2NQPA

Crystal structure of pseudoudirinde synthase trua in complex with leucyl trna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transfer RNA
publication title How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Isomerase/rna
total genus 80
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.4.99.12: tRNA pseudouridine(38-40) synthase.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01416 PseudoU_synth_1 tRNA pseudouridine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA01
3.30.70.660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA02
1DJ0A 4NZ6A 4NZ7A 2OMLA 2NR0A 1VIOA 4IQMA 2NQPA 2NREA 2GMLA 1VS3A 4J37A 4ITSA 2OLWA
chains in the Genus database with same CATH superfamily
3G8SA 1N52B 2OSQA 4WP8A 1NHUA 2XGPA 2KJWA 1W25A 3OR1B 2IIHA 3SSSA 4BHQA 3M2VB 4KGXB 3RTVA 4W92B 3QRPA 3HFVA 4LIRA 2Z56B 2VBYA 1RHQB 4P7TA 5K8NA 1Q8IA 4CM2A 2OMLA 4O3PA 1CJKA 3OVSA 5KG6A 3R2DJ 2OKQA 2M0GB 3UN5A 3FFIA 1JJCB 4CTAA 3WX8A 3B54A 4ZLLA 1X7VA 1RACB 2ZC3A 2OJ3A 3G71S 1ZBTA 2KU7A 3C19A 1KLMA 2OPSA 3S1TA 4DF4A 1I5OB 3I4PA 3H5SA 2HMIB 4LF6J 4HH0A 4OIXA 2ZOGA 2ZM6J 2DIUA 2GX8A 2RDIA 4I7FA 2V67A 3FCWA 4WJBA 2HRTA 3KDNA 4X64F 1N5TA 1RUSA 1PAUB 3TAMA 3HKWA 3IGVA 3THPA 5B7WA 1FVQA 2R7SA 2R8JA 3QO9B 9RUBA 2XHCA 1PILA 3H20A 4UY8T 4A8XA 3GIJA 2DBBA 1NNDA 3ZZOA 5ETRA 1XNRJ 3PJ9A 5IXUA 1JXVA 4TKTA 3DM2B 5J2QB 4RW9B 3CC7S 2R7XA 1PIEA 4U8VA 1MN9A 3PFEA 5B0CA 2GHVC 1F2HA 1NK8A 2IAJA 4DPUA 1S9EB 2N4CA 2ZM6F 2MZSA 1NK0A 4QZVB 3PKMA 4AQYF 3NCQA 2JWNA 5B0FA 1PC5A 2YPYA 1WG1A 2K7JA 1YGYA 1I94J 2F65A 3V2UC 4DL6A 5AE2A 1RKJA 4RBUA 3N6MA 4OHYA 4H4MA 2ZDOA 3FZBA 5F0UA 3MMCB 2VG7A 4UOCA 2WVBA 1RAGB 3BGFA 2N7CA 2J0XA 3DLHA 1QDUB 2DVIA 2JC0A 3JYTA 1YHQS 1RHKB 2RT3A 4CLTA 2UUAF 1HD0A 4DN9A 1N8RT 2R7RA 2Q3PA 4WZMA 3KJNB 1WHYA 4LIWA 5L46A 4ZPDA 2M4MA 2J0WA 3KLHA 4CT8A 4HYKA 1B0VA 5H9FK 1FWPA 4NCBA 3P6YC 5LL6d 1SQGA 3M32B 4IG0B 3GG0A 1HWLA 3P96A 4F67A 2L48A 4DFJA 2HYIB 2MDAA 1XNQJ 1RU2A 4KGZB 3PYEA 2BR0A 4HKQA 3NCRA 2V69A 4DX8H 3DU6A 1T3OA 4RNNA 2Z58B 1AXQA 2P9CA 5D8HB 4OQJA 1FXDA 4M5HA 3A8EA 3J7Z5 4PYAA 1RWVB 2WOMA 3TRGA 1Y3JA 2AQ4A 4OFZA 1NK6A 1JLGB 1RE1B 1DLOA 3RAXA 1WEXA 4KO0A 1TZ0A 4RBTA 1VIXA 1U2RA 2V8HA 4NXMJ 1IR0A 2MHEA 5D0GA 4RNFA 3M1VA 2CRLA 3D5MA 5HP1B 1MMDA 2UXBJ 2C2MB 2QFJA 4NE9C 1TL4A 4M63A 1C1CA 4MIBA 2Q6CA 3AQPA 1S9GA 2MHNA 1KFSA 2LYVA 1PKUA 1VJQA 3OLBA 4R0JA 4GRSA 2D1CA 3IR5B 4O3RA 3R5AA 4DSJA 1UPPA 3KUHA 3ZFVA 2NUHA 1UFWA 2KRBA 3FMWA 3DKDA 3CD5A 4MFBA 1RGVA 4WCEQ 1WEZA 1AUDA 3O6QA 1RWPB 3ZTRA 1PYTA 4JI8F 4X4RA 2IMWP 3SFGA 4K2XA 2K3IA 3MCNA 1RK8A 4AT1B 2N82B 3C16B 3CDEA 4Q0BB 3LP1A 4UOGA 2KT5A 4DR4F 2BDPA 1IQTA 1K8AT 3G86A 1M1KT 2K1RA 3H2UB 2FC9A 2IBOA 2D3ZA 4DV5F 3KHHA 3ZTPA 4M95A 3M2UA 1VQMS 4ED6A 2QLXA 1LXJA 4FF1A 4TU9A 2YNIB 3WQPA 3MMJA 2ZFHA 5J2MA 2HFOA 3D7SB 2A10A 3AB4B 3MR7A 4OL8A 2PMZD 4OX6A 2PMHA 3HK2A 2OI2A 4LF4J 2B4UA 2XO7A 4G3IA 1S5ZA 4DL5A 5F8JA 1MROB 1MWYA 1PBUA 3RB4A 4ED5A 1D9FA 3T1HF 3TZXA 5F3TA 1DHMA 2VG6B 1MWZA 4MK8A 1WD6A 2PIIA 5IWAF 5SZTA 3OTBA 2HNDB 3CT9A 4M1KA 1I6JA 4NYZA 2VIHA 2EXUA 2KFNA 4C11A 1SUQA 3QJJA 4PRFA 1NMEB 2DJWA 4U9RA 1T0TV 1UPMB 5JVHQ 3FJ2A 2JOQA 4CQ1A 5HVHA 2BJEA 2ERRA 5D3GB 4OV1A 1UW4A 2GQQA 5EX0A 1VQ4S 1RT1B 5DG9A 1S77D 1VBYA 4ECYA 2LXFA 2L08A 1HL6A 4NLPA 1YJWS 3NNCA 1H2UX 3GFHA 3R5CA 4F8RA 4MJKA 2AGQA 2QL5B 1GK8A 1KQKA 1SB6A 1NJZA 5C25A 5JVGQ 2WVFA 1GMUA 4USWA 3MEGA 4P9SA 3SYZA 3HI9A 2MTLA 2VDIA 2FHOB 3FGVA 3G9CA 3ETMA 2V4QA 3I87A 4DV7F 3SQGB 4DSFA 3WC0A 1FFSB 1X0PA 1O6XA 4WE1A 4HT7A 4F0MA 1KVJA 2VPYB 4ZK7M 4L3NA 1VQ7S 2PFDA 1BHNA 3WZ0A 3K7RA 3HVTA 4PQUA 3CPWR 4AL7A 1JB0C 3NS7B 3IM9A 2V8PA 1U1NA 3MD3A 3P49B 5KFPA 1CVJA 1VQYA 4HHUA 4G1PA 3VHQA 1SJQA 1M1GA 1SVDA 2DCLA 1AA1B 2G2YA 2YY3A 3OR2B 2FJDB 3WDOA 4F0HA 1WHVA 2YX1A 4ID5B 3DRPA 4PWDA 4UQGA 3M8QA 3D6FB 4AXIA 1T11A 2VKZG 2XY7A 2XEXA 4XDCA 4LSLA 3M9OB 2FJEB 4RU2A 3QJLA 4BC9A 1Y7PA 3T9ZA 1X31C 3D67A 2GAHC 4LF5J 1ZM3A 1UVIA 5DO2A 3DRRA 1JLCA 1Y5LB 3GB0A 1HMVA 2WB4A 4K50A 4OLOA 5DG8A 2V50A 1S6QA 2I9SA 2H54B 4OI2A 4A48A 3RBZA 1JK9B 1NPPA 2ZH8A 4X4NA 1REVA 3W8PA 3W7BA 1YJVA 2DHGA 3RW7A 3Q8QB 1R43A 1CPZA 3GV8B 2L9DA 2UZAA 1R7IA 3W8GA 1TFYA 1DTTA 2N4DA 5J2NB 4F2RA 4A47A 3MMAB 3CE8A 2F8HA 3LQVA 4RJVA 1B4SA 4ZVOB 2PI5A 3BGUA 3EMTA 1B0TA 2V68A 2ZBRA 3I0RA 4CZCA 4NA1A 4USJC 1N4LA 1IKXA 4NZ0A 4LF5F 3Q22A 5HJXA 2H5JB 5AE1A 3TJ9A 2WHOA 1KVIA 1OWXA 4L74A 1FE4A 3PRBA 1VQ8S 2VA2A 2KTQA 5CYMB 2VOOA 1VK3A 1PYSB 1U2FA 5D0HA 3NOCA 1WNEA 4IYQA 5JJBA 3DN9A 2QIFA 3DLGA 4LREA 1WF2A 3QAEA 2VG5B 2LQ5A 1MG7A 3LANA 2CFXA 2KXHA 4PUOA 3BBFA 3GYGA 2H48B 1U8SA 4LBHA 3W2WB 2ILYA 2N7YA 4FP9A 3FMBA 5KFJA 3WC2A 3ULHA 2HNYA 2FVSA 4LT6A 2R7TA 2CPIA 1YJUA 2M70A 2JSXA 1HWUA 1XIQA 3EX7B 3FBFA 2R8IA 1GX6A 2XMWA 4U7UD 3CD0A 4MKVA 4PG6A 3C15B 5D0EA 4JI5J 2W4PA 2W7AA 4JUZA 4P10A 4DSIA 2H5EA 2AX1A 3DLLQ 5FIIA 4DR2F 1CULB 4H4OB 2FUG9 3D28A 2MGZA 1NB7A 4USTA 2XSJA 4XDDA 4DV2J 2P5VA 1YZ6A 4HR2A 2MMYA 2XLJA 3MPWA 3D9BA 1YG0A 2DR8A 2JEGA 1NK9A 4OZ2A 3RW6A 4MT1A 2CZVC 3HT0A 1GXTA 2MLZA 4ELVA 2OEMA 2Q1LA 2ZH9A 