1LJYA 4R7JA 3UZZA 1VP5A 3KAOA 2QV4A 3ITCA 2VCBA 3DHDA 4TO8A 2QT3A 3CAKA 4BF7A 2PC4A 8CGTA 1LQAA 1FWRA 2NQZA 2PUZA 1JRCA 1VH7A 2P8CA 4J9JA 3A22A 4PRTA 2CESA 3WF0A 1UBPC 1D3CA 2CHOA 5D38A 3ZZ1A 4GCAA 1RA5A 1RQBA 4DUXA 4QE4A 1YPFA 1O6IA 3HJZA 2J13A 2P0OA 4AD0A 1FH8A 2VO5A 3B40A 1OIFA 2AMGA 2Q3RA 1DIDA 1CCWB 2ZX7A 2CBIA 2XVPA 3ID7A 1JFXA 1XLGA 3UZJA 2ZZ4A 2V5BA 1DWGM 1ME7A 4A05A 5TQLA 3S42A 5EU9A 4B90A 1UA3A 2F84A 5BXSA 3NL2A 4MSSA 1E5NA 3BSGA 4HB7A 1M3UA 1RH9A 4DNHA 3O16A 3H54A 1JPIA 4UQ9A 1G6CA 4CVUA 2Q3OA 4RCXA 3KBVA 1NWSA 2MANA 4LS1A 4IIEA 1WDDA 1E5JA 3G1RA 1EWEA 5E0KA 3L0GA 1O12A 1XPGA 3L2LA 4L4PA 1TIMA 3UR7A 3GWQA 3EAUA 3WN6A 3AIBA 4YU1A 1HVQA 4B5TA 4GIEA 2AL2A 1HW6A 1OFQA 3G1VA 2O55A 3VCRA 4TU1A 1RJPA 5I3GA 3O05A 3WQDA 2J27A 2WC7A 3PJWA 4JKKA 1ZB5A 3WYZA 4K3ZA 3P3BA 1XP3A 1M04A 1XCXA 3W71A 1TV3A 3BAWA 5G4EA 1JDDA 1E55A 1RPXA 3R13A 1SW3A 3ZS4A 6TIMA 2OQHA 2QZRA 4C6DA 3NQDA 1XC6A 2AKZA 2DPEA 1US2A 2IMRA 4JDYA 1HKMA 3GXFA 3VGBA 1OIMA 1XIGA 3S5ZA 4ZEPA 4HKPA 3F2DA 1QVBA 2GQ8A 4AF0A 4MM1A 4DBDA 3NPWA 3VD3A 3W9ZA 2XSXA 3VCCA 2FMOA 4GABA 3H70A 1U5VA 4IQJA 4WLCA 3SN1A 3BW4A 1GKRA 5I3KA 3APYA 4PMVA 4EF9A 3P82A 4O1CA 4RZ5A 3N14A 3SCRA 1A5BA 3VABA 2G41A 1L2QA 4H7VA 2FFCA 2WPGA 2DJLA 1XG3A 4PMNA 1T41A 5GQBA 3WH5A 4GC4A 3ZSSA 3WFLA 1ENUA 4FLRA 4N42A 1UASA 3CWHA 4YXGA 1Q4NX 4K37A 4LPCA 2OZTA 1ZJAA 4WY0A 1UR1A 5CPTA 5BOOA 2V0TA 2C15A 3DC0A 3K46A 4QR6A 4D6GA 4NUWA 4C6BA 4UTJA 1BF6A 1DKWA 4NIRA 1DE6A 1V7AA 3N2MA 3GTHA 3VPLA 3LYEA 3RMEA 2HE8A 4W9TA 1QW9A 2CLHA 2D2OA 1TELA 2PEVA 3ALFA 4JTSA 4NT0A 4J3TA 2D0FA 2D2HA 2ZDSA 5A2AA 4US5A 3VU2A 5LGXA 1JYVA 1BPLB 3LCFA 1LOQA 3AS2A 4NRSA 3V0UA 3UT0A 2W92A 1RBAA 3PTDA 3L4ZA 5LGZA 3QOMA 1XYLA 1FH7A 3G8RA 3NZQA 1TREA 2OLSA 4IISA 1VIZA 3QGAC 3GRIA 1V0MA 1TVNA 1OFAA 4K7YA 5M1TA 1JL8A 3LHUA 5F2IA 4GVHA 3FYPA 4Z0JA 