2NQPA

Crystal structure of pseudoudirinde synthase trua in complex with leucyl trna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transfer RNA
publication title How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Isomerase/rna
total genus 80
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.4.99.12: tRNA pseudouridine(38-40) synthase.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01416 PseudoU_synth_1 tRNA pseudouridine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA01
3.30.70.660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA02
2NREA 4IQMA 1VS3A 2GMLA 1VIOA 2OMLA 4ITSA 2NQPA 4NZ6A 2NR0A 1DJ0A 4J37A 2OLWA 4NZ7A
chains in the Genus database with same CATH superfamily
4X64J 4ES1A 1FDBA 2CVIA 1CJUB 1SUQB 1HNVA 2JSXA 1OQ6A 2P2CB 3IAM9 1OSDA 1HQUB 1CS4A 3PRDA 4ZVTB 1LFWA 1WORA 3MM7B 3NS5A 4KHPJ 2J0SD 3C6UB 2FZKB 3OXFA 3SEOA 1C4AA 1TKXA 1XWLA 3ILJA 3IP0A 3PRVA 2L3MA 2HWTA 2MZ1A 4QWDA 3M2VB 1TU0B 5EDWA 4JYAF 3QO9B 4EYIB 3WZ0A 3CB4A 2NXCA 5JVGQ 2XS5A 1GXUA 4RL1A 3H4DA 3BSNA 2IJRA 4ZP7A 2BEFA 4RWWA 2UXCJ 1U45A 3VGSA 4JI4J 1HNZJ 3C66A 3DRPB 3FEZA 2XMAA 2YWKA 2YBVA 1K1SA 2GS8A 3DXBA 4ZDNA 4R5PA 3F41A 3CWJA 3RYLA 2VG6B 4ECWA 4FYXB 1MW7A 4EBEA 3KLFA 2GVZA 3H7HB 5HLFA 1UCNA 3Q8PB 3GJRB 3FFIA 4QJVA 4DV4J 3MPDA 3GU0A 2HEKA 1WHXA 2UU9J 3FCVA 3OTOF 3ILOA 4O3OA 2GAGC 1UTAA 4YHHF 2HBZB 1UWBA 3KLHA 2HRUA 1ZAWA 1WEZA 1SCJB 2BQ3A 1ZTTA 1X5OA 2G13A 2IAJA 4H4OA 3D0HE 4ZPVR 2KB2A 2OMOA 1VI7A 2CDRB 1SL0A 5C2CA 4GO5X 1S6UA 5D4LA 3W2VB 2O67A 2XGPA 3AB2B 1P27B 1VK8A 3K17A 4L76A 2YWGA 3D6FB 3Q8VA 5KFAA 2ERRA 2W9BA 5T7LB 1Q5YA 4KFBA 3UE2A 3BH6B 4PCQA 2RH3A 1S1VB 4ZCLA 4OHXA 1U25A 5EWGA 3CSKA 2GC8A 3DRSB 4C3LA 4DSLA 4CTAB 2J9DE 3H2UB 3R97A 1LWEA 3FRZA 2E5LJ 2XMKA 4FF1A 1H2TZ 1EKRA 2DRBA 4F50A 4K4ZA 2ZOGA 3HSGA 4M5NA 5L1LA 1G4CA 3NGDA 4ZCMA 1T03A 3PKYA 2P9GA 5A8WB 1TK0A 1SH3A 4ATNA 1Y9OA 3RG6A 4DR1F 4P72A 4U7UD 1VIXA 1QUVA 3T5KA 3D7SB 2CJQA 4KKOB 2VQFJ 4YMEA 4J9QA 2Y3YA 4GC6A 3BQ0A 2AX0A 3NG8A 1F5CA 4PWDB 1WHYA 4ZVRB 4ANDA 2FJAB 1BQXA 3JYTB 3NS7B 1HR0F 3OQ2A 3LAKA 4WFBQ 2C2OB 2KYZA 1M1HA 2IRYA 3C14A 2HS0A 1RA6A 2M2BA 3MUMP 3QGGA 3B4MA 3IGNA 1HYSA 1EHWA 1VQLS 2CQ1A 4IYQA 1W2BR 5CYMA 2DNHA 3TP2A 3LP1A 1NJYA 2RQMA 2MDAA 3E3XA 3B82A 3ITHA 2A10A 1N33F 4C8LA 4HH1A 5EN1A 3KLVA 5KFVA 1EX8A 2UUBF 1HI0P 1GEHA 1OY9A 2EVZA 5KFGA 3HD1A 3MMCA 2F1FA 2CNKB 2ZBCA 2YX4A 3MMJA 5U47A 3EGVA 4C48A 1ZPWX 3VAJA 1IKXB 3EYZA 4M1KA 1RAFB 2MKSA 5A8RA 2HMIB 5LJ5Y 1H98A 1KBRA 3R8YA 3JSMB 1H74A 1JK9B 2JFDA 2KN4A 2KFYA 2OTLS 4NE9C 1X0FA 2NXEA 2XEXA 2QA4G 3KFWX 1ZA1B 4EBCA 1C0TB 5CQGA 3WC0A 3LTOA 1XJWB 1T9VA 2HFUA 1T9XA 1RWNB 1U0HB 4P2SA 1GFWB 2OPSA 3G4SS 4RKUC 1U49A 2WOMA 3D9BA 4RR5A 4CLPA 2DR5A 1FJGJ 4BWMA 4DR4F 2G1DA 3TR5A 2XSFA 5KFBA 1UW4A 1VJWA 2Q1LA 9ATCB 4J37A 3GV7B 5AT1B 1YQHA 1UFWA 3AXMA 2OIHA 2F3JA 4LF8F 3NOCA 3KK2B 3KUEA 4ZP8A 4LFBJ 1GMWA 2QG9B 2FB0A 2QL7B 2GGPA 3W5XA 1HD1A 2RT3A 4B3TF 3MPVA 2B7BB 4ANCA 4ZIWA 5KFOA 4NLWA 3F0NA 5B0EA 2Q6BA 2XHCA 3NGUA 1SC6A 3MEGA 2R7TA 3B78A 1UFKA 1K73T 4R8UB 3C6TB 3U1NA 1HI8A 2FPHX 1KVJA 1F2GA 3QNWB 3IXQA 2RF2A 1NZAA 4N7TA 4MMOA 1FI4A 2RSQA 5DGAA 3KK3A 3FSXA 1NB7A 4CLTA 1HWJA 4A8YA 2UP1A 5HROA 3TNVA 3CJ2A 1FKAF 1FCAA 2DNNA 4IFYA 1RHQB 2UXBF 3M6UA 4M5DB 2DTJA 1IWAA 3K59A 1KC8T 5HN0A 3IWXA 1LW0A 1U47A 3I0RA 5BYRA 1V9OA 3DI6B 2H3EB 4F26A 2VJUA 1MNEA 1VQPS 2W9CA 5IT4A 4L75A 1GT8A 3QJLA 4DSFA 4DV2F 2V6AA 1VRQC 3A8EA 5KFPA 4ZA1A 5DDRC 3OSNA 5GAEU 1WHVA 2OHDA 3G8TA 3SDEB 4DQPA 5GAGU 3OLAA 1T05B 4TYBA 4F2SA 1ZAVA 4WZQA 3BGLA 1UZDA 3DRXA 1F5AA 1SC1B 4BWJA 3M05A 1S0MA 2MY8A 2HLUA 4ZVQB 3QBCA 1FK9A 1S7IA 4IG3B 5DG8A 8RUCA 1HBOA 4OV1A 4QWBA 3UFCX 3SSSA 1M1KT 2FIUA 4OZ1A 2U2FA 2OUGA 1QSSA 1VC0A 8ATCB 4W92B 4ANEA 2FJDB 3OVSA 3P5TL 2R7UA 4OZ3A 5DQHA 2IRUA 1IJEB 1LWXA 3OTDA 2FVQA 1S48A 4LRFA 1XC9A 5ADZA 3V4MA 4F3MA 1JX4A 3LWMA 2G1HA 3ISZA 5A0YA 1X4GA 2O5DA 2WBMA 3T5LA 3I31A 4K4YA 4UY85 3PW0A 4ECTA 1WSVA 1XIQA 4TU7A 3KNGA 3PIOQ 3OR1A 2VOPA 3SIPB 4CDIA 2QFJA 3E2EA 3KMQA 3HHKA 3U1LA 2AIRB 1MROA 1IJFB 2ZD1A 1ZA2B 2M7SA 1SPBP 5EWFA 1RAJA 2RUSA 4P7TA 2CQCA 2EI5A 2O01C 1FF2A 2GQQA 4Q5VA 2H5JB 4ELTA 3J7YI 3W5YA 1CVJA 1JLGA 4F4XA 1TV6B 1XNRF 1AFIA 3QGHA 4K7QA 1TMJA 4EBDA 3QIPA 4JI3J 1CSJA 4WFNQ 3M2RB 3GB0A 1X9SA 4DR5J 3HCXA 1RAIB 4PZVA 3LANA 3Q83A 2ATCB 1U02A 4TVAB 1MU2B 5L1KA 2W8KA 4OJHA 2K3IA 2C2NA 1ICEB 3CD0A 2QSWA 2BM1A 4DQSA 2I5JB 2JX2A 3V2UC 2DRDA 1WDTA 2VG7A 3B8HA 3MWBA 3GLJA 1WC4A 3HZGA 4B3SJ 5T41A 4B9UA 2IM3A 1RTJB 1S6QA 5KG4A 1RTHB 2W1BA 4NCAA 1HNIB 4OI3A 3G6VA 4D3HA 4RW7A 4YDXA 2WONB 5K9FA 3LALA 3CC7S 4DQQA 4ALZA 4RBUA 1VBKA 3MECA 3LF0A 4ID5B 4RW9A 1BE4A 4ED8A 1NMEB 3JSYA 1V3SA 3I5BA 4HYKA 1VR6A 3FBBA 4BS2A 2BJ7A 3RAQA 4L3NA 5A8KB 3GCXP 5M2PA 1EP4B 3NNAA 1UETA 1BQMB 4OYIA 4WYWA 2LA4A 1RKIA 3AOBA 4OV6A 5HBMB 5I42B 3BGUA 2UUCJ 2J9CA 3TJ8A 1N34F 1HBUB 3UWTA 2PSZA 2IDLA 3HMJG 3LH2S 5E3CA 2WVFA 3SXLA 4KT0C 1Q95G 3TAQA 4X4VA 3KLGB 3RBZA 3I55S 2CZ9A 2B4UA 1NKCA 5HMYA 2EXUA 4DZDA 1UVIA 2ILYA 1UAWA 2X51A 3MAAA 4L74A 2FY1A 5KFZA 4K4TA 2V8DA 3I5AA 