2NQPA

Crystal structure of pseudoudirinde synthase trua in complex with leucyl trna
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Isomerase/rna
molecule keywords transfer RNA
total genus 80
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 5.4.99.12: tRNA pseudouridine(38-40) synthase.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01416 PseudoU_synth_1 tRNA pseudouridine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA01
3.30.70.660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nqpA02
4IQMA 2NREA 4ITSA 1VIOA 2GMLA 4NZ7A 2NQPA 2OMLA 1VS3A 1DJ0A 2OLWA 4NZ6A 4J37A 2NR0A
chains in the Genus database with same CATH superfamily
3TANA 5GADI 4NCAA 1WC4A 3SSQA 4ANDA 3TO8A 2WCXA 5B0GA 5AXMA 2MZ1A 1FRJA 2VQFF 1NEEA 1N56A 2QT7A 2ZDOA 2HEKA 5C25A 1HR0F 2H54B 4ZA1A 3DOKB 1TKXA 2JL9A 1QVFR 4M8LA 4Y6IA 1TV6A 2RF2B 1WC5A 3D1OA 4LJMA 3TVKA 1ZPWX 5C2CA 4N5SA 2ZH9A 4IG0A 4F25A 2D9PA 1TKTA 2SXLA 4MKAA 1M5PC 1OQ3A 4NLUA 2VHGA 2JOQA 1U1NA 2AV5A 5DM6Q 2WVEA 4JI6F 1XR6A 4QR2A 3Q83A 1NHUA 4PEOA 5G4DA 1MWQA 5LJ3Y 3PIPQ 1Q82T 5LMUJ 2MY8A 4Y2CA 3G4SS 4F3OA 3BDEA 1F5BA 2UZAA 4ER8A 1YJTA 2O1PA 2YNFA 5HMZA 2DR9A 3T1AA 3UN3A 3ZFVA 4C0BA 2VJUA 4B9SA 3AD7C 1X7VA 4TYAA 2D3O1 1RT7B 4DUYF 2BOPA 2IC3A 1RKIA 2W2NP 1Q0NA 5F0WA 1KRPA 4GVBA 2FLPA 3BSOA 4UZBA 5D0HA 3VAIA 1XK8A 3LAMA 3GV7B 1HBUB 1QM9A 3IG1B 4F50A 2C2EA 3Q2TC 3NMAA 4ZOSA 3BO3A 3O2IA 1IJEB 1Y00A 5A6WA 4X4OA 1XEZA 4DJBA 4YDDB 4ECTA 1FE4A 1WSRA 4KFBA 4RW8B 4B9LA 4O3QA 5BYRA 3VAMA 2GQCA 4PG7A 3MM5A 4N77A 1FJGF 3GFZA 1GH8A 5JJBA 1RCXB 1BD6A 1UP1A 2M52A 2DNYA 3OR1B 5HVFA 1IKWA 1N0VC 3TX0A 2HHHF 4EGLA 1XERA 3TAPA 1VQNS 2VBWA 3MTKA 2KN4A 3UDEA 4R5PA 2MLZA 1NK0A 5JXSA 2QSWA 2W24A 