1MSSA 4HNUA 2QAPA 2NQLA 3NQBA 4L56A 5JH1A 4RPPA 5M3WA 3EA3A 1V3LA 3FVDA 3NM3A 4HN4A 4R53A 4D1IA 2ACQA 5C2GA 1EPXA 1TTIA 4H9YA 4D6EA 1FWDC 3BLIA 5K4XA 2UBPC 3HMCA 3QH2A 1BTMA 1E1EA 1O68A 2G97A 1QR7A 1PYFA 4DUVA 1ICSA 3ZMRA 3VA8A 2ONEA 3IJ7A 4AMAA 5CKSA 1GW1A 3TYBA 3NQMA 3MSRA 2RFGA 2BY1A 2OU4A 4GJJA 2ZUUA 2PS2A 3SCVA 1Z8AA 1LL6A 2PTZA 1JDEA 1GHSA 3B8SA 4X2RA 5M17A 3AYTA 4I9AA 1I2NA 4NYYA 3KZSA 4O8RA 4V33A 4ZO7A 4FALA 3TJXA 1H1YA 3KOYA 1A47A 3S6TA 2EJAA 2H3DA 1TYGA 1WXYA 2NXHA 5C9XA 4MMWA 4EF8A 4NZ5A 2ALDA 1XV8A 2E9BA 1KRBC 3VINA 2GJXB 3LCHA 3TN5A 4AEEA 3PBMA 3M07A 3G0SA 4XAYA 1RJRA 4PUUA 5FL0A 1UQZA 1BWLA 1SMAA 3O8AA 1B3YA 4J27A 4O1FA 5CC6A 2QJMA 1W1YA 3CV6A 3BMWA 2BP1A 2WLZA 2YCLB 4H6KA 3HQOA 1WXJA 3WLSA 2VEGA 3TJ4A 2FFIA 4UNKA 2VOTA 3T42A 3CPGA 1A5LC 1DVJA 4AZ6A 2D2GA 2YA2A 1ECQA 3KX6A 4O4WA 1JUEA 2WKGA 2ZUSA 3UW6A 4JY8A 2ZXBA 3EOLA 4PMZA 3E0FA 4DPPA 1NF0A 4CU7A 2X2YA 3KUMA 4DBSA 3BPWA 3LRLA 4AYSA 3N2TA 1ZS2A 2WYSA 3VKAA 5H1WA 4XB3A 3RX2A 4JDBA 2WB5A 3E6EA 1B9BA 1WZKA 4Z1AA 1MRAA 3WH9A 1QHPA 1SJDA 2WVVB 5HJLA 4ICCX 1J5TA 1XUUA 3QHMA 4GQRA 3U7BA 3LMYA 2G37A 2EHHA 4GOAA 3PPGA 2PWHA 2J77A 3O07A 1JGMA 3TOYA 2YA0A 3EWDA 4AD1A 3N15A 4MKSA 2C71A 3SGGA 1IWBA 3NGJA 1W1B1 1XYZA 5HMFA 2E77A 1UKOA 3C2FA 4EXQA 1B0IA 3M5VA 4U31A 1P0BA 4IMCA 3OLDA 4NJHA 2GYIA 5CPOA 2ZZ1A 4AMCA 3R8RA 1MO0A 1P1XA 3WCZA 4PTVA 4UXDA 3LK6A 3LPOA 3MMDA 3DN5A 1RP9A 1UWAA 4CKQA 1OYBA 3PANA 3P60A 4ORMA 4F0MA 3WG6A 4P7OA 3AZSA 2AQVA 4XBKA 4NZ1A 5LIUX 1H7NA 3R89A 3N18A 4HNCA 2VDGA 3F5KA 4QNWA 3KP1A 2J74A 2ZZ3A 3LTYA 5U7SA 2VR5A 3SM0A 3VD7A 4P8XA 1P5BA 1JDCA 4M24A 3TYCA 3G1FA 5D8ZA 4PYSA 4EKJA 3EX3A 4FSAA 3U0HA 3QOKA 1XIBA 4I3GA 2FJUB 3V16A 2OLAA 1EDQA 3BC9A 5I7GA 4MG4A 1L8PA 3CZGA 1E4LA 1ONRA 1NOUA 2J9ZA 4Q4MA 3IGSA 4LCSA 4Q8NA 1VFHA 3S1UA 1TX2A 5F7UA 2DFAA 3E2RA 4RNJA 4C60A 1UZHA 