4V19J 5F8HA 1MLAA 2XWYA 2LKZA 4LF8J 4ZVSB 3VAGA 4Y00A 4NYPA 4M5DB 3SQOP 4IDKA 2C28A 2ZZMA 5KFFA 4ED0A 1BWEA 3CCZA 2CKWA 2DB1A 1X5TA 2AYGA 3C3LA 2ZD1A 3RR7A 4DV3J 2YXLA 5L1JA 2BANA 5GADI 3WIVA 3M2RB 3BBCA 5KFSA 3BH7B 3EVMA 2HNZA 1TK0A 3DLBA 1ZM4A 3BZQA 1KLNA 3HSGA 1VRTB 1RT5A 1S9FA 1FDNA 4PWUA 4NLXA 2YNHA 4GVBB 1HQUB 4RW4B 2JEJA 2J6SA 2C1EB 3LALA 5CYJA 2BE7D 1B0PA 2DY1A 4DQQA 1QSSA 3N01A 2AMCB 4R25A 2QC3A 1N34J 1NSKL 3GONA 3DYAA 5HN0A 4YMEA 5KT4A 3SCLE 4ECXA 3EGWB 3OT9A 4LQ9A 5IM0A 1RTHB 4CYUB 3OTEA 1F5BA 3ZZPA 2OH2A 1U6FA 3KMSA 2E44A 4ZIVA 3PX6A 1J5EJ 3LWLA 4DV3F 2CJXB 4B3TJ 1HBMB 1TL3B 2Z8QA 2QA2A 2WZ1A 4F3MA 5T7LA 4Y2CA 1YIJS 4GO5X 4C3KA 5A8KB 1TFWA 3DLEA 4ALZA 3LP0B 3X3UA 1S0OA 2XYGB 5FDLA 2W8LA 3IWLA 2R7QA 3AJ2A 3VCDA 3V4IA 3EGVA 4UOHA 4C7QA 5H9FJ 3N9UC 1HA1A 3UD3P 2D3OR 4ECVA 1PJ6A 1C4CA 3LW5C 3VAHA 1VK8A 1F60B 4MK9A 4RPFA 3UI3A 5AE3A 3KHRA 2HRYA 4IFYA 3GV7B 3RG6A 2UXCJ 4HACA 1U8WA 2YWHA 4HH1A 2OPQA 5HO4A 1H0HB 1R8BA 4DUZJ 3L7PA 3BO3A 2MSSA 2RJZA 4Q2MA 1J5EF 1MU2B 3TYTA 3AT1B 1HQEB 1R89A 4WTYA 3GTYX 4A8KA 3IRXA 4IQMA 3Q8RB 4LRDA 1FESA 3RRKA 3FQKA 1N36J 4DV6J 5D4PA 2MSTA 3BGRB 1HBUB 3OFEA 2OPSB 4GC6A 1FT8A 4OYZA 1SXLA 2B5JA 2VU5A 4ZMMA 1RT6B 3PW2A 2XHWA 3BKUA 1NKBA 1IBCB 3N79A 4ID8A 4RW6B 4OHWA 2EFVA 2GIQA 2HHWA 1LWFA 3BYRA 4Y0FA 2CQ2A 2MB0B 1B99A 3I32A 2J0SD 3CDAA 1S1WB 2UXCF 3QRRA 4ES3A 3HD1A 3CCQS 1S79A 4WIIA 1XC9A 3W5ZA 1AZSA 5G0RB 4KKOA 1JLAB 4HL9A 1N5YA 2F40A 3NEKA 1T94A 1OPZA 3M6UA 4HEA9 2Y8YA 2ZNYA 2DK2A 1X4HA 4JI2J 2QMWA 1NM2A 1U48A 4O3NA 1YQHA 5KFDA 1OYEA 1KQFB 1L3TA 2CVEA 2RE1A 3CW2C 1N5QA 4I56A 3HHEA 1FEEA 3KLFB 1FFGB 2XS7A 3TUJC 3OXLA 5AJ3F 2BW7A 2EPIA 2B0GA 3CIMA 2HHSA 3KOAA 3BSAA 1VCTA 4OX7A 1JQGA 3O44A 3HKZD 1TKDA 4RW8B 1NHVA 1XR5A 2KM8B 3T41A 1AYEA 5CAAA 5KFQA 3O8WA 3OQ2A 1YJTA 3K17A 1H7XA 3CNQP 1E6YA 2HPUA 3MWBA 5DM7Q 1OPIA 1XBWA 1HFEL 1Q78A 4H4MB 3H4DA 4CLLA 3ICLA 4Z7YA 2RUSA 1DTQA 4ECRA 1B70B 3V6JA 4X66J 1WC1A 1M1HA 4WFNQ 3CD6S 3RRGA 4NPOA 3CDBA 2DT9A 3QAUA 4DFKA 3A3OB 2FY1A 1JLBB 3FNNA 1VQNS 4J7CA 4QU6A 3MM5B 2ZEJA 2XYHB 3HZEA 3OXFA 3SCIE 2G13A 3UW1A 2UUCF 1RCXB 3KLHB 5EWFA 4K5RA 3VZHA 4DPYA 4HDHA 3HJVA 1FD8A 1UVNA 2VUGA 4JI1J 3GV5B 1KR4A 3QGHA 4ZPWR 3TW0A 4O3SA 4IUFA 2J0QD 5I4MA 1J5OA 4Z2XA 5IS2A 3GZ7A 3HSDA 1JLQA 4TN2A 1F3VA 3HDSA 2HFZA 1L3SA 2W4CA 3KWMA 2AEMA 2DPJA 1PCAA 2A6OA 3IM8A 3L7UA 2V8DA 5A76A 5L9XA 3JQJA 5A2QY 2WAQD 3TEGA 3SCKE 4ZHRA 3SDEB 2DH7A 1HW8A 2LU2A 3KNGA 3UFCX 4C6AA 5ETKA 4B9UA 3ZZUA 2ZWPA 2FJXA 2FC8A 2AGPA 1Y0HA 4PEOA 3AD7C 2PEBA 2M3DA 2OSRA 1J27A 3KJVB 1R8PA 5L9NA 4I68A 5K14A 1OY8A 2OFHX 5LSOA 4F0KA 1JNZB 2EK6A 2DY9A 2GVZA 1QAYA 2HZVA 3UR3C 3GIKA 4N8OA 4DS4A 3SCJE 1NBEB 4I67A 4NXNF 2F4FA 5EDWA 1FE0A 4LRAA 3K8VA 3HMJG 3KXDA 3DFEA 1S76D 3KLVA 5A2QU 3LAMA 1RTJB 2HBQB 2K8GA 3GR1A 1U6ZA 3OFFA 4PWWA 4IRKA 2B6AB 2KRRA 4LFBF 3I0SA 3TA0A 3UVJB 1RU1A 4DR5F 1HI8A 2CWKA 4OI4A 3C46A 2E5GA 3PG9A 2IJFA 4NCGA 2ZH6A 2OD4A 1VRUA 3GCXP 1S0VA 2XSFA 3LP1B 3NXZA 1WORA 3JSBA 3C14B 3TUPA 2GZOA 2LQBA 1RHRB 4CLYA 3HHKA 2MKHA 4O44A 4DV0J 2CJYB 3M2UB 1IBLJ 2ASJA 5FLXU 2YH0A 1C2PA 5DDOC 2FTRA 2BVZA 1VIOA 2EKNA 1HHSA 2AW0A 3E01B 3H40A 3HHLB 3OR1A 3TI0A 1TUWA 1Q7LB 1QVGR 1QJHA 2RHSB 4FNHA 1WC5A 2YPZA 2Y1RI 4WPAA 3TX0A 3ITHB 5ADZA 1VQ6S 3CJ3A 4HT5A 2MLYA 3IS9B 3DDIA 2C2EA 3G6ES 4DCPB 4FYXB 2E1RA 1CG2A 1HNXF 2HMIA 1KEKA 1PJ5A 1HNWJ 3SV3A 2ALZA 4NLDA 3CO9A 4D3GA 4OI6A 3T5KA 2QG9B 1D0EA 1R8CA 3RGIA 2BEFA 1YRUA 1UWBB 3R5JB 5HBMB 1RAAB 1RLDA 2HHQA 1SJRA 4TYAA 3H7HB 1NZ8A 5L38A 3NMAA 3MCMA 2Q66A 2G1HA 3PDNA 5LMNJ 4Y6IA 5MAOA 3OSNA 4Q44A 3QO9A 1S1XB 3C2PA 2IPOB 3TX8A 1SKSA 1IBKF 4KBIA 1X4CA 5IOLA 3R9LA 1NHKL 4A8YA 2VV5A 3DM2A 5J2QA 4CLUA 4RW9A 2BBEA 2CPHA 1FX2A 3SI8A 2VHGA 1WWHA 3K2YA 1FTCA 3GE9A 4YR2A 3PKYA 4WK3A 2C2KB 1HNWF 5GMKa 3CXCR 1VDHA 3E51A 3T9NA 4ED7A 3V6DB 2V8VA 1KNZA 2DYAA 3BPSP 1YJRA 4GVLA 1NJIT 5KG1A 4U96A 1T9UA 3FVYA 4XK8C 3UD4P 3H5UA 2ACMA 1VQ9S 3CMQA 4BDPA 3MMCA 1K1QA 1V9OA 2FIUA 2VODA 4JOUA 1BQXA 3IA0A 3W9HA 3CJ8A 5ETVA 4J9QA 1C0UB 1RT4A 1T9TA 2A0FB 3G82B 4TLQA 2J9DE 2BE2B 2DHAA 2CG4A 3C6UB 2IC3B 2XMAA 1G6BA 1GFWB 2IDLA 2WSEC 4DZDA 1RZMA 1FRHA 1XK8A 4DR7J 2ZUAA 3I31A 5KFAA 3UD5A 2ZH4A 4LF9F 1LOUA 5KFVA 5KFRA 1S48A 2EBGA 2ZZTA 1UZHA 4AYBD 5T14A 2X51A 2KZMA 4WYLA 3M32A 4IG0A 3FSXA 2G2OA 3G6VA 1O51A 4LSLB 1ZAXA 2R2RA 2IJNA 4C4WA 1FJEB 4WU3A 3UQSA 3TWZA 1LK5A 3NP5A 2VKRA 1YJ9S 3NGRA 1WC4A 2CZ9A 1BQMA 1NJWA 2WK4A 3HP6A 2BRKA 2BYCA 4JV1A 3PM9A 3UO0A 1QUVA 1S6QB 4L6V3 2P6SA 1U02A 1V3SA 1HLWA 1VMBA 4OMFG 4OZ5A 1ZM9A 3D1HA 3PYDA 4X62J 4NRTA 1JLGA 2HVIA 2M52A 2LDYA 2CPDA 2A3JA 1XMQJ 4MIWA 5KT5A 1DTTB 2ACYA 4H54A 4JI6F 5HQLA 5HP1A 4TNOA 2V94A 3MCOA 2HAIA 1O5JA 2RRNA 2FLPA 3FBCA 2HLTA 1H2TZ 4GKJJ 2VOPA 3PZPA 4I0WA 3HPOA 4EBEA 2UVUA 2NYHA 3TVZA 2VBZA 2ZHOA 3KLGB 3MGJA 3D6TB 4EBCA 1U0HB 2Z2LA 1CQNA 4N76A 4AFFA 3CCES 3LGNA 4OYBA 2C3OA 2Y3YA 3RU0A 1CJTA 2QMUB 4DR3F 1YX2A 4W4MA 4RLEA 4C0OC 1FEHA 2YBVA 4ZJQA 4M5GA 4DL4A 5IT4A 4EGLA 2FY8A 4FXWA 2AJ2A 5KFWA 4UZBA 1RWUA 2KXNB 2CNNB 2ZH3A 3C16A 2AEJA 4Q0BA 4ECUA 1IJEB 3L7OA 