2NQPA

Crystal structure of pseudoudirinde synthase trua in complex with leucyl trna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Isomerase/rna
molecule keywords transfer RNA
total genus 80
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.4.99.12: tRNA pseudouridine(38-40) synthase.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01416 PseudoU_synth_1 tRNA pseudouridine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA01
3.30.70.660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA02
1DJ0A 1VS3A 4ITSA 2NR0A 4NZ7A 4IQMA 2OMLA 4J37A 4NZ6A 2NREA 1VIOA 2NQPA 2GMLA 2OLWA
chains in the Genus database with same CATH superfamily
1U6FA 3OT9A 1UWBB 1UEKA 2ZKUA 3FEZA 5I3UB 4QWDA 4USVA 3UNYA 3VV2B 4DR2J 4HR2A 1CJKB 1EP4B 1LK7A 1M1HA 1JXEA 1RT3A 2B4VA 4J9KA 1VQNS 2CPJA 1B7FA 3ETMA 3FK4A 3WZ0A 1JLFA 3M9MB 3KLHA 4M5GA 1CJKA 3FDSA 1LWCA 2MZJA 2KB2A 1GQEA 2ZNYA 3M1VB 5KFIA 2HFVA 3BKUA 4DI6A 4FS2A 1M90T 2VKZG 5G4DA 2J8AA 2NUUG 2OI2A 1WHVA 1KVKA 1SKUB 3EZOA 4CO3A 2OEJA 1REGX 2YKAA 2FVCA 1KTVA 1H6KX 4F4AA 5F8LA 3S7RA 5B0GA 1FKOA 1FX2A 2BABA 4RLEA 4NA1A 1RAGB 2FC8A 4NRTA 2KXFA 2NXNA 3TAPA 2BEFA 4I2QB 1U1NA 1HBMB 2CPIA 1JLGB 3ZTRA 4NI2B 2UV8A 1VR6A 4M5JA 4Y3CA 4AD6A 4R8UB 4TVAB 1VK3A 4UUXA 3BYPA 2BW7A 1NLKL 4NASA 2V4QA 1K73T 1T9VA 1RADB 3DFEA 3AJ2A 4WBFA 1B99A 2IHR1 1YVFA 3OTOF 3VAFA 3L09A 4U67Q 3NCPA 3DRRB 3J81j 1XNQF 2HHXA 1EX8A 1R8PA 2IMOA 1H2TZ 2DITA 1HBMA 3GJRB 3ILIA 5KFAA 1VQ7S 4JI8J 3VHQA 2B9EA 5D77A 4CT8A 3BO3A 3MM7A 2B9YA 4N56A 4FS1A 3CCQS 1BQNA 2HKEA 5C24A 2Z2LA 5A8RB 4OX9J 3KOAA 5F8JA 4ID8A 4RL1A 1TL1B 3UD5A 1RAHB 4DZ6A 2LQBA 1MNEA 2W24A 4IH6A 1WD6A 2XLJA 4WE1A 4RNHA 4JV5J 2J8SA 3W2VB 1B64A 2RILA 3OQ2A 2VFRA 3J7YU 3L3CA 1JLGA 3ISNC 2XG8A 3NWRA 4B17A 4A46A 1VHFA 1J5EJ 3BDPA 3CC2S 3PDNA 6AT1B 3RB4A 1JLQB 1WOPA 2J9DE 3D0GE 4UF4A 4OZ3A 4DDFA 1S6QA 2R8KA 2XWYA 3BR8A 2EEYA 3M8QA 3UDCA 2EFOA 3CCLS 1HR0F 1V3SA 2VA3A 4MMOA 4QIFA 2ZBRA 3CMES 1ZZFA 4CLPA 4WK1A 2D41A 2HRTA 3SQGA 3A13A 1FEHA 3EGWB 3F56A 3I31A 3KNGA 2HGNA 4WKRA 3MMCB 4ITSA 3D1HA 3AFGA 4W4MA 2RF2A 3RBZA 4BHQA 5FJ4A 3ITHA 4DSKA 2K7KA 5DGAA 4DUYJ 2PD1A 4DV1J 3LGNA 4OYPA 2OTJS 3PJ9A 3ZZZA 5IQQA 1NEEA 2DO4A 3VCDA 1Y10A 4LMZA 1W26A 2FYXA 4O0IA 1JLFB 1RWWB 4DZDA 2M5YA 3MPYA 5I3QA 3M2UA 4KHMA 3CMQA 1UA0A 4TQSA 5D8HB 1HWUA 2QL9B 1IVZA 5C5JA 1FD2A 1EJ7L 1I94F 2L9NA 4EUVA 2YWFA 2VPZB 2IM3A 5K8OA 4ZJQA 1KFDA 1CC8A 2B4PA 2V4JA 2O1PA 3NAHA 1TL1A 4I1TA 4DPWA 2QSFA 3PJXA 2ZH8A 4EBCA 3MXHP 5D4NA 3GV5B 3PW0A 4G1QA 4B08A 4ZKAA 1KHVA 2YBVA 3SFUA 2I8EA 2OPSA 3M8WA 4YB6A 1RBLA 3FQKA 4QOTA 5ETQA 2BJDA 3R6LB 4PYAA 4X64J 4NXMF 1F9EB 3S8SA 1JKHB 1CPZA 5THWA 4ZCKA 3IGVA 4PEOA 4DV6J 2BJ8A 1X60A 4PXEA 4DX5A 5EN1A 4U8VA 2CPZA 1KKHA 2MKIA 2ZUAA 1F0XA 1P8GA 4QQBA 2HQIA 5B0FA 3W62A 1T8EA 2AJQA 3FNNA 4O44A 3G82B 1N5SA 3ZTQA 1L3KA 1RWVB 3DDIA 2YKNB 4X66F 4ED1A 5IWAF 2MQMA 1TKTB 3PX0A 1VRUA 3P3DA 3RUBL 2BYCA 1GXLA 2IC3B 3JTPA 5GAHI 2EK6A 3M2VA 3ADAC 4A8FA 1FRJA 4X65J 3CJ3A 2I38A 1EARA 1V3ZA 2UXDJ 1BY9A 3GJSB 1WACA 2V9WA 2N7YA 4ES1A 1CC7A 1H73A 1MMNA 2NSBA 4OJ3A 5CZXA 1SUQB 1X4BA 3KLFB 3LALA 3V81B 5M2RA 1AXQA 1S57A 3OV7A 4A8WA 2FIUA 2R8IA 3CEDA 2E1PA 3MM8B 3TI0A 4HVZA 4LRAA 4NLPA 4WFYA 1KQFB 2XQCA 1JJHA 1Q86T 1K0TA 5LMNF 2LVWA 1NPRA 2Q6BA 2FHOB 2RDDA 4JI2F 4BCAA 4X65F 4YFUA 2W9CA 1N54B 1FDAA 4CO4A 1MSWD 2KU7A 4I64A 1S1UA 3MECB 4S0MA 5D4OA 4RW8A 1UVKA 1LW0A 1TKXB 4A8XA 1SC6A 2B43A 2CIMA 2VQEJ 1AFIA 3A8IA 2DGUA 1MMLA 1UWBA 3W8GA 1GT8A 3H5XA 3JS9A 3VGUA 4NLGA 2OH2A 2MHEA 4LF8J 4N8OA 4CYUB 2COLA 4K8RA 4X62F 4YEAA 1JLCB 2LECA 1HNVB 3WIUA 3NOGA 5B0DA 4Y0FA 5I3PA 1KQSR 1S9EA 3A8JA 1B0TA 3N5BA 3FEYB 4E98A 1PJ5A 1YJ7A 2IAJA 3NKYA 1RT6B 3EDQB 1FDBA 1D9AA 1N88A 2VKRA 3IO1A 1JXLA 2UXDF 1NUEA 3QIPA 1SH0A 5IS2A 1RWMB 2AJFE 3R9LA 4ECWA 5CYJA 2G0IA 2F40A 2HHUA 2AZ3A 2FHJD 2J7UA 5F8GA 3BBBA 4QIVA 3NGDA 4DR3J 1N8RT 4K4WA 4C8LA 3OL9A 4DCPB 4OHVA 3G6XA 1UPPA 3ENQA 3FKBA 3NAIA 4DV3F 2UU9J 4HH0A 5L1JA 4EEYA 4P71A 4LFAJ 4F26A 3IS9A 1IR2A 2V50A 5CAAA 4AL6A 2EFVA 2E1RA 4PUOB 3WBZA 2VFSA 2MZSA 4OHWA 3QBCA 3WIVA 1S9GB 1TAQA 2GO9A 1UVMA 3TEHB 4ZVOB 4P72A 3PKMA 1VCTA 2O5DA 3H7HB 5ETRA 1FDNA 1GMWA 3W5YA 1CJVA 1WHWA 1HPZA 2DGVA 3DLKB 1U8WA 1HBUB 1GX5A 4IDKA 4NLQA 4ZPCA 2QTWA 3I0SA 4CH0S 5LXYA 3R1LA 1N56A 1JNRB 2CVEA 2XYPB 2CQHA 2VC1A 4X2BA 1KVJA 2VB6A 2VICA 2NZ4A 2CQPA 2F9DA 4I2PA 1X8DA 3KNAA 2HHHF 3NLCA 2GGPA 3JAMU 3C6TB 5DO2A 4Y2AA 2E5GA 2NPFA 5LSLA 1PYOB 3PCOB 1I94J 1PBUA 5ETTA 1T3OA 4U8YA 1D9FA 2RT3A 1RGVA 1WF2A 3HSDA 3PEHA 4GVBA 4P2XA 4ZPVR 2E9ZA 4PWDB 1YBTA 1YJTA 1TL7A 3FFIA 4AQYF 4QW9A 4B9TA 4E0DA 4J9SA 1NJWA 4XPEA 4YDDB 3VAJA 3ZZYA 4HYKA 2QA1A 4AE5A 2HIYA 3UDLA 2JVRA 4G6VB 4EI2A 2SXLA 1X9WA 3GFXA 4I2PB 3H25A 1R0AA 4X62J 2DVIA 3OFEA 2D3UA 3H42A 3KHGA 4GKJF 4TQRA 3BPSP 1FXDA 1P1TA 1GTEA 3HHLC 3K5PA 4O3OA 2FHKA 2W2OP 2IRYA 4ICLA 4URQU 5F0WA 1QLNA 1Q78A 2FY1A 3HULA 4EZ6A 1RTJB 2QYGA 2UUTA 2XY5A 2BJ9A 2ZC4A 2J7WA 3VGVA 2MYFA 3T5KA 1X7VA 2VPWB 4I68A 1UVIA 3SMZA 2C2OB 4F0KA 1U49A 2VG6A 2VBXA 3MM6A 3US5A 2D1CA 2WK4A 1TV6A 2WVDA 