1OPZA 4CT9A 2V2QA 4EEYA 2CRLA 1OYDA 5ETRA 2CPYA 4EO6A 3DGPA 3ETOA 1P9YA 1XMOF 4DV0J 4CNZA 2WSEC 4F04B 2YWHA 3AY0A 3HVWA 1U1OA 1ZTWA 4P2MA 4P10A 2GIQA 3NOGA 4GMKA 2C3PA 3DU5A 4MKAA 2QC3A 1HNVB 4HACA 3MAHA 3CGIA 2IC3A 1R6VA 1X31C 4XO0A 3Q8QB 4OMFG 2B51A 1CS4B 1U1PA 3CF5Q 3OJUA 2KJVA 3MCNA 5JVHQ 5HANA 1M5VC 2BE2A 3TO8A 1HHQA 1TKXB 3CDUA 3KHRA 2MLXA 1VK3A 3G2XA 3DDKA 1HIYA 1LNQA 2RMLA 2CNNB 3GWCA 2XMJA 3NNHA 2ZWPA 3DLGA 1SJRA 4LREA 2R2SA 4LR7A 5IXUA 1X7VA 3D2WA 1ROFA 4TQSA 4K2JA 1Y3KA 4KHRA 2V50A 3JSBA 4B9NA 4R5PB 5DLFA 3LWLA 4CLKA 1F1BB 2OO4A 2CIMA 3KLFB 2GVZB 3SFGA 5HLFB 1U48A 4GKJJ 1O8BA 3FFIB 3UN5A 4ZVPB 2B9EA 1MLAA 2BM0A 1SKRA 3LO3A 2QE5A 1W7WA 1WF2A 4FYYB 3HVTA 2G0JA 4WK3A 1UWBB 3KLHB 1UEUA 2YKQA 2J7WA 3QRQA 4FF4A 2R4FA 4LT6A 2IAJB 2MQQA 2GJIA 4H4OB 3ELHA 4JI7J 3HXMA 4ECVA 2XSJA 2AT1B 4B3MF 1X4DA 1UEVA 4CIOA 2CNLB 2W9BB 1F2HA 4KFBB 4DLGA 3CC4S 4LF6F 1KONA 5IWAF 4F67A 2M9KA 3BF4A 2Y9HA 2UUTA 2KXHA 3FUYA 2J9EA 2A3JA 1FWLA 3J7A1 5L8RC 3A8JA 1LWEB 2YY3A 4DZ6A 2A0FB 5K20B 2FJXA 2HFSA 5HL7Q 1FRHA 4FYVB 2ZKUA 1T03B 4O4RA 4AQYJ 3P45B 4RPFA 4E2FB 2Y8WA 3VAGA 5RUBA 3BO4A 1Q8BA 4ZPCA 5AJ3J 3MEEA 3Q8YA 3OXGA 5D8HB 4A8KA 1HD0A 3FQKA 2H4WB 4DCOB 1CQNA 4IR9A 4ZN1A 1F3VA 3UI3A 4WTYA 1HBMA 1YRTA 3BGOP 3HSJA 2Z2LA 4UUXA 3C14B 5F8LA 5AXNA 2LEAA 3IRWP 3D5MA 4MH8A 3T1HJ 2GW8A 2IIHA 1DTTA 1DLOA 2IA0A 4B9TA 1H7XA 2DD8S 2EBEA 4YR0A 5KFYA 1HYSB 4M5IA 1PIEA 2COLA 2HFVA 4TLQA 1XTZA 5CYMB 3D6TB 5KOWA 2OD6A 3LP1B 2YXLA 3L9ZA 3OT9A 2ZOMA 1KTVA 4CO2A 4NEZA 1S6OA 4J91A 1FDAA 3ITHB 2UV8A 4F0MA 3HHLA 2OPQA 2DEIA 3MMBA 2V69A 3D0GE 1T8EA 5CXTA 2MY7A 3MMCB 1JNZB 2GO9A 3CMAS 1X4AA 3BYRA 4IRKA 4X4NA 4X64F 3EICA 3A8KA 4WU3A 3MM8A 4PRFA 2E5HA 1RDRA 4DG1A 4ELVA 2KRRA 2CPJA 2KHDA 1TMMA 2BRLA 2XGQA 2HVHA 4USIA 5CYQA 3FNNA 5A8RB 3FKBA 1FESA 3I82A 2BUNA 3FSYA 1LK7A 2QGFB 4ZVGA 4KHPF 3AA8A 2C2RA 2ZBRA 3PTWA 5F3TA 4CLYA 3IR5B 4Q8FA 3UQSA 3R5DA 2OPSB 4LSNA 1VC5A 2VJVA 3H25A 2WOMB 4WKYA 1T9TA 1EAYC 2FHOB 3FMBA 1UVJA 2U1AA 1IVZA 2DYAA 2UUWA 1JLQA 3K58A 4X66J 2HFOA 1YJWS 3G9CA 3MFIA 2UXCF 3US5A 2B56A 2FHJD 2ZFHA 2NYHA 2KO1A 4JI4F 2QZ8A 4HHUA 4M5MA 2RNEA 5DETA 1HNZF 1B4SA 3H98A 9RUBA 3CCMS 4DMZA 2V9KA 3E01A 1QAYA 3DMJA 2QRRA 4C8YA 2DEJA 4XDCA 1JNRB 1DBDA 5K14A 2MKCA 4USHA 2B7CB 2GGPB 5F8JA 2W25A 3H5XA 4YB5A 1K44A 2VBWA 2AX1A 4DV4F 3O3LA 5I3PA 1H72C 5KAKA 2HQDA 2WW4A 4ED0A 3PYEA 1JJHA 3MEGB 4FNHA 2ZH8A 1Y5IB 2OP5A 2RKIA 4CYUA 4DS5A 3GIJA 3H59A 2MZJA 4H54A 2OFGX 2EK1A 4CO5A 3QIDA 2RF2B 1N4LA 3JAMY 5ETVA 2KT2A 2PN6A 4J9PA 4B9VA 3KK3B 5M2UA 5HROB 2EKNA 2YQ3A 1JXEA 2IFXA 2BV3A 4IFYB 3RRKA 5DQGA 3E8OA 4QWEA 1VS3A 3HZEA 3I0SA 1LW0B 1S0NA 1U6ZA 1WHWA 3FBEA 2CXEA 3I0RB 4KB7A 1UA0A 2W01A 1BGXT 2EG2A 2X1AA 2D9OA 2VIHA 1HNXJ 1N5QA 3EPIA 2ZBPA 3EX7B 3BPDA 2W9CB 2Z2YB 4JV2A 2QX0A 3OFHA 1I5OB 1YJ7A 4WE1A 1PJ7A 5CZXA 3CIZA 2ADBA 2HHXA 2E5LF 1WI6A 4YR3A 1D3WA 5KT6A 3IWNC 2DGUA 3GE9A 4USUA 2DXDA 3W61A 2R3VA 4DFMA 4KJIA 2D3UA 2KXFA 3T6BA 2XS2A 5HP1A 1FK9B 2MMYA 2HVDA 3NGKA 5LM7E 4QZVB 1PAUB 1NK5A 1HBOB 5K8OA 2K2PA 1IKYA 5AXKA 3Q23A 3G8SA 3NY0A 3S7RA 3RR8A 1S5ZA 3OJSA 3VALA 4NLTA 2LQJA 3VR1A 3DGVA 1FD8A 4DPXA 2LP4A 3Q24A 2R7OA 1RSCA 3MZIA 2YNIA 2ZHAA 1FRXA 1Q79A 3UDLA 1YJTA 2JNJA 2OH2A 4NYPA 3TX0A 1XMBA 3UCUP 4N47A 2YPZA 3I6PA 5A0YB 4LR8A 2B9YA 3RGIA 3GYGA 2Z56B 1J2VA 4USVA 3OR1B 4DV6J 1SH2A 2C2KB 3C15A 3H5YA 1YTYA 1FNXH 1TR0A 2Q79A 3N0VA 1MROB 4IOAQ 3L95X 2ZD1B 3TWZA 2AGPA 2N3LA 2HGNA 1FKPA 4ZVSB 1ELOA 1APSA 2QO3A 2R8KA 5BYSA 3V6KA 2OJ3A 1Q82T 1YGYA 2H65B 3H5UA 1AT1B 1OQ3A 2IBKA 3SCIE 3MM6A 3V6JA 3N5BA 2FLOA 3OFFA 4LF1A 2JEGA 4ZJLA 1Z1ZA 2UVRA 3UN2A 1CLFA 1YVFA 4I7FA 2IDEA 3FMWA 1JLGB 3DFEA 4HKQA 3H0PA 2JRSA 2OD4A 1FA0A 1Y5LB 4C8KA 4I4BA 2RS2A 4H4KA 2DGQA 2YWWA 3QIPB 3RRGA 4DF8A 2XY5A 1QTMA 1P6TA 3WQPA 1NRKA 1ACMB 2R8GA 3HT0A 2LA6A 1FJGF 1D9DA 3VF0B 5ETKA 4Q8EA 2HAFA 1Q4RA 4CT8A 1VGYA 1XQIA 3DM2B 2BABA 2DGWA 3IBFB 2VG7B 2CPFA 2HGMA 2R2UA 1SVDA 4LFBF 1UVMA 3FCWA 4I6YA 1YWXA 4CI0B 1VRUA 2J0XA 3WBZA 1RWOB 3M9NB 5KFFA 3V6DA 4X4OA 2CJKA 1YJNS 3L7UA 2RRAA 1S6QB 1XR5A 5ETTA 4DPWA 2CQ2A 4XAKA 3D4JA 3OL6A 3M8PA 3Q8RB 4I1TA 4FS2A 5J1EA 2ZBQA 3WIUA 4NASA 4RW7B 4FF3A 1PKUA 1TL1A 4KGZB 5KG7A 4ED5A 3MI7X 1BWEA 3R7NB 2RDJA 3MECB 1YRUA 1RBLA 4RW9B 3BR9A 4MTPA 4DX7A 1HFEL 2LQ8A 2EFVA 2HHUA 3ULHA 3VCDA 4DLEA 2POKA 2VC1A 1S59A 2HGLA 1GNKA 4ZMMA 3M2VA 5IC6B 2CNOB 4K4SA 4MIAA 4J9UE 4DR7J 4OYOA 3CE8A 3ETMA 1GQEA 5IZHA 2Z58B 3PKMA 5B0BA 3BB5A 1WWHA 2NYIA 4ZPWR 1EB0A 2LDYA 1CJKA 4E8UA 1FRJA 4M5LA 2XTJP 4WP8A 4J9MA 4FBTA 1J27A 3H40A 3MAAB 4CLFA 1L3UA 2GA7A 1WG1A 1Y11A 3TVZA 4C8MA 5K8NA 4GVBA 2DH9A 2OPPA 2FJBB 1CG2A 3LAMA 2VA3A 1RHKB 5GAEI 3DGPB 5LSLA 4DR2J 5H9EJ 4DF4A 5E33A 2HBYB 3WHIA 3HP6A 1U09A 4AYBD 2CQPA 1PILA 2BE7D 3ADAC 1KQSR 1FE0A 3BKFA 2VH7A 4HACB 4DQRA 2IC3B 1KHVA 1XNQJ 3NWRA 4LIRA 1KKHA 1FXRA 1Q0NA 4LJMA 3R5BA 6FD1A 2QSFA 2QYCA 3EVWA 1MN7A 2ZM6J 3MAQA 1RT1A 3EZ5A 2VFUA 2J7UA 2BE2B 2NPIA 3PJWA 2CPXA 3D67A 3FJ2A 5E3RA 2K06A 2RDDA 5CZVA 4LRDA 4PABA 1SC3B 4B02A 1KHWA 2PO4A 4MKVA 3DLGB 4ZKAA 2LXIA 1NU4A 2L9NA 4GRSA 