3OL7A 1R0AA 3BN7A 3L4BC 2LQ8A 2MKYA 4KY3A 2DNKA 2KXFA 3KG0A 4JI0J 3D68A 1Q0NA 5SUHA 5LXYA 4DDFA 5DLGA 4YB5A 2CDRB 4O23A 5F8IA 2J9CA 5KFLA 3ZC4A 4DV1J 2YNIA 2MXYA 2B56A 2QJ3A 3Q2TC 1FRJA 3QATA 2JX2A 1DAXA 1XQIA 1HHQA 2KT2A 5EHHA 4IKAA 1WOOA 4CLFA 1YZ7A 2AHOB 1TAQA 3TAQA 2HK3A 2RH3A 2B4OA 1RTZA 2FZCB 1MROA 3N0VA 2XSJB 4K0KJ 4PR6A 1IUJA 3TJAA 2HQDA 3K5OA 3T5HA 2YX7A 4C48A 4CLPA 2QN6B 2VG6A 4NL5A 4ITSA 2RDDA 4FPIA 2WSCC 3NNHA 2HNDA 1UWAA 5ITHA 3TR5A 4WWSA 2CQHA 3MAHA 4K4TA 5F8LA 1Y10A 2RUGA 4Q2LA 4JV0A 2HS0A 2ZDPA 3K58A 5EN1A 2BJ8A 2CJAA 5D3GA 2CADA 1V5VA 4J9NA 3GU0A 3M8SA 1RAEB 3QJPA 2LEPA 1RT1A 3J7YI 2HNZB 4JYAF 4FZVA 1K44A 2E7WA 1RAJA 1RT5B 1QLNA 1F5CA 1D8YA 2YNHB 2NZCA 4QWAA 4YDDB 1K47A 1TL1B 4K0KF 3C6TB 3D4JA 3R1LA 5KFMA 2J7WA 5M2UA 4U7UK 2W2MP 1JJ4A 4K7QA 3LGMA 4RUAA 2NXUA 1EETB 3DYAB 2ZH5A 2IM0A 2YH1A 3F0NA 1S6OA 2RQKA 3GMGA 1S57A 4BC7A 3PYGA 3UN3A 2CWXA 4EZ9A 3SQGA 2CQGA 1R0BG 3GQCA 4F4YA 2O01C 5RUBA 3OHAA 1H3DA 1SQFA 2RNEA 2WRMA 3FRZA 1Z4UA 2EEYA 1RT2A 3UWTA 2DGQA 3QT7A 1YWXA 2DHSA 4LBIA 3FQLA 1G4CA 4R5PB 4IR1A 5FDLB 2MEWA 1OS5A 2HK2A 2XQCA 3V4IB 2G0JA 3MR5A 5KFZA 3OJUA 4DV4J 2CJQA 1FJGJ 1FDDA 2XNQA 4HLBA 4L72B 4CWBA 2FJVA 1GH8A 2HQFA 5DQIA 1BD6A 4K2JA 4DU8A 3OR2A 1FRIA 4NWBA 1WELA 1ZAVA 2XCPA 2ZE2B 5A0YB 3QIDA 4LVNP 2DR9A 1SKUB 4ID5A 3G96A 3VGSA 4HACB 3CDWA 4YB6A 4W98A 5DRKA 3NGKA 3MUVP 3ZTQA 3IFEA 3THVA 2VFRA 4NLYA 3T19A 1Y9OA 2HHHF 3CUNA 3TZWA 1N56A 4PXEA 4HDGA 3MUMP 1OSDA 4ZDNA 5B0GA 3BH6B 1B3TA 2IBKA 5E0OA 5B0DA 1KKHA 1SJ1A 3GP9A 1EQ0A 3US5A 4KGKA 2HS4A 3FBEA 1FX4A 4ELTA 2J6TA 1VC6A 2WTFA 1X60A 3EXCX 5HLFA 1HWKA 4IH6A 1N33J 4J9OA 1FJGF 2QLBB 1P1LA 4LR7A 3BPDA 2HWIA 1RBOB 5D6GA 3N28A 4ED4A 3SV4A 5H9EK 2XZWA 2X7IA 4WKYA 2W9BA 5DQGA 1LK7A 3G87A 4J5OA 2O67A 3PFOA 1F9FA 3ADAC 1S97A 3MMAA 4YHHJ 4MMOA 2R8KA 1Q1KA 2VPZB 3HJFA 1N6QB 4KFBB 3PR5B 2GVDB 2HZAA 1HR0J 3CCUS 4ES1A 4U7CA 4P6QA 1SI9A 4J90A 1GMVA 2AP6A 4ENOA 3LPYA 2H9ZA 2E1AA 2RQMA 5I3PA 2JFKA 4ZS6A 1K1SA 4OI3A 4RO0A 1JKHB 1GNKA 3VVTA 1VI7A 1N33F 5CYMA 4C97A 4WTOB 3FEZA 1APSA 1UEKA 2V5HG 3J7ZT 1RT7B 1KQGB 2I2YA 4OJ1A 1VQ5S 2VQFJ 2L9WA 2VG5A 3W66A 4J9PA 5THWA 1LQ9A 3JTNA 3Q8SB 3QGGA 3KUGA 1XTZA 4LJMA 2OHDA 3VZIA 3W2WA 4ILRA 2UUBJ 4K5SA 4YY3F 1KDNA 2FHMA 1SQEA 2GQCA 2JNJA 1D09B 1OYDA 1CEZA 1BGXT 3MURP 3FCHA 4DN0A 6FD1A 1YKWA 2J76E 4FVCA 1NUEA 3FEXB 3CCSS 2PFFB 2XWXA 4R0EA 3GIIA 1DARA 2Y9HA 2GCFA 2R8HA 5D4LA 2JLEA 1N48A 3C15A 2V2KA 4CNYA 5EX3A 1JX4A 2MLXA 1HI1A 2QA4G 1NH7A 2L9NA 3I4HX 1PC4A 2DH8A 1CULA 4H4OA 4DL2A 2DKOB 4QYRA 3O1LA 3KLEB 1WF1A 1UVKA 3KDOA 5E7OB 3KHGA 3MFHA 3ELHA 5H1SV 4ZP6A 2RB7A 2JRSA 2XZDB 1RYRA 2LVWA 1IXKA 1N32F 5AXMA 5J1NA 4E2FB 4M5NA 2DNOA 4G65A 3JXOA 2YKOA 4C8NA 2XMTA 4M5DA 4ECQA 1YBUA 4JV5J 1ZM2A 3NBPB 4ZHRB 4B02A 2E5JA 3D6MB 4V19X 2QA4S 3H2VE 3HVWA 3HULA 3M2RA 2PO4A 8AT1B 4R8UB 3GWCA 1VRTA 2HWTA 1X9MA 1BWVA 4UOFA 1SL1A 4GVBA 2YKNB 1FKPB 1HQUA 4LSNB 1BXNA 4RW4A 2WBMA 1NDKA 1Q81T 5DS7A 2HGNA 1CC7A 5CD4H 4Y2KA 2ZUGA 5C2CA 2CVIA 1ZTWA 4NEYA 4USIA 2DNLA 4G1QB 3CJSA 5L1IA 1BLUA 1RTDA 1RTHA 3CEDA 4CYUA 1Q5YA 2U2FA 3NS5A 2DRBA 2AZ1A 4B3MJ 1UVLA 1KRPA 2ZBPA 5BXIA 4H4KA 3DLKB 3D0HE 2HVDA 2M9KA 5IT9Y 3SBMA 1HBMA 2QA1A 1TL3A 3HD2A 7FD1A 4NCGB 3D66A 5A8KA 2J8SA 3GIMA 4I1TA 3LP0A 1H72C 3OTOF 2NUUG 1UVJA 1DQAA 4WXWA 1VBKA 4A8SA 2KT3A 4DSKA 4PPZA 4PPDA 1P9QC 1VQOS 2X3GA 3TUZC 5KFBA 3M6VA 4RZRA 3GLJA 1RJJA 4QR2A 4FBTA 1HIYA 2ZJPQ 1X5OA 3W61A 1VGYA 1EQMA 1QAXA 1VRQC 3VAJA 3QQCD 1NEEA 4CP5A 3JSMB 1QM9A 2GA7A 2KVIA 4N77A 5A6WA 1O0PA 4B3MF 3L95X 2B43A 2HBRB 2V63A 3IR7B 1MU2A 1HQEA 1ZPWX 4PKDB 2OD6A 4QW9A 4YN3B 3VGVA 4F02A 4FVMA 5IV4A 3VQTA 1IN0A 4ED3A 2KFYA 4NA2A 2VQEJ 3M6XA 3NS6A 1D9DA 1LXNA 3R97A 5HMXA 5HATA 2KKHA 3BGRA 1HBUA 4BWMA 1RWNB 4IR9A 3NOGA 3SMZA 1RT6A 4F4AA 1WUUA 4RW6A 4KH1B 2UVWA 3GCWP 1J2VA 4X65F 1Q82T 5GAHI 5F8MA 1RADB 2E7XA 4KGVB 5KG4A 4PG7A 1S1WA 2DGSA 2G0IA 3M30B 1SC4B 3QMQA 4V1Ak 2MJNA 2C42A 4J91A 1W2IA 2CUYA 5G0RA 1JLAA 2AJFE 4Y65A 3D3CJ 3EJMA 4J9LA 1CJUA 4USVA 1GTEA 4NLTA 1UMJA 2HKEA 1FJ7A 1S7HA 2C2DA 2DPIA 1W2BR 1F5AA 4X4OA 2W24A 3TEHB 3MD1A 3K0JA 4I2PA 2BQUA 3BGLA 3U7JA 4QCLA 2UV8G 2F9JA 1X4DA 2V2VA 3MEDB 2D69A 3BQ0A 3KLFA 2WBRA 4A4JA 3S6EA 2EG1A 3BEGB 2JVOA 3JAMY 2HIYA 4LF6F 1BMQB 2HGMA 1S10A 3PX0A 2IM2A 3P5TL 3H59A 3UCZP 3GJSB 4RW8A 1U09A 5B0AA 3MM6B 4E0DA 3PW4A 5HMYA 2PEHA 4OZNA 1VOMA 2DXFA 1YSJA 2DR7A 1EKRA 2KM8C 1Q4RA 1Q95G 3ONQA 2MQPA 5CCMA 4QIVA 1FXRA 2FVRA 2KN4A 4KE5A 5HAOA 2NCKL 3JQMA 4F4WA 3DGPB 3CJQA 3RYLA 1P1TA 3PEJA 4ATNA 2FLLA 3CJ2A 3PNIA 1WI6A 4IQXA 3GG1A 1RT4B 1XNRF 2E9TA 1XWLA 1MSWD 3Q2SC 2LLZA 3W9IA 1MMLA 3DOKB 3HVAA 1JLBA 5CZXA 1FRLA 3MM5A 3JAMU 2ZOMA 3V5RA 2QLFB 3BB5A 4JI7J 4EUVA 1TV6B 4O0IA 1M5KC 2MZTA 1LWCA 5E33A 2F4VJ 3E3XA 5BR8J 2PT0A 3EZOA 4A8OA 7AT1B 2BX6A 1I94F 4DX6A 3LAKA 3A8KA 1SH3A 1P27B 5F9NA 2ZWOA 1KVKA 5DJBA 3W5YA 3QFHA 2FGOA 5KT7A 5KFHA 3RB3A 1HPZB 4U6PA 4EEYA 1UW9A 2B3TB 2DEIA 1BQMB 2IM1A 2GGPB 3G6XA 3SDEA 4B17A 4KAIA 1KBRA 1B64A 2F8EX 3TA1A 4WBFA 3KHLA 2I5JB 2ALYB 1LW0B 2XMUA 3P5BP 2MQNA 1RWKB 4CO5A 4ZLNA 1Q8BA 1LV5A 