5I24A 4C90A 2Z6IA 2Z2BA 3PFMA 4MPQA 2HXUA 1ZBCA 3C2VA 1GVYA 1UD4A 4N4QA 3STPA 4A29A 1IXPA 2GJNA 4KEZA 3R8HA 1BVWA 3H4WA 1B1YA 3QYQA 1RUSA 4NILA 3FYYA 1GQKA 3S9ZA 3M7WA 4CCDA 4MJ2A 1KRCC 2G5WA 2Z26A 1E15A 3TMLA 2VDHA 3GD6A 4HD5A 3CUGA 1HJWA 1CXLA 4X2PA 3A4AA 3CPRA 5ABFB 3BL3A 4HA3A 1V6UA 2EPOA 3GFYA 1N2VA 4ZTYA 1NFBA 3V35A 1A0CA 3II1A 5CC3A 5HNNA 4E2OA 4GG9A 2FHFA 4AZ7A 3H4XA 2FHBA 1XLBA 1G4TA 3WMLA 4JTTA 4GI9A 4M1BA 2HCVA 2VUNA 3KRBA 4V28A 1CWYA 3BLDA 4MPKA 2FPTA 3RMJA 4C6FA 3CXOA 3QMTA 2EPMX 4ZFCA 1QNQA 3MBFA 1TV8A 2I5QA 4PMXA 4ZB2A 1VS1A 4GIYA 1JDFA 4HTBA 1MW1A 2C91A 1AJ0A 4MLJA 5CGQA 3FSUA 4UTMA 1MQPA 1M7JA 3M0ZA 1GWJA 1EJUC 4S3FA 3B0YA 2WZEA 1OCBA 3WLQA 1ZUAX 3N34A 4FK9A 5C55A 4ZQNA 4LB3A 2E1WA 4J2MA 1CDGA 1LG2A 1GOOA 3N3MA 4TVUA 2Y62A 1YPXA 2FDMA 3AAMA 1YDYA 3W2UA 4B2DA 3E1F1 4MWAB 3W1PA 1OINA 3GY1A 1F9CA 4QJ3B 1W8GA 4LUTB 4AWTA 1TV2A 4B91A 5DQPA 4EWJA 4K6AA 1I75A 1A50A 3KOXA 2P53A 3QZAA 4W8LA 3S0CA 2VX5A 3HG5A 4H7ZA 1TZ9A 2PDWA 4GVGA 2YDAA 4MF4A 3S2LA 1W31A 3LU2A 1UJPA 3IACA 2YKKA 3RRAA 1SMDA 3LXBA 4ZENA 3ALGA 4O1BA 3QQ0A 2YBUA 3WUGA 3NEVA 3EXTA 1J12A 1HGWA 3LLDA 3CUJA 3G1YA 4PMYA 3HGOA 3EDDA 3WBXA 1DPMA 1GVOA 3F4DA 1EZ2A 1K8CA 3SADA 1KFJA 4M6UA 4WY0F 4GIAA 1D8CA 5ECVA 1I60A 3P7YA 1IEXA 4AC7C 3R94A 5C6MA 5HUPA 5BOEA 4YCPA 3B8WA 1IXOA 4UOJA 2CHRA 3M0XA 3D3FA 3UPWA 3B9NA 3N3TA 9XIAA 2HWGA 3L7RA 1R6WA 4E4PA 3DKLA 4OOZA 3ANVA 3LZ3A 2YCIX 2EBNA 4JIHA 4GYJA 4D72A 3GZ3A 5CAHA 1BLIA 1TRDA 1GOWA 2TRSA 3O0FA 1G7UA 5A2BA 1RPKA 1CXFA 2YL9A 2JALA 3KVJA 4Z2KA 4JFWA 3CIVA 5IBXA 2REQB 3IAQA 2VR4A 3RN6A 3WUEA 3B3DA 2EPNA 1KXVA 2QAFA 3BK0A 4WK9A 3ITYA 4GC3A 4WDTA 1OFPA 4N6FA 3ARSA 2BMBA 4HYRA 4WF7A 3LGGA 1OD0A 2ASHA 2O9RA 2JGYA 3RHGA 1W9BM 2A21A 2OQLA 3MKKA 4AY8A 1QFEA 1TVPA 4KCVA 3QY8A 1LT7A 2PDKA 3UG3A 3GXDA 4GKTA 2GGHA 1OQFA 4GQGA 2TYSA 4RL3A 