4HYKA 1N32J 1R6VA 4RW6B 4DG1B 1HQUA 3EWGA 3QGIA 3HSGA 4KIAA 4U8VA 3CF5Q 1HHSA 5IZHA 3LH2S 5HO4A 5RUBA 2MKSA 2B4UA 2FY1A 2Q66A 4LF5F 3OVBA 5D3GB 1QUVA 1AFIA 4ZHRA 2QE5A 3D0GE 1U02A 2VG5A 2BOAA 3PRVA 2FD2A 4FBUA 2EFQA 2B7BB 2DIUA 3NS6A 5H9FK 2NYHA 4L74A 4EYIB 2KL8A 4BLGA 2BQUA 3CW2C 2FZKB 1UL3A 5KFRA 4DV5J 3J7AN 3DKDA 4ZIWA 1X9MA 4IH6A 2CPZA 1N33J 1GTHA 1JLFB 1GTEA 3VZHA 4P2MA 3B54A 3E01B 1ZA2B 4CLUA 3M8SA 4DL2A 1R7IA 5A8RB 1FX2A 1T9WA 4U7CA 2A2DA 2E1RA 1OPZA 3M8ZA 2C2NA 2WHOA 2CPFA 3H2VE 3DC2A 3OL7A 4GC7A 2IM3A 5ADZA 4QWBA 5AE3A 4V19J 1RAHB 1CVJA 4B3OA 2KFNA 2MSSA 4XK8C 3B8HA 5MAOA 3RBZA 1GMVA 3D6FB 3L09A 4NXNF 4UQTA 3W9JA 3IM8A 2XY5A 1KVIA 2PSZA 1EETB 1B70B 1SV5A 1ZTWA 4BCAA 4DR3F 2ZBCA 1M5HA 1YJ7A 3HHDA 3HI9A 3H59A 1CPZA 2AWZA 2HVEA 4TU8A 2QA2A 3QLHA 1SCJB 3QQCD 4PABA 3K2YA 5D4NA 1FXRA 4DXLA 5A0YB 5F9NA 3J81j 3QRRA 4PCQA 3ZZYA 2FJEB 3EICA 3OQ2A 2ZD1A 1OJ4A 3M30B 4OZ0A 1TKDA 2LQ9A 1TR0A 2GVDB 3H7HB 1O51A 3CCTA 3QFWA 3BYRA 4YS2A 2YNHA 3GLJA 2HHSA 4U8YA 4DPOA 4U95A 1K8AT 4IQMA 4LBPA 3ETOA 1S4EA 4H4KA 1YDLA 3DLHA 4USUA 1RWOB 2RDDA 3CE8A 1RBOB 3R5CA 4MFBB 3EM1A 1KLMB 4ICLB 4YP3A 3GIJA 2YH1A 2J9DE 3CDUA 3POTA 4ILLA 2MJNA 3DLJA 5EWEA 5C2GA 1H73A 4RNNA 1TUVA 2OFHX 3BKTA 1KBRA 1GT8A 3MM7B 3VVUA 4DQQA 2KG1A 3D2WA 4A8FA 3PJWA 1ICEB 2DNZA 4IFVB 3ZZPA 4K4YA 4AL7A 1RHKB 3H90A 2MKIA 2P6TA 2RJZA 5CD4A 2E9RX 1C1BA 1KHVA 4CT8A 4KHRA 3Q0AA 4ATNA 3VAKA 3THVA 1NKBA 3PZPA 1XWLA 1M1GA 2XWXA 2QLWA 5E41A 3VALA 3P6YC 2CDQA 4USWA 1JLBA 2C3MA 1DTQA 1R0CB 4YHHF 1HKAA 1RAFB 3C16B 5FD1A 2ZH1A 3DLGB 1N5YA 4CRJA 1IBMF 2J6TA 1DLOA 4WXOA 1QDUB 2DGXA 2XC9A 1H74A 2Y1LB 2YNGB 3CJKB 1VQPS 2FJXA 2HURA 4NMXA 3N5BA 4RUBA 3CCUS 4URQU 3SV4A 2XS7A 1D3WA 4QJVA 1JLCA 