1FKPB 1RXOB 4FYWB 3F41A 3IBCB 5F0UA 2R7SA 4I56A 2I1RA 3OJSA 3MMJA 3CCWA 2FHJA 1VRTB 1RTDA 4NCGB 2GMHA 2ROPA 3MHYA 1RT2B 4K4TA 2CPYA 1S77D 4LSLB 7FDRA 2K1RB 1C2PA 1F2HA 1KONA 1T9TA 1UKUA 2GZOA 4LIRA 4WU3A 3W9IA 4MT1A 5LXRA 1DRZA 1WG1A 4JI8F 1ZPVA 2GHVC 1ZOTA 2E5LJ 2LEPA 2P9CA 3CDEA 1ZM4A 4DEZA 2VPXB 5CD4A 1TKZB 5LSOA 3S01A 1G1XA 2ZHOA 3BF4A 4EGLA 1TK5A 3R8YA 5DG7A 5LL6d 1U26A 4KC5A 3NBPB 2XNQA 2DR5A 3Q8VA 3T3FA 3V4IA 5CZVA 2KRBA 4M5MA 3EGNA 4PWUA 2AYBA 3B4DA 4KHRA 1S1UB 5F41A 5LMUJ 4J9NA 3S6EA 2LEBA 4I67A 2LLZA 2EXUA 2ZM6J 2P8IA 2CJBA 3VQSA 2F63A 1CJUA 3UPFA 2DGSA 2BVZA 2W9CB 4X64F 4NXMJ 2ZZMA 1XWLA 2YVSA 4FP9A 2CA9A 4OYZA 2OPRB 3TVKA 2AWZA 6FD1A 1XNRF 1KP6A 1AFJA 5GMEA 3UQSA 5KFVA 3EZ5A 1WKLA 1U2CA 2IYIA 2BOAA 2HWHA 1DTTB 3G8TA 1FRXA 2G2YA 4ED4A 4LREA 2W2NP 2ZOMA 1NJIT 1Q82T 4NLRA 1RJJA 2RQMA 3MEGB 2F8HA 1UAWA 3OSPA 2VHGA 3KTQA 3NMAA 4FXDA 4PG6A 1RK8A 1S79A 1Q5VA 3NS7B 4ZPTR 3MD1A 4WKYA 2XZWA 3Q8UA 1CJUB 4Q2LA 5EWEA 2J7KA 4DL6A 1IBMJ 3QT5A 5F9LA 2E1CA 2UXBF 2APOA 3WX8A 2XMKA 5H1SV 2G1HA 4NZ6A 3PG9A 2MQOA 3D54A 4EYHB 2QG9B 5CQGA 4WF9Q 3LP1A 3MR2A 4X4SA 4WIQA 3SSRA 1OSDA 2H5JB 3ISND 3ZTPA 1N32F 3NS5A 9ATCB 2VV5A 4IRKA 4JI4F 2IAJB 2H4YB 1H74A 1E6VB 2ZH5A 3OTBA 8RUCA 2VBYA 4DLEA 2GHWA 2RAQA 4AT1B 3K5NA 5I4MA 3W64A 2JLFA 1K47A 3KJNB 1RKJA 3R5BA 4DQIA 1I1GA 3CPWR 1BQMA 2BANB 4O4GA 4IOCQ 2HNYB 3HZGA 2QFJA 3T6BA 3VTIA 2WOMB 4DV5F 2OPPA 3IR7B 3PEJA 4F0MA 2ASJA 1YWXA 1NK9A 2DR7A 1OS5A 1CQNA 2VIHA 1LW2B 3GWCA 3EDRB 4LF7J 1DTQA 5HSPA 5FDLB 2V8DA 5CYQB 1YG0A 3SI8A 3RBDA 1S4EA 5D6GA 1JLEB 1S7IA 5KG3A 4QWCA 5H9EJ 1H7XA 5C25A 4DPUA 3BGRA 3W1YC 1RAOA 4JB8B 1KLNA 1HWJA 3EXCX 4DV2F 2RB7A 1IUJA 4OQJA 2B6AB 4TN2A 2Q43A 3OVSA 3HZEA 2HHHJ 1R0AB 1UPMB 3U27A 1S6QB 1IKWB 4YB7A 3WX4A 4AXIA 4IO9Q 4ZMMA 4UT4A 3GLJA 4D3HA 1TAUA 3MM5B 2DXFA 2WB1D 3A12A 5KT4A 2VG7A 1N5QA 4EMDA 4CTAA 3EYZA 1F9HA 1T03A 4JI7J 3DRSB 2LQ5A 2R9LA 4OX8A 2JEJA 4KO0A 1SH2A 3AA9A 2AP6A 2UXCF 4Y2CA 5D4LA 4LBPA 4XPCA 2ZBIA 3LP0B 5K9FA 4YN3B 2I6WA 4L76A 3W60A 2W4PA 2X7IA 2DJWA 3IAM9 4C3MA 4USJC 2N3OA 2N3LA 3IXQA 2IRUA 1EHWA 2ZWPA 2LEAA 1RZMA 4HTIA 8AT1B 2B7CB 2HHVA 3R5DA 4PZVA 4LRDA 5KFTA 3UNGC 4PG8A 4YQWA 3UVJA 2BV3A 2ASLA 3I32A 3FEXB 1HW8A 2GX8A 2VZ9A 5HVGA 1XMQF 3H4BA 2RQ4A 4NL5A 2IY5B 3CIZA 4HT7A 3UVJB 1NJZA 2AGPA 1DY3A 2NCKL 4F2RA 1NAQA 4KKOA 5KFHA 2Z2YB 3AD9C 4YB1P 3SSQA 4J9RA 1SKSA 2HMIB 2MB0B 3SDEB 3SCKE 4ZLJA 1NO8A 1WSRA 2HNDB 3ENAA 5GAGU 3HFVA 3PM9A 3NNAA 2N82B 2ROEA 1U1LA 1T3NA 3IWNC 2FY8A 3D6FB 5HL7Q 2HYIB 1ZH5A 2VOOA 1Q79A 4DV2J 1LFWA 1CG2A 3FJ2A 4Q7AA 4M5HA 2Y0SD 4YMEA 2CJXB 2IM2A 2CQGA 2K06A 2AU0A 2OPSB 1BD6A 1BMQB 2W2MP 3HD1A 5ETLA 1KHWA 2CNOB 3MTKA 4Q0BB 2KHCA 2W8KA 2BACA 1REVB 3EPIA 3MR7A 3BO4A 2DR8A 1ZETA 2YNFB 1B0PA 5J1EB 3BGRB 3QZ8A 2UVWA 3R27A 4EU0A 1YTYA 2C28A 5L8RC 4CO0A 3B78A 1RT5B 4DR1F 4DWIA 3MAHA 2H1YA 3GU0A 4MK9A 2ASYA 1PIEA 3CJRA 1LWFB 1N5YB 3D1OA 5CYQA 2ZUGA 1Z2LA 5EHHA 1EKRA 3GB0A 1FVSA 3IRXB 2KG0A 1NKCA 2GVDB 1ULRA 1OQ6A 3SFGA 1IBMF 2ATLA 2OLWA 2CJAA 3AODA 1GNKA 4C4WA 4F3MA 5IT9U 3I0RB 2BJEA 1RYRA 1QUPA 2VOPA 2V34A 2ZBCA 1T7PA 3AH6A 3KHRA 4F8RA 3Q8YA 2BRLA 2R2UA 2XHCA 2XMUA 3N9UC 5KT7A 3VAHA 5C24B 5DDOC 1QSSA 1UJ4A 2ATCB 2HNYA 2N4DA 2RDIA 2W2QP 3CSKA 4G65A 2QLFB 3I9V9 3U7JA 5IC4B 4Q44A 2IVYA 2GAGC 3R3TA 1WSVA 3J80U 2FJDB 3DLHA 1CJTB 2IBOA 2C42A 3JYTA 1WTBA 2KXHA 2XS7A 2R2TA 1VQMS 4CLKA 3NEKA 3SSSA 1OO0B 2DTJA 2R7UA 1C1BB 4RNFA 5D0GA 4ANCA 4KB7A 2C3UA 1T02A 4ZN3A 3LPEA 1M5KC 4RWWA 3PJWA 3DOKB 1WI6A 1RHQB 1PJ6A 3W2WB 4D3GA 2OPPB 2MSTA 4DV3J 2UU9F 3DDNA 2VBZA 3VVUA 3VVTA 1VJQA 5D0HA 2ZVSA 4ZPBA 2YQ3A 5FD1A 4KPYA 1H38A 5KTQA 1PGZA 3F73A 3PTWA 3MOJB 2HK3A 3BB5A 3GONA 1RE1B 3NNHA 4LRBA 1NK8A 3BO2A 2JOQA 3N6MA 1CBKA 2GQCA 4F4XA 2XMMA 3DRRA 4RPFA 2MMYA 1KRPA 3PXGa 3CD0A 4JI5F 4OZ2A 1WTFA 3CT9A 3QT8A 1T95A 5KG4A 2PI5A 1QY7A 4WXWA 1VBYA 4LFBJ 4Y2MA 5J1NA 5DRKA 1H2VZ 2AGQA 3EVMA 2Y0BB 2CZ9A 2L08A 2C2KB 3HDSA 4OLOA 2EG1A 2F8EX 3I55S 4RNOA 3E01A 2ALZA 1F6TA 1KQGB 1NSKL 2Z2MA 3D67A 1EZZB 1NH8A 2BMBA 3I5BA 1FRMA 3MR6A 1U48A 3G87A 2QC3A 2YH0A 2ZD1B 4KPCA 4LF1A 4JI0F 5I3UA 4CTAB 2FJVA 1RAEB 1NDLA 1RTHB 2ZE2A 4XAKA 4NXNJ 2R7TA 2E5JA 3OFGA 2NXEA 3BEGB 5CYMB 4CM2A 1HQUA 4M5DA 4ZHRA 1HW9A 1NRKA 1OY9A 1TL5A 4I6WA 4JI3F 3HHLD 1HMVA 2WRMA 1FFGB 2VU5A 4RBUA 5KG7A 2B6AA 1NZ8A 4DL7A 3MUVP 4N5SA 3G2XA 1AYEA 3U1NA 3ZZUA 3M9NB 3LP2B 3LTOA 3R97A 4F4YA 2CADA 5C42A 2DNKA 1RTIB 2CQBA 2EI5A 2KJWA 1E6VA 1D0EA 1XBWA 5HQ8A 3R2CJ 2X1AA 2FJXA 1NK5A 4HACB 2K1RA 1RT3B 5A8WB 1FERA 1GMUA 3IG1B 2EFGA 3HFKA 3QATA 1FX4A 2EPIA 3D4JA 1UP1A 4RW6A 4O3NA 3V6JA 4B3TF 1VC6A 3K58A 4EFAC 1S10A 1BQMB 1Q16B 2A18A 1JLBB 2BANA 3IP0A 4ID5A 3I5CA 4O4GB 3C6UB 3T1AA 4RUAA 1KSPA 1V6HA 4QIEA 4M94A 3OR2A 3OHBA 2JSXA 2RJZA 2EFQA 2GAHC 3PFEA 4FYYB 2WCXA 1IWAA 3U02A 4Q43A 4Q8EA 1X4EA 2HHWA 3DXBA 5K8PA 1SJRA 4DR5F 3D5MA 3FCVA 1TFWA 5KG1A 3MCNA 4DSLA 2E7XA 3QNWB 2CQDA 4NYOA 1X9SA 1S1XA 2MTLA 1R89A 1UEUA 2KYZA 4PG7A 2WSCC 1QTNB 3Q8RB 4MH8A 2UVUA 1RB0A 2G2OA 3FVYA 4KV8B 4LF2A 3W63A 2N4CA 1F5AA 3SCLE 2UUBJ 4O3SA 1DZ5A 2F8MA 