4G6VB 4DOZA 4QIWD 2F4VF 5BR8F 3KJVA 4AE5A 3LP2B 4A8MP 3HT3A 4EU0A 3I9V9 3OFGA 4LF7J 2WW4A 2ZH1A 3DCAA 2E5HA 4OHZA 3NG8A 2KO1A 1ZAWA 1XNQF 3UNYA 2E66A 2NSBA 1RTJA 1FO1A 1F0XA 3Q8UA 2J6UA 2M88A 1EJ7L 2B6AA 1UKUA 1NAQA 1CJTB 1TK8A 3VF0B 3UVJA 5AXNA 3TQEA 1OY6A 5E41A 3GYXB 4XO0A 4HI2A 5U47A 2VFUA 3AD9C 4LRBA 3M6WA 5HSPA 4TLRA 1YVFA 3CMES 2DGOA 3MF5A 4F3OA 2XMKA 3C14A 4NXMF 1R0AB 3L09A 5F8GA 4YB1P 2HFNA 4C98A 1RAIB 4DX7A 2XO6A 2UXBF 2EKYA 1FWKA 2BRLA 2GIFA 4X2BA 1QTNB 5D15A 2QSWA 3MTJA 3E01A 1OO0B 1X8DA 4DZ6A 2GJ2A 3MTKA 5CXTA 4JI4J 3HHLA 3LH2S 3DRXA 2R9LA 1YBTA 3M8ZA 2ZKTA 1OQ6A 2DNHA 4M5JA 5ETTA 2UXDJ 3HHLC 5LM7E 3I6PA 3CJRA 3F44A 2ZC4A 1NDCA 3RUBL 2W01A 4QIEA 4UZCA 3PCOB 3W65A 3ITHA 2F63A 4Y28C 5I42B 3KK2B 1RYSA 4YP3A 2HWHA 2B7BB 4TXSA 1NCLA 3TVYA 2AGOA 2MKCA 4K4SA 4C8LA 2ZBCA 5H9EJ 3JB9k 2NQPA 2QFIA 1N5VA 3FBBA 3GFYA 2QX0A 3IS9A 2PI4A 2B8QA 1FI4A 2CIMA 1EARA 4XAKA 4P2MA 3PO4A 4M5IA 2VBXA 3OVBA 3PW7A 2MKSA 5JXSA 2UU9J 1BQNB 4ANCA 1FXLA 3G8QA 2DGWA 3D0IE 2AYMA 4TY8B 1UEVA 1HQ2A 1DQ9A 5KFNA 3W3SA 1UWBA 3BF4A 4CO0A 1G7CB 5HBMA 3SSQA 5KFUA 2YTCA 1RWXB 4P2SA 3V81B 1IM6A 1U1KA 5B0EA 2KYXA 4OV6A 3MM9B 4BS2A 2MKKA 4DEZA 3T1AA 1U7LA 4ED8A 5J2PB 4LF4F 3KK1B 4QWDA 1S1XA 3W9JA 3W62A 3N5BA 4DPWA 5KOXA 4B3RJ 5IQ6A 2R4FA 4PYDA 2W1BA 2ZH2A 2G1DA 3RRHA 1SPBP 1LFWA 3ILLA 4IO9Q 3GR0A 1Q53A 3CSKA 3WBZA 4FF3A 1WI8A 1VBZA 4OYIA 3RB6A 4C9DA 1T3NA 3FKBA 4PZVA 2JEFA 4UT4A 5IT0A 2XCAA 4DUYJ 3V6DA 5FJ4A 2CXEA 4UUXA 1S1UB 1CSJA 1U0SA 1RISA 4NI2B 4O0NA 4XPEA 2FQQB 2XNRA 2E5LJ 4LFCJ 4PXDA 1RT2B 2NSCA 1PAEX 3Q0AA 3D54A 4RW7A 2YNFB 2DNMA 4FXVA 2AZ3A 4OYMA 3M8WA 4CLWA 3MM8A 1QUPA 1TP7A 1QSLA 4LFAJ 2DNNA 4DFPA 2KDOA 1H73A 1R0CB 1NKCA 4NLVA 3RAQA 2LDIA 1FFWB 3JTPA 1G1XA 4CH7A 1C0UA 2ZZNA 3LO3A 1PSDA 4P7VA 2JZ5A 3J7YU 3W64A 3G82A 4RUHA 2BE2A 3C6UA 3KFWX 2NXEA 3BS9A 5D0RA 3EDQB 2IC3A 2D3O1 1V3RA 3CJKA 1T03B 4NLUA 5EWEA 4RNOA 2NS1B 1CJVA 1NPRA 2BE9B 3J80Y 2HLUA 7FDRA 4B3OB 2W8KA 2V8GA 1RT3B 2XI2A 5A8WA 2MQQA 2ROGA 2VL1A 1HBOB 1KD1T 4LR9A 2X1AA 3PVXA 2LEBA 3K59A 1SCJB 2E5LF 4LFCF 4EYHB 2J9DA 4K4UA 3KTQA 4AL6A 3IC1A 1LFPA 2I1RA 2DIVA 1WC3A 1R6YA 4LFAF 4P2FA 4ZP7A 4DUTA 1IWAA 3EGZA 1IKVB 5HLFB 1X4EA 1FDAA 1YTYA 3P3DA 1Y3KA 1VR6A 1IBMJ 1R8AA 2RKIB 1M5PC 4Q8FA 4AD6A 2OMOA 2UUWA 4NASA 3J80U 2W9BB 2XZTB 5K20B 1RTIB 4URQU 2BMBA 3M8YA 2XY6A 1HBNA 4CO3A 1YJNS 5DLFA 5HQMA 3KK3B 2D9PA 1BY9A 3PR4A 2IYIA 4DCOB 1RAOA 2NXCA 1GT8A 4G1IA 3KLGA 2FJBB 4WIQA 4IOCQ 1CLFA 1U0HA 4ZPCA 4YEAA 3EZUA 4URGA 1YITS 4ED2A 4XPCA 2VFVA 5KFEA 4NLGA 4BWJA 2HQCA 4IFVB 4WP3A 2W9CB 4Y3CA 3TOQA 2A18A 3M9MB 4IO1A 4I6YA 5KFCA 4DPTA 1W7WA 4ZPBA 3JQKA 1TKXB 4CM0A 2FHKA 2JFDA 1KS2A 1VQPS 2H51B 3Q86A 1URNA 3NGSA 3TAPA 2OPRB 2YQ3A 3AA9A 4LF2A 5CD4A 1VHFA 2AEFA 2FLNA 2FVQA 2OPPA 4KPCA 2M2BA 1D1UA 2O66A 1P8GA 4NLRA 3CCLS 2IM3A 3LWMA 2HBZB 2HIQA 1PG5B 4ZIWA 1M90T 1FJCA 2YKMB 3R8YA 1YBAA 4PG8A 3IWXA 1T9VA 5IFMA 4WFAQ 3CF5Q 3P8BB 4OZJA 1U6BA 5GMEA 2UVRA 3T1YJ 2MY7A 1NU4A 5DGAA 3N4WA 2M8DB 2CNLB 3VAIA 2AYBA 2EI5A 4OZLA 4ANEA 1HNZJ 2DNPA 1WEYA 2ZITA 2HQIA 2LFVA 1FRXA 4ZVUB 2BOPA 1KHWA 1QY7A 2EWHA 3W2VB 3HCXA 3AA8A 1QTMA 2SXLA 1Y00A 4WFYA 1E6VB 4X84A 1KTVA 3TA2A 1TKZB 2E7VA 3Q8YA 1ZA2B 2R2TA 5KTQA 1Y5NB 5EWGA 4FS1A 4Q7AA 4JI5F 1TQLA 2CPXA 3DHXA 3BO4A 2DGTA 4MAKA 4I64A 2Z30B 2FGCA 4B9LA 4OHXA 1JWWA 1NXIA 1NK4A 4K4VA 4NOHA 4LQ3A 3TZYA 4D3HA 4DV2F 3KYLA 1TL1A 1HD1A 2OGUA 1TKTB 3C6TA 1V3ZA 2M8HA 3POTB 5GAEI 3NMRA 4Y2AA 5E3AA 5DDQC 5JUMA 4JBCA 4DI6A 2DO0A 1EETA 4OJ3A 2UUTA 2R3VA 3A8JA 1FVSA 4NMLA 4DSLA 3VWSA 4LF8F 3JTOA 1RTDB 4ZVRB 3F56A 2C3PA 1AROP 4DJBA 5GMDA 4LUBA 5KFYA 3MEKA 1N0VC 3O5TB 4ZA1A 1SIWB 3VV2B 1AW0A 1KONA 1U2CA 4X64J 2QGFB 2HRUA 3IO1A 5LJ3Y 2APOA 2CQDA 5DETA 2FJAB 1FDBA 2LQ9A 4R5PA 4TVAB 3PACA 3IMQJ 1ZA1B 1U1RA 3D1OA 5LMUJ 1VLYA 2R42A 5BJRA 4HVZA 2I0XA 1FKOB 5DGBA 2VJVA 3QGIA 3PV8A 2WB1D 4C0BA 2X1BA 1UJ4A 2YKQA 1DZ5A 2WCXA 1K0TA 1SKRA 3E2EA 3B6BA 1N34F 1NSPA 2WVEA 1CQMA 3LPEA 2ZE2A 5A0YA 4ZN3A 3GJRB 1LEOA 2ZHAA 3SIPB 2PSZA 2CDQA 4AQYJ 3BV8A 5FD1A 3OBIA 2GFFA 1U47A 1Q86T 2XB2D 2W7PA 1IKWB 2G2ZA 1S59A 2ROEA 1PBAA 4ECSA 4B3TF 3VAFA 3KMQA 4KV8B 1H98A 1I1GA 2JLFA 1WJ9A 2KI2A 4GMKA 5LMUF 4QWCA 3AXKA 2UUAJ 3IG1B 4N47A 1K73T 2IHR1 3UDVA 4TU7A 3BDEA 1ACMB 2B9EA 2DXEA 2OUGA 5CHCB 4ETZA 2CPEA 3UR0A 2O1PA 3MAQA 1LNQA 4KT0C 4PAAA 1UEUA 4LRFA 2YNGB 4NA3A 4FBUA 1D3WA 3QSYB 4DUZF 2MZJA 3UDEA 1CJUB 3FUYA 2XG8A 1N6QA 1LKZA 4KFBA 2GVDA 3PIPQ 3RZAA 4ZN1A 3W1YC 3VAKA 4CIOA 2GMHA 1R6VA 3DNCA 3LTOA 2VPXB 4K59A 1KHVA 1Z1ZA 1UCNA 2HBYB 2V4RA 4I2PB 1BC6A 6FDRA 3H8YA 1N36F 1SC6A 4DV6F 3ENVA 3OUYB 4Q8EA 3MXHP 1JKHA 2YKAA 2IRUA 3HHLD 4ZJLA 1UL3A 3IAM9 3OD2A 2DRAA 1RT7A 3VAMA 4ZCKA 3MR2A 5KT6A 3PRDA 1SV5B 4YQWA 3CWJA 2UV8A 1TMMA 4HTIA 1SJ3P 1X5PA 1JMTA 2EW9A 2K2PA 2EFOA 4IH5A 5HANA 4NRUA 4EO6A 4RL1A 5GAHU 1KWMA 2Q43A 3A1YG 3SXLA 2GQ2A 3EDRB 2RRAA 3DOMB 4JI2F 3EVOA 2B9YA 1UETA 1EHWA 1CS4B 4FKYA 2GMLA 2RF2A 4ZLPA 1SBRA 1R27B 4OJHA 2LCWA 2LECA 1JNRB 3MI7X 2QYCA 3CMAS 2FB0A 2OAUA 1VISA 2XY5A 1LWCB 4QOTA 4FF2A 3I55S 1H74A 3KLEA 2YWWA 2DGVA 4USKA 3H5XA 