4LX4A 4RW3A 4MB4A 1F4HA 1LG1A 1AD1A 2GJXA 4RNHA 1FKWA 4GGHA 3PBYA 5H6HA 3TA6A 4F2BA 2WW5A 4O0QA 4A3RA 8XIAA 1XQKA 4AFYA 2GK1B 4LT9A 3P5YA 3RR4A 1H4PA 1A5CA 3NCOA 2F38A 3E38A 1WNOA 2YCLA 4AVFA 4LEQA 3WO8A 4C6QA 1UIOA 4LSBA 3CV1A 4YLWA 3B0UX 5BRPA 3ARYA 4QBXA 3IAPA 3O63A 3DAQA 4Y9OA 1H61A 2A7NA 2X1UA 2YLLA 1V3HA 3K13A 1WXZA 4JIIX 4IP4A 3WDHA 4L6HA 3H26A 2DZWA 2VGFA 4GMEA 3M0VA 3RPDA 3B9DA 1QATA 4Y7EA 4UTLA 1IIHA 1E0VA 1LRTA 3ELFA 4W84A 4O1EA 1E0WA 3BQ6A 3ZJ6A 3CTTA 4UR9A 5D05A 2HMCA 1KM3A 3VOCA 3W81A 1CGUA 3L66A 1O95A 1A5SA 3AYRA 1IEVA 4US5D 4UMBA 1K6AA 5D4YA 1JD9A 1VF8A 4XZMX 1H1ZA 3CO4A 3L23A 2VT0A 2X42A 5EPDA 3GDBA 1NDWA 4OBTA 1V6YA 1OABA 1XH0A 2HRWA 3K4AA 4S3DA 2PDHA 2WPBA 4UTIA 2ACRA 4FXFA 1TTPA 4JQ3A 2DV0A 1QO5A 1S38A 4H1ZA 3L5MA 3HGSA 1VRDA 2PZ0A 1LP6A 2D73A 4UTWC 1WUFA 3RDKA 4ECLA 5HWNA 1K9EA 3QHNA 1S5NA 1XH2A 3E0VA 1FWEC 3UXKA 2WZHA 3GTXA 4DX3A 1CENA 3I7RA 1OT1A 3KCJA 5CSSA 2WZTA 1JF5A 1Q66A 4J28A 4DO4A 1S5VA 1W5OA 1KCZA 3JVAA 4I8YA 2FTPA 4AX6A 5HJXA 2VRKA 2I5IA 3MP4A 2G8ZA 2ISWA 3PTQA 4LV9A 4QLJA 3DG7A 1J11A 1IF2A 1Z48A 2R1MA 4LQ1A 3OZOA 1GPFA 3AISA 4HYWA 5FOOA 5FF4A 1R7AA 3H2MA 4X60A 1PDZA 1OX6A 4TX9A 3ZR4A 2DSUA 5HXMA 3KEHA 1VCGA 4Q7IA 3W01A 3IIXA 5LXEA 2DGAA 3HG4A 1BYCA 1PTDA 3M4HA 3UXDA 4JHZA 3FFSA 3ES7A 3I4KA 3WMSA 1O66A 2JGQA 3BG9A 2H8XA 3EXSA 1W37A 3N04A 4JTDA 2FTWA 2PDLA 2VEKA 1JCNA 4L80A 1TE1A 4LCRA 4KIEA 4Q3MA 3KHDA 3TFCA 3CHFA 2V81A 4Z2JA 2OQYA 1POKA 5BXPA 2PURA 2R14A 2WJZA 3O6YX 8RUCA 1EJXC 1O1HA 3WQ6A 3G6LA 3N6QA 3OTRA 4XVDA 3NOEA 3KFTA 3SI9A 4C5YA 3PJTA 5FJRA 5CBJA 3G0UA 5ABTA 2WMJA 2P1FA 3AWNA 4Z1CA 3VVGA 3WLKX 1KXHA 1GZGA 3KTXA 5HATA 1RXOB 1E4MM 3QGVA 4Q4KA 3MMTA 2CLOA 1T6MA 4UQDA 2YL8A 1JCTA 3T8LA 3IK4A 2DSVA 3L0KA 5D9MA 4XQ6A 4E2DA 5DY3A 4JEJA 1VEOA 3B97A 1KLYA 1XH1A 1US3A 3W7CA 3NG3A 1Q45A 4YTQA 1OX4B 3GVVA 4EXBA 