1BE4A 3JXOA 2XMWA 2CAJA 2OMLA 1FKPA 1ZM3A 3QIDA 3K59A 4PXCA 3PX4A 4UQTA 4MIBA 3QJJA 5J1PA 1DQ9A 4HH1A 3NGKA 3QGPA 3AQOA 2OTLS 2Y8WA 2JVOA 2FVPA 4JP8A 4C0BA 3RB6A 2R8GA 2L9DA 4J9VA 3KK1A 5HP1B 1NK4A 4Z7YA 4ZIWA 2GMJA 3G6ES 1BQXA 3MEDB 4GVBB 3RAXA 1XNRJ 3GYNA 2VQFJ 4V19X 1N33J 1ZM9A 2DGWA 2ZH2A 3AA8A 3OTEA 1UFKA 5EWFA 3JSMB 1U02A 5JXSA 3OL8A 4TNOA 3GYXB 5M2UA 1KWMA 3OL6A 1M5PC 4K0KF 2KN4A 3OD2A 3PZPA 1HPZB 1ROFA 3DLKA 3C14B 3MDFA 4IDKB 2RMLA 4NLTA 2YNHB 4LFAF 4NLYA 4HKQA 1S4FA 2RNEA 4JV0A 5J2NB 3X3UA 4DL3A 1N48A 2WBMA 3SQOP 2DK2A 1DQ8A 2MZRA 3CIMA 3D3BJ 2J9CA 2HZAA 2VPYB 3RTVA 1LWCB 5KOXA 2DNRA 3TR5A 4OZ5A 4F3QA 3CCVS 3SZ2A 4KGKA 1NZAA 2D9OA 3SBMA 3M7VA 3D6TB 4WPAA 1ZZNA 2JDJA 2AF6A 2KDOA 1YIJS 3FBCA 3HKZD 2CDQA 4ECVA 3R6GB 2MZQA 3M2RB 4U6PA 1SL2A 2J0SD 1K44A 1QUVA 5GMKa 2QT7A 3CCRS 1R3NA 2IM1A 2JNJA 5HLFB 3ICLA 3D0HE 3GE9A 2MEWA 1Q8LA 2IVFB 2HFUA 1TKZA 1JJ2R 2IJNA 3ZNUA 1QAJA 4HACA 5E3CA 1WELA 3R7NB 3UDVA 2HS3A 2NPIA 5KFLA 2V2KA 3UCZP 4JI3J 4DFPA 4LUBA 1OPIA 3AOBA 4F0HA 4ZDNA 5AJ3J 2KT2A 2NREA 4PUOA 3R1HA 1UFWA 1VQKS 2KO1A 1LWEB 1OY6A 3IC1A 1Q5YA 5AE3A 1PBAA 3CO9A 4GRSA 1N5VA 1HMVB 4KQZA 5IQ6A 3KMSA 1B0VA 1CULA 1WC0A 5E41A 4BDPA 4MFBA 3GV7B 4MIWA 1UVJA 2D9PA 1FEEA 4KIAA 2Z57B 3U1MA 4CLFA 5SZTA 5D0RA 1KLMB 3TUPA 1C1CB 2ZD1A 1SH3A 3O8WA 2A0FB 5D78A 3VGSA 2HQDA 3E51A 1U7LA 4MKAA 2LXIA 2V8HA 4FN5A 4FKYA 2P2CB 1RTJA 5KFXA 3V6DA 2NXUA 2CFXA 2XULA 2V94A 5IM0A 2VG5A 2ZDPA 4Y65A 5L46A 1ZAXA 2RU9A 4ZVSB 3T5HA 5B0EA 3OXGA 2J6TA 1XMBA 2OSRA 1NKBA 2XM3A 1T0TV 2CNKB 2ZZNA 4RW9A 2JLEA 4NLOA 2JEGA 1Q8IA 1U47A 4W90B 4DV4J 1IBLJ 1GH8A 3MAAB 1NH7A 2FB0A 4ECYA 4A8OA 3NOCA 1IWGA 1DURA 3GIRA 4J9MA 2BM1A 3IBFB 3FCHA 1YZ7A 4IRCA 4ZCLA 2H54B 1K1QA 1Q8KA 2L3MA 3IAS9 1U1RA 2POKA 4KTQA 2XYHB 4MFBB 1FRHA 2RUGA 1RQ0A 4QJVA 5EDWA 1T9YA 2HQFA 3NY0A 2X1BA 2I5JB 3FCWA 4C8MA 3CGIA 1HWIA 3PX6A 4C9DA 2E29A 3BKFA 3T41A 3WQPA 1RUSA 1RU2A 1S1XB 7AT1B 2V69A 3V6DB 4H4MB 1VFJA 3RB3A 1YJWS 4J91A 1FKAF 1R8CA 2R3VA 4BC9A 5AXMA 5BYRA 2FGOA 3V5RA 1YHQS 4JV1A 1NMEB 3QT6A 4KY3A 4WYLA 2H65B 1S9GA 2HFZA 1LK5A 3IR5B 3W5XA 5IC6B 2MJUA 2F4FA 2D3ZA 4URGA 2MKCA 1AZSA 2W9BA 3B8HA 3C15A 3KHHA 5L9XA 4X4TA 4IG3A 3TNVA 3RR7A 4KAIA 3GSIA 5DM6Q 1S48A 1U25A 2VDIA 2JL9A 4WFBQ 1XR7A 1PC5A 1FJGJ 4LF4J 2FVQA 4DU8A 2UVRA 3BS9A 4R5PB 3N6NA 2HURA 1UA1A 4CH1A 1C1BA 4DL2A 1BWVA 1HLWA 2FTRA 1N34J 3SV3A 3IRXA 5H9EK 4FDFA 1Y5NB 4QYRA 2CG4A 3G96A 3RR8A 1TZ0A 1VQSA 1UEVA 2AV5A 2B5JA 2OPQB 2XI2A 2W7OA 2DH7A 3BREA 3H5YA 1OPZA 3PW5A 3K0JA 1UW4A 3QRPA 2AJ4A 1GX6A 1J5EF 4WZMA 3DGPB 1IR1A 5KFJA 4KHPF 5KAKA 1QVFR 2LU2A 1TR0A 2HPUA 4C6AA 3KLFA 1FK9B 3M8SA 3P8BB 4K4YA 2PEBA 4ECSA 3DLBA 3C2PA 2NR0A 1C0TA 1SQFA 2QA2A 4AYBD 4OYBA 1PYSB 2P6SA 4OX7A 4IKAA 4JI6F 3LUYA 2XMTA 5ITHA 3QZ7A 2O3DA 3BSCA 2J0WA 3FFIB 4HHJA 1NK0A 4PYDA 1SB6A 3M8PA 1RCXB 2HHQA 5K14A 5HROA 4WFXA 1RBAA 3R5CA 2ZH1A 2AX0A 4JUZA 5F8HA 1SC3B 2IBKA 2DO0A 5IT9Y 1T9UA 5HJYA 5HMWA 2LXFA 5GMDA 3KLEB 2XS2A 3MM7B 2P9EA 1SJ3P 4KR0B 1UZHA 2HGLA 2MZTA 1SUQA 4YY3F 5ETKA 4RU2A 5IT0A 2B8QA 3HP6A 2B8PA 4DFJA 3PRVA 4R25A 4XTTA 2XBPA 4CLSA 5IV4A 1S1WA 1VMBA 3JB9k 2MZ1A 4Q2MA 5GVQA 2LKZA 5K5MA 4FF1A 5K8MA 2Z56B 3CJKB 3M2VB 4LFBF 2AT1B 2WSFC 3CCZA 2WBRA 2B4UA 4ZVHA 1WC6A 5B0CA 2JC1A 3LQVA 5J2MA 4JI5J 1R6YA 2QE5A 4ECUA 5FLXY 2FJEB 2FLOA 3FZBA 4FXWA 2XC9A 1R8BA 5E0OA 4NI2A 5D15A 2V5HG 4RBTA 5RUBA 3HXMA 2DGQA 3FRZA 4DJBA 3N79A 2OEMA 4RUHA 2YWEA 3M32A 5IFMA 1ZTWA 3HK2A 1QD1A 1SJQA 2CNLB 2R7WA 5J2PA 2PN6A 3BZQA 4ZVGA 4IOAQ 3JYTB 2KM8C 3MM5A 5BXIA 1SBRA 1VHIA 3QFHA 4QR0A 3AXMA 1IM6A 3TYTA 3ULHA 2DNYA 3UCGA 1T9WA 1S9EB 4LRFA 1UMJA 2EC2A 4UOHA 1LXJA 3E3XA 4TYBA 4LF7F 4TKTA 4TY9A 4DR4F 1HD1A 4BWMA 4C8OA 3J7ZT 1UJ5A 2BUNA 2CUYA 2DIVA 4M5DB 1W7WA 2J5AA 5KFPA 4DR1J 5JMNA 3QYYA 3FUYA 1WNEA 5A2QY 2CVIA 2DNOA 1FE4A 5T7LB 1Y4ZB 5KFNA 3ELHA 1FNXH 2QV6A 1S6PA 3HSJA 1VC0A 3J7YI 1LW2A 3E8OA 2VUGA 2ZJRQ 3LW5C 2WB4A 2EC0A 1X0PA 4WTYA 4R0JA 3GFYA 3BPDA 4G3IA 3CCUS 1IQTA 2XWXA 2GJFA 7FD1A 3KG1A 2BDPA 1A9NB 2OFGX 3JTOA 5J1EA 5DGBA 1BGXT 2BE7D 3CJTA 1KD1T 1IN0A 3EVOA 3LA0A 2MQNA 2QL5B 3W65A 4Q5VA 2YPZA 4JBCA 2IDEA 2LDIA 2MSSA 2CJKA 4GKKJ 1PJ7A 4NEZA 2KVQE 2V4RA 5KT5A 2HHTA 4TU7A 4ZLLA 2R8HA 1RHKB 1S6PB 2KFZA 2E44A 3NGUA 2RIJA 3DYAA 4X84A 2AJ2A 2BQRA 1KTQA 3UI3A 3NS6A 1N6QB 2UXBJ 4OYAA 3PHEA 3G71S 1RKIA 5L39A 3FRYA 3RW7A 4WJBA 4IG3B 4DF4A 3AHPA 3C16A 4IG0B 3HVTA 2ADBA 4P9SA 2PT0A 4UOFA 1KC8T 4USKA 2V63A 4NLDA 2R4FA 1IQZA 1X5TA 3C16B 4IG0A 4K5RA 3ZZRA 3R5JB 1HHTP 4DR6J 4OYOA 1WDTA 3SEOA 4C3KA 2XNRA 2FJWA 5A8RA 2RSQA 4DU7A 2C2MB 4OX9F 2PMZD 2XLKA 3VF0B 3GR1A 4ED7A 2GC8A 3FSXA 4OZ0A 3K5LA 1WWHA 3MUTP 2DGXA 2DNLA 3QPIA 3FQLA 5KFMA 3TJ8A 1Z4UA 3LOUA 4P2MA 1T11A 4GC6A 1EIYB 2I5JA 2X1GA 3PW7A 2HSEB 3TUIC 3M6UA 3T1HJ 2PFDA 3KUHA 2BA9A 2PO4A 3DHXA 4G1PA 4M8LA 1NB2A 4X4OA 3NL0A 4JYAF 4IFVB 4F4KA 3OFFA 3T5LA 1VQLS 1T05A 4B9MA 2YKQA 5IOLA 1RT7A 2G13A 1N6QA 3I4HX 3BGOP 1LV5A 3CNQP 2GVDA 1S1WB 4IYQA 1VQ8S 1GXTA 4JV2A 2KYXA 3S1TA 4I2QA 9RUBA 2VG7B 4WP9A 4CDIA 2LA6A 1TL4A 4ZK7M 1S0NA 3N4WA 1LWFA 2KM8B 2GMLA 1VIXA 