2OEJA 1JJ2R 4JI8J 5C24B 2IRYA 5ETPA 4QPXA 4FYVB 2DITA 1WSVA 3NY0A 2CA9A 4QJVA 2VC0A 3MECA 4DR4J 1VC5A 2EG2A 1C1BB 1TL5A 3QT6A 3DMJB 4YR3A 4DV5J 1OIAA 1W26A 1MN7A 3QWUA 3ET6B 4RNMA 5E5NA 2FZKB 1VQKS 3OLAA 1NO8A 3G4SS 4Q5VA 4X66F 1U26A 3NBPA 3UDLA 5F3ZA 1EX8A 2CQCA 3SEOA 1KN6A 3KJQB 3EUNA 1WSRA 3T6BA 4J9KA 3KLIB 1QD1A 4J9VA 2Z0GA 4R8UA 2G9OA 2VA3A 2CPZA 2RIJA 2YQ0A 5KFIA 1S1TB 4ICLB 4JI1F 3MFIA 4QIGA 4JV2A 1S1VB 2WONB 1UVMA 3EE3A 3R27A 4F50A 2YKNA 1FKPA 4LSNA 4PXCA 1HI0P 1P6TA 3RB0A 3MHYA 5HVGA 3GYNA 3T1HJ 3NAIA 3QBCA 1HYSB 1PJ7A 3IBWA 1FWLA 2FD2A 5IWAJ 2EC0A 4G1QA 8RUCA 1DJ0A 3QPIA 5LOQA 1L3UA 4BLGA 2K3KA 2KG1A 5HL7Q 4EZ6A 2B9XA 3EVWA 3DLKA 3P45B 1FK9B 3BSOA 2RRBA 4YS2A 3QWPA 2VICA 3GPAA 1UA0A 1LWXA 4TU8A 3H4BA 1A0OB 2E1PA 1EZZB 2CPJA 3DDKA 2DH9A 1IJFB 1TL7A 3TANA 1T9XA 3R7NB 2R7WA 2AKWB 2NPIA 2A2DA 4ECZA 3V6HA 4Z37A 3FC9A 4BCAA 4K4YA 4O4GB 4N5SA 1VBXA 3BKTA 3M8RA 1S6PB 2DHHA 4JP8A 4I6AA 4ILMA 4YFUA 4OI1A 1KOHA 3TP2A 2J9EA 1CBKA 3RBEA 2DXDA 4ZVGA 2ASYA 4PQAA 5JMNA 1NJYA 3JSMA 4DV7J 5KT2A 3JSRA 4OZ1A 5GAGI 2F1FA 2JVRA 3QIPB 3K5LA 2B51A 4DF8A 4CO1A 1KTQA 2CAJA 3DC2A 3HF5A 1QAIA 3G2XA 1Z2ZA 3AFGA 1IKYB 2GO9A 4X4QA 3W5XA 4M5LA 4N8NA 3PTWA 4XIUA 1UA1A 2OTLS 4CDIA 3UDCA 2HW3A 2W2NP 2ASLA 3IRWP 3K5MA 2OELA 4RKUC 4DV0F 5DDRC 2EVZA 3MMBB 3PRVA 5E3CA 2H65B 1IBLF 1HNVB 3AXMA 2FZGB 4OYXA 3MR3A 2LXUA 4LMZA 2HSEB 2N3OA 1Q79A 2XS2A 2F5GA 4GC7A 4O4RA 1T05B 2MKIA 3J81j 2C2ZB 1T9YA 3HLUA 2RS8A 1VQLS 3OJSA 3M30A 4MKAA 2VFSA 1UFKA 2D41A 4WFZA 1ZOTA 2LA4A 3QYYA 1NSQA 5B0BA 1NK7A 1KSPA 1JXEA 1FNMA 5E3QA 5ETSA 1LW2A 4FYDA 4MKBA 1PO6A 4ZVPB 3IR6B 1Y4ZB 2ZJQQ 3QLHB 1RAHB 3DRSB 1C0TB 3MEDA 4WF9Q 3MOJB 1T95A 4U67Q 4TYBA 1YK9A 3MZIA 1CC8A 2J5AA 1WOSA 2MQ8A 4WP9A 5KG2A 4PG5A 2JL9A 2EC2A 2C3YA 3MM6A 2XYPB 2V4JB 5DZ6A 2N3LA 2D9OA 2MKJA 3R7SB 4KH0B 3OL9A 4ILLA 3FK4A 4RW7B 4KPYA 2OTJS 1UZDA 2XS5A 1RLCL 3MCSA 4OZ3A 2VH7A 2HVHA 4OYOA 5F8NA 5C2GA 3DGPA 1AFIA 3MM8B 5LMNF 1SJ4P 4F4ZA 2V9KA 3ILJA 2RSQA 3U1MA 3DLJA 2YKPA 3JS9A 4KGMA 4DCJB 4UY85 1DURA 1M5VC 1Q7YT 1U1OA 3DOKA 4I4BA 5J1EB 5IZHA 4U95A 1HNIB 5AXLA 1F1BB 2BQ3A 3CJKB 4EWTA 2COLA 1TV6A 2RD5C 3CULA 1Y11A 5KFTA 2E1MC 1CJVB 1JLEB 1AUSL 3B4DA 3N6NA 1N0UA 4MH8A 2CQBA 5J1PA 3R2CJ 1S12A 2DGXA 5A8WB 4F4KA 2DNRA 5LSLA 3MAAB 2IJRA 4ZP8A 4ZVTB 4WZQA 3M8PB 5L39A 1P9YA 1QE1A 5C42B 1EP4B 2MJUA 1XJWB 1N5SA 5L1KA 1Q5VA 1HPZA 3U1NA 4YUDA 3MPDA 4F04B 2IRXA 3NGTA 3BQ2A 4LSZB 1IVZA 2GGPA 2PN6A 2BJDA 4MTPA 1GXUA 1X4AA 2I5JA 1EIYB 4W90B 1LW0A 4DQIA 4OYAA 2LQJA 2RMLA 2AU0A 1FRKA 4N7TA 4DR2J 4DR7F 1NJXA 3KG1A 3EPGA 1KP6A 3LP2A 3B4MA 1HBNB 2CZ4A 2VC1A 1G3OA 4DMZA 3H5YA 1F3FA 2CYYA 2DTJA 4WFBQ 4Q43A 4YOEA 2CJBA 2CPFA 2UVVA 5I3UB 2HVZA 2Q6BA 4I2QB 1FCAA 2YX4A 2C3MA 3W60A 4CNZA 1RHJB 1SL2A 1M5SA 4U8YA 1T02A 2DD8S 4IG3B 4B3SJ 4UW2A 1YJ7A 4X62F 5HROB 4ZPVR 1M5HA 3FCVA 2HGLA 5DZ7A 3CCTA 3CCVS 4RBVA 4B9SA 3BSCA 4N41A 4KB7A 1XMQF 2YWKA 3OL6A 2MY8A 1N54B 4QWEA 3BGOP 5KAKA 3DHWC 1FA0A 1T9WA 4ER8A 3ENWA 2V6AA 1JLFB 1FHTA 2OPPB 3DGVA 3ZO7A 4GKJF 4CO4A 4RR5A 4L75A 4DLEA 1XR6A 2KL8A 4I69A 4ANDA 1NRKA 3CDUA 1SC3B 5KFXA 1R3NA 3D1QA 2GJFA 2XULA 4Q45A 3ETOA 4F4XA 4B3SF 3KK2A 5I42A 5KOWA 4DR1J 2BACA 2YQ1A 1GAOA 1LWEB 4ELUA 2RILA 4TQSA 2O3DA 4P72A 4NCAA 2CNKB 5KFGA 2PE8A 4JI0F 4ERDA 4X4PA 5IC6B 1BQNA 5HK4A 1ZYQA 4NEZA 1ZETA 2YWEA 2NR0A 4TY8A 2I38A 2MZ1A 2IA6A 2VB6A 3R5GA 4DV1F 5E2QA 1WC0A 3UPFA 3GSDA 2O5DA 3OHBA 2H5IB 4GKKJ 2LMIA 3V81A 1RA7A 2E29A 2DO4A 1HKAA 2BKPA 4KHRA 2Y1JA 1WACA 3MM9A 3PX4A 2R7UA 2OIHA 3MM7B 4RX6A 3AODA 1TVRB 1WKKA 3HXMA 5J2PA 5GVQA 3KK1A 4PCQA 2AV5A 1MMNA 2OP5A 2VF3A 4CO2A 5AT1B 2W2QP 1QAJA 2RQ4A 3FSIA 4DR1F 1ZZNA 3H0PA 2BV3A 2X3DA 4ZVHA 5F0WA 1BE4A 2ASDA 4DL0C 4DG1B 1SIZA 4ZCMA 4CT9A 2F3JA 1DFDA 2Y0BB 1RABB 2DNYA 3C66A 3IP0A 2V9WA 4J9UE 4IH7A 3LGHA 3EYZA 4QR1A 2QT7A 3LUYA 3TNVA 4PG4A 4YB7A 1S1UA 4NI2A 3CC2S 4GKKF 3MOZA 4L76A 2BJ3A 2MZRA 2W25A 1WDTA 3VQSA 3EPIA 2YNFA 3TZZA 4DU7A 4KSEB 4A8QA 2I8EA 3MEEA 2GS8A 3A13A 4QBUA 1CJKB 1S4EA 2HG4A 2ZJRQ 1RWMB 3AD8C 4J9SA 1FNOA 5GADU 3FFIB 3AH6A 4CTAB 2F8MA 4KTQA 2B9WA 2DISA 2ZHBA 4B08A 3Q8PB 2Z4PA 1SH2A 3ZTOA 1KLMB 1X4GA 2JJ4D 5M2PA 3R6GB 2QV6A 5AJ3J 1T03A 2OEKA 9ATCB 3NKYA 4QW8A 4WFXA 2R2SA 4L3KA 4B3OA 5GAEU 1RT3A 2PC6A 4I7FB 4EK2A 2CQ4A 2QZ8A 1HBOA 1Q8KA 2J7KA 3GSIA 4USHA 4LR8A 1YRTA 1HWIA 1VYAA 4KR0B 4ZCIA 3CJTA 5HVFA 3TAMB 3J7AN 2KB2A 2Y1LB 4UQTA 4EYIB 3G8TA 2KZZA 2V2ZA 3CTRA 2ZKUA 1U4BA 5ETLA 1RI7A 4ZOSA 3BBBA 1IKVA 4DV4F 2ZNZA 2W9AA 1RBAA 2AWZA 2RKIA 3F41A 3D2WA 4MIAA 2QL7B 2M5YA 2MZQA 4ZKAA 3ISNC 1ZTTA 1VLOA 2IAJB 1WG5A 2UUCJ 4C2MA 3I5BA 1WHWA 1RTIA 4OYWA 4F26A 5LXRA 5KG5A 2W7OA 1AT1B 4P75A 3I56S 4TQRA 1A7GE 4HHHA 1YRXA 2BUNA 3VTIA 1AFJA 3M7VA 2LA6A 6AT1B 2X1GA 3KK3A 4B9TA 1TAUA 1NK5A 4Y34A 1VC0A 2VJUA 3I9ZA 3FRYA 3BO2A 2D74B 2J8AA 1U1PA 1FTRA 3HZGA 1F6TA 4JI3J 4DPOA 2AYEA 3HX9A 3PJXA 2QL9B 2OFGX 3B8HA 2VG7B 4P74A 3NWGA 4QYZK 4ZVEA 3HVRA 1U24A 3JYTB 4RU9A 1GQEA 3NAHA 4IFVA 2W9CA 2M7SA 4CCHA 2E1CA 1FRMA 2HQ3A 2AD9A 2C2OB 3CJ0A 1TKXA 3UN2A 2HQGA 3QZ7A 4F25A 4ECWA 4E8UA 3NGUA 1MW7A 1RSCA 