1HI1A 4LR9A 4DU7A 1EKRA 3D67A 2OSQA 1GQEA 4QQBA 2A10A 2ZZNA 3ADAC 1TP7A 3L3CA 4EBDA 2JFKA 3LPEA 2I5JB 2HW3A 4JBCA 1DQAA 1U6ZA 4AL5A 1HQUB 2C3OA 5GAGI 1IWGA 2YWWA 2B9EA 5KG3A 1S97A 2KZZA 4LF7J 1TV6B 3PG9A 2YKPA 2ZWPA 1RSCA 2DGWA 4W98A 4P71A 2X3GA 4FYVB 1RTHA 4G1QA 1V3ZA 3HHKA 3R3TA 4DCOB 1ZAWA 5IM0A 4RUHA 1F5CA 1J27A 2W8KA 1Y11A 4C98A 4HI2A 2LU1A 3CD0A 2YKNA 3KJFB 1B0VA 4B3SJ 3MMBB 1QE1B 2GA7A 2WAQD 4GRSA 3PO4A 2E5LJ 2F65A 2JZ5A 1NUEA 2YPYA 1MMDA 3JTNA 3MMCA 2J8SA 1TUGB 4DZDA 1WC3A 9ATCB 1H38A 4USKA 5EWGA 3SZ2A 2DNLA 3PO5A 4F2SA 3FCHA 2WBRA 1BQMB 2LQBA 5I3UA 2PFFB 1WF1A 5ITHA 1WHXA 2RILA 2J9EA 2J7WA 1UJ5A 4JI4J 1JB0C 1FT8A 3LTOA 3MPDA 5D4OA 3R5JB 1WG4A 5KFTA 3T6JA 5C7PA 4WFAQ 2HBQB 4RJVA 2HAFA 3KLIB 1T9XA 2MKKA 3IRWP 3CJ4A 1IUJA 4OJ3A 1S1XB 1NRKA 5C24A 2D3OR 4DR6F 1DTTB 1S4FA 1YK9A 1QD1A 4ZVTB 4C9DA 3Q86A 3KXDA 4I69A 4B3SF 3J81U 3I4PA 3M6WA 2BDPA 5F0UA 4ECQA 5B0FA 1RBLA 3MI7X 3MEKA 4L6V3 5GAEU 3WIUA 1H3DA 3KHRA 1RHQB 2DR7A 5KAKA 2Z2MA 1SL1A 1P6TA 2GCFA 1ZAVA 3RAMA 4WE1B 1LW2A 4ED6A 2RQMA 4HR2A 4J9UE 3GILA 5EX0A 2E29A 3U7JA 4WFNQ 4ZCMA 2M3DA 4F4AA 2NYIA 2CJQA 9RUBA 1NDPA 3NCQA 2I1RA 3DGVA 5CZVA 4K4SA 1WDDA 1SKUB 2JX2A 3UR3C 4LF4J 1QAIA 4HT7A 3TWZA 1FK9A 1HMVB 1ELOA 4LREA 5GVQA 3N6NA 1X4DA 4N8OA 1LV5A 3KTQA 2D9OA 2RT3A 4K4WA 3M2RB 2RHQB 4FS2A 2E66A 3UN5A 1UCNA 2IMWP 4LF9F 2CUYA 3GWCA 3NCPA 1JMTA 3WQPA 2EW9A 4OJGA 4RWXA 2ALYB 4USTA 4RZRA 1FERA 3CCJS 1XMOF 4RW4A 4O23A 1UPPA 2POKA 1S1TA 4HI1A 3OTOF 4Q8EA 1RHUB 2E5JA 3K5PA 3LA0A 1P8GA 1NBEB 4DHVA 4TQSA 3B78A 2CQPA 2YNGA 3G96A 4C8YA 1R3NA 4PXDA 3ISNC 2BABA 1RYRA 1N5YB 1WORA 4C48A 1SKRA 3GIKA 2B3TB 2MQ8A 4KYZA 4P7TA 3SFUA 4OJHA 1A9NB 1RT1B 1Y7PA 4N8NA 5B0DA 1NSPA 2IM1A 2BJDA 2HAIA 