1TELA 1TL3B 1S7HA 1C2PA 2XQCA 2BACA 4F8RA 3P96A 3TX8A 4LBPA 1BWVA 2KRBA 4Y2IA 1TKDA 4N76A 5FDLA 2NUUG 3FEXB 5KFTA 1TKTA 2PMHA 3BQ1A 3W9HA 1UJ5A 1NB2A 3MURP 4FKYA 1RTIA 2LEPA 3SSQA 4RU2A 1REVA 2BRKA 1UPPA 1FRLA 3ZXWA 3J80U 2O3DA 4HDGA 4Y65A 1GX6A 4OI2A 1FTCA 4JI3F 4G3IA 3CVKA 4PPZA 4PXBA 5KT2A 2DNOA 2HLTA 4PAAA 4FPIA 2YH1A 4C98A 1J5EJ 1BUXA 4DR5F 4UOHA 2CWXA 2NCKL 3SBMA 1WTFA 2XY6A 2EC2A 1YJVA 1FDNA 1LK5A 2QYGA 2IM1A 4NLUA 2QLXA 3D6MB 4UZBA 2A6MA 3HVTB 2DCLA 3ISND 4UOGA 4C7QA 4CQ1A 4NI2A 4PXCA 2F9DA 2VFVA 1CEZA 2V68A 4N77A 2BJ8A 3DDIA 1V3RA 3M8YA 2V8HA 4P9SA 2IYGA 2WHOA 3W8PA 2HHQA 1RBAA 1BLUA 4RW8A 2XSJB 1KSPA 1HWLA 4IG0A 2FDNA 2J7KA 3W60A 4O3RA 3J7YU 2G2ZA 5KFXA 1T9UA 3UO0A 2AYGA 2AYEA 1FRMA 3LGNA 4ED3A 4DUZJ 3MEDA 3ZTPA 2W9AA 3ZZOA 1NSKL 4M5JA 4DV7J 2EC0A 2CA9A 3ENQA 1Q7YT 1H2VZ 2OEKA 2YX1A 3GYNA 2WB4A 4DL6A 3RAMA 1RCXB 2ACMA 1C0TA 3C8YA 3KLIA 4R0JA 1FHTA 2P6SA 1ZH5A 1AB8A 5HVHA 2B8PA 2CQHA 1TUGB 2NREA 2OEMA 2QL5B 3DLLQ 3GP9A 4RUCA 3MEEB 1VLYA 1R8PA 2UUCF 1QY7A 5K5MA 1N5VA 2OSRA 4DX8H 3MMAA 2YH0A 4MKBA 2W2OP 1VQSA 3NMAA 1BQNA 3KUHA 5A76A 2DH7A 3UCZP 3IWLA 1YBTA 1HBMB 5D4PA 2NPFA 3W1YC 3NXZA 3BREA 4YN3B 3PACA 3LPEA 1SBRA 1KVKA 1T3NA 1DTTB 1RADB 1DLOB 4LF2A 2BX6A 3VGVA 2FHMA 2E44A 1HW9A 2PFFB 3IMQJ 1TVRA 3CJKA 1KEKA 3QGIA 5F8HA 3V81A 4F2RA 4DV0F 2H5IB 1NAQA 3HHLB 1NK0A 2KTQA 2OPQB 4PG4A 3MMBB 2MKJA 2XCPA 1U1LA 4B3OA 2VL1A 4JI0J 2N3OA 3PYGA 2QL9B 4MT1A 3MM8B 2R8JA 2XULA 3NNCA 1AUSL 4LF5F 4ECYA 3MM5A 4DG1B 3W63A 1D09B 1AXQA 1F9EB 1IN0A 4IOCQ 3GZ7A 3THTA 5CYQB 4Y28C 4TY8A 4NA3A 4JV5J 3QLHA 2E1AA 2P8IA 4DR3J 1L3KA 2KM8B 2MEWA 3MTJA 3MR7A 1WSRA 3LW5C 1CJTA 4ED1A 3BH7B 2MQ8A 1JLEB 5H9FK 1HI1A 4K5SA 1N8RT 3NGRA 4LSNB 1M0SA 4S0MA 1WD6A 1R8HA 5ETLA 3CCJS 4OYZA 4OJ1A 1JLQB 4QW8A 2ZJRQ 3J7Z5 3JTOA 1WKLA 5J1PA 2PT0A 2JH3A 2D3OR 1UMJA 2VODA 2WRMA 5GADI 4QYZJ 1GXLA 3E01B 1VQOS 4RW6A 1BD6A 1LV5A 4QQBA 4JI8F 3DMJB 4U8YA 5K14B 4A8FA 1WKKA 2HQIA 1RWUA 5LL6d 2M4MA 1IXKA 5LOQA 1T9YA 4GKJF 1NK7A 2RHSB 2I9SA 3AXKA 4IO9Q 4DJBA 4OYXA 1RLCL 5A6PA 5B7WA 2RKIB 4CYUB 4MYTA 4QCLA 1E6VA 4A8MP 1RT5A 1D9AA 2OI2A 4Y2CA 3D68A 1SH0A 2AJ2A 2KL8A 1DARA 2RAQA 2CWKA 3CCVS 4HL9A 4JI7F 2H1YA 2K3KA 2Q43A 2HVZA 1VLOA 3UDVA 5D0EA 3AH6A 1IKVA 1NKEA 5EX0A 3I0SB 4AE5A 3AOAA 2CPHA 1TZ0A 5KFCA 2IMOA 5C25A 4NZ0A 2C2ZB 1UVKA 5DS7A 4WE1B 1QUPA 3CMQA 2R9LA 1G6BA 1S1UA 3I87A 2JZ5A 4Y00A 4RU9A 5KFKA 2R7VA 4NLSA 4C9DA 2YKPA 4JI5J 4F0KA 4OX6A 1Q81T 2UUAJ 4NX9A 4AQYF 4PKDB 3NGSA 5HP1B 4OLPA 3DRYA 2CDQA 3BGFA 2E7XA 5AJ3F 3RUBL 4Y3CA 4DL5A 4OX8A 4NMLA 3KJQB 1IKYB 4A8SA 4KGVB 1NM2A 2HNDA 4O4GA 3EGWB 3HM9A 3K7RA 1CBKA 2HWIA 3CCRS 3AHPA 4OHZA 1FEHA 1PBUA 2I8EA 2FLLA 2YNIB 2C1EB 3T1HF 2IBOA 5KG6A 2YKMA 1JXLA 2CKWA 4NA1A 3PX6A 1T9WA 4F4WA 2YNFA 2LMIA 2HNZA 4FZVA 1LEOA 3CJ4A 1HARA 4J9KA 2CQDA 4O3NA 3MF5A 2D3ZA 3TQEA 2DO0A 5CHCB 1F6TA 4JB8B 3SMZA 3CD5A 4N41A 3KG0A 3AAWB 3DHXA 3H2LA 3KMSA 4BBYA 1GK8A 3C15B 4W98A 4EI2A 2B4PA 4LRCA 3CPWR 3JXOA 1T95A 1FKPB 3KK1A 2WTFA 2W2MP 4Y34A 2HFZA 3J80Y 4FS1A 1EARA 2CJXB 3MM6B 3OHBA 4MFBA 2CPIA 3L3CA 5E3PA 1OY6A 2L41A 4WBFA 4I7FB 2ZEJA 1SQFA 4C3KA 4IH5A 4LUBA 2LFVA 4DV1J 2BDPA 2J9DA 2DHXA 2BKPA 4JI2J 3EDQB 2FQQB 3PFOA 2HNYA 1N36J 3ZFVA 4X66F 4IH7A 2XLIA 3BV8A 4AL6A 1SB6A 1WJ9A 1VJQA 3L7PA 2OTJS 2KZMA 2UVVA 2MB0B 2G4BA 3EM1A 1HW8A 1RT4A 1RT6A 1U6FA 4C11A 4DL2A 3TUIC 1U1QA 2R42A 3G8QA 1EETA 4J9RA 1LFPA 1VRUB 4UZCA 2CZVC 4USMA 3AD8C 1QAXA 1B7FA 2MQLA 5K8PA 2VC0A 4I69A 1IM6A 3V6DB 1T0TV 2ZUAA 4NLRA 3NAHA 4J9SA 2K7KA 3K2YA 1WF1A 3BSOA 2X1FA 4WIQA 3GONA 4XPCA 2FC9A 3EPGA 2ROGA 3M8PB 5J1EB 3BZQA 4DR1J 1FRKA 1TL1B 4AUKA 1GTHA 1RCOB 4Q44A 2EFGA 1N6QA 2MZQA 2W4DA 3HJFA 3G86A 4B9MA 2MYFA 3EMTA 1FNMA 4P2XA 1X4BA 4ES3A 1NPPA 3VQSA 2LU2A 3QT5A 4AFFA 2BXJA 2FVSA 3THPA 3GQCA 3HHLC 1IBCB 3M8ZA 3CULA 4DU8A 1KLNA 5B09A 1CC7A 5F9NA 3J81U 3DLKB 2AU0A 2KU7A 4LSZB 1UP1A 2BJDA 2WCXA 4OI6A 1CJKB 4OZ5A 1R43A 2VV5A 2XMTA 2DR6A 1RGVA 2W7OA 5KFSA 3EVOA 3SV4A 4BLGA 2KM8C 4GVBB 2AKWB 4KBIA 1R0BG 4KPYA 2OPPB 2MJNA 5HJYA 1QAJA 4KAIA 4YDDB 3DKDA 2J5AA 2MQMA 2N4DA 2KZZA 2XLJA 1RACB 2V4JA 3OTCA 2XZDB 2KH9A 4RUAA 1UVLA 3IGVA 5IQQA 2FZCB 2LQBA 4FNIA 4J9VA 4FP9A 2C3MA 5D77A 3TAPA 3C46A 3RB6A 1NKBA 1PAEX 1AYEA 7FD1A 2BMBA 3CJTA 4WZMA 1RT1B 2CVEA 1WNEA 4RUHA 2H9ZA 2LQ5A 4DSEA 1S4EA 1KNZA 4LF8J 1MSWD 3A13A 1AA1B 1FX4A 1R3NA 3I4HX 4Z37A 3QMQA 4F4KA 1K0VA 2BR0A 4FF2A 5KT5A 3UR0A 5CYJA 3UCGA 1YZ6A 2ILZA 3D66A 2AD9A 3TA0A 5KFRA 2MZRA 3M1VA 1Q1KA 2ZNZA 2ADCA 2B4VA 2RILA 2PA3A 4ENOA 1SKUB 2V2ZA 3QAUA 2ZOFA 3PO4A 5FDLB 4MAKA 1UWAA 3TJ9A 1TKTB 1WG5A 3ZZTA 1DTQA 1WTBA 2DHGA 5FIIA 1OPIA 1RTIB 1R0AA 4QR1A 4DFKA 4IDKA 1REVB 3AFGA 2VBYA 5E3AA 5J2NA 1OYEA 4LFAJ 2DIUA 2NQPA 4C0HA 2APOA 2HHSA 4B17A 3CIMA 4NL5A 1QJHA 1LWFA 2I38A 3AJDA 4NI2B 1DFDA 4CM2A 5DRKA 2B6AA 4GC7A 5HMZA 2JLEA 2MLZA 2D74B 2DGXA 1RWPB 4QBUA 1S0VA 2IVYA 4RW8B 4F0HA 2XS7A 2KG0A 1OMSA 4IG0B 2PFDA 2Z2ZA 2KFNA 1KP6A 3GILA 2I6WA 4U6PA 2ZJPQ 3MGJA 2V2KA 1M5PC 4OI1A 1IR1A 5FD1A 3AA9A 2FZGB 1FFSB 4OZJA 4YOEA 3KJFB 4KH1B 3MEDB 3GV5B 3CCES 2QMXA 3ZTRA 4CZCA 4C0BA 