3U02A 3V4MA 5HMZA 4ZPAA 3D3BJ 2RHQB 3R3TA 3T6JA 2XC9A 4DX5A 2VD3A 3V6KA 2OPRA 4FF4A 1SJFA 2QMXA 2ZVSA 4WU2A 2GHPA 4YHHF 4A8WA 3OV7A 3ZZYA 1UTAA 3UNGC 3PYFA 2A2CA 4DFMA 2GO8A 4QQBA 1HR0F 3HO1A 4NXNJ 1SH0A 1REGX 4JI3F 1NKEA 2GAGC 4ETXA 2EFQA 4I6WA 4NMXA 1ZH5A 2RF2B 2G4BA 2YKMA 4NLWA 4NLSA 1VQSA 3U1LA 4C8OA 4LFBJ 2HFSA 3R5BA 5BYQA 3Q83A 4DLGA 3PHEA 1MNEA 5K5MA 4DR5J 3DOLA 4XTTA 1T7PA 2BKOA 4KRWA 5CYQA 3GILA 2VQFF 2WOMB 1KQSR 3A4TA 3SZ2A 3CJ5A 1DLOB 2UP1A 4KO0B 3R1HA 3MECB 4IRCA 2P6TA 5A8RA 3K5NA 1Y5IB 2JEIA 1M5OC 4MKYA 2IVYA 3W2VA 3CCWA 1GEHA 3PJWA 4FN5A 2UUBF 3M1VB 1GTHA 4S0MA 5D78A 3CVKA 1E6VA 1OY9A 2XTJP 2FYXA 4KQZA 4OX8A 2KHDA 1TKZA 3PO5A 4NLOA 3OTDA 5FLXY 4CH1A 3M4XA 1C1CB 3IWNC 5EGYA 2GIRA 2VFTA 3DI6A 4HTJA 3B78A 1S9GB 2QRRA 2ABYA 1Q16B 4HHJA 5B08A 4JB8B 2R7VA 3GJTB 5HI7A 1WTFA 4HI1A 4X4UA 1KC8T 5KFKA 4MFBB 2HHUA 2B8PA 4Z7CA 3X1LB 3I5AA 4FXDA 4ED1A 2Z57B 2DEJA 4FPRA 2MQMA 3NL0A 2P9GA 3HHDA 2G0CA 5T41A 1TKTA 1VS3A 1RB0A 3K57A 3POTA 2XM3A 3LOUA 2HHTA 5M2RA 1HW9A 4C8MA 1TR0A 4RUBA 2K1RB 4NZ7A 2Z2ZA 1HNXJ 4RWXA 3GFZA 3H90A 2RAQA 2BJ9A 2ZBQA 2QTWA 4JV5F 3BR9A 5ETNA 5K8MA 1SL0A 3S01A 4UUWA 5J2MB 3M2VA 4IRDA 4H4KC 3L9ZA 2P2CB 1NPKA 2ZBIA 1PGZA 5F9LA 1L3KA 1TL7B 2BM1A 2A6MA 5L1LA 2E5IA 4DQPA 2NLWA 2C22A 1NLKL 3KJFB 3QGPA 4F2SA 2DRDA 1FKOA 2J7UA 1IBKJ 4MK7A 3PEHA 1D8ZA 4DWIA 2BOAA 2V34A 3AOAA 2F7VA 1WHXA 1WF0A 2NYIA 4X4VA 5L8RC 3AHPA 1NSAA 3ZZTA 4CLKA 2KHCA 4J9RA 2ADBA 2KH9A 3J81Y 4KHMA 3VALA 2W2OP 4NX9A 4F7VA 3PY8A 1YDLA 4C11B 1F2GA 1SUQB 2IDEA 1GX5A 2AIRB 3ZZZA 3FSYA 2KG0A 3D6HB 5IV3A 5IT9U 1WDDA 2LEAA 1IKWA 1BUXA 4RWWA 2HFUA 4KV8A 4P73A 4EMDA 4QR0A 1YLXA 4DXLA 2XBPA 3SFUA 2QSFA 5C5JA 3L3CA 5I3QA 2BQRA 1EKSA 3RR8A 3FEYB 3F73A 1GXLA 3CC4S 3AY0A 4OJGA 3HSZA 3IG1A 5DG7A 2H4WB 1ITPA 5C25B 2Z2MA 2AJ1A 4P2XA 2IYGA 1K9MT 3QFWA 2XMVA 1XR7A 3G6YA 3MEGB 1TUGB 3CJ4A 1TELA 2ZVIA 3J81U 4OX9J 1S9EA 2EFNA 3TQ1A 1X4BA 1NDLA 2YNGA 4ZVQB 4LF9J 1GMWA 5DQHA 1S6UA 1RBLA 2JH3A 4WE1B 2FPHX 5C7PA 4EO8A 3AOBA 1B7YB 3AB2B 2R8GA 1LW2B 1OJ4A 4F36A 3NGDA 4J9MA 1WTBA 3HVTB 4PQUB 2VQEF 1NH8A 5GAGU 4J37A 4QPTA 2CQPA 1EAYC 4ZPTR 1S7IA 2WVDA 2HS3A 4TY9A 3OUYA 3DXBA 2FHJA 2DR5A 1U1MA 3CCRS 3J7A1 3T5LA 3EWGA 2AF6A 1QVFR 3AJ1A 2KFZA 1SV5A 1YI2S 4RUCA 3FDSA 1R8HA 3RBXA 1HWJA 2Q79A 4M8LA 3OW2R 2PD1A 4OX9F 5EUHA 3PIOQ 3DRPB 2JLGA 1H7WA 4PWDB 2K06A 2U1AA 3WIUA 4X4TA 2IFXA 2NREA 1DBDA 4JI6J 3M8QB 3HFZB 2ATCB 1MWQA 2C2NA 4LF1A 3QZ8A 1S72S 4ZLJA 3GIRA 4C3MA 3MPUB 5DDPC 4AL5A 2CQ1A 5KG3A 3DOMA 2BJ1A 5IC4B 1CS4A 4A8FA 3TUIC 1ICEB 3DRRB 1JLCB 1HMVB 3Q89A 1NB2A 4DR3J 2VPWB 3IXQA 3IGNA 1X9SA 3ISZA 2XMJA 2B4PA 2FJWA 3K8WA 1REVB 5C24A 1U1LA 3A3NB 3EZ5A 3B82A 5DM6Q 1OMSA 4Y2MA 2NZ4A 1RA6A 2MQOA 2RU9A 2POKA 1QE1B 1C1BA 2KVQE 1S49A 3DMJA 3DU5A 1JJHA 1IM4A 3D0GE 1RXOB 5HJYA 3ET6A 4WYWA 3I0RB 4FDFA 1U1QA 2QO3A 1X4FA 2DNZA 4EI2A 5CCLA 3VR1A 1IKXB 1ROFA 3EM1A 1Q8LA 3OPKA 1RP5A 2VBWA 1KFDA 1H6KX 3ILOA 1H2VZ 5D4OA 3OXGA 2R7OA 1X0FA 2BKNA 3KLIA 1HHTP 4RNHA 4FS2A 1ULRA 4JI7F 3UCUP 2L41A 2VONA 1TUVA 2JC1A 1S1TA 2VASA 4ICLA 1S1VA 2WONA 3DLGB 3H25A 2HEKA 5K9FA 5LT5A 2CQ3A 1WKJA 2XGQA 5E3PA 4PUOB 2IVMA 3ZZRA 1HYSA 1D9AA 1QSYA 2I6WA 3BKFA 3ZNUA 4ZP9A 4C3LA 4FYWB 3ENAA 3PW0A 2NXJA 5K8OA 4IOAQ 3HM9A 1NDPA 2A1BA 2HNYB 3BR8A 3RAMA 1UJ6A 4OYPA 3PXGa 3MUTP 1FK9A 2QYGA 3T3FA 4C8YA 3DRYA 4ECTA 4DL3A 1SKWA 5CA5A 2RU3A 4QWBA 2DR6A 3VVUA 1DY3A 1NZAA 5AXKA 2GHWA 4DPXA 3BYPA 5MLCV 4JYAJ 5B09A 4DBQA 5LJ5Y 3QNWB 1I3OB 4B9VA 2OLWA 2MGZB 4OHVA 1WG4A 2Y0SD 2X1FA 4YR0A 4O4GA 3LA0A 3GFXA 4LF7F 4KC5A 1S6PA 2AX0A 4KYZA 4PXBA 4WXOA 3IBFB 2NPFA 2Z2YB 2DGUA 3ZTSA 2MPUA 5G4DA 2FVPA 1UJ5A 3ISND 2BA9A 4QIFA 3BM7A 2AJ0A 2YWGA 2OO4A 1TTHB 2EFGA 2FLOA 4OI0A 3MDFA 4IDKB 4X4SA 3QIPA 5IQQA 1AB8A 5CZVA 3VGTA 1RHMB 4LRCA 4AXJA 2ZD1B 1RKIA 1K0VA 4PABA 5ETOA 3K89A 4E98A 2YWFA 1IKYA 2BANB 3BSNA 2PA3A 1UP1A 3PHTA 3NCPA 3A8IA 4CI0B 4EBDA 3AOCA 2DNGA 4CH0S 1A9NB 2Y1IA 3EGNA 2E9ZA 1SC1B 1S99A 2ROPA 4QU7A 3MMBA 1HNVA 5E3RA 2QLJB 2CJKA 5CH7B 1IQZA 1T05A 4Y2IA 1IWGA 2VZ9A 1B7FA 4K8RA 1XMOJ 4JI4F 5IM0B 1ZPVA 2MYFA 2H1YA 4C8ZA 5CQGA 2UXDF 4QYZJ 3TO8A 2NXNA 1S0NA 3O3LA 2FVCA 4USUA 2HHHJ 3KUEA 2ILZA 2GNKA 3CGIA 4NYOA 1FERA 4ES2A 1RWWB 4FNIA 1VJWA 3NLCA 5T7LB 2IMOA 2D7SA 4GO7X 3QLHA 2P9EA 3DLEB 1C4AA 1DQ8A 3DRSA 3UE2A 2QLWA 1C0TA 3BJYA 3ENQA 4M5MA 5KG0A 2WSFC 1TU0B 5D4NA 2UU9F 1RCOB 1N88A 2HURA 3N5FA 2IVFB 2V4JA 3R6LB 3OTCA 4NLQA 2AT1B 1XEZA 1XMOF 4IFYB 4OLPA 2OPQB 3C8YA 4USMA 1EB0A 5K8PA 1U25A 3MEEB 3HHNB 3P4UB 3MPVA 2RVJA 4URSA 4C0HA 3CB4A 3IRXB 5LSRA 3I96A 1ELOA 3TJ8A 3CIZA 4C8KA 3IAS9 4OZ0A 4B3RF 2HHPA 2CG8A 3E8OA 8ATCB 3AJDA 4DQSA 5J1EA 4CLSA 1HNIA 1JIHA 2B5JB 3Q24A 4FKXA 2L3MA 3K5PA 1ZZFA 2H4YB 1JLEA 1FNXH 2PGCA 2FDNA 3DDNA 4AUKA 1L3VA 1LWFB 4DUYF 1XN9A 2EBEA 3MAAA 3DXSX 4CRJA 3M8PA 2DHXA 2HFVA 5C42A 2XLIA 3LF0A 1EP4A 5J2NA 4WKRA 4KJIA 5BYSA 4DHVA 4O3QA 2RDJA 2CPYA 1O8BA 1AZSB 4KIAA 4KKOB 2AJ4A 3KKFA 4YY3J 1N5YB 5D77A 2KYZA 2LXIA 4DQRA 4LVOP 2IA0A 2DNQA 5HMWA 1OSCA 2B7CB 2WW8A 1G2EA 2AJQA 1S4FA 1UFLA 2BM0A 2QE5A 4P52A 1TK5A 1V6HA 1U45A 3M05A 1FF2A 