3M8ZA 4QR2A 3OXFA 5KFYA 3KLEA 4MYTA 1D3WA 3KFWX 2J9EA 1FFWB 3HHLB 3Q23A 2HBRB 4QWEA 5JVHQ 1JX4A 1IM4A 2UUWA 4FYXB 5B0BA 2F65A 2W1BA 2JHEA 1S49A 5DQGA 1VRQC 4LVOP 1RWUA 3UO0A 3DOLB 2OIHA 4B3MF 4OL8A 4FPIA 5KFOA 1LFPA 4PPDA 1RCOB 2PE8A 2F4VF 4YUDA 1X4HA 1EP4A 1MN9A 1FTRA 3T9ZA 5KT2A 2GA7A 1HNWJ 1M1KT 3MPDA 3VALA 2GQ2A 2U2FA 1C4CA 1FK9A 3TVYA 4KT0C 1XR6A 3VQTA 1R27B 5KFRA 4IOBA 4KKOB 3Q83A 5G0RA 3M05A 4PABA 2KT5A 2CJ9A 2JEIA 3KDNA 2Y3YA 3R5AA 1LXNA 1SPBP 3RAMA 4N76A 4QW8A 4KFBB 3PRBA 5JVGQ 4V1Ak 2RE1A 2G4BA 4B3RF 3UN2A 2HW3A 2XSJA 1VQOS 2OHDA 3BSOA 2O67A 5KT6A 1EB0A 4H4MA 4OFZA 4C2MA 3MMAB 1FWLA 1KN6A 1ZTTA 1NDCA 4BBYA 3G9CA 1FF2A 3BV8A 1J5OB 3W9HA 1JNZB 1SV5B 3F0NA 2XCPA 2IFXA 1SIZA 4CLZA 3G6YA 3GCXP 5DLFA 2A1BA 2YWGA 2GJ2A 1U1PA 3M6XA 1IJFB 4USMA 4ECZA 4CRJA 1CVJA 3OUYB 1MWYA 1AZSB 4K5SA 4O4RA 2W9BB 1NSAA 2YNGB 5I42B 2XTJP 2ZH7A 2E7VA 3MMBA 5CHCB 3TO8A 2J6UA 1I6JA 4NLXA 4FVMA 1T94A 3CTRA 4UZBA 4RZRA 4ECRA 3K5OA 1VISA 1WEXA 3D28A 1T03B 2ALYB 3HT3A 4NCBA 3MTJA 3W66A 4C48A 1JMTA 1NXIA 2Y1IA 2I9SA 2QLBB 1TL3B 1YJNS 1YGYA 2DXEA 3MCOA 4OZLA 5HBMB 4LF9J 3BN4A 1HIYA 3LPYA 1DARA 1Q8BA 5AT1B 4RBVA 1FI4A 3AJ1A 1YRUA 3PO4A 2C2DA 1YRTA 3DRPB 4QIGA 3J7A1 1NSPA 3WC0A 4ZJLA 2HLUA 3BGUA 3H2UB 3HI9A 2OD6A 4BC7A 4B3SF 2IYGA 4KYZA 1YJRA 1WF0A 3OBIA 4GO5X 4PQUB 2GVZB 2PEHA 2DNPA 3M6WA 1FJEB 3CDWA 5KFSA 3M8RA 4LT6A 4ZVPB 3TANA 4IFYA 4I6YA 3NXZA 2IDLA 1Q7LB 1H3DA 2GO8A 3H2LA 2GFFA 4MYUA 3DGPA 3HSZA 4Y34A 4A4JA 2RVJA 2EW9A 1NHKL 3CULA 3MGJA 5KFDA 1FRIA 1WJ9A 2Q79A 3EM1A 1JLEA 2F9JA 2HEKA 3HFZB 4USTA 1Y5LB 3KLGB 5LMUF 3LH2S 4F2SA 1HYSB 2W9AA 3HF5A 1U6ZA 3KJVB 1DQAA 1QAIA 5EUHA 4ZN1A 1SIWB 1EETA 4GVLA 3QGIA 1UL3A 2GIRA 3V4MA 2RU3A 3T1YF 3PO5A 2DNMA 4F25A 4IR9A 2WVEA 4NYZA 1HYSA 3UW1A 4PG4A 1FESA 3OSNA 3POTB 1B70B 2C3OA 2M88A 4DX8H 2F7VA 3D6MB 3DXSX 3SV4A 3NWGA 1VQ6S 4XDCA 2RH3A 4IQMA 3PW4A 4CLYA 3KK3A 2XHWA 3NGRA 4XO0A 1TKDA 2GCFA 1AUSL 1NPPA 4LF4F 5GADI 2IPOB 2CPDA 4CO5A 2JRSA 4U7CA 4ZPDA 1XIQA 2R2SA 1N36F 1QJHA 2FJBB 5CCLA 1EETB 1X4DA 1RTIA 1SQEA 2Q3PA 4LJMA 1MWQA 3PR5B 3CO0P 3KLIB 4Y2KA 3FSIA 3T5JA 2H9ZA 3BYRA 1G2EA 4DFKA 3W3SA 1WG4A 3T6JA 1YITS 3TQEA 2JX2A 5DETA 2G9OA 1UCNA 2QMWA 1HNXF 4QBUA 4KHPJ 4Z7CA 5LOQA 2QA4S 2M7SA 1YJUA 1WF1A 4ZVTB 2EK1A 4HHHA 4KSEB 2ZOFA 3NP5A 1NM2A 1GK8A 2UZAA 1WKJA 3BJYA 3TUJC 2GNKA 1ZAVA 1FT8A 1MLAA 2HAFA 3PYEA 1N34F 1N32J 4J37A 2HWTA 4JOUA 2ZFHA 3CCTA 4RW4B 3SIPB 1FJGF 2YXLA 5ADZA 3D9BA 4DN9A 1RHUB 2E5IA 4DN0A 1WEZA 4L6V3 4PAAA 2XLIA 4J9QA 4PWDA 2HWIA 3F44A 3BGLA 3K2YA 3HHDA 2C3YA 1FD8A 2C3PA 2YKPA 1P6TA 4K0KJ 4ILMA 4FZVA 4DQQA 4CQ1A 1LWEA 1TL3A 4KGMA 4N41A 3JSMA 2H51B 1PCAA 4I4BA 2VG5B 2Z8QA 1BXNA 3TA1A 4KGZB 3GIKA 3KLIA 1S72S 2HS4A 1RT4A 1HBNA 3TAQA 1UVNA 4EO8A 2BRKA 2E1MC 4HDGA 4DXLA 1L3SA 2BW2A 3QAEA 1MG7A 3K8VA 1YDLA 4CLTA 4TU8A 1C1CA 1NK7A 3LAMA 4NEYA 1S97A 1KLMA 1M5SA 2WW4A 3AD8C 2C1EB 1JB0C 1VRUB 2DNGA 2OO4A 1HBOB 2JC0A 2X51A 4LBHA 1VLOA 2JH3A 4CNZA 3OUYA 2VDHA 5AE1A 2B9WA 5E33A 1SJ4P 5I42A 3DLLQ 1AA1B 4DUYF 3KK3B 1RHRB 3DLGA 3GPAA 3L7PA 2KT3A 1CULB 3L7UA 4ES2A 3OJUA 3JQMA 5F8IA 3C46A 2UVVA 1TTHB 1GFWB 3BBFA 2E5HA 4R0EA 2B0GA 3UD4P 4K50A 4NMLA 4ELVA 5DZ7A 1B7YB 2VG6B 4TU9A 2HBQB 3RRHA 4NCAA 1S5ZA 3B6BA 3C8YA 4P75A 5D3GA 2C22A 4USUA 4YY3J 2I0XA 1OYDA 4LSLA 4B3TJ 4G1QB 5E3QA 3CDAA 1XTZA 2DY1A 2YWKA 3QAUA 1MROA 1RBOB 4F04B 3KHLA 2VJUA 3MMCA 5J2QB 4PKDB 4X4UA 2UP1A 4J90A 1N4LA 5E3AA 2J76E 5KG5A 1VIOA 3L4BC 1U1MA 2W7AA 1TELA 1YZ6A 3K8WA 4Y6IA 1HI1A 1PAEX 2G1DA 2Y1RI 3HX9A 3M8QB 3O6QA 1NJYA 1TVRA 2W4DA 1VQYA 4ETZA 2AHOB 5EGYA 2ZJQQ 4WFAQ 2GVZA 1YLXA 3KK1B 3DOLA 4DUZJ 3TW0A 2V6AA 5HMYA 2KTQA 1RA6A 1CQMA 5J2NA 3AOCA 2HHSA 2HVZA 4YR3A 1N52B 2RRAA 3HHNB 2VQEF 4X4VA 5HBMA 1RAAB 3ILJA 2HLTA 2V8PA 3M8YA 1RLCL 2GW8A 4NLSA 4OHXA 1FJ7A 3CCES 1HQUB 3M6VA 5A8KB 3OVAA 1WG5A 5A76A 1L3TA 2DNQA 3VZIA 5F3ZA 5L38A 3RBXA 4PQAA 4WTOB 2FZGB 1RHJB 3GCWP 3KK2B 2YY3A 3KWMA 4YR0A 1SQGA 2RS8A 4OHZA 5F9NA 1RWPB 2DNHA 3D0IE 3HHEA 3C3LA 1RT1B 1VYAA 5HP1A 1KR4A 2Q1LA 3QSIA 1F5BA 4NX9A 4RUBA 4ZPWR 3CCJS 3W2VA 1VQPS 3IS9B 4O44B 1RSCA 4M95A 3I9ZA 3UDEA 3C6TA 3W5ZA 3J7Z5 2PMHA 1RYSA 1VJWA 3Q89A 3Q8QB 1YKWA 4HTJA 2W4CA 3RBEA 1WOOA 3SCIE 4RW6B 2H4WB 4X4QA 3P5TL 3P96A 2D7SA 2RKIB 4DPYA 4OHYA 3I0SB 2DPJA 4N47A 4R8UA 1HBUA 3AB4B 3GR0A 5A0YB 4DCOB 4FYDA 4RNMA 2FGCA 1Y3JA 5D0EA 4HI1A 2A6MA 4CIOA 1HWKA 1MMDA 2YKOA 4U7UD 2KRRA 3KLVA 3H90A 3ZZOA 1PKUA 4WZQA 2CZ4A 3I4PA 3DRXA 4OZNA 3N6LA 4I69A 2ILYA 2J0XA 1R0BG 1JWWA 4DV6F 4DV1F 1JLAA 4LRCA 3B4MA 1S6UA 5K14B 5CYMA 4ZHRB 5KFEA 3IWLA 1V5IB 3I0RA 4TXSA 2C2RA 4N8NA 1TFYA 4Q8FA 1N33F 3RAQA 2EFNA 1LWXA 3TJAA 3BN7A 3TZXA 3M2UB 1NU4A 3KUEA 4LFCJ 3LGMA 3ZXWA 3OR1B 5DDRC 2QLJB 1NCLA 2LDYA 2OD4A 2YNIA 1IKVA 2CYYA 3OPKA 4HDHA 2HNZB 4ED0A 3D2WA 4DL4A 1L3UA 2VONA 1O6XA 3N28A 2EBEA 1RDRA 3PIOQ 1UVLA 5CCMA 4P6QA 3GQCA 3NMRA 3CDBA 2ZOGA 3H98A 1S1TB 1F3VA 1E6YB 4ETXA 2BQUA 2DISA 4YR2A 3OL7A 4KE5A 2XS5A 2YKMA 3V81A 1QDUB 2CJYB 1S1VB 3QWPA 2KVIA 2CQ2A 3Q22A 4A8YA 4CLWA 4R5PA 3K89A 4P52A 4DSEA 1IKVB 1SI9A 2AEJA 5E3PA 1X9MA 4IUFA 