3PG9A 3AJ2A 1QSLA 2DHSA 3NP5A 2PD1A 2ZITA 3CO9A 4F02A 4KHMA 4WFXA 1KOHA 3TEGA 3KLIB 2IM0A 2HHHJ 3PJ9A 1X9MA 2RD5C 3WX8A 2AF6A 2GMLA 3NWGA 2HQ3A 2ZC4A 3PYFA 4OZLA 4DOZA 3K0JA 2ALZA 2ZHOA 1S76D 4DR7F 1VQ4S 1S79A 3LP2A 4DV5J 4RW4A 3HKWA 3MMAB 1NDKA 4WTOB 2HS3A 2ZH4A 1H38A 3GG1A 3W9JA 4EZ9A 1BQNB 3M8RA 3O2IA 2OFHX 3AT1B 1RAGB 3GJQB 4ZVHA 3IO1A 2W4PA 2W2PP 2YTCA 2GCFA 4NEYA 4LF9J 3PRBA 1U1KA 1XK8A 2HQFA 2D9PA 3W3SA 5IT9U 1H7WA 4ZLPA 2Q66A 1TVRB 8AT1B 3R3TA 5HVGA 5D0RA 3D6HB 3CJKB 4HLBA 3R6LB 1C1CA 4DR2F 3V81B 1SV5A 1KVIA 1FJCA 4H4KC 3HJVA 3ZZUA 3LQVA 2JC1A 2ZNYA 3QJJA 2AEJA 2BBEA 4UF4A 5KT7A 2MZSA 4XK8C 2VKZG 4F25A 3V4IB 3HSZA 3W2WA 2B0GA 3M6WA 3KG4A 1KDNA 4B3OB 3MD3A 1TFYA 2FVRA 4QIFA 2RUGA 5D6GA 4PG7A 4WKRA 4TKTA 1Y4ZB 2XM3A 1XNQF 1IBMJ 3MM5B 1D8YA 3PXGa 3GCWP 4FBUA 3RAXA 5KOXA 4DCPB 5E2QA 1RHUB 4X62J 4TY8B 2NS1B 2ZM6F 3ZC4A 4RLEA 3QLHB 4KPCA 2YQ1A 5KG2A 2F63A 2NZ4A 2JFKA 5BXIA 1CJTB 3ZZYA 5SZTA 4M8LA 5HVFA 4TYAA 4UOFA 3GPAA 1N5TA 1J5OA 5LSRA 4NPOA 2QEXS 1H3DA 1S4FA 3GFYA 5KFNA 2GIFA 1ZM2A 2LKZA 2AEMA 2OMLA 2F8HA 2QA2A 3NRBA 3MR5A 2VASA 4P7VA 1RWWB 4F4ZA 1JLAA 2VUGA 3DLJA 2WZ1A 4WF9Q 1H0HB 3BO3A 4TY9A 1S49A 3UPFA 2RQ4A 2ZC3A 4RW6B 5ETNA 1HMVA 4AXJA 2HVIA 2FJWA 3IM8A 2W2QP 3KTQA 2H51B 1HPZA 1RT2A 2DH8A 3TA1A 4MIBA 1BC6A 4K59A 2LXFA 1J5EF 4DX5A 1SJFA 2XLKA 1A7GE 2ZZNA 2Z2MA 4ZIVA 2HZCA 1E6VB 1W2IA 1RT5B 1U2FA 1R8AA 1NCLA 1N52B 4M5HA 1PYSB 4OYWA 2FD2A 3CCSS 2AJQA 3J81Y 1TL5A 1QE1A 2QFIA 2CADA 2EKYA 1IKVB 2O66A 3R5CA 3M8QA 2HS4A 5D3GA 3EDRB 3OR2A 1NH7A 2XNRA 2GVDA 5C25B 5F8NA 2ABYA 2XMVA 4PG8A 4C8ZA 3TAMA 2A18A 4DUZF 1KLMA 3KOAA 4KO0A 1YG0A 2XI2A 4DV7F 4QU7A 1S1UB 2ASJA 4CLSA 1VRTA 3QZ7A 1T94A 4X65J 2F9JA 4ECQA 2ZH9A 4YP3A 3G6XA 3PCOB 1VQ9S 3MR6A 3JSRA 4IKAA 3QWUA 4OI0A 3KDNA 3PO5A 3HHDA 1KQKA 3MCSA 1X5PA 3PIPQ 3T5JA 3D3BJ 3MD1A 5CD4H 3B54A 5LJ3Y 1G1XA 3FCHA 3EE3A 2VU5A 4HVZA 2XHWA 2HNDB 4O4GB 3I9ZA 1M5KC 2V8PA 1R31A 3DM2A 2KVIA 3TUPA 2DY1A 2L9WA 1BHNA 1U1MA 1S0OA 3OUYA 2Y1JA 3A1YG 3N6MA 4DWIA 2YKMB 2VPWB 2OLWA 2NZCA 2R2TA 2M0GB 4Z7CA 3PHEA 2YNFB 1A6LA 1KD1T 4DFJA 1WC5A 2HNZB 1F3FA 3E51A 2N82B 2CAJA 3GMGA 4K0KJ 2EEYA 5C7PA 5KG5A 3B6BA 1OSCA 3H4BA 4ZITA 4RNMA 5IM0A 3OLBA 2A6OA 1WOSA 1K1QA 2L9DA 3QYYA 5LSOA 2V8VA 3NCQA 2LCWA 1NHUA 3LPYA 5F8IA 2DHAA 2WSFC 5B0FA 3BQ2A 1NUEA 1Y0HA 1RT7A 4JI0F 4M5KA 3OXLA 3HULA 5HO4A 2UV8G 3KK1B 2HHVA 1EIYB 4X2BA 2LDIA 2I2YA 2KG1A 2YNHA 3EUNA 3BBCA 3CD7A 3BBBA 2MLYA 3AD7C 5B0AA 2N4CA 4MFBB 1ZBTA 4Q2LA 3R7BB 4JV5F 4DR3F 4F36A 1YJ9S 3DCAA 3DN9A 1F9HA 4CH7A 3PYDA 4EMDA 3ZTQA 1S1XA 3MOZA 3M30A 4F3OA 3CNQP 3KHHA 2NLWA 2ZUGA 4HI2A 2DJWA 3KJNB 2VDHA 2JC0A 2CJYB 3DOLA 4B3MJ 2HNYB 1FX2A 2IRXA 1KR4A 3UD5A 2B43A 1L5UA 3BSCA 4M94A 5T14A 1LXJA 1NPKA 1WC1A 1S9FA 1IR2A 2IYIA 3PHTA 4EO8A 1RT4B 1RT6B 1DY3A 1N5YA 4C11B 4ER8A 3TQ1A 1CJVA 1EETB 2ZBIA 1FKOA 2V9WA 1SXLA 4AL5A 1XBWA 2V2VA 4ILMA 3RW6A 5KTQA 4WWSA 5D0GA 3F73A 1U0SA 4P2FA 4LF7J 1WF0A 5DLGA 4IFVA 2CYYA 1F0XA 4MJKA 3L4BC 4C6AA 2PA8D 1ITPA 5LMNJ 2SXLA 4KC5A 2R2RA 3A3NB 2FLPA 2RQKA 2R7RA 3PW5A 4ZVUB 1N6QB 3W8GA 3IBWA 1RK8A 2H48B 1PJ6A 4O23A 1WC0A 4RBVA 1G3OA 3R6GB 2MGZA 3ICLA 1YZ7A 5GADU 2X7IA 1CC8A 1B0TA 3EZUA 1QM9A 1Q5VA 1UL3A 4AXIA 1SQEA 1U1NA 2IM2A 3F44A 4KGMA 1TL3A 4ID8A 2QLBB 1PGZA 2AGOA 3QWPA 4HHJA 4NXMJ 4BDPA 4JOUA 3SCLE 4DL0C 3T1YJ 5IT9Y 5A2QU 1PBAA 5MAOA 2FY8A 3DOMA 1NXIA 1SIZA 1UFLA 2AJ1A 1DAXA 4JI5F 4OYBA 4NXNJ 4JBCA 4EK2A 2BQUA 2UUAF 3M2UA 3CJ3A 5JMNA 4B3RJ 2YKNA 2LECA 2VQEJ 1KFDA 3FZ2A 2JL9A 3ZTOA 4ZCIA 3PNIA 2ASLA 3Q89A 2XBPA 1KTQA 4LBIA 4ZOSA 4JI1J 2AYMA 5I3UA 3T6JA 4I2QA 4C2MA 3ZO7A 3N79A 3K8WA 2V4JB 3CDWA 4TLRA 1PSDA 2LQ9A 1V6HA 2Y0SD 3ENWA 1VHFA 4HT7A 3GSIA 2QA4S 4LSLA 1TK8A 2MKIA 2F4VJ 2XYPB 2LLZA 2IJFA 5HMWA 4K4XA 4FXWA 1SQGA 4UY8T 4LIWA 3Q8UA 4FXVA 2ZZMA 2RU3A 3ILIA 4OHWA 2W4CA 1OIAA 3MCMA 3V5RA 2XMUA 4QR0A 4QPXA 3ENAA 3IC1A 5F0WA 2JEFA 4ED4A 2XWYA 5BR8J 1I94J 2FHJA 2W24A 1U8WA 4ETZA 4X4QA 4FPRA 3M9OB 3GV8B 3BM7A 3OTEA 1U7LA 2J8AA 3M1VB 4N8NA 2X3GA 2ZH6A 3DLBA 4ZHRA 3PW4A 4ECZA 2AMCB 4JV0A 2OPRA 3QPIA 3R5AA 2LU1A 2HZAA 3VGTA 3HT3A 4G1IA 4ZPAA 1YLXA 1DTQB 3DNCA 3GTYX 3RBEA 4ZPBA 4O44A 1R0AB 1MN9A 4KYZA 3BN4A 4IDKB 4DV1F 2AJ4A 1U6BA 4QR2A 4P71A 3DLEA 2IMWP 5J2NB 4JI2F 2Q6CA 2AGQA 4MKYA 4J7CA 1NDPA 3W7BA 5M2RA 4OFZA 2PDAA 2IPOB 4Y2KA 1N36F 4LQ9A 1HHTP 2GQCA 1S9EA 2O1PA 4RNFA 1NK6A 1KFSA 3HD2A 1B3TA 2JOQA 1EQMA 1LWFB 2EFQA 2XG8A 3HHEA 2B6AB 2PEBA 3R7SB 2Z30B 3CCTA 5AE1A 4EYHB 3RB3A 5JJBA 2E5JA 7FDRA 4QPTA 3PX0A 2V34A 5CAAA 3NEKA 2DHHA 1HNWF 1VMBA 2PI5A 3UVJA 4DEZA 3GFHA 2ATLA 1HHSA 2KFZA 2HSEB 2EBGA 4UOCA 2N7CA 3OW2R 4KIAA 3TOQA 3UD4P 3PEHA 2WVEA 2CQGA 1S6PA 1NLKL 1ZAXA 3EZOA 5I4MA 2GMHA 2HKEA 1QAIA 3J7AN 1VOMA 4DSIA 5KG0A 4LR9A 1IKWA 2F5GA 5E0OA 1JLEA 4BC7A 1JLFA 1JQGA 1VFJA 1HBNA 2V4QA 4XIUA 2VZ9A 4NLPA 4OYMA 2MZTA 3BGRA 4NRUA 4CWBA 1N0VC 3PZPA 3LP2B 2A2DA 3TANA 3A12A 1AROP 4RNNA 4RW4B 5IQ6A 1SC4B 2CUYA 1DQ9A 1M1GA 2HQCA 4XDDA 1WG4A 4CO0A 3M6VA 3T1AA 3O8WA 3TVYA 3W64A 1LXNA 4DL4A 2G2YA 1Q8LA 3MHYA 1VHIA 2BYCA 4I67A 3GIKA 1EZZB 3H42A 2DK2A 3G82A 5HMXA 4MIWA 