2IY5B 3H2LA 2EK1A 1Z2LA 1HARA 2CQ0A 2HHVA 3BQ1A 3TVKA 3BN4A 4ZVFA 1M0SA 3CD7A 2CNOB 3IN5A 2MQLA 3N6LA 2R2UA 1XMBA 1URRA 3Q23A 1KOOA 2GC8A 1VFJA 3QSIA 2P8IA 2ADCA 3OFHA 1E6YB 1ZS6A 1WKLA 2PMWA 1RWOB 4MYUA 4L73A 3Q8VA 3NWRA 1N32J 2V2QA 5I3UA 1F9HA 1DTQB 4I2QA 3CCMS 1OQ3A 4DSEA 3EICA 2HVEA 3KNAA 2B4VA 2K7KA 3NRBA 3H42A 1TMJA 2LP4A 3S8SA 4IG3A 1IBMF 2BJ7A 3MPYA 4YDXA 4B9NA 4K4WA 3QRQA 1DRZA 5HROA 2GMJA 3WHIA 1RHUB 2V0NA 1IR2A 3RJMB 1UAWA 3KG4A 3HFKA 3IBCB 4DL7A 2GJIA 2KJVA 3SSRA 5BYRA 3U27A 3R7BB 4FYYB 4CLZA 1WOPA 1J5OB 3QT8A 1JLFA 1XERA 2CQIA 3A12A 1RQ0A 2PA8D 2GW8A 1WC6A 1JLQB 2D3UA 4N56A 1PYOB 3I5CA 3I82A 5KG7A 2BW2A 4DR6J 3OL8A 1V5IB 2F9DA 2JHEA 2RS2A 3OVAA 1U49A 3H98A 5F41A 2CJ9A 3ILIA 3THTA 3BREA 4NZ6A 2LU1A 2W2PP 2XLKA 2Y8WA 3NNAA 4KHPJ 1S0MA 4IOBA 4LBPA 2E9RX 3TARA 2XI3A 4ZITA 5KT3A 1A6LA 2BXJA 1X5SA 3DOLB 3CO0P 3W63A 1GMWD 5CABA 1IR1A 5CYQB 4M94A 3GJQB 4F3QA 2ZOFA 3UCGA 3ZNJ1 1FKAF 2C2RA 2HZCA 1F9EB 2DCUB 1L5UA 4B9MA 4P71A 3AQOA 5A8RB 3OTOJ 1T8EA 1LWEA 3T5JA 5K14B 1RAFB 3FZ2A 3HSJA 1RDRA 2EFPA 2GVZB 4ZJOA 4K4XA 4A46A 2FHJD 5A6PA 3CCJS 3OSPA 4DS5A 2W4DA 4MYTA 1X9WA 5KFOA 3R5DA 4WK1A 3EXYA 2H3EB 3MR6A 4DR6F 3DI6B 4M5KA 4EFAC 2QEXS 1H38A 1FD2A 2C3UA 1R31A 3BDPA 3ZZ0A 4ZCLA 4KHPF 3VGUA 4O3OA 3I0SB 2HHXA 3MM7A 2VDHA 1VHIA 1TVRA 2ZH7A 3T1YF 1I51B 2GV1A 3JSYA 2PDAA 2XMMA 2BZ2A 1VRUB 1HNZF 3WX4A 2ATLA 4BBYA 1JXLA 2WVCA 3QT5A 4UF4A 3RBDA 3S7RA 3M9NB 3AAWB 4UTGA 3O2IA 4DG1A 2BABA 3ZXWA 4O44B 5ETQA 2JDJA 2HAFA 2RQCA 3A3PB 5HQ8A 3PW5A 2YVSA 4K4ZA 4X65J 5ETMA
chains in the Genus database with same CATH topology
3G8SA 1N52B 1VQ6S 1QAJA 2RQ4A 3FSIA 1UWBA 2OSQA 3BF4A 3CJ3A 4DR1F 4CO0A 1ZZNA 1G7CB 1NHUA 5HBMA 3SSQA 4HT5A 5KFUA 2BV3A 2XGPA 4ZVHA 3IS9B 2KJWA 2YTCA 3V81B 4P2SA 1W25A 3OR1B 3G6ES 2C2EA 5F0WA 3SSSA 1U1KA 5B0EA 2KYXA 2ASDA 4DL0C 4BHQA 3M2VB 4W92B 3RTVA 3MM9B 2E1RA 4DG1B 4BS2A 2MKKA 1SIZA 4ZCMA 1CG2A 4LIRA 4CT9A 2F3JA 1KEKA 1HNXF 2HMIA 1DFDA 4DEZA 2VBYA 3T1AA 1U7LA 2DNYA 3C66A 4ED8A 4P7TA 5K8NA 1Q8IA 5J2PB 3SV3A 4LF4F 2V9WA 3KK1B 4IH7A 2OMLA 4O3PA 4NLDA 4QWDA 1S1XA 2ALZA 3CO9A 4D3GA 4OI6A 3EYZA 4QR1A 3OVSA 3T5KA 3N5BA 5KG6A 2OKQA 1D0EA 2M0GB 1R8CA 2QT7A 3LUYA 3FFIA 3TNVA 4CTAA 5KOXA 4PG4A 1YRUA 1UWBB 5IQ6A 4YB7A 1S1UA 2R4FA 3CC2S 4GKKF 1X7VA 3MOZA 5HBMB 2MZRA 2W25A 2ZC3A 2OJ3A 2ZH2A 2G1DA 2HHQA 3RRHA 1SJRA 4TYAA 1LFWA 3G71S 1ZBTA 2KU7A 4IO9Q 3VQSA 1KLMA 3GR0A 1Q53A 2OPSA 3EPIA 3CSKA 3S1TA 2YNFA 4DF4A 3WBZA 5L38A 3NMAA 4FF3A 2Q66A 1WI8A 3I4PA 1VBZA 3H5SA 3RB6A 4C9DA 4KSEB 4A8QA 2HMIB 1T3NA 2I8EA 4HH0A 3MEEA 3PDNA 4OIXA 2ZOGA 4Y6IA 4QBUA 5MAOA 2JEFA 3OSNA 4Q44A 2DIUA 1S1XB 3QO9A 5IT0A 2GX8A 2HG4A 3C2PA 2ZJRQ 2XCAA 3V6DA 4J9SA 1FNOA 5GADU 5FJ4A 3FFIB 3TX8A 2RDIA 1SKSA 3AH6A 4CTAB 1IBKF 2F8MA 4KTQA 4I7FA 4UUXA 4KBIA 2B9WA 1X4CA 1S1UB 1CSJA 1RISA 2DISA 4XPEA 4A8YA 4WJBA 2VV5A 3DM2A 2ZHBA 5J2QA 2XNRA 4B08A 3Q8PB 4PXDA 4RW9A 1RT2B 2NSCA 4X64F 2Z4PA 1SH2A 2BBEA 1KLMB 1X4GA 2CPHA 3Q0AA 3D54A 4RW7A 2JJ4D 2YNFB 5M2PA 3SI8A 2DNMA 1N5TA 2QV6A 1WWHA 3K2YA 4FXVA 1T03A 1FTCA 3MM8A 3TAMA 1QUPA 3GE9A 1TP7A 3HKWA 3NKYA 3IGVA 3THPA 5B7WA 4YR2A 4WK3A 3PKYA 4QW8A 1FVQA 2DNNA 4WFXA 1HNWF 2R2SA 5GMKa 3CXCR 4DFPA 2R7SA 3E51A 2R8JA 2KDOA 3T9NA 1NKCA 4NLVA 3QO9B 4B3OA 5GAEU 3RAQA 1RT3A 4ED7A 1PILA 2LDIA 2PC6A 3V6DB 2V8VA 1KNZA 3H20A 4UY8T 4A8XA 3GIJA 3JTPA 1G1XA 1YJRA 2DBBA 4CH7A 1NNDA 3ZZOA 1C0UA 1NJIT 5KG1A 4I7FB 2ZZNA 2CQ4A 2QZ8A 1HBOA 1PSDA 3LO3A 4P7VA 2JZ5A 3FVYA 5IXUA 3J7YU 4TKTA 3DM2B 4XK8C 5J2QB 3UD4P 3H5UA 2J7KA 4RUHA 2BE2A 3C6UA 4RW9B 3KFWX 3CC7S 2R7XA 4USHA 3BS9A 3PFEA 5B0CA 2GHVC 2IC3A 1YRTA 1HWIA 1V3RA 1NK8A 2IAJA 1VQ9S 4BDPA 3MMCA 3CJKA 1T03B 4KR0B 4NLUA 4ZCIA 1K1QA 5EWEA 3TAMB 1S9EB 4RNOA 1V9OA 2FIUA 2KB2A 2NS1B 4UQTA 4EYIB 2VODA 3G8TA 2N4CA 2KZZA 4JOUA 1BQXA 3CTRA 2ZM6F 2ZKUA 3J80Y 2MZSA 1U4BA 2HLUA 7FDRA 1NK0A 4QZVB 3IA0A 2W8KA 3PKMA 4B3OB 2V8GA 1RI7A 1RT3B 4ZOSA 4AQYF 1IKVA 3NCQA 2JWNA 2XI2A 5B0FA 4DV4F 5A8WA 2MQQA 2ROGA 4J9QA 1PC5A 2ZNZA 2W9AA 1WG1A 1C0UB 2VL1A 1RT4A 2K7JA 1HBOB 1YGYA 1KD1T 2X1AA 2AWZA 3PVXA 2LEBA 2RKIA 3F41A 3K59A 3V2UC 2E5LF 4LFCF 4TLQA 4DL6A 3D2WA 2J9DE 2BE2B 2DHAA 2CG4A 4EYHB 2J9DA 3C6UB 5AE2A 4MIAA 1RKJA 4RBUA 4K4UA 3KTQA 2M5YA 2MZQA 3N6MA 4OHYA 4H4MA 2ZDOA 2IC3B 3FZBA 4ZKAA 4AL6A 5F0UA 3ISNC 1ZTTA 1G6BA 2IAJB 1WG5A 2WSEC 3IC1A 1LFPA 3MMCB 2I1RA 2VG7A 4UOCA 4C2MA 2DIVA 1R6YA 3BGFA 2N7CA 3I5BA 1FRHA 1WHWA 4LFAF 1XK8A 2J0XA 1RTIA 3DLHA 4ZP7A 3I31A 4F26A 5LXRA 2DVIA 5KG5A 2JC0A 2W7OA 5KFAA 3I56S 3JYTA 3EGZA 4TQRA 2ZH4A 4LF9F 1A7GE 1LOUA 5KFVA 5KFRA 1YHQS 1S48A 1YRXA 2BUNA 2EBGA 2RT3A 1IKVB 3VTIA 1AFJA 5HLFB 4AYBD 2UUAF 1X4EA 5T14A 1FDAA 2LA6A 3KK3A 2X1GA 3P3DA 1YTYA 4B9TA 2X51A 1NK5A 1TAUA 4Y34A 1HD0A 1Y3KA 1VC0A 4DN9A 2KZMA 4WYLA 1N8RT 3I9ZA 2Q3PA 3FRYA 3M32A 2R7RA 4IG0A 3BO2A 4WZMA 1R8AA 2RKIB 3FSXA 2D74B 3G6VA 1M5PC 1O51A 4Q8FA 4LSLB 1WHYA 1ZAXA 2J8AA 1U1PA 4LIWA 2R2RA 1FTRA 2IJNA 4C4WA 3HZGA 1FJEB 4WU3A 4DPOA 3UQSA 2AYEA 3HX9A 2OMOA 3PJXA 4ZPDA 2OFGX 3B8HA 2UUWA 2M4MA 2VG7B 1LK5A 2J0WA 3KLHA 4CT8A 4HYKA 2W9BB 3NP5A 2VKRA 