1J2VA 2BM0A 2M3DA 3CD7A 3E01B 1RT7B 3NG8A 3IA0A 4MIAA 2DBBA 4DF8A 4KGVB 4NLUA 3IMQJ 1TKTA 5LM7E 2JFKA 3SDEA 6FDRA 4IQXA 5T7LA 3PFOA 3DMJB 3ET6A 3RG6A 4DHVA 1SL1A 1RHMB 2R7OA 3ILLA 2XI3A 3MPWA 1S9FA 1DBDA 3DOMA 1VBZA 3OTDA 2YQ1A 2AJ0A 5K20B 5KT3A 1HNXJ 2E1AA 2BXJA 3EE3A 4B3MJ 4QYZK 4Q0BA 3I82A 1R8AA 3OXLA 4P74A 5CH7B 2XGQA 5LMNJ 1LNQA 2FC9A 2QSWA 3WDOA 3ISZA 1NBEB 2UUAF 2CQ1A 4NOHA 3CCMS 5DZ6A 2HVEA 3GZ7A 1V5VA 3UFCX 2AZ1A 1F3FA 1DHMA 1NHUA 1H98A 4C0OC 1QSLA 3GG1A 3M32B 2HVIA 1YI2S 3D68A 3BGFA 5ETMA 2WTFA 5SUHA 3TOQA 4DL0C 2M2BA 4F67A 5DM7Q 4DQPA 4NLWA 2HZVA 5J2MB 1QE1B 4ELTA 2G0JA 2EFPA 2M4MA 4KO0B 2J0QD 1D09B 2BBEA 1NSQA 4W92B 1XNQJ 4JI0J 2P6TA 2V8GA 4B3SJ 4FBUA 4ECXA 5FIIA 3OFHA 1TK8A 3MAAA 2CPEA 2PFFB 5K8NA 5H9FJ 2VJVA 4WYWA 2ZJPQ 5DG8A 4P7TA 1DJ0A 4XDDA 3G8SA 3WHIA 4ZVUB 3MEGA 3TARA 2PMWA 4ZCIA 4YHHJ 2CDRB 4RWXA 1ZPWX 1WC1A 3DOMB 2LQJA 4RO0A 5A8KA 2QL7B 4MK8A 2DEJA 2BR0A 2LCWA 1WHYA 1U8SA 2VQFF 1WC4A 3TX0A 1GTHA 4NZ7A 3ENVA 4CO1A 3GIIA 5L1IA 4BS2A 2HNZA 2RUSA 4C11B 3O5TB 2QA4G 4MTPA 5IT4A 4ED5A 4K4UA 3M1VA 1D8ZA 3E2EA 3Q8PB 2DHXA 2WSEC 3A3NB 4EWTA 2CQ0A 3PR4A 1NB7A 5HMXA 1U4BA 5LT5A 3AAWB 2YKMB 2RHQB 1UFLA 5T14A 1M5HA 3DU5A 1GMVA 4QR1A 2YWWA 3HM9A 4B3OA 2IVMA 3KJQB 1UW9A 3V6KA 3KMQA 4B9NA 4C98A 5KFZA 4URSA 3D1QA 4ZJOA 2QRRA 3GSDA 4M5LA 4ZCMA 2L41A 4B3RJ 3PYFA 4DR2F 1X0FA 1PO6A 3BH6B 3CE8A 1ACMB 1FWKA 1HNIB 4DV5J 4QU6A 4GC7A 2FZKB 3OR1A 2HQGA 1RLDA 4IH7A 3N5FA 4ZITA 2HVHA 2AEFA 2IA0A 4EK2A 1RT2A 3DN9A 4NCGA 4H54A 3THPA 4PRFA 1XQIA 2NLWA 1HR0J 2HNDA 2H3EB 2Z30B 3KG4A 4WE1B 5DDPC 1VBKA 5GAEI 4PG5A 3TZYA 2DD8S 1S99A 1QE1A 3JSYA 4TLQA 2CRLA 4QPXA 2FZCB 2BOPA 2QFIA 4UY8T 4DBQA 2IM0A 1HNWF 5C7PA 2D74B 3C15B 2DHSA 2DKOB 2E7WA 3I6PA 4HLBA 1K9MT 1HI0P 2MDAA 3RRGA 4KJIA 3R5GA 1G4CA 3KKFA 4NLVA 2VC0A 3MCSA 2K3IA 4O3RA 2O01C 3MEKA 4M5IA 5HK4A 3O1LA 4M1KA 2NSCA 2QX0A 4XIUA 1ICEB 1YSJA 4ED6A 1DTTA 5HJXA 3CF5Q 4C8KA 3MI7X 4ANEA 2AD9A 2W2PP 3A1YG 3HVAA 4TYAA 5MAOA 5BYQA 3UN5A 2RS2A 1XMQJ 5KG6A 3QO9B 3I5AA 4UW2A 1HHQA 5KFUA 2LXUA 1SL0A 5KFKA 2ZHAA 5HROB 3LP0A 3UR3C 3DLEB 4CLLA 4CWBA 4HHUA 2CG8A 1A7GE 1JXVA 1MN7A 2WONB 3EMTA 2LP4A 2QMXA 4KBIA 2E9RX 3KDOA 4J9OA 1XJWB 1UWAA 2MPUA 4IO1A 1ZA1B 5LJ3Y 1TU0B 4J9PA 1URNA 3UWTA 1BUXA 2DHGA 4OYIA 3MEEA 1OIAA 1FKOB 2PA3A 3LO3A 2VBWA 4RW7A 4DS5A 5HMZA 1IKWA 2P5VA 1C0UB 1N0VC 3P49B 4DV7J 2X3DA 2R2RA 4QIWD 2XZDB 3I96A 3PIPQ 2ZM6F 4ZVRB 2B56A 5C25B 3SYZA 1DLOB 3Q2TC 1IKXB 2CPHA 2HBZB 3GJQB 1Y00A 3BM7A 1P9YA 1QAXA 5C2CA 3KLHB 3NGSA 2XY7A 3I87A 2F3JA 1Y3KA 2DCUB 3IBWA 4QPTA 1VLYA 2B3TB 1OMSA 2GQQA 4ZP7A 3H59A 1DTQB 2ZEJA 3JSBA 1FVQA 3AOAA 2KZMA 2GV1A 2WOMA 2ZNZA 2WVCA 4JYAJ 4A8SA 3AJDA 1XK8A 4I7FB 3FBFA 4PXDA 2B9XA 2ZH6A 2VD3A 4PXBA 4DLGA 3VAMA 3T1HF 2VA2A 1HBOA 3MPUB 1TV6B 1W25A 4FNHA 1CS4A 1RABB 3QIPB 4KH1B 1S0MA 1QTMA 2YTCA 4GO7X 2Y9HA 2AKWB 2XB2D 4O0NA 1IKXA 1HNZF 3KJVA 4C3LA 3AT1B 4Y2IA 2BX6A 3EXYA 4DV0J 2KHDA 3MCMA 1CSJA 2V0NA 2NUHA 4HT5A 4F50A 4YB5A 4W98A 3TRGA 5LJ5Y 1VQ4S 1RA7A 1DAXA 2QLXA 1S0OA 1U24A 4LBIA 3TAMA 4DR6F 1IKYA 4UTGA 1FHTA 4N77A 1YBUA 2V2QA 3GJTB 4G1IA 3KYLA 1R31A 4ERDA 3PVXA 1U6BA 2XMVA 1HQEA 2CWXA 2DNZA 3CCSS 3VR1A 3LWMA 4LF6F 4LR8A 1M5OC 1GEHA 2P9GA 1A6LA 2JFDA 1RWXB 2AMCB 2KL8A 1U0HA 1ZM2A 1TUWA 1RWOB 1YQHA 3P5BP 4F4WA 5KOWA 2WONA 4K7QA 5IXUA 4K4XA 4FKXA 2EG2A 2ZHBA 4CT9A 2B51A 3TWZA 1SC1B 2YNHA 3O44A 5HI7A 1VQ9S 2DH8A 3DRPA 1JK9B 2V68A 1QVGR 1S7HA 3AQPA 3P4UB 1TP7A 5HN0A 2KH9A 2RQCA 1IKYB 1Q95G 3HCXA 4GKKF 3TAMB 1RAFB 1HQ2A 1WEYA 3CDUA 4LF6J 2OGUA 3DGVA 1CJVB 4Y00A 2GIQA 1R43A 3MUMP 1F60B 5CXTA 3CJSA 2HQCA 4J9UE 1QM9A 2C2ZB 4MJKA 4JI1F 2VH7A 4H4OA 3PY8A 4CCHA 2R7RA 1HL6A 2QMUB 2U1AA 1U0HB 2WVFA 3KG0A 4JI4J 4BLGA 3EX7B 3QGGA 1R0CB 3FC9A 2H5EA 2UUCJ 2F4VJ 2MHNA 5M2PA 1SJ1A 1X5OA 3EJMA 1LOUA 3GV8B 2CNNB 3HKWA 1XC9A 1D9DA 1RWNB 3W9JA 4Z37A 3CMAS 1J27A 4FBTA 2DR9A 5HANA 1B4SA 1EKSA 2VODA 2NQPA 1SV5A 2A6OA 3DOKA 4QWBA 4FYVB 5A6WA 1J5OA 2ZC3A 3FBEA 4X4PA 1IXKA 4KV8A 2C2EA 2BE9B 3B54A 1H7WA 2BJ3A 4OJ1A 4P2SA 4AL7A 1RT6A 1SXLA 3HT0A 2E66A 3IWXA 3K17A 4KFBA 4WU2A 4EBEA 2AQ4A 2ZBQA 3FBBA 4ZVEA 3U1LA 2BJ7A 2XSJB 1N5YA 3L9ZA 4ZS6A 3GILA 1T9XA 1NJXA 4MKVA 1JJ4A 1F9FA 2BKNA 3ETOA 3OTCA 4ZPAA 4DMZA 3K5MA 4DS4A 1QSYA 1OY8A 2JJ4D 4B3OB 2HFNA 4U7UK 3EUNA 4NA3A 5CD4H 4MKBA 1KNZA 8ATCB 4FNIA 1WDDA 3GIJA 3BDEA 1HARA 3DLGB 5E2QA 4ES3A 1IBKJ 1HA1A 2HRUA 4OI6A 4RW8B 2ZH9A 3A8KA 2MGZB 4DPXA 5EX0A 2XO7A 2XSFA 4P7VA 1TMMA 3MD3A 5U47A 1AROP 2NYIA 2XEXA 1O5JA 2ROGA 5KG2A 5IV3A 4UQGA 1G3OA 2JEFA 4FF3A 2QEXS 2MLZA 3ZZ0A 3HO1A 4O3PA 3P45B 2ZH4A 1HBNB 2RF2B 3A3PB 1JIHA 3CJ4A 2DRBA 3QJPA 1HNVA 2DNNA 2OUGA 4FVCA 3ONQA 2PGCA 3LP2A 1WI8A 4U95A 2KG1A 3TEGA 4X4NA 4YDXA 1REVA 1FA0A 3O3LA 5AJ3F 2ZWOA 4CM0A 1KS2A 1PSDA 2AJ1A 1WHXA 2E9TA 1SC4B 1JJCB 4RR5A 3J80Y 1FO1A 1IJEB 3PRDA 3TUZC 2DY9A 3BQ1A 2HZCA 2ZE2B 3LAKA 4DFMA 3HJFA 3MWBA 1OWXA 2VF3A 2ADCA 3WC2A 4J5OA 3K7RA 1UETA 3GYGA 3QRQA 1M1GA 1TQLA 1ZA2B 2LQ9A 4LQ3A 1RISA 2H48B 3FMBA 5DDQC 3GFHA 2GGPB 3W7BA 3QO9A 4WK3A 2CQ4A 2YKNA 2UUAJ 2V8VA 3PYDA 1YBAA 1KFSA 2HMIA 3DHWC 3T19A 