3HLUA 3ILLA 1D8ZA 1Q8IA 4L72B 2BOPA 4RNHA 4GVLA 4L3KA 3KHGA 1F9FA 2B5JA 3CCQS 4E0DA 4WFZA 2UU9F 3S8SA 4HR2A 5HQLA 1C1CB 2J8SA 2E1RA 1SV5B 3RW7A 2RQCA 3N28A 2L48A 4RBTA 1N56A 4DL3A 1R7IA 4OIXA 1S57A 3IAS9 3G87A 4LBHA 3W2WB 5L1IA 2R7QA 3HVRA 1V3ZA 1XR6A 4YUDA 4A47A 3GFXA 3JS9A 1WC6A 2ZE2A 1HQEA 4YR2A 1NPRA 2JVRA 5ETQA 1NZ8A 4LRBA 4NLDA 1YJUA 5HK4A 2W8LA 4X4SA 2DNKA 3CC2S 3CW2C 5KFIA 2KJWA 5H9EK 2M70A 2VPYB 2GJ2A 3TW0A 1MWYA 4K2XA 4PUOA 3QJPA 3EGNA 2YWFA 4E98A 1JB0C 4L73A 3HFKA 1PYTA 1YIJS 1J5OB 1NNDA 3EWGA 1WELA 4NLGA 1O0PA 3MPUB 4ECXA 2DGTA 1FVSA 3THVA 3KXDA 1RI7A 3RBXA 1JLAB 4Q43A 4MK9A 4CO3A 3U7JA 2ZH5A 1ZYQA 5DDPC 4I64A 2ZVIA 5C42A 4OYPA 1LW2A 4U67Q 1HMVB 1CULA 2VQFF 3IN5A 3JB9k 2VPXB 2LVWA 2C2EA 2BQRA 3MCOA 1HPZB 1RT2B 3MUVP 2VKRA 4KE5A 4LFAF 3AQPA 4U9RA 3T3FA 2FVCA 2KHCA 1NJZA 5DM6Q 2HK2A 3FC9A 5HJXA 3S01A 4M5GA 4J9OA 3PR5B 1Q53A 2J6SA 4GKKJ 3VAKA 5KFDA 1SIWB 4NLYA 1F5BA 3N5FA 3C2PA 5KFEA 5D15A 2I1RA 4N8OA 3OL9A 3HFVA 3M9MB 1JLBA 5BYQA 1QE1B 1X8DA 5A2QY 3M8QB 2UZAA 4ZLJA 2QT7A 2C3OA 5D3GB 1FFGB 4RJVA 4WJBA 2C3YA 2UXDJ 1LWCA 3OR2B 4OX7A 7AT1B 2QMUB 5GMKa 2GVDB 2YQ0A 2ZJQQ 2DBBA 1M5SA 5E7OB 3KG1A 2CQIA 2VF3A 3SQGA 3TAMB 3VQTA 3A8IA 3DHWC 1KLMB 1JJ4A 3H90A 2DISA 4KO0B 3SI8A 1X0PA 2V8GA 5D78A 1TL7A 2ALYB 1VRTB 3ZZZA 3TUJC 3UDCA 1VQYA 4ICLA 4TQRA 2HIYA 2LYVA 4NA2A 4OHYA 2HHHF 4TN2A 3P8BB 1S12A 4CH1A 4ILRA 1T7PA 2LXUA 5H1SV 2CQ4A 1S9GA 2ZDPA 3PDNA 2V0NA 2NSBA 4HHHA 1WOPA 2MQPA 1K0TA 1X4EA 4X84A 1IBLJ 3CCWA 4DV5F 4YY3J 2VONA 1I3OB 2E1PA 1GMWD 1TKZA 1QVFR 3Q2TC 4HDHA 1FXDA 4DR6J 3DRRA 1N0UA 2VBXA 1DZ5A 3AB4B 3MEKA 1C1BA 3OUYB 2I0XA 4G1QA 3D1HA 2VFRA 3ZZRA 3IG1A 2VHGA 4JI6J 3F56A 1Y00A 4LF9F 3LA0A 2E66A 2JEIA 3RJMB 3RB4A 1RT3A 2Y8YA 2EK6A 3CJ0A 2KI2A 1KS2A 3P6YC 4DU7A 4WK1A 5HQ8A 5IM0B 2LEBA 2WVBA 2XO7A 2ZDOA 2FTRA 2ASYA 5KFMA 3KNAA 2MKYA 4USKA 5CD4A 2IA6A 1RT7B 2E5GA 1JIHA 3OSPA 2B9WA 3W9IA 2DVIA 2VPZB 1RXOB 1IBMF 2YNHB 4PPDA 1GX5A 3AJ1A 4X62F 5L1JA 1OS5A 2CJ9A 4IQMA 1L3SA 2BVZA 4EU0A 2BOAA 2QJ3A 4CLWA 4CLZA 5DG7A 3VZIA 3DLKA 4AL7A 5G0RA 1GH8A 1S1XB 4NRTA 2AZ1A 1DURA 4ECUA 3M30B 2BKOA 4M95A 3M7VA 2B9XA 4IO1A 4CH0S 3DOLB 1OO0B 3LP0A 3TRGA 3MM9A 5ETOA 1BY9A 4DPUA 3O44A 3RB0A 4C0OC 2AWZA 1QSYA 3TYTA 4FVCA 1FT8A 1URNA 4A4JA 4Q0BA 4ECRA 4NCBA 3CDEA 4B9LA 4KRWA 1NJWA 3BEGB 1N5YB 3A3OB 1CJVB 3CJ8A 3FZBA 4URSA 3R1LA 1FKOB 3TVKA 5B08A 4ZVFA 2UVUA 3ONQA 4DQIA 2GX8A 1TP7A 4QIWD 4EZ6A 3P49B 3DYAA 4O0IA 1FVQA 1UEKA 4CO4A 4ZK7M 1BXNA 1GTEA 3L7OA 3NL0A 4IFVB 1RZMA 4ZP6A 3VZHA 3N9UC 2E7WA 5GAHU 1MMNA 4QYZK 5C24A 3JAMU 1ZZNA 4FYDA 5L39A 3NLCA 3KLEA 4DUYJ 4KV8A 3VAIA 3NBPA 4B08A 4QIGA 5F8GA 3BDEA 4G6VB 4QW9A 2C42A 3D0IE 3CEDA 4OJ3A 4DPYA 1NO8A 2MGZB 5HQMA 1UKUA 1RHMB 2VFTA 4KGXB 2EG1A 4NYZA 5EWEA 1CQMA 2XY7A 1FD2A 1RWVB 4LF4J 3EXYA 3M8SA 2DNQA 5MLCV 5E3QA 3D1OA 4CM0A 3M32A 2R7WA 3DOMB 4X65F 3MOJB 2HRTA 4LMZA 1KRPA 4C8OA 5IS2A 3PR4A 4P6QA 3M2UB 1RAOA 2MHNA 2YKNB 2GAHC 3QAEA 1ZPVA 4ZS6A 3I56S 2CJBA 4LF5J 1HA1A 4V19X 4N5SA 1IBKJ 1YITS 4IQXA 4OX9J 1WEYA 1JLCA 5L9NA 4N56A 3RU0A 3I5CA 5I3UB 4I2QB 5EUHA 4FXDA 4DV3J 4F3QA 4CNYA 3GIIA 1BMQB 1M5HA 4DCJB 3GYXB 2FGCA 4TXSA 2HW3A 2WSCC 2AV5A 2M88A 3G6YA 4ELUA 2AW0A 1YK9A 5FJ4A 4B3SF 4LSLB 2Q3PA 3NS6A 2XMWA 3G96A 1AZSA 2K7JA 4CP5A 1HWIA 1NDLA 3FDSA 4K0KF 1YBAA 1EJ7L 3T9NA 1B7YB 1T11A 3TZZA 3PFEA 2HYIB 3KYLA 2H54B 2ZWOA 2EW9A 2PI4A 2WBRA 2D3O1 3G71S 5L9XA 5E5NA 4JI8J 4JUZA 2XC9A 2Z8QA 3DDNA 4O3QA 5IFMA 1JWWA 4WXOA 1ZM4A 1Q7LB 1YDLA 1DQ8A 1VBXA 3C3LA 4QIVA 2DGOA 3I32A 1H6KX 1EKSA 2YWEA 4ZHRB 2DRAA 2KYXA 1XERA 2E9ZA 2OPRB 3QRPA 1YBUA 1RAHB 3BPSP 2FJEB 5I3QA 2DCUB 4ZVOB 4O44B 4WP9A 3TEHB 2DPIA 1S10A 4PXDA 4J5OA 4P74A 2RB7A 2VD3A 2CG4A 2MKHA 3DLEB 3FBFA 4CLLA 2QIFA 2RS8A 5LMUJ 2N7YA 2MSSA 1S9EB 1VBZA 4L6V3 5D0HA 2XO6A 1S1TA 2GQ2A 1F60B 2MHEA 3PW7A 2DPJA 1RYSA 3OFEA 1U24A 5DG9A 1QLNA 3O6QA 3UD3P 1N88A 3K89A 3QSIA 3CDBA 5IOLA 3CT9A 2A1BA 1RUSA 3WDOA 5KFQA 4PG5A 2QN6B 3IRXA 2R7XA 1FE4A 3JQMA 3V4IA 3UVJB 1ZS6A 1T3OA 4OZ2A 3FSIA 2QLFB 1X60A 3FGVA 1JMTA 2DR7A 2DIVA 2EFNA 2ZH2A 4ZLLA 4LF7F 3CMES 2DB1A 4XPEA 1I51B 2CQ0A 2XB2D 2MQNA 3B4DA 1S77D 2G2OA 1PYOB 5LMNF 2RIJA 1S6PB 3GJTB 5FLXU 2EFPA 1URRA 3N6LA 4LFCJ 1R89A 3C16A 2DNRA 1IKWB 3FBCA 3P4UB 1JLFB 1I6JA 1UZHA 1PC4A 1HBNB 2E9TA 1HLWA 2VICA 1RWKB 2XMMA 5KG1A 4WXWA 2BJEA 3BGRB 1R0CB 2G9OA 4Y2AA 1R8CA 3VAFA 5BJRA 3POTA 4TU8A 4KR0B 4MK8A 4F4YA 2K1RA 4NXMF 4KTQA 1Z2LA 2OSQA 1SJQA 1T02A 1REGX 2L08A 2M3DA 1Y10A 2AJ0A 3T1YF 3CJQA 1GMVA 1ZM3A 5ETMA 5J2PA 3BO2A 1SJ3P 1K47A 1X4HA 1WDDA 4OL8A 3MR2A 2BJ9A 2DGSA 3R9LA 1JKHA 4NXNF 1C0UA 3ET6A 1FFWB 3G82B 4O0NA 2VG5A 1U8SA 2IJNA 4RO0A 4B3RF 4J9LA 3TZYA 1S1WA 2HRYA 1RE1B 2VQEF 4PXEA 1RYRA 5F0UA 1Y7PA 2B5JB 3NKYA 1FERA 4URQU 2G0IA 2NXUA 4X4RA 4B9SA 2E1CA 3J81j 4QWAA 1WACA 4PQAA 4NLXA 4G1PA 3OL8A 3IS9A 3D3CJ 4ZVEA 2PMZD 1MWZA 3GIRA 3IM9A 5KFWA 4WPAA 4A8OA 4JI1F 2P6TA 1KQFB 4PQUA 3VAHA 5SUHA 2HBRB 2GV1A 5CA5A 1E6YA 4OJGA 2GJFA 3VHQA 3BBFA 2ZE2B 5B0DA 1HQEB 2BKNA 2NSCA 3D28A 3IA0A 1XMQJ 2DKOB 3QQCD 1RU1A 3TI0A 3M4XA 3Q8SB 2EPIA 2F4VF 4OYAA 4HTJA 