3AIQA 4O16A 3U8GA 1E6NA 1QASA 3N2OA 3CEUA 4DB7A 4IIHA 3NTYA 4AZ5A 5C54A 4DYEA 3W88A 2DIEA 2CLLA 3KBSA 1WB0A 1D9EA 3MA8A 3RIKA 4I90A 4BHYA 2GGIA 3VD4A 1IT0A 4MKNA 4IG2B 3KM8A 1K8XA 5FEPA 1A3HA 3MKCA 3B0VC 4X0NA 1QOQA 5L6UA 2Y8UA 1MDRA 3EOSA 3F4NA 5IDZA 1BYBA 2UY5A 3H8AA 2ZXQA 1LM1A 2VMFA 1BHGA 3WD2A 3VO0A 4G6CA 3NVDA 2VD9A 4MNMA 4LTSA 4XBJA 1AQFA 3HPZA 3OZMA 7REQB 1MWOA 2GL5A 3QRHA 3VOJA 1XIDA 4WEVX 4FNQA 2GPTA 5A6BA 5KMYA 3GC4A 1GKQA 1IIGA 1BSLA 4PCSA 3W53A 4ADTA 3W6LA 3L4WA 4DXVA 4IPNB 4PE8A 1W5MA 1E9YB 1LF1A 2RAGA 3TLQA 5LNWA 3KVKA 3USBA 2ZZ7A 4OGZA 1MW2A 3A3HA 4M3PA 4Z08A 5FACA 1H3GA 2R94A 1UPMB 2ICSA 1LWJA 4AG0A 3BICA 3C5QA 3MANA 5HA7A 5DXYA 1NDZA 3VD5A 3C56A 1J0ZA 1HKVA 1NQ6A 4WGXA 3SUVA 4A35A 3MW7A 1T7LA 2ZE3A 1OGGA 4DZ5A 4OUIA 3TCSA 1DQWA 4F0KA 3A3WA 3UWVA 2A1YA 4O0ZA 4HU4A 1CT5A 4V15A 1L6WA 3EWBX 4HCHA 1C8YA 4NJJA 1UD3A 3VZXA 3ONBA 4XZHA 4AZBA 1UD8A 4MVAA 2FHCA 3QW4B 3O6CA 4L65A 4A3YA 4D6HA 2HK1A 3CPUA 2QYGA 2PDUA 4H01A 1GHRA 1SM9A 4QE5A 3VNKA 3W6YA 1EP2A 4JNMA 2V3EA 3CUXA 1K8YA 3UESA 3KCLA 3RLUA 1JZ6A 3A5FA 1FVPA 1JJKA 3MTWA 3W29A 3FDGA 5GNZA 5A6KA 4IIGA 3W76A 1SJAA 4M1RA 3UWYA 1EC9A 4M56A 2GVLA 4JIQA 4XVEA 5GNXA 4FZIA 2A85A 4UQAA 1VKFA 3W2MA 1KBKA 1KRAC 3GC2A 3RM9A 1E1CA 2XN1A 2QULA 5SWUA 5M03A 2WHLA 3E5PA 3OVRA 3T0BA 3TN3A 3PAJA 4DUWA 2BHZA 5K4ZA 3OZYA 1LWIA 1VJIA 4P8VA 4GY1A 1GG0A 4IUOA 1ITQA 2F6UA 2JEQA 2WWCA 2PAJA 3PWAA 4XK2A 1EJVC 2WM0A 4TMBA 2WSYA 2PFHA 4WCJA 1HT6A 1DXFA 1V51A 3RG6A 3E2SA 3LRMA 4GQ0A 5D02A 1P0EA 2PC8A 3NPVA 4O11A 3WH7A 4YNGA 3FY1A 3W37A 4UR7A 3WLJA 4JY9A 5CPLA 2DSZA 5C0QA 2VEMA 1XLCA 1K7EA 4HMCA 4WDXA 3WIJA 1GVFA 2Q71A 3SFKA 4YVVA 3AHZA 3VIKA 1MZHA 5GVJA 3E49A 3FJ4A 1U5JA 1F6KA 1H2JA 3PBVA 4Y2WA 1TR1A 1DWIM 2WWDA 2C19A 1GOKA 3LB0A 4PB3A 5EMJA 5A8MA 4ILSA 1CXIA 1XLEA 5FF2A 4GYPC 4N9BA 1NQKA 1S3HA 3O06A 