1F5CA 2MQLA 5E7OB 4OV1A 2Y1LB 3MMAA 4UOCA 2F1FA 1AT1B 3THTA 3C19A 1VS3A 3SXLA 4LIWA 1FE0A 2IJRA 3ZC4A 1F2GA 4LVNP 1KOOA 1S6OA 5IWAJ 2XCAA 2AX1A 3PKYA 1X5PA 3D66A 4X4RA 3VAKA 3CD6S 3PACA 3GFZA 4CO2A 3RRKA 4DSFA 2MKYA 2GIFA 4FPRA 4PR6A 3HVWA 2Z4PA 3C6UA 3DC2A 3KJFB 3MM9B 4DPTA 4DQSA 4QCLA 2QN6B 1KQKA 4LSNB 4OI2A 2D69A 5BR8F 3HLUA 3PNIA 1H0HB 1RAIB 2EKNA 3ET6B 3IG1A 3Q2SC 3W2WA 1U45A 5A8WA 4DR4J 2YPYA 1LQ9A 2MY7A 3IM8A 4J7CA 4OJGA 4DR7J 3NGTA 4B9UA 3AD7C 5F8NA 1HNIA 1H2UX 2OP5A 2AEMA 1WUUA 2Z2ZA 2XO6A 1U2RA 2D3O1 5C42B 4NPOA 3P6YC 4A8MP 4OYXA 1S1VA 3HVRA 2XZTB 3SQGB 5GAGI 1RT5A 1L5UA 4OX6A 3GG0A 1JLCA 4P73A 5ETPA 1IBCB 3QQCD 1EAYC 1WORA 2QYCA 3HHLA 4CYUA 4EYIB 4DR7F 2V2ZA 3DI6B 5AXNA 4KGXB 1U2FA 4L74A 1RTHA 2KJVA 3IFEA 3LGHA 4MAKA 4OZ1A 3PW2A 5L1LA 1TMJA 2L48A 2MQPA 4PWWA 4IFYB 4AFFA 4ER8A 3TJ9A 4ENOA 2JLGA 4EZ9A 1LKZA 2A3JA 4DR5J 4ATNA 5DLGA 3Q8SB 3OHAA 3X1LB 1NPKA 4A47A 3MECA 4YHHF 2KKHA 2OELA 3H4DA 5IZHA 1SCJB 2R7QA 5FLXU 1T05B 3RW6A 4RKUC 1PG5B 4DV4F 1IBLF 1U09A 2MKJA 3MM8A 1H72C 2XYGB 2CPFA 1R6VA 5MLCV 3V6HA 2D3OR 3BBCA 3UR0A 5GAEU 2FUG9 3AXKA 3EWGA 2DGTA 2WHOA 2YNFA 2WW8A 3J81U 2FVRA 1Y9OA 4O3QA 4K59A 1SJFA 1TK0A 1Q1KA 2M9KA 2E5LF 2R7XA 5KFWA 3CWJA 1JKHA 2HQ3A 2H5IB 1BC6A 3M30B 1JLQA 3G86A 4QZVB 2X1FA 1P1LA 2CXEA 3DRYA 5AXKA 5HQLA 2M52A 4DUZF 2GHPA 4CZCA 2G0CA 3ZFVA 2RKIA 5BJRA 3CC7S 1HWLA 4EBDA 1FRKA 1HFEL 5HQMA 4M63A 2BE2B 3H2VE 2WZ1A 1W2BR 3KUGA 1VK8A 1KEKA 1DFDA 4Y28C 2KZZA 2UUCF 3B82A 1B3TA 2IMWP 2BE2A 2XMJA 3A4TA 3BR9A 4YP3A 4FF2A 2Z0GA 2L9WA 3THVA 4WP3A 4LF5J 2XGPA 3LWLA 4UY85 3NCRA 3OTOJ 4LR7A 5B08A 1RP5A 2FVSA 2K3KA 1RU1A 4DG1A 4UZCA 4JI2J 4C8NA 4ILLA 3FSYA 4IH5A 1KBRA 1I5OB 4OV6A 4DX6A 1UJ6A 4DUTA 3MURP 2FLPA 1KOHA 1MWZA 5D4PA 3DKDA 1I51B 1XR5A 5ETOA 2YH1A 1L3VA 4B9VA 4GKJJ 1OQ3A 3JQKA 4I0WA 4OZJA 1E6YA 2HIQA 4EO6A 5B7WA 4OIXA 1VI7A 3DMJA 1WKKA 4L72B 3VAGA 4A8QA 1KDNA 2LU1A 4NYPA 3VAIA 2EVZA 3Q86A 1QAYA 4ZVQB 3IR6B 3Q24A 2Z58B 4ANDA 3CUNA 1R8HA 1PYTA 4M5KA 5JJBA 3M8PB 4HL9A 5H9FK 1HI8A 2J9DA 2PIIA 3MF5A 4USIA 2YQ0A 5FDLA 2KFNA 2IJFA 5CA5A 4L3KA 3CJ2A 3UN3A 4C11A 3J81Y 1KVIA 4ED8A 1TVRB 5L9NA 2NXCA 4HI2A 3DI6A 4NMXA 3RYLA 1BQNB 2DRDA 4LF5F 1CEZA 2JWNA 4WIIA 3ZO7A 1U0SA 4LFCF 1S1TA 2IRXA 1WC3A 4TLRA 4RU9A 1VGYA 4XK8C 3HD2A 2W01A 2NYHA 2ABYA 2RD5C 1MW7A 3BH7B 4FXVA 5ETVA 2OKQA 5DQIA 4A8KA 4ELUA 1G7CB 3TX8A 4ILRA 2HG4A 5D3GB 2YNIB 5A2QU 1WC5A 1O8BA 5DJBA 3TA0A 2HGMA 1RTDB 1C4AA 2ILZA 3H20A 2UV8G 4LQ9A 3TZWA 1VQ5S 1X4CA 2A2DA 4K2JA 2AYGA 3CC4S 3DNCA 1FXLA 3ZZTA 1SKWA 3LF0A 2M0GB 2V67A 1OJ4A 3HMJG 3DDKA 4DR3F 4F02A 4NZ0A 4TY8B 4I6AA 3A8EA 3MM9A 3EICA 3V2UC 4OYWA 4LSNA 1TUGB 1EQMA 1JLAB 3CJKA 2UUBF 4L75A 2PA8D 1MROB 5BYSA 5KFCA 1N0UA 1XN9A 3BQ2A 4K4ZA 5KFGA 4DG1B 4B9SA 2DGOA 3A3OB 2ZKTA 3M30A 4P2FA 4AL5A 1UZDA 4U9RA 2VL1A 3MFIA 3L95X 4ICLB 4DCJB 3Q0AA 5AE2A 2Q6CA 2MQQA 1N36J 4LF8F 5A0YA 2C3MA 3MPVA 2EWHA 2VFTA 2RDJA 2AYEA 3VGTA 2V2VA 4ZLNA 4ZA1A 3QLHA 2J6SA 2ZVIA 4RUCA 2R42A 1F1BB 2CWKA 1YJVA 2PDAA 1NDPA 1P9QC 1O0PA 5EWGA 3OLAA 2MJNA 2GS8A 4USWA 4QU7A 2ZDOA 2OPRA 3W8PA 3CD5A 4WFNQ 3SCJE 4DV7F 4K4VA 2DEIA 3RZAA 2PC6A 1FDDA 1LEOA 1Y7PA 2OAUA 2QO3A 2RHSB 4RW4A 3DRSA 1AUDA 3T1YJ 4ECQA 1RT1A 4H4OB 1RT4B 2B4OA 3KXDA 4RW9B 2I2YA 3QJLA 2CQIA 5GADU 4DL5A 3KK2A 4A48A 3G4SS 4DSIA 1HNZJ 1X5SA 2FLNA 2HVDA 2CPXA 5EX3A 2ZH3A 4E2FB 3O2IA 4OYMA 3R7SB 4Q45A 2CKWA 1ZS6A 3EPGA 3AY0A 3BSNA 2OPQA 4HEA9 2ACMA 4OI4A 2B5JB 2B7BB 4C8YA 3CJ8A 4J9LA 3CVKA 4OI1A 2EKYA 2IIHA 2ZBPA 2DHHA 2HFOA 1JQGA 5F8MA 1NHVA 1U1KA 4CP5A 1GXUA 2FDNA 4LSZB 4ZIVA 4NE9C 2W7PA 1HKAA 5A6PA 1ZBTA 1C0TB 4X66J 1S59A 2DRAA 4U96A 2LQ8A 3ZNJ1 3QWUA 2LFVA 1GAOA 1URRA 1R7IA 2NXJA 1VDHA 4B9LA 1TUVA 2RRBA 4QWAA 5J2QA 4LF9F 3HSGA 3TZZA 2VASA 1FRLA 1FTCA 3BQ0A 4IR1A 4FF4A 1ITPA 3HHKA 4CNYA 4MK7A 1Q4RA 2WAQD 4JI7F 3QRRA 1RWKB 4ED2A 3DLJA 3CJ0A 2AYMA 2N7CA 2YWHA 3ZTOA 5C2GA 1S76D 2HBYB 3N01A 1IBKF 2KFYA 4UUWA 5KFFA 1U1OA 2JZ5A 5J2PB 3OLBA 5HLFA 3LP1B 4WWSA 2W8LA 1V3RA 1D8YA 4P10A 2Y8YA 4OLPA 2HK2A 3H5UA 1VOMA 2O66A 1X4FA 5KFQA 3MEEB 1Q53A 1FCAA 2FD2A 3R2DJ 3MM6B 2MY8A 5AXLA 2NZCA 2PSZA 2QLWA 2ZITA 5B09A 5IM0B 1X4GA 2YX4A 1TL7B 1Y0HA 3MAQA 3FGVA 3W61A 2AW0A 1XMOF 3K57A 1UTAA 1NK6A 2IA6A 1NNDA 5BR8J 3OVBA 1DLOA 3MOZA 4DOZA 2HAIA 2QZ8A 3C14A 3JTNA 2MQ8A 4CI0B 4DQRA 1BLUA 1FFSB 2FHMA 4UOGA 2FQQB 2NS1B 2W25A 3IM9A 4C0HA 3H8YA 1C0UA 4RJVA 1Z2ZA 1PC4A 2FJAB 2X3GA 4K2XA 4RNNA 1Q7YT 2PI4A 2DYAA 3PYGA 1PILA 3DU6A 3MEDA 5KFBA 4JI1J 2OMOA 2A2CA 3D6HB 2OEKA 5DG9A 1AW0A 3UD3P 1V9OA 1N5TA 2MKHA 3DM2B 4KRWA 2MKKA 4CH7A 3DLEA 2YNGA 2Q66A 1K1SA 1X31C 4JV5F 1RI7A 3FZ2A 3GTYX 3PHTA 3HJVA 3ZTSA 5T41A 3V4IB 2DH9A 3JSRA 3NBPA 1FNOA 4LR9A 5JUMA 3MR3A 1Q0NA 5HVFA 4ZOSA 1NKEA 2A10A 2KI2A 4YOEA 1ELOA 1IR0A 4L73A 4O23A 4USHA 2LYVA 4H4KC 4ALZA 5HO4A 5DQHA 2XMAA 3PV8A 2QJ3A 3NCQA 4NXNF 3CXCR 4MKYA 2WVBA 3EGVA 2CQCA 1W2IA 1OYEA 1HHSA 2C2NA 1MU2B 2QIFA 3ILOA 3MZIA 4PCQA 1G6BA 4NRUA 5DS7A 2V9KA 4AUKA 2Y1JA 3TA2A 5CABA 2MLXA 2MGZA 3T9NA 2M8DB 2ZZTA 1CS4B 3M2RA 4WXOA 5B0AA 4N7TA 4C7QA 4DSJA 3JQJA 4NWBA 1PAUB 1YX2A 1VRTA 