4YB1P 1X4FA 1FWKA 1TFWA 1NH8A 5DO2A 2C2MB 4K5RA 2GFFA 3OL7A 3K5LA 2QLWA 4PUOB 2IY5B 3H2VE 1IUJA 1N32J 2WVDA 3CXCR 3BN7A 4KQZA 3CO0P 3HFZB 5BR8F 1I94F 3K57A 1FTRA 3SSRA 2PC6A 1B70B 4DI6A 4C97A 4YB7A 2ZZTA 3EJMA 2P5VA 1V5IB 4P52A 4PWUA 5B0GA 4V1Ak 3PJXA 2AZ3A 1RTDA 4TNOA 3UNGC 5C42B 2CPDA 1LW2B 1B99A 1UJ4A 2KXNB 4KY3A 4RX6A 2K8GA 5HSPA 4C8NA 1CULB 5KG3A 1SKSA 3QFHA 1WOOA 4P75A 3A4TA 2V4RA 1TK5A 2DITA 3MXHP 2XCAA 2CFXA 4I56A 1B64A 1VCTA 1NJXA 2GHVC 5IT0A 1U1RA 2Y1RI 2PE8A 2J76E 2BW2A 3CD6S 4WFYA 2DNZA 3U27A 2E5IA 4X4UA 2OKQA 4UQTA 5J2QA 1DRZA 1RAAB 5KT4A 4I68A 1U2RA 2BW7A 1PG5B 3WC2A 4JYAJ 3S1TA 1I1GA 3HHLD 2B8QA 4LVOP 3RZAA 1WC3A 1YX2A 3KWMA 3K5PA 3PEJA 4LVNP 5GMEA 3TJAA 1RQ0A 2JHEA 2IVFB 1D0EA 3HVAA 1JLBB 2HIQA 1LOUA 5D4NA 4O3SA 3PV8A 1NK4A 4Y0FA 4DX6A 5B0CA 1YJRA 3KJVA 3T5HA 4ITSA 1JJ2R 1LWCB 4LQ3A 3X3UA 2Z57B 2ZHBA 3SQGB 2BANA 3VV2B 4DS4A 1VC6A 4NCGA 4W4MA 3HHNB 5KFHA 3UW1A 1VIOA 1SL2A 3R5JB 1FJ7A 1TL7B 4X4PA 3OTOJ 4NMXA 1FEEA 2X1GA 1P1LA 4ICLB 4YHHJ 4QIEA 1K9MT 4R25A 3WIVA 4TU9A 4EWTA 1Y5NB 1KOOA 4NZ6A 1S9GB 4WCEQ 2J0WA 2G0CA 1H73A 4JV1A 5L38A 4J9NA 3KUGA 1L3TA 3FRYA 3L09A 2D41A 1PJ5A 1TKZB 3QFWA 1X5SA 4I2PA 2C28A 1OJ4A 3DRRB 2WW8A 4BCAA 5L46A 1C1BB 1IM4A 4ZN3A 4OQJA 1HKAA 2YNGA 3PY8A 2FVPA 4G1QB 3IG1B 2HBQB 1VBYA 2ROPA 2F8EX 4PEOA 1RT3B 3H5SA 2FJVA 1FDDA 2RRNA 4IRDA 3KKFA 5DZ6A 1JJCB 4F7VA 4IOBA 5DDQC 1YI2S 1D1UA 2BJ1A 4NLQA 4H4MA 2GO8A 4YQWA 2VBZA 1IQTA 4OI4A 1N54B 1Q8KA 1HWKA 4BC9A 3LGMA 2RJZA 4QYRA 4EUVA 1HR0J 3SCKE 1TTHB 2UVWA 5IV3A 3ZTSA 3DOKA 2QTWA 2RDIA 4I6WA 5JUMA 3MFHA 2VB6A 4U7UK 5DGBA 2OEJA 1HNXF 5HI7A 4YFUA 1SKWA 3T9ZA 2FGOA 2Z4PA 2AQ4A 1OY8A 1RBOB 2E1MC 2MXYA 1TUWA 1X5TA 5G0RB 3X1LB 2VOOA 3W65A 3GIMA 2NUHA 1KWMA 4WYLA 4DSJA 5J2MA 1PC5A 2XZWA 1GXTA 4NOHA 3J7ZT 4D3GA 1N33J 3QT6A 4O3PA 4A8WA 1IQZA 3M8WA 3GR0A 3LP0B 2BZ2A 2UUBJ 3HX9A 4DN9A 4CRJA 1RU2A 3MM9B 1NHVA 3RBDA 1CJUA 3OTBA 1SUQA 1VQ7S 2PGCA 4Q0BB 3H8YA 4A48A 4DFPA 2IHR1 5AXMA 1HQUA 3GFZA 4QWCA 3PVXA 1JXVA 4UTGA 1G7CB 1ZZFA 2A2CA 3FEYB 4UUWA 5EX3A 3MTKA 4I0WA 3QRRA 5FLXY 2FLNA 3MM7A 3HF5A 2HPUA 3C6UA 3MDFA 3D1QA 2OGUA 4C4WA 1VQ5S 2M5YA 3DYAB 3KDOA 2V94A 1QTNB 3VGUA 2M8DB 2WK4A 3O1LA 4U96A 3R2DJ 3BJYA 4GKKF 4ERDA 2AP6A 2RU9A 3I4PA 1U4BA 3QO9A 5C24B 4PR6A 5KT3A 5HATA 1RA7A 4ED6A 3KLEB 4DR4J 4KV8B 4CO1A 3M6XA 3NBPB 1UW9A 1Q16B 4XTTA 4OZNA 3VAMA 2J6TA 2F7VA 4Q7AA 3DRPA 5LXYA 2ZH3A 1M90T 1AFJA 4DV6F 3BYPA 2B4OA 2JEJA 2CQ3A 2H5EA 1O5JA 1U26A 4U95A 2UXDF 1GAOA 2VG6A 3VVTA 4IRCA 2MTLA 3LUYA 4B3TJ 1TQLA 1OWXA 2HHWA 4Z2XA 2MSTA 5AXLA 4AT1B 2YVSA 4RWXA 2M8HA 2GHPA 2YKAA 3ENVA 3RTVA 3M32B 4RUBA 4ZPDA 2GZOA 4DL7A 4Y2MA 5GAGI 2PEHA 2CPEA 3KHLA 2FC8A 2DR9A 3IBCB 5J1NA 5DDOC 3BKTA 4USTA 3CTRA 3HI9A 4NWBA 3ZZ0A 4Y6IA 3W2VA 2FYXA 4KGKA 1IBLF 1RP5A 2UXBJ 2F40A 3ZNUA 4YY3F 3DU6A 4HTIA 3OV7A 5T7LA 5HAOA 3CJSA 1JLCB 1VQ6S 2DNGA 1YHQS 2NXNA 4NZ7A 4DR6F 1S1VA 4HEA9 4DHVA 4FYWB 3OD2A 2RVJA 2ZH1A 4WIIA 1FNOA 3OVAA 1RWMB 2XNQA 2WAQD 3DRSA 3VTIA 4CTAA 4DV2J 5C5JA 1NDCA 3ZZPA 2C2DA 4JI6F 3R5GA 1UPMB 2CJAA 1AZSB 3A3PB 3DLHA 3O5TB 3CCZA 4FN5A 4USJC 2KT3A 2VDIA 2HURA 5A8WA 1HWUA 4AD6A 4KSEB 1TAQA 3NAIA 4IH6A 1NK9A 4Q2MA 4RZRA 4URGA 1TAUA 2X3DA 1NSAA 1AUDA 4KKOA 3UDEA 2DXEA 2DY9A 3V6HA 2GHWA 1N48A 2R7SA 1YRXA 4K4VA 3OFGA 4U8VA 5GVQA 5D4OA 5DZ7A 3BSAA 4PWDA 3RR7A 2D69A 3JYTA 3SCJE 4UQGA 1XR7A 4DSKA 1QD1A 5THWA 2V5HG 5F3ZA 3I96A 1A9NB 5ITHA 1IWGA 3VVUA 3OHAA 1MMDA 1M5OC 3TA2A 2DNLA 1VQ8S 1NHKL 2OAUA 2Y1LB 1LKZA 1NEEA 4I6AA 3JTPA 2KKHA 3HK2A 2VFSA 2DO4A 4WU2A 3GR1A 3QATA 6FDRA 4UW2A 5ETSA 3FQLA 1B0VA 4Q45A 1DQAA 5IC4B 3UR3C 1O51A 2ASDA 3QZ8A 2HK3A 1S1TB 3FK4A 3W5ZA 5G4DA 3TZWA 2HZVA 4QOTA 3Q86A 1RABB 3AOCA 4DN0A 1P1TA 1IKXA 2GIRA 2EWHA 4X4TA 3BS9A 4FVMA 5CCMA 3JTNA 5CABA 2HMIA 3IRXB 4HT5A 4ZP9A 2XYGB 4K4UA 3JSMA 5F41A 3TARA 1R27B 3G6ES 1VQKS 1C4CA 5CH7B 1XNRJ 1S72S 3IR7B 1DJ0A 1U0HA 2F65A 3Q2SC 2WB1D 4J90A 1SJ4P 4OZ0A 3HKZD 2DXFA 4DUYF 2GNKA 1NK8A 3C16B 3NGTA 1SJ1A 5DQIA 2Y1IA 1UJ6A 2XYHB 2C22A 4NLVA 2W2NP 3KK2A 1FJEB 3R2CJ 2F4FA 3PX4A 3GG0A 1VISA 4EFAC 2MQOA 5AE2A 3JQJA 3K5OA 5GAHI 3POTB 1RWXB 1XEZA 1KQGB 2K1RB 1K8AT 4LF4F 3C19A 3H20A 4KH0B 1DHMA 3BKUA 3HDSA 3OPKA 3EVMA 2ROEA 2KVQE 2HFNA 1U2CA 1HQ2A 2BA9A 5J2PB 6AT1B 4K50A 1ZETA 3CJ5A 4R8UA 3C6TA 1JKHB 3W66A 1IR0A 2F8MA 1C0UB 3ET6B 2PMWA 2XZTB 2W7PA 4OLOA 2VG5B 5KFJA 2QA1A 1L3VA 1RB0A 1S1WB 2VA2A 4G65A 4K4WA 2H4YB 3QGPA 1RLDA 1Z4UA 4LRAA 3Q0AA 3MPWA 4ZCKA 4EGLA 3VWSA 4M5DA 1IBKF 2OELA 3BR8A 3N4WA 3T41A 3IS9B 3NCRA 4OX9F 3SFUA 2WVCA 2JWNA 3DI6A 2JJ4D 3SYZA 3CCLS 5KFUA 2EFOA 3ISNC 1LQ9A 4DBQA 1KN6A 3CUNA 4PQUB 1N34J 3SQOP 2BE9B 4DV3F 2KDOA 4NLOA 1E6YB 4A46A 4ZJQA 1VQMS 2MJUA 2HG4A 1R8BA 2YX7A 3DXSX 3SDEA 1G2EA 2RRBA 2JLGA 3HPOA 4ILLA 5CCLA 1T05A 4IUFA 4Z7YA 4F4AA 1NJIT 1Q86T 2DGVA 4CLUA 4HH0A 2NXJA 1YKWA 2C3UA 4IG3A 4YEAA 2YPYA 1SI9A 3JQKA 3I9V9 2JVOA 3DC2A 4DUTA 2MKKA 1B0PA 1XMOJ 4PWWA 4DPTA 3T19A 1NBEB 2DNMA 1RKJA 1Z2ZA 1A0OB 3UNYA 2KT5A 4PYAA 3TZXA 4DXLA 2XWXA 3S6EA 2M52A 4OHVA 1QVGR 4YS2A 2Z0GA 2R8IA 1RTDB 3AQOA 1NSPA 4DPOA 2CPZA 4ETXA 5A6WA 1Q78A 