4MOZA 1LBFA 1TV5A 4C1NA 1HVXA 1LT8A 2VDIA 4GX8A 4JGDA 4WDWA 1QTWA 1X8FA 3KRUA 1Q6OA 1AW2A 5HNTA 4I9JA 2E5BA 1EDGA 2W5FA 5G4WA 5JUVA 5JBDA 4RXFA 1UUOA 1FWCC 4LUSB 1DOSA 2WC4A 2JEPA 3DGBA 3FNDA 5HDRA 1MXSA 3INPA 5DO8A 4UBPC 3S6OA 4JTKA 1VFFA 1JVNA 4L6OA 1G01A 2VGBA 3KRSA 1I8JA 4WJEA 3GDKA 4ERGA 2PDCA 3CAWA 3KW3A 2ZZ6A 4IF2A 2ZZ2A 1EQCA 3DFOA 4GXPA 3ARVA 2ZX5A 3AOFA 2XIMA 3TXZA 2IXUA 2GVEA 3BH4A 4Z1YA 3U2ZA 1K6WA 4D6DA 2GVGA 2C6QA 2SFPA 2YW4A 4UTTA 2A0NA 1F76A 1RY0A 2WMHA 1PZ2A 1DHKA 2BG5A 3ZLHA 1LOSA 1NJJA 4GLEA 2NWRA 3QLDA 1XRVA 3PPFA 1KLZA 4K8HA 4KQNA 1YDVA 9RUBA 1SFJA 2XM1A 3L12A 3VTRA 3H55A 2Z1BA 1XBXA 2QGHA 3OLEA 1BGGA 1YE6A 1CLVA 3NQEA 4RV3A 3FHAA 1LLZA 2Q01A 1UKTA 3TX9A 4TX6A 4X3ZA 1NWTA 4JX5A 2CLPA 5HQMA 2YCEA 1HP4A 5CQ1A 3L68A 3OQ8A 3VGHA 3DFTA 1DQXA 2Z7GA 3ZVHA 8XIMA 3TQVA 5L9FA 3PUOA 4S3JA 4H6RA 1E9ZB 3OOQA 2VX4A 2WLYA 1UD5A 1KM4A 4DWSB 4JTJA 2YYTA 2HE5A 3M43A 4BQ2A 1PB0A 2YZRA 3VOIA 1CZ1A 2OGJA 1RD6A 2ZC1A 4XKYB 5AY7A 1YTKA 5EB8A 1A5UA 4S3BA 4RR4A 1ONEA 1G1YA 4HHHA 3WK3A 1EGVA 4ONVA 2BOGX 1V6VA 4XD5A 3CAQA 1PCWA 3CYJA 1R3YA 1FFRA 2CETA 1FWNA 3QPEA 4XZ9A 3GNPA 3BSHA 4U10A 4KEMA 1LROA 1ZP3A 4C7FA 4CQ8A 1E6SM 3R1ZA 1REQB 5FJOA 1VFOA 4DNMA 4QTGA 4ZOEA 1W1TA 5CPNA 1IQ8A 1PX8A 1PBGA 5FAGA 4B5NA 4A3QA 3NFUA 1I2PA 2OSYA 4LWWA 2X0SA 1KTNA 1XLJA 2QUNA 4HMEA 2XU2A 4OE7A 4KGJA 1DWJM 4QDPA 1RQEA 1E9LA 3NUKA 4DJEC 1E56A 3B9OA 1TA3A 2YXXA 4CN6A 3QKEA 4ATWA 1G69A 3QC0A 1NOWA 4HCDA 2PWGA 2OTDA 3OA5A 2IKGA 4G1NA 1SR0A 1PCKA 4Y8EA 1DJNA 1E4NA 5A8OA 3QPYA 3IJIA 4AHPA 1Q8AA 4J1OA 4UTHA 5KZ6A 3W3OA 1CLKA 3PZVA 2WM1A 3A4XA 2NV9A 4GO9A 1TWSA 2WKJA 1TJ1A 1VFUA 1QI5A 2E68A 1MUWA 2YBTA 3I68A 2Z4GA 1Q65A 3EB4A 4CLMA 1TMQA 1BF2A 1H62A 1UWRA 2PLMA 2QJIA 2DJXA 1B30A 4P7NA 3AIRA 1E6XM 1W3LA 1XC4A 3MI3A 4PMOA 2CLMA 2FPVA 3W7DA 1JCXA 4DVOA 2O4QA 1VJZA 2E9LA 4O13A