3QMQA 4CLUA 1I3OB 3HPOA 1YJ9S 1ZYQA 4NA2A 4OMFG 2UXCJ 1VC5A 4DV0F 3GP9A 2AGOA 1ZAWA 3IN5A 2BKPA 3EGZA 4BWJA 2DXDA 2VFVA 3DM2A 1BWEA 3D7SB 2XY6A 2DB1A 1VBXA 1FJCA 4ZP8A 1MU2A 2EBGA 3ITHB 1FNMA 1XERA 3AB2B 1XEZA 2G2ZA 1YRXA 2BKOA 4KH0B 3KLGA 4DX7A 3ZZPA 3BKTA 2HFSA 3QT7A 3N0VA 3R7BB 1SKRA 2OJ3A 2LA4A 3VWSA 2GJIA 1Q81T 1Z1ZA 3C66A 3H40A 2DT9A 1K0VA 2DCLA 4RW7B 5ETNA 3TQ1A 2R8JA 1BHNA 5LSRA 2K2PA 5L1KA 1A0OB 3QSYB 3DCAA 4WCEQ 2DHAA 3GIMA 1NDKA 4F4ZA 4PQUA 3H5SA 3BSAA 2HS0A 3CJ5A 2AIRB 2VFUA 1LW0B 1TKXA 1EQ0A 2K8GA 3VZHA 4B02A 4E8UA 5F3TA 1RACB 2BZ2A 1AB8A 1HD0A 3GMGA 3L7OA 1Y11A 1YK9A 2BJ1A 2ACYA 3H0PA 3RGIA 2M8HA 2RRNA 2MXYA 2KXNB 4ECTA 4JI6J 1X4AA 4IFVA 4ZVFA 4C97A 2YX7A 2LMIA 2MKSA 4ZP6A 3RJMB 1RTZA 3IGNA 4OI0A 4V19J 2CQ3A 3UE2A 1M5VC 3G8QA 3I56S 1D1UA 3CB4A 2K7JA 4M5NA 3EVWA 4QYZJ 2YX1A 4F3OA 4PPZA 4C8ZA 1GMWD 2HHPA 3EZUA 3OW2R 3IRWP 3RB0A 4RX6A 4F7VA 5HAOA 2OSQA 2IC3A 3TVZA 2R7VA 2QGFB 1SVDA 2RQKA 1HQEB 2HRYA 3CJQA 3M4XA 2M70A 5G0RB 3ENWA 3MMBB 3OR2B 4DPOA 4F36A 3UCUP 2DPIA 1P27B 2F5GA 3D3CJ 4WFZA 4AXJA 4I7FA 3QLHB 3QFWA 2ASDA 1XMOJ 3G82A 5E3RA 5HATA 1Y5IB 5GAHU 2ERRA 3HVTB 2CJQA 5E5NA 3POTA 3DYAB 4Z2XA 3M9OB 4AQYJ 1WOSA 2FPHX 4OI3A 4YS2A 1M0SA 5KG0A 3MR5A 5HVHA 3NNCA 4OJHA 5ETSA 1CLFA 3TP2A 1OSCA 3NRBA 1U1QA 3J7AN 3JAMY 3LANA 3CW2C 4L3NA 1FXRA 2CZVC 2MLYA 4ED3A 2FLLA 1O51A 1S12A 3QGHA 4ZP9A 1APSA 3MFHA 1FWPA 1CJTA 4ZLPA 1RAJA 4H4KA 3FMWA 3G6VA 4WP8A 4IRDA 3RU0A 2BQ3A 2OFHX 1JLBA 2DR6A 4GMKA 4ID5B 4TY8A 1K8AT 2V4JB 4K4SA 1S0VA 2DIUA
chains in the Genus database with same CATH topology
1U6FA 1UWBB 3FEZA 2ZKUA 5I3UB 4QWDA 4J9KA 1EP4B 1LK7A 2B4VA 1JXEA 1RT3A 1VQNS 1B7FA 1GH8A 2CPJA 3WZ0A 1JLFA 3M9MB 3KLHA 3FDSA 3M1VB 1LWCA 2MZJA 2KB2A 1GQEA 2ZNYA 5KFIA 3PIOQ 2ZH5A 1M90T 4FS2A 2VKZG 5G4DA 2J8AA 2NUUG 1WHVA 4CO3A 2YKAA 2FVCA 1KTVA 1H6KX 5F8LA 3S7RA 5B0GA 1FKOA 2BABA 4RLEA 4NA1A 2FC8A 4NRTA 2KXFA 3TAPA 4I2QB 1U1NA 1HBMB 2CPIA 1JLGB 2UV8A 4R8UB 4Y3CA 1VK3A 4UUXA 2V4QA 1K73T 3DFEA 3AJ2A 2IHR1 1YVFA 3OTOF 3VAFA 3L09A 4U67Q 3NCPA 3DRRB 1XNQF 2HHXA 5KFAA 1R8PA 2IMOA 1H2TZ 2DITA 1HBMA 1VQ7S 2NR0A 5D77A 4CT8A 3BO3A 3MM7A 2B9YA 4N56A 4FS1A 3CCQS 5C24A 2Z2LA 5A8RB 3KOAA 5F8JA 4ID8A 1TL1B 2LQBA 1MNEA 2W24A 4IH6A 1WD6A 2XLJA 4WE1A 4RNHA 3W2VB 1B64A 2RILA 3OQ2A 2VFRA 3J7YU 3L3CA 1JLGA 3ISNC 2XG8A 4B17A 4A46A 1VHFA 3BDPA 3CC2S 3PDNA 3RB4A 1JLQB 2J9DE 3D0GE 4DDFA 1S6QA 2R8KA 2XWYA 3BR8A 3M8QA 3UDCA 2EFOA 3CCLS 1HR0F 1V3SA 2VA3A 4MMOA 4QIFA 3CMES 1ZZFA 4WK1A 2D41A 3SQGA 3I31A 1FEHA 3EGWB 3F56A 3KNGA 2HGNA 4WKRA 3MMCB 4ITSA 3D1HA 4BHQA 2RF2A 3ITHA 4DSKA 2K7KA 5DGAA 2PD1A 2OTJS 3LGNA 3ZZZA 5IQQA 1NEEA 2DO4A 3VCDA 4LMZA 4O0IA 1JLFB 2M5YA 3MPYA 5I3QA 3M2UA 4KHMA 1UA0A 5D8HB 4TQSA 1HWUA 5C5JA 1FD2A 1I94F 2L9NA 4EUVA 2YWFA 2VPZB 2IM3A 5K8OA 1KFDA 1CC8A 2V4JA 2B4PA 2O1PA 3NAHA 1TL1A 4I1TA 4EBCA 2QSFA 3PJXA 2ZH8A 3MXHP 5D4NA 3GV5B 3PW0A 4G1QA 4B08A 4ZKAA 1KHVA 3SFUA 2I8EA 2OPSA 2DIUA 4YB6A 3FQKA 4QOTA 2BJDA 4NXMF 3S8SA 1JKHB 1CPZA 5THWA 4ZCKA 3IGVA 4PXEA 5EN1A 2CPZA 2MKIA 2AJQA 1F0XA 1P8GA 4QQBA 2HQIA 5B0FA 1T8EA 3FNNA 4O44A 4X66F 1N5SA 1L3KA 2YKNB 4ED1A 5IWAF 2MQMA 1TKTB 3PX0A 1VRUA 3P3DA 2BYCA 1GXLA 2IC3B 3JTPA 5GAHI 2EK6A 3M2VA 4A8FA 1FRJA 3CJ3A 2I38A 1V3ZA 1BY9A 1WACA 2V9WA 2N7YA 4ES1A 1CC7A 2NSBA 1MMNA 4OJ3A 5CZXA 3KLFB 1SUQB 1X4BA 3V81B 3LALA 5M2RA 1AXQA 3OV7A 4A8WA 2FIUA 2R8IA 3CEDA 3MM8B 3TI0A 4HVZA 1KQFB 4NLPA 4WFYA 1Q86T 1JJHA 1K0TA 5LMNF 2LVWA 2Q6BA 4BCAA 2FHOB 4JI2F 4X65F 4YFUA 2W9CA 1N54B 1FDAA 4CO4A 1MSWD 2KU7A 4I64A 1S1UA 3MECB 5D4OA 4RW8A 1UVKA 1LW0A 1TKXB 4A8XA 1SC6A 2B43A 2CIMA 1AFIA 2DGUA 1MMLA 1UWBA 1GT8A 3H5XA 4NLGA 2OH2A 2MHEA 4N8OA 4X62F 2COLA 4YEAA 1JLCB 2LECA 1HNVB 5B0DA 4Y0FA 2ZZNA 1KQSR 5I3PA 1S9EA 3N5BA 1B0TA 4E98A 3FEYB 4ES3A 3NKYA 2IAJA 1RT6B 1FDBA 1D9AA 1N88A 2VKRA 3IO1A 1JXLA 2UXDF 3QIPA 1SH0A 5IS2A 2AJFE 4ECWA 5CYJA 2F40A 2HHUA 2FHJD 3NGDA 2J7UA 5F8GA 4QIVA 1N8RT 4K4WA 4C8LA 3OL9A 3G6XA 4OHVA 3ENQA 3NAIA 4DV3F 4HH0A 5L1JA 4EEYA 4F26A 3IS9A 4AL6A 2EFVA 2E1RA 4PUOB 3WBZA 2VFSA 2MZSA 4OHWA 1S9GB 1TAQA 2GO9A 1UVMA 3PKMA 2O5DA 1FDNA 1WHWA 2DGVA 1HPZA 3DLKB 4IDKA 4NLQA 1HBUB 1GX5A 4ZPCA 4CH0S 2AD9A 3I0SA 5LXYA 3R1LA 1N56A 1JNRB 2CVEA 2CQHA 2VC1A 4X2BA 1KVJA 2VB6A 2NZ4A 2CQPA 2F9DA 4I2PA 1X8DA 3KNAA 2HHHF 3NLCA 2GGPA 3C6TB 5DO2A 4Y2AA 2E5GA 2NPFA 5LSLA 1T3OA 1D9FA 2RT3A 1RGVA 1WF2A 4ZPVR 3PEHA 4PWDB 2E9ZA 1YJTA 4AQYF 3FFIA 4E0DA 4QW9A 4B9TA 4J9SA 1NJWA 4XPEA 4YDDB 3VAJA 3ZZYA 4HYKA 2QA1A 4AE5A 3UDLA 1X9WA 2JVRA 4G6VB 2SXLA 3GFXA 4I2PB 3H25A 1R0AA 2DVIA 3OFEA 2D3UA 3KHGA 4GKJF 4TQRA 1FXDA 1P1TA 1GTEA 3HHLC 3K5PA 4O3OA 2FHKA 4URQU 2IRYA 4ICLA 5F0WA 1QLNA 1Q78A 2FY1A 4EZ6A 1RTJB 2UUTA 2XY5A 3CD6S 2ZC4A 2J7WA 1UVIA 2MYFA 3T5KA 2VPWB 1X7VA 4I68A 3SMZA 1U49A 2VG6A 2VBXA 3MM6A 3US5A 2D1CA 2WK4A 1TV6A 1FKPB 3F41A 5F0UA 2R7SA 4I56A 2I1RA 3OJSA 3MMJA 3CCWA 2FHJA 1VRTB 1RTDA 4NCGB 2GMHA 2ROPA 3MHYA 1RT2B 4K4TA 2CPYA 1S77D 4LSLB 7FDRA 1C2PA 1UKUA 2K1RB 1KONA 4LIRA 4WU3A 5LXRA 1DRZA 1WG1A 4JI8F 1ZPVA 2GHVC 1ZOTA 2LEPA 3CDEA 2P9CA 1ZM4A 