5F8MA 4DDFA 4WP3A 2XI3A 3MPYA 1YSJA 1ZOTA 5GMDA 3UN3A 2V67A 5K8MA 1H2UX 4MYUA 4MK7A 1AW0A 5LMUF 3CDAA 3AODA 4K8RA 1UVNA 4M63A 2Y0BB 1R6YA 5J2QB 3IR6B 3PW2A 3RRHA 2E9RX 5LT5A 2DT9A 4ZPTR 2BJ3A 2MPUA 3SV3A 1S97A 1SL1A 1Y3JA 2J0QD 3LGHA 3MR3A 1RTZA 2D7SA 5KFLA 2CZ4A 3K5MA 1X9WA 5JXSA 3BDPA 3AD9C 3PM9A 1NSQA 5LXRA 5IV4A 1W25A 1RHRB 3GSDA 1P9QC 3KJVB 4A8XA 3FVYA 1TV6A 4ECSA 2DNYA 1ZM9A 1TL4A 3QSYB 4FDFA 2BANB 5F9LA 4NCGB 2AHOB 4YB6A 4CCHA 3M2RA 1MWQA 4RNOA 1PCAA 3N01A 1MU2A 5E41A 4LFCF 2E29A 2QLJB 4PG6A 1W26A 3MUTP 2PIIA 1VYAA 1ULRA 4WFAQ 1RAEB 2NR0A 3K8VA 2RHQB 2I5JA 1HL6A 3CCUS 4ZLNA 4ED7A 1QDUB 1VQNS 1WEXA 1UA1A 1FO1A 3W62A 1RHJB 2JDJA 3NCPA 1CPZA 1XN9A 2J6UA 1WKJA 1S99A 3EXCX 3QT8A 3R27A 1VDHA 3U02A 2FHKA 1P8GA 2E7VA 1RTJA 2X1BA 4A8QA 4LF6J 2QMWA 5IWAJ 4I2PB 1RTHA 4U7CA 1HNIA 5ETPA 3Q22A 2WONA 2HAIA 4USWA 1O6XA 2CG8A 3OBIA 2YNGB 4PYDA 3D54A 3K5NA 2AJFE 4ID5A 3OVBA 2JLFA 3IFEA 1N5SA 1PO6A 2HHTA 4FKXA 1X4CA 2FUG9 2HVEA 2RE1A 2AYBA 5C2GA 4ZJOA 2IVMA 5A8KA 2HWHA 3WX4A 4P73A 4ED2A 1EP4A 1WI8A 2DNPA 4HI1A 1BQMA 1RJJA 2DR8A 4NYOA 2QV6A 1FWPA 1MMLA 5HBMA 5I42A 2ACYA 1WUUA 4H4MB 5EHHA 3GJSB 2P9CA 2ZKTA 1HBUA 3U1MA 2ZH7A 2B3TB 2P9EA 3HSDA 4BHQA 5DJBA 3LOUA 2HHPA 1D9FA 1FXLA 1XMQF 3DOKB 1MG7A 3KLGA 5AE3A 3P3DA 4IR1A 4C3MA 3CJRA 3N6NA 2CQBA 2YKOA 4JP8A 3EGZA 5EGYA 2D1CA 1TUVA 4GO7X 2R8HA 1GMUA 1N32F 2HQGA 4R0EA 4V19J 1RISA 2W7AA 3QT7A 1EQ0A 5J2MB 4ES2A 3NMRA 3TUZC 3P5BP 2ZVSA 3HO1A 5DM7Q 4QU6A 1V5VA 2GMJA 2V63A 1HNWJ 3SZ2A 5H9FJ 3ZNJ1 4W90B 3R1HA 2AEFA 1FRIA 4UT4A
chains in the Genus database with same CATH topology
2FJEB 1YTYA 1FNXH 5I3QA 1TR0A 2DCUB 2Q79A 1FDBA 3N0VA 4TYAA 1MROB 2CVIA 4ES1A 3L95X 1SUQB 4IOAQ 2ZD1B 4O44B 1HNVA 2JSXA 1N5TA 1J5OA 5LSRA 2AGPA 4NPOA 2QEXS 1OQ6A 2DPIA 1S10A 4PXDA 4J5OA 2RB7A 3IAM9 1OSDA 1H3DA 2N3LA 2HGNA 2VD3A 1FKPA 1HQUB 1ELOA 1APSA 2CG4A 2QO3A 3PRDA 1S4FA 2R8KA 5BYSA 2MKHA 1LFWA 3DLEB 3GFYA 5KFNA 3V6KA 2OJ3A 1Q82T 1ZM2A 2LKZA 1YGYA 3H5UA 1OQ3A 2QIFA 2RS8A 2IBKA 2N7YA 3SCIE 2OMLA 2F8HA 3MM6A 2QA2A 3V6JA 3N5BA 2MSSA 2FLOA 3MM7B 3NRBA 3NS5A 3MR5A 2J0SD 2VASA 4P7VA 3C6UB 3OFFA 3OXFA 4F4ZA 1JLAA 3SEOA 2JEGA 1S9EB 2VUGA 3DLJA 1C4AA 1VBZA 1TKXA 4L6V3 1Z1ZA 4WF9Q 1XWLA 2UVRA 1CLFA 1YVFA 4I7FA 1H0HB 1S1TA 3BO3A 2GQ2A 3FMWA 2L3MA 2HWTA 1JLGB 4TY9A 2MZ1A 4QWDA 1S49A 3DFEA 4HKQA 1F60B 2MHEA 2JRSA 3UPFA 3M2VB 3PW7A 2DPJA 2RQ4A 2ZC3A 4RW6B 1RYSA 2OD4A 1FA0A 1Y5LB 3OFEA 1U24A 4C8KA 5DG9A 4I4BA 1QLNA 3O6QA 5EDWA 1HMVA 3UD3P 4JYAF 4AXJA 2HVIA 1N88A 3QO9B 2RS2A 2FJWA 4EYIB 3WZ0A 4H4KA 2DGQA 3QIPB 3CDBA 3CB4A 2A1BA 3CT9A 3KTQA 3RRGA 5JVGQ 3WDOA 4DF8A 2XY5A 1HPZA 1QTMA 5KFQA 1P6TA 1RT2A 1NRKA 4PG5A 2DH8A 1GXUA 2XS5A 3H4DA 3BSNA 3TA1A 3IRXA 4ZP7A 4RWWA 4MIBA 2R7XA 2R8GA 1BC6A 1U45A 2LA6A 4K59A 1FE4A 1FJGF 2LXFA 1D9DA 1J5EF 3VF0B 3V4IA 1SJFA 1T3OA 3FSIA 3C66A 3DRPB 3FEZA 2XLKA 2YWKA 1A7GE 4Q8EA 2ZZNA 1Q4RA 2Z2MA 1K1SA 3FGVA 4CT8A 1JMTA 1VGYA 3DXBA 2HZCA 3DM2B 1E6VB 2DR7A 2DIVA 2EFNA 1W2IA 2ZH2A 1RT5B 2BABA 2DGWA 1U2FA 4ZDNA 4LF7F 1R8AA 4R5PA 3CMES 2VG7B 3F41A 3CWJA 2CPFA 2DB1A 4XPEA 3RYLA 2HGMA 2CQ0A 2R2UA 2VG6B 4ECWA 1MW7A 4EBEA 4LFBF 2XB2D 2MQNA 3B4DA 1UVMA 3KLFA 5HLFA 1S77D 4I6YA 1N52B 1YWXA 5LMNF 2FD2A 4CI0B 2RIJA 1VRUA 1S6PB 3Q8PB 2J0XA 3FFIA 4QJVA 3CCSS 3WBZA 2EFPA 1URRA 3N6LA 3M9NB 2AJQA 3J81Y 1TL5A 5KFFA 3V6DA 4X4OA 2CJKA 1R89A 1WHXA 1YJNS 1QE1A 2RRAA 2EKYA 1IKVB 2O66A 3R5CA 3OTOF 1S6QB 1XR5A 2DNRA 3M8QA 1IKWB 2HS4A 4O3OA 2CQ2A 1JLFB 1I6JA 4XAKA 5D3GA 1PC4A 3OL6A 3M8PA 3Q8RB 4I1TA 4FS2A 5J1EA 1HBNB 2E9TA 4YHHF 1UWBA 3KLHA 2HRUA 3OR2A 1ZAWA 1NH7A 1WEZA 4RW7B 2XNRA 2XMMA 5KG1A 4WXWA 2BJEA 3BGRB 5C25B 4FF3A 5F8NA 2ABYA 1TL1A 2XMVA 4PG8A 1ZTTA 2BQ3A 2G9OA 4Y2AA 1X5OA 4C8ZA 1R8CA 2G13A 2IAJA 3TAMA 5KG7A 3VAFA 3MI7X 2A18A 4H4OA 5BJRA 4ED5A 1BWEA 3D0HE 4ZPVR 3POTA 2KB2A 4DUZF 2OMOA 4TU8A 1VI7A 4KR0B 4MK8A 1KLMA 1SL0A 2RDJA 3MECB 4GO5X 1S6UA 1YRUA 5D4LA 4F4YA 3KOAA 2K1RA 4KO0A 4NXMF 4RW9B 1YG0A 4KTQA 3BR9A 4MTPA 2XI2A 3W2VB 2O67A 2XGPA 1Z2LA 4DV7F 1HFEL 3AB2B 1P27B 2OSQA 1SJQA 1VK8A 1T02A 1S1UB 2EFVA 4QU7A 2ASJA 2HHUA 1VRTA 2L08A 3QZ7A 1T94A 2M3DA 2YWGA 2F9JA 4ECQA 2AJ0A 3T1YF 2ZH9A 4YP3A 5KFAA 3ULHA 2ERRA 2W9BA 3VCDA 4DLEA 2POKA 5T7LB 3G6XA 1ZM3A 4KFBA 5J2PA 2VC1A 3BO2A 1SJ3P 2HGLA 1VQ9S 3MR6A 1GNKA 3JSRA 4IKAA 3UE2A 1X4HA 4ZMMA 4OL8A 3M2VA 3MR2A 4PCQA 2DGSA 2RH3A 3QWUA 1JKHA 4OI0A 4K4SA 4MIAA 1S1VB 3PO5A 3HHDA 4ZCLA 1KQKA 3MCSA 4NXNF 1C0UA 1X5PA 1U25A 4OHXA 5EWGA 3PIPQ 2VG5A 3CSKA 3CE8A 1U8SA 2IJNA 2GC8A 3DRSB 4C3LA 4B3RF 4J9LA 4DSLA 3T5JA 4CTAB 1GQEA 2J9DE 3H2UB 1LWEA 3FRZA 3MD1A 5IZHA 1S1WA 5CD4H 2HRYA 5LJ3Y 1G1XA 3FCHA 3PKMA 2VQEF 2XMKA 5B0BA 4PXEA 3BB5A 1WWHA 1RYRA 4FF1A 1H2TZ 5F0UA 4HVZA 2DRBA 2XHWA 1Y7PA 2B5JB 3NKYA 4F50A 1FERA 2NYIA 4URQU 4K4ZA 2NXUA 4X4RA 4B9SA 2E1CA 4ZPWR 2ZOGA 2HNDB 4O4GB 4QWAA 1WACA 3I9ZA 2LDYA 4PQAA 5L1LA 4NLXA 1M5KC 3NGDA 4G1PA 4ZCMA 4E8UA 3OL8A 3IS9A 1T03A 1FRJA 1R31A 3DM2A 3PKYA 2KVIA 4ZVEA 2P9GA 2PMZD 5A8WB 1TK0A 1MWZA 1SH3A 5KFWA 4J9MA 4ATNA 1Y9OA 4FBTA 2L9WA 4A8OA 4JI1F 2P6TA 1U1MA 4DR1F 3OUYA 1S0OA 