3NWGA 1YJ9S 4ZVEA 1RTIB 1B0VA 3HVRA 1BQMA 1NJWA 4URQU 1U24A 2WK4A 3HP6A 3JYTB 2BRKA 1GQEA 4RU9A 3NAHA 4IFVA 2XY6A 2BYCA 1HBNA 2W9CA 4CO3A 1YJNS 2M7SA 5DLFA 4JV1A 4NCBA 3PM9A 3KK3B 2D9PA 1BY9A 3PR4A 1QUVA 4CCHA 3P6YC 1S6QB 2E1CA 4L6V3 1FRMA 2HQ3A 2AD9A 2P6SA 5LL6d 1V3SA 2IYIA 1VMBA 1QSLA 3M32B 4IG0B 3CJ0A 4OMFG 4OZ5A 3GG0A 1TKXA 1HWLA 1ZM9A 3QZ7A 3D1HA 4F25A 3P96A 4F67A 1GT8A 4G1IA 4ECWA 4NRTA 4E8UA 3KLGA 1MW7A 2FJBB 3U02A 3V4MA 1JLGA 2L48A 2HVIA 4IOCQ 5HMZA 4DFJA 1CLFA 4ZPAA 2HYIB 4ZPCA 2M52A 2LDYA 2MDAA 4YEAA 3EZUA 3R3TA 2CPDA 3T6JA 2XC9A 2A3JA 2VD3A 4URGA 1YITS 4ED2A 4XPCA 3V6KA 2BR0A 2VFVA 4HKQA 5KFEA 2OPRA 4MIWA 4NLGA 4BWJA 3NCRA 4IFVB 5KT5A 1DTTB 2ACYA 4DX8H 1SJFA 4FF4A 2QMXA 2ZVSA 4H54A 2W9CB 3DU6A 4JI6F 1T3OA 4WU2A 2GHPA 4YHHF 4Y3CA 4A8WA 5HP1A 4TNOA 4RNNA 3TOQA 2A18A 1AXQA 2V94A 3OV7A 2P9CA 3M9MB 5D8HB 2HAIA 3ZZYA 4IO1A 4I6YA 1O5JA 2RRNA 3UNGC 5KFCA 4OQJA 2FLPA 1FXDA 2HLTA 2A2CA 4ZPBA 4DFMA 1H2TZ 2GO8A 2VOPA 3A8EA 4QQBA 1TKXB 3PZPA 1HR0F 3HO1A 4I0WA 3HPOA 3J7Z5 2FHKA 1SH0A 2JFDA 4EBEA 2UVUA 2WOMA 1KS2A 4JI3F 3TVZA 3TRGA 4ETXA 2VBZA 1Y3JA 1NKEA 2ZHOA 3KLGB 1VQPS 2AQ4A 4OFZA 2EFQA 1NK6A 3MGJA 1JLGB 4I6WA 1DLOA 4EBCA 3RAXA 1WEXA 2Z2LA 4KO0A 1CQNA 1ZH5A 2RF2B 2G4BA 1TZ0A 4N76A 1URNA 3TAPA 4AFFA 4RBTA 3CCES 3LGNA 1VIXA 1U2RA 2YKMA 4NLWA 2C3OA 4NLSA 3RU0A 2OPRB 1VQSA 3U1LA 2V8HA 2YQ3A 3AA9A 1IR0A 4C8OA 2MHEA 1VHFA 4RNFA 3M1VA 2CRLA 3R5BA 5BYQA 3D5MA 5HP1B 2FLNA 4DLGA 4DR3F 1MMDA 2FVQA 3PHEA 1MNEA 4RLEA 5K5MA 2OPPA 4C0OC 1FEHA 3DOLA 2QFJA 2M2BA 4DL4A 5IT4A 4EGLA 1T7PA 4KRWA 1TL4A 5CYQA 3GILA 1D1UA 4FXWA 2VQFF 2WOMB 4M63A 1C1CA 1P8GA 2O66A 1KQSR 4NLRA 5KFWA 1RWUA 2IM3A 3CCLS 3SZ2A 4MIBA 2Q6CA 3CJ5A 1DLOB 2KXNB 2ZH3A 2UP1A 3LWMA 3AQPA 4KO0B 1S9GA 2MHNA 3R1HA 4ECUA 4Q0BA 2HIQA 1KFSA 1IJEB 2LYVA 3L7OA 3MECB 4IRCA 2P6TA 5A8RA 1M90T 3K5NA 1FJCA 1Y5IB 2JEIA 2YKMB 1M5OC 3OLBA 3OL7A 4MKYA 4R0JA 2IVYA 1YBAA 4PG8A 1R0AA 3BN7A 3W2VA 3IWXA 2D1CA 3CCWA 3IR5B 5IFMA 3PJWA 3R5AA 4FN5A 4O3RA 4WFAQ 2UUBF 3M1VB 4DSJA 3CF5Q 2DNKA 2KXFA 1GTHA 3KG0A 3ZFVA 2NUHA 4OZJA 1UFWA 5D78A 2KRBA 3FMWA 1U6BA 3CD5A 3CVKA 4MFBA 2UVRA 1E6VA 1RGVA 4KQZA 5SUHA 5LXYA 4WCEQ 4DDFA 4OX8A 2KHDA 2MY7A 1TKZA 4YB5A 5DLGA 1NU4A 4NLOA 1WEZA 3OTDA 3PO5A 1AUDA 3O6QA 4O23A 5FLXY 5DGAA 5F8IA 4CH1A 2J9CA 3N4WA 4JI8F 5KFLA 3M4XA 4X4RA 1C1CB 3ZC4A 2IMWP 2M8DB 3SFGA 4K2XA 2K3IA 3IWNC 3VAIA 1RK8A 2YNIA 2MXYA 2AYBA 2EI5A 4OZLA 2GIRA 2VFTA 3DI6A 4HTJA 3B78A 5EGYA 2N82B 2DNPA 1WEYA 2ZITA 1S9GB 2HQIA 2QRRA 3CDEA 4Q0BB 2B56A 3LP1A 3Q2TC 2KT5A 2ABYA 1FRXA 4DR4F 1FRJA 2BOPA 1KHWA 1Q16B 4HHJA 2JX2A 1QY7A 1DAXA 5B08A 2R7VA 2BDPA 1IQTA 5HI7A 2EWHA 3W2VB 1K8AT 3G86A 1M1KT 2KT2A 2K1RA 3H2UB 2FC9A 5EHHA 1WTFA 2IBOA 3AA8A 4HI1A 1QTMA 4IKAA 2D3ZA 4DV5F 3KHHA 4M95A 4X4UA 3M2UA 2SXLA 1Y00A 1KC8T 4WFYA 5KFKA 4MFBB 1VQMS 2HHUA 1TAQA 1E6VB 4X84A 3X1LB 1KTVA 3TAQA 3I5AA 3TA2A 1TKZB 4FXDA 4ED1A 4ED6A 2RH3A 2B4OA 2QLXA 1LXJA 4FPRA 2MQMA 3NL0A 4FF1A 2P9GA 1MROA 4TU9A 3N0VA 2XSJB 3HHDA 2G0CA 2R2TA 2YNIB 5T41A 1TKTA 1IUJA 4PR6A 1VS3A 3K5OA 3MMJA 5KTQA 3K57A 2ZFHA 1Y5NB 3POTA 5J2MA 3LOUA 2HHTA 5M2RA 3T5HA 1HW9A 5EWGA 2HFOA 4C8MA 2YX7A 4FS1A 1TR0A 2A10A 4Q7AA 2VG6A 3AB4B 4NL5A 4JI5F 4OL8A 1TQLA 4ITSA 2PMZD 2K1RB 4OX6A 2CPXA 3DHXA 2PMHA 4NZ7A 2DGTA 3BO4A 3HK2A 4MAKA 2WSCC 4I64A 3NNHA 2HNDA 4RWXA 3GFZA 2FGCA 4B9LA 4OHXA 5ITHA 3TR5A 1JWWA 2B4UA 2CQHA 2XO7A 1NK4A 3MAHA 4G3IA 4K4TA 4K4VA 5F8LA 4NOHA 2RUGA 4Q2LA 4LQ3A 4JV5F 4DL5A 3BR9A 4D3HA 5F8JA 4JV0A 1MROB 2HS0A 4DV2F 3KYLA 1MWYA 2ZDPA 3RB4A 5K8MA 3K58A 5EN1A 1TL1A 1HD1A 1SL0A 1TKTB 2CJAA 5D3GA 4ED5A 3S01A 4UUWA 3C6TA 1V3ZA 2M8HA 3POTB 1D9FA 5GAEI 5J2MB 3NMRA 4J9NA 4Y2AA 3M8SA 3T1HF 5E3AA 3QJPA 5DDQC 3M2VA 4IRDA 5F3TA 1DHMA 2VG6B 4H4KC 4JBCA 1MWZA 5JUMA 4MK8A 2ZBIA 2DO0A 1PGZA 1WD6A 2PIIA 1EETA 5F9LA 5IWAF 4OJ3A 2LEPA 2UUTA 5SZTA 1RT1A 3J7YI 3OTBA 2HNZB 4JYAF 1FVSA 4FZVA 2HNDB 4NMLA 4DSLA 1L3KA 2E7WA 3CT9A 4M1KA 2BM1A 3VWSA 4LF8F 5L1LA 1I6JA 1RAJA 2E5IA 3JTOA 4DQPA 4NYZA 1RT5B 1RTDB 1QLNA 3F56A 2C3PA 2NLWA 1F5CA 2KFNA 4C11A 2C22A 1SUQA 3QJJA 1AROP 4PRFA 3QGPA 1D8YA 2DJWA 4F2SA 2YNHB 4U9RA 4DJBA 1FKOA 4LUBA 2J7UA 3MEKA 5KFYA 4YDDB 4QWAA 5JVHQ 4MK7A 3FJ2A 1N0VC 2JOQA 3O5TB 3PEHA 1TL1B 4ZA1A 4K0KF 4CQ1A 1SIWB 1AW0A 1D8ZA 4DWIA 2BJEA 2ERRA 5D3GB 1KONA 3C6TB 3R1LA 5KFMA 4OV1A 1UW4A 2J7WA 2GQQA 5M2UA 5EX0A 4U7UK 2F7VA 2HRUA 1WHXA 1JJ4A 3IO1A 3LGMA 1WF0A 2NYIA 5LJ3Y 2NXUA 2APOA 4RUAA 2CQDA 1EETB 3DYAB 5DETA 2FJAB 2ZH5A 4X4VA 1VQ4S 1RT1B 1FDBA 5DG9A 2IM0A 5L8RC 3AHPA 2LQ9A 4R5PA 2YH1A 3PACA 1S77D 3ZZTA 1VBYA 4ECYA 2KHCA 4J9RA 2ADBA 2KH9A 3J81Y 1S6OA 2LXFA 2RQKA 4KHMA 3GMGA 3VALA 2L08A 4NX9A 1U1RA 1HL6A 3PY8A 3D1OA 4BC7A 1VLYA 4NLPA 1SUQB 4C11B 1YJWS 1F2GA 1GX5A 3ZZZA 4EZ9A 3SQGA 2CQGA 1H2UX 3FSYA 5BJRA 4HVZA 3NNCA 3GQCA 3GFHA 2KG0A 2I0XA 1FKOB 3R5CA 4F4YA 4F8RA 4MJKA 2AGQA 5DGBA 2O01C 3OHAA 1H3DA 3QGIA 1KQKA 1SB6A 1NJZA 3PV8A 2LEAA 1IKWA 2WB1D 5C25A 4C0BA 5JVGQ 2X1BA 4RWWA 2RNEA 2WRMA 3FRZA 1Z4UA 1UJ4A 1RT2A 2YKQA 3UWTA 2DGQA 1DZ5A 2WCXA 1K0TA 4KV8A 1YWXA 1SKRA 3E2EA 3MEGA 4QR0A