4DEZA 2VPXB 1TKZB 5LSOA 3S01A 1G1XA 2ZHOA 3BF4A 4EGLA 1TK5A 5DG7A 5LL6d 1U26A 4KC5A 3NBPB 2XNQA 2DR5A 3T3FA 3V4IA 5CZVA 2KRBA 4PWUA 3EGNA 2AYBA 3B4DA 4KHRA 1S1UB 5F41A 4J9NA 2LEBA 3S6EA 4I67A 2LLZA 3VQSA 2CJBA 3UPFA 2W9CB 2DGSA 2BVZA 4X64F 2ZZMA 1XWLA 2YVSA 4FP9A 6FD1A 2OPRB 3TVKA 2AWZA 1XNRF 1AFJA 3UQSA 5KFVA 3EZ5A 2IYIA 2HWHA 1DTTB 3G8TA 1FRXA 2ZOMA 1NJIT 1Q82T 4NLRA 1RJJA 2RQMA 3MEGB 2F8HA 1UAWA 3OSPA 3KTQA 3NMAA 4FXDA 2KZZA 4PG6A 1RK8A 1S79A 4ZPTR 3MD1A 4WKYA 2XZWA 2E1CA 4Q2LA 5EWEA 2J7KA 4DL6A 2UXBF 5F9LA 2APOA 2XMKA 5H1SV 4NZ6A 2MQOA 3D54A 4EYHB 5CQGA 4WF9Q 3LP1A 3MR2A 4X4SA 3SSRA 1OSDA 3ISND 1N32F 3NS5A 2VV5A 4IRKA 4JI4F 2IAJB 1E6VB 3OTBA 2VBYA 4DLEA 2GHWA 3K5NA 5I4MA 2JLFA 1RKJA 3R5BA 4DQIA 1I1GA 3CPWR 1BQMA 2BANB 4O4GA 4IOCQ 2HNYB 3HZGA 2QFJA 3T6BA 3VTIA 2WOMB 4DV5F 2OPPA 3IR7B 3PEJA 1NK9A 2ASJA 1YWXA 2DR7A 1OS5A 1CQNA 1LW2B 3GWCA 1DTQA 5FDLB 2V8DA 5CYQB 1YG0A 3SI8A 3RBDA 5D6GA 1JLEB 5KG3A 4QWCA 5H9EJ 1H7XA 5C25A 3BGRA 1KLNA 1HWJA 3EXCX 4DV2F 2RB7A 1IUJA 4OQJA 2B6AB 4TN2A 2Q43A 3OVSA 3HZEA 1R0AB 3U27A 1S6QB 1IKWB 4YB7A 3WX4A 4AXIA 4IO9Q 4ZMMA 4D3HA 3MM5B 2WB1D 5KT4A 2VG7A 1N5QA 3EYZA 4CTAA 1T03A 3DRSB 2LQ5A 2R9LA 4OX8A 2JEJA 4KO0A 1SH2A 3AA9A 2AP6A 2UXCF 4Y2CA 5D4LA 4XPCA 2ZBIA 3LP0B 5K9FA 2W4PA 3IAM9 2DJWA 4C3MA 4USJC 2N3OA 2N3LA 3IXQA 2IRUA 2LEAA 4HTIA 2HHVA 2B7CB 3R5DA 5KFTA 4YQWA 3UNGC 4PG8A 2ASLA 2J0SD 2BV3A 3I32A 3FEXB 1HW8A 2GX8A 2VZ9A 1XMQF 3H4BA 2RQ4A 4NL5A 3CIZA 4HT7A 1NJZA 2AGPA 4F2RA 1NAQA 4KKOA 5KFHA 4J9RA 4YB1P 1SKSA 3SSQA 2MB0B 3SDEB 3SCKE 1NO8A 2HNDB 5GAGU 3PM9A 3NNAA 2N82B 2ROEA 1U1LA 1T3NA 3IWNC 5HL7Q 2HYIB 1ZH5A 2VOOA 1Q79A 1LFWA 1CG2A 3FJ2A 4Q7AA 2Y0SD 4YMEA 2IM2A 2CQGA 2AU0A 1VQ8S 2OPSB 1BD6A 4Q0BB 1KHWA 3MTKA 2KHCA 2W8KA 2BACA 1REVB 3EPIA 3BO4A 2DR8A 1ZETA 2YNFB 1B0PA 5J1EB 3BGRB 3QZ8A 2UVWA 3R27A 4EU0A 1YTYA 2C28A 5L8RC 4CO0A 3B78A 1RT5B 4DR1F 4DWIA 3MAHA 4MK9A 2ASYA 1LWFB 1N5YB 3D1OA 5CYQA 2ZUGA 1Z2LA 5EHHA 3GB0A 3IRXB 1FVSA 2KG0A 1NKCA 1ULRA 1OQ6A 3SFGA 1IBMF 2ATLA 2OLWA 2CJAA 4C4WA 1GNKA 4F3MA 3I0RB 2BJEA 1RYRA 1QUPA 2VOPA 2ZBCA 1T7PA 3AH6A 3KHRA 4F8RA 2R2UA 2BRLA 2XMUA 3N9UC 5KT7A 3VAHA 5C24B 5DDOC 1QSSA 1UJ4A 2HNYA 2N4DA 3CSKA 2RDIA 3UCZP 3EGZA 3NMRA 3I9V9 3U7JA 4Q44A 2IVYA 3R3TA 2FJDB 3DLHA 2IBOA 2C42A 3JYTA 1WTBA 2KXHA 2XS7A 2R2TA 1VQMS 2R7UA 3SSSA 1OO0B 2DTJA 1C1BB 4RNFA 4KB7A 2C3UA 1T02A 1M5KC 4RWWA 3PJWA 3DOKB 1WI6A 3W2WB 4D3GA 2OPPB 2MSTA 2UU9F 3DDNA 2VBZA 2ZVSA 4ZPBA 2YQ3A 5FD1A 4KPYA 1H38A 5KTQA 1PGZA 3F73A 3MOJB 3BB5A 3NNHA 1NK8A 3BO2A 2JOQA 3N6MA 2GQCA 4F4XA 2XMMA 3DRRA 2MMYA 1KRPA 3PXGa 3CD0A 4JI5F 1WTFA 3CT9A 1T95A 5KG4A 2PI5A 1QY7A 4WXWA 1VBYA 4Y2MA 5J1NA 5DRKA 1H2VZ 2AGQA 2L08A 3HDSA 4OLOA 2EG1A 2F8EX 3I55S 4RNOA 3E01A 2ALZA 1KQGB 2Z2MA 1NH8A 3I5BA 3MR6A 1FRMA 1U48A 2FJVA 2YH0A 2ZD1B 5I3UA 4JI0F 4IRCA 4CTAB 4XAKA 2R7TA 1RTHB 2ZE2A 2E5JA 3OFGA 5CYMB 3BEGB 4ZHRA 1HQUA 4M5DA 4JI3F 1HW9A 1NRKA 1TL5A 4I6WA 3HHLD 1HMVA 2WRMA 5KG7A 4RBUA 2B6AA 4DL7A 3MUVP 4N5SA 3U1NA 3ZZUA 3M9NB 3LP2B 4F4YA 5C42A 2DNKA 1RTIB 2CQBA 2EI5A 2KJWA 1E6VA 1D0EA 1XBWA 5HQ8A 2X1AA 2FJXA 1NK5A 2K1RA 1RT3B 5A8WB 1FERA 3IG1B 2EFGA 3HFKA 2EPIA 1UP1A 4RW6A 4O3NA 3V6JA 4B3TF 1VC6A 3K58A 4EFAC 1S10A 1BQMB 1Q16B 2A18A 1JLBB 2BANA 4ID5A 4O4GB 3I5CA 4RUAA 3C6UB 3T1AA 1KSPA 4M94A 1V6HA 4QIEA 3OR2A 3OHBA 2JSXA 2RJZA 2EFQA 3PFEA 3U02A 4Q43A 2WCXA 4Q8EA 2HHWA 1X4EA 3DXBA 5K8PA 1SJRA 4DR5F 3D5MA 1TFWA 5KG1A 4DSLA 2E7XA 1X9SA 2CQDA 4NYOA 1S1XA 1R89A 1UEUA 2KYZA 4PG7A 2WSCC 3Q8RB 4MH8A 2UVUA 3FVYA 4KV8B 4O3SA 2N4CA 1F5AA 3SCLE 2F8MA 2XMWA 2OMLA 3QIDA 1FKPA 1ZM3A 3K59A 3PX4A 4PXCA 3QJJA 4UQTA 4MIBA 5J1PA 1DQ9A 4HH1A 3NGKA 3QGPA 3AQOA 2OTLS 2JVOA 2FVPA 4C0BA 3RB6A 2R8GA 2L9DA 3KK1A 5HP1B 1NK4A 2GMJA 3G6ES 1BQXA 3MEDB 3RAXA 3GYNA 4V19X 1ZM9A 2DGWA 2ZH2A 3AA8A 3OTEA 5EWFA 3JSMB 5JXSA 3OL8A 4TNOA 3GYXB 5M2UA 3OL6A 1M5PC 4K0KF 2KN4A 3PZPA 1HPZB 1ROFA 3DLKA 3MDFA 4IDKB 4NLTA 2RMLA 4LFAF 2YNHB 4HKQA 4NLYA 1S4FA 2RNEA 4JV0A 5J2NB 3X3UA 4DL3A 1N48A 2WBMA 2DK2A 1DQ8A 2MZRA 3CIMA 2J9CA 2VPYB 3RTVA 1LWCB 5KOXA 2DNRA 3TR5A 4OZ5A 4F3QA 3CCVS 3SZ2A 4KGKA 1NZAA 2D9OA 1ZZNA 2JDJA 2AF6A 2KDOA 1YIJS 3HKZD 2CDQA 4ECVA 2MZQA 3M2RB 4U6PA 1SL2A 1QUVA 5GMKa 2QT7A 3CCRS 1R3NA 2IM1A 5HLFB 3ICLA 3D0HE 3GE9A 2IVFB 1Q8LA 1TKZA 1JJ2R 2IJNA 1QAJA 5E3CA 1WELA 2HS3A 2NPIA 5KFLA 2V2KA 4DFPA 4LUBA 1OPIA 4ZDNA 2KT2A 2NREA 4PUOA 3R1HA 1UFWA 1VQKS 2KO1A 1LWEB 3IC1A 5AE3A 3CO9A 1N5VA 1HMVB 4KQZA 5IQ6A 3KMSA 1B0VA 5E41A 4BDPA 4MFBA 3GV7B 4MIWA 1UVJA 2D9PA 1FEEA 4KIAA 3U1MA 5SZTA 1KLMB 1C1CB 2ZD1A 1SH3A 3O8WA 5D78A 3E51A 1U7LA 4MKAA 2LXIA 2V8HA 4FN5A 3V6DA 5KFXA 1RTJA 2NXUA 2CFXA 2XULA 2V94A 2VG5A 2ZDPA 4Y65A 1ZAXA 2RU9A 3T5HA 3OXGA 2J6TA 1XMBA 2OSRA 1NKBA 4RW9A 2JLEA 4NLOA 2JEGA 1Q8IA 1U47A 4W90B 1NH7A 2FB0A 4ECYA 4A8OA 1DURA 4J9MA 2BM1A 3FCHA 4ZCLA 1K1QA 1U1RA 2L3MA 3IAS9 2POKA 4KTQA 4MFBB 1FRHA 2RUGA 1RQ0A 4QJVA 5EDWA 2X1BA 2I5JB 4C8MA 3CGIA 1HWIA 4C9DA 2E29A 1S1XB 1YJWS 3V6DB 4H4MB 1VFJA 3RB3A 1FKAF 1R8CA 4BC9A 5AXMA 5BYRA 2FGOA 3V5RA 1YHQS 4JV1A 4WYLA 2HFZA 1S9GA