1KQFB 3H40A 2Y1JA 4PQUA 3A1YG 1L3UA 3N6MA 3VAHA 4DWIA 1VIXA 5SUHA 5CA5A 1QUVA 2GV1A 2GA7A 3T5KA 1E6YA 2YKMB 1WG1A 2VPWB 4OJGA 2OLWA 4KKOB 2CJQA 3TVZA 4C8MA 2R2TA 2ZE2B 5B0DA 5K8NA 2M0GB 1HQEB 3PHEA 2YNFB 1A6LA 1KD1T 4DFJA 2NSCA 3D28A 3IA0A 2DH9A 2OPPA 4YMEA 4J9QA 2FJBB 2HNZB 1CG2A 3LAMA 2VA3A 3E51A 4GC6A 2N82B 3BQ0A 3M4XA 3TI0A 2AX0A 3GMGA 3NG8A 5GAEI 5LSLA 5H9EJ 4DF4A 3Q8SB 1F5CA 4PWDB 1WHYA 2EPIA 5E33A 2FJAB 1BQXA 2F4VF 5KG5A 3JYTB 1HR0F 4HTJA 3OQ2A 1OSCA 4YB1P 3HP6A 1X4FA 3LAKA 3H4BA 1U09A 1TFWA 4WFBQ 4RNMA 1NH8A 4AYBD 5DO2A 2KYZA 5IM0A 3OLBA 4K5RA 2CQPA 2GFFA 2IRYA 1PILA 1K1QA 2HS0A 2L9DA 3QYYA 1RA6A 3OL7A 5LSOA 2V8VA 2M2BA 3K5LA 3NCQA 2LCWA 1NHUA 2QLWA 3LPYA 5F8IA 2DHAA 1KQSR 4PUOB 3MUMP 1FE0A 2WSFC 3H2VE 3QGGA 1IUJA 3B4MA 5B0FA 3BQ2A 2VH7A 3CXCR 3IGNA 4DQRA 1HYSA 1Y0HA 3BN7A 2IC3B 1RT7A 1KHVA 4JI0F 3OXLA 4KQZA 1VQLS 4LIRA 2CQ1A 5HO4A 1FXRA 2UV8G 3KK1B 4IYQA 2HHVA 5BR8F 4X2BA 4LJMA 1I94F 3K57A 5CYMA 3R5BA 1W2BR 2LDIA 2I2YA 6FD1A 2QSFA 2QYCA 2KG1A 1FTRA 3SSRA 2DNHA 3TP2A 2YNHA 3EUNA 3LP1A 3MAQA 1NJYA 2RQMA 1RT1A 2MDAA 3EZ5A 2PC6A 2VFUA 3CD7A 3E3XA 3B82A 3ITHA 2A10A 2J7UA 5B0AA 2N4CA 1N33F 4C8LA 4MFBB 4C97A 1ZBTA 2BE2B 2NPIA 3PJWA 4HH1A 4Q2LA 4YB7A 2CPXA 5KFVA 3KLVA 4JV5F 2P5VA 4DR3F 3FJ2A 5E3RA 2UUBF 5B0GA 4PWUA 1YJ9S 1HI0P 3DCAA 5CZVA 3PJXA 2EVZA 5KFGA 3MMCA 3DN9A 1RTDA 4TNOA 2F1FA 3UNGC 2ZBCA 5C42B 2YX4A 4CH7A 2CPDA 4B02A 1KHWA 3MMJA 1LW2B 1UJ4A 2PO4A 2KXNB 5U47A 1S1XA 4RX6A 2K8GA 3MOZA 4C8NA 4ZKAA 3DLGB 3M30A 4F3OA 2LXIA 3KHHA 1NU4A 1ZPWX 2L9NA 5KG3A 1TL3B 1SKSA 1S7HA 3VAJA 1IKXB 3EYZA 1C2PA 2NLWA 2BACA 2ZUGA 4HI2A 4F8RA 2DJWA 4M1KA 3P96A 2V4RA 2MKSA 2JC0A 1TK5A 3DOLA 3TX8A 2DITA 3MXHP 2CFXA 4I56A 5A8RA 2XCAA 2HMIB 2HNYB 5LJ5Y 1H98A 1NJXA 1B64A 2GHVC 5IT0A 1U1RA 2KRBA 2IRXA 2Y1RI 3JSMB 4Y2IA 1TKDA 2PE8A 2J76E 1JK9B 2JFDA 2BW2A 2KN4A 4N76A 5FDLA 2KFYA 1KR4A 2OTLS 3CD6S 4WFYA 2DNZA 2NUUG 3FEXB 2XEXA 5KFTA 3U27A 2E5IA 2QA4G 1TKTA 3KFWX 1X0FA 2B43A 4EBCA 1L5UA 4X4UA 2OKQA 4UQTA 5J2QA 1C0TB 5CQGA 3WC0A 3BSCA 1DRZA 5KT4A 2PMHA 4M94A 4I68A 5T14A 1U2RA 1LXJA 3BQ1A 1UJ5A 3MURP 3WC2A 1RTIA 2LEPA 4P2SA 1S9FA 2IYIA 3S1TA 4EO8A 3SSQA 4RU2A 1REVA 2OPSA 1I1GA 1RT4B 2BRKA 3HHLD 1RT6B 3G4SS 1FRLA 4RKUC 1U49A 2WOMA 2O3DA 4HDGA 4C11B 1N5YA 4Y65A 3TQ1A 4LVOP 1GX6A 3RZAA 4OI2A 1EETB 1FTCA 3KWMA 2ZBIA 1FKOA 2V9WA 4JI3F 1SXLA 4G3IA 3K5PA 3CVKA 3PEJA 2DR5A 4PPZA 4LVNP 4PXBA 4BWMA 5KT2A 2HLTA 2DNOA 1RQ0A 4DR4F 2YH1A 4C98A 4DR5F 2JHEA 2IVFB 1D0EA 4AL5A 2G1DA 3HVAA 3TR5A 1JLBB 2HIQA 1XBWA 2XSFA 5KFBA 1UW4A 1VJWA 2Q1LA 1LOUA 5D4NA 4O3SA 4ILMA 1WTFA 4J37A 2XY6A 3PV8A 3GV7B 1YJVA 1NK4A 3RW6A 1FDNA 1LK5A 5KTQA 4Y0FA 2IM1A 1YQHA 4NLUA 1UFWA 3F73A 5B0CA 1YJRA 2QLXA 2OIHA 3KJVA 2F3JA 4LF8F 3T5HA 4ITSA 1WF0A 3HVTB 5DLGA 1JJ2R 3KK2B 2DCLA 3ISND 4C8OA 4ZP8A 1LWCB 4IFVA 4C7QA 4LQ3A 2CYYA 1F0XA 4CQ1A 3X3UA 4PXCA 2F9DA 4MJKA 2ZHBA 2PA8D 2VFVA 1CEZA 3SQGB 4N77A 2SXLA 2FB0A 4KC5A 1V3RA 2R2RA 2BANA 4DS4A 2V8HA 1VC6A 2RQKA 2GGPA 4NCGA 2R7RA 2FLPA 3PW5A 1HD1A 2IYGA 2RT3A 1N6QB 4B3TF 3MPVA 2WHOA 3IBWA 4UY85 1RK8A 2HHQA 3HHNB 1BLUA 4O23A 4RW8A 1VIOA 2B7BB 2XSJB 3UW1A 5KFHA 1SL2A 5KFOA 1FJ7A 4NLWA 4X4PA 5B0EA 2Q6BA 1KSPA 4RBVA 1HWLA 4IG0A 1G3OA 2FDNA 2J7KA 2MGZA 3ICLA 4O3RA 1FEEA 5GADU 3J7YU 2X1GA 1SC6A 1CC8A 5KFXA 3MEGA 1B0TA 1P1LA 4ICLB 3EZUA 2R7TA 3B78A 1K73T 2AYGA 2AYEA 4R8UB 1FRMA 3C6TB 1QM9A 3LGNA 3U1NA 4QIEA 1HI8A 1UL3A 1K9MT 4R25A 2FPHX 1KVJA 4AXIA 1SQEA 4ED3A 1U1NA 2IM2A 3F44A 4EWTA 4TU9A 4KGMA 1TL3A 4ID8A 1F2GA 1Y5NB 1KOOA 3MEDA 3IXQA 4NZ6A 1PGZA 2RF2A 1NZAA 2AGOA 3QWPA 2W9AA 4HHJA 3ZZOA 1S9GB 4WCEQ 2J0WA 4BDPA 4MMOA 2G0CA 4JOUA 2RSQA 4JV1A 3SCLE 5L38A 5DGAA 2EC0A 3KK3A 3FSXA 1NB7A 4DL0C 1HWJA 4A8YA 2UP1A 4J9NA 5HROA 3ENQA 3TNVA 1Q7YT 1L3TA 3FRYA 3L09A 5IT9Y 2D41A 3CJ2A 1H2VZ 1FKAF 2YX1A 3GYNA 1FCAA 2DNNA 2WB4A 1TKZB 4DL6A 4IFYA 2UXBF 3RAMA 5MAOA 3DOMA 3M6UA 4M5DB 2DTJA 1C0TA 3C8YA 1SIZA 1UFLA 1X5SA 3KLIA 4I2PA 4R0JA 3K59A 1FHTA 1KC8T 5HN0A 2P6SA 3IWXA 2C28A 1LW0A 1ZH5A 2AJ1A 1DAXA 1U47A 4JI5F 3DRRB 2WW8A 3I0RA 2NREA 2CQHA 4JBCA 4BCAA 5BYRA 1V9OA 3DI6B 2BQUA 2UUAF 3DLLQ 3M2UA 4F26A 1C1BB 1MNEA 3CJ3A 1IM4A 1VQPS 4OQJA 2YNGA 2YKNA 2W9CA 2LECA 3PY8A 2FVPA 5IT4A 4G1QB 4RUCA 1GT8A 3IG1B 3MEEB 1VLYA 1R8PA 3QJLA 2UUCF 1QY7A 5K5MA 1KFDA 3FZ2A 4DSFA 1VBYA 2ROPA 2JL9A 4DV2F 1N5VA 2OSRA 3A8EA 4DX8H 4ZA1A 4ZCIA 5KFPA 5DDRC 3MMAA 2YH0A 2F8EX 4MKBA 3OSNA 5GAEU 1WHVA 3G8TA 3SDEB 1RT3B 1VQSA 3H5SA 2FJVA 3NMAA 3PNIA 2ASLA 1FDDA 1BQNA 2RRNA 2DH7A 3UCZP 4IRDA 4DQPA 3IWLA 2XBPA 5GAGU 3KKFA 1HBMB 1KTQA 3OLAA 1T05B 4TYBA 4F2SA 1ZAVA 5D4PA 2NPFA 4WZQA 3BGLA 4IOBA 5DDQC 4ZOSA 3BREA 2AYMA 3DRXA 1F5AA 3PACA 5I3UA 3T6JA 4I2QA 4C2MA 1SBRA 4BWJA 3N79A 1YI2S 1D1UA 3K8WA 3M05A 1S0MA 2V4JB 2MY8A 1T3NA 1DTTB 2HLUA 4NLQA 4H4MA 1DLOB 1FK9A 2GO8A 4YQWA 3CDWA 4TLRA 4IG3B 2VBZA 1PSDA 1IQTA 2LQ9A 1V6HA 2Y0SD 4OI4A 1N54B 2FHMA 3ENWA 1VHFA 4HT7A 5DG8A 1HWKA 1HBOA 2E44A 4OV1A 4QWBA 4BC9A 1HW9A 3UFCX 2PFFB 3SSSA 2QA4S 3LGMA 2RJZA 1M1KT 4QYRA 2FIUA 4LSLA 1TK8A 1TVRA 2MKIA 4OZ1A 4EUVA 3CJKA 3SCKE 2LLZA 2U2FA