2VQEJ 3V6DB 1LKZA 3R1LA 2OH2A 3IR7B 3MMCB 1HNIB 1DAXA 1RA6A 1FNXH 1XMBA 3W9IA 2HWIA 1T94A 3KJVA 4NPOA 4NLSA 3BGRA 4UZCA 2BEFA 3MD1A 3ICLA 3VV2B 4TU9A 2OEMA 3LP0A 2JJ4D 3C6UA 4IH5A 1V5VA 4HHHA 3UN2A 2ASJA 3BEGB 1BGXT 4XPEA 2FVQA 1YJRA 4LFCJ 5T41A 5C5JA 7FDRA 2DT9A 4O3NA 2C1EB 3FRZA 3MUVP 2RKIB 3MUMP 3QIDA 2GHWA 2RE1A 1RAGB 1TAQA 3MM5B 4PZVA 3TQEA 2W4PA 2VC1A 2B4OA 4KFBB 3W60A 2GVDA 2ZVSA 2HHXA 4B3TJ 1U7LA 4IR9A 2HMIB 2ZD1B 1WJ9A 1H2VZ 1NHKL 1WD6A 2F3JA 2NXJA 5K8MA 1IKXB 4FVMA 4F0MA 1TKXB 5B7WA 4X66J 3ZZUA 2DNOA 2BQRA 2QSFA 2PDAA 3H98A 3OV7A 2C3UA 2KO1A 1HI0P 3ZTPA 2FHOB 4KO0A 4LT6A 3BSAA 3ZO7A 2FVSA 1HYSA 4YN3B 3JSYA 5K14B 4IYQA 4F0KA 3FQKA 4UOGA 4LFBF 1CC8A 4C8LA 2FDNA 3F41A 1VQSA 4PQAA 2AZ1A 2W9CA 2R7RA 4IR1A 4W92B 4OYBA 2DVIA 1FO1A 1M5SA 1R0BG 1SKWA 5D8HB 2CQ2A 2HFNA 2GIRA 2HZCA 1A0OB 1TFWA 3D1QA 3EUNA 3TVYA 4OZ2A 2AD9A 1VMBA 1C1BB 2BX6A 3T6BA 4CNZA 4MT1A 4PXEA 3KUEA 2ASDA 1S57A 5KFUA 4N56A 2NUHA 2XY7A 5HJYA 2V50A 2QV6A 2P9EA 3EXYA 2NCKL 3K57A 5AXLA 3KK2B 2LEPA 2Z2YB 3KG1A 2XCAA 4B9UA 2ACMA 5I3PA 5KFYA 4ZS6A 3NAIA 5EHHA 3OVSA 2AP6A 4ED5A 3US5A 3W2VA 4P2FA 2LXUA 2CPYA 2MQQA 2G2ZA 4DF8A 2XHCA 2ZNZA 3FBEA 4C8OA 1UEVA 1WOOA 6FD1A 3BPDA 1W2IA 5KG0A 3IFEA 2RU3A 3OUYB 3MHYA 2MGZA 1WUUA 4HTJA 5DRKA 3DLEB 4WU3A 1SBRA 1TMMA 4ID5B 4C8MA 2CVIA 2VFRA 1Q16B 4OZNA 4IRDA 2C2ZB 3CD7A 1SC1B 3G71S 2ZHBA 2WW8A 3EZOA 2GJIA 5A0YA 3CCZA 1PC4A 2ROGA 4NOHA 1XMOJ 2AJ1A 2OGUA 1TKZB 2K1RA 2IRXA 2ZDPA 4NI2A 4NLTA 3CDBA 4OI6A 5ETVA 4W4MA 4TY8B 4FYWB 4KH0B 4MIAA 5DETA 1X5TA 1U49A 1NSQA 4KTQA 4KGVB 3FBBA 4ZPTR 1J2VA 1M5VC 5EX3A 2RQ4A 4PYDA 4WZMA 3TEHB 2BE2B 1UPMB 1OWXA 5ETPA 1N5VA 1VIXA 2CQ3A 3IMQJ 4HLBA 5KG5A 1MROB 2HLTA 3E3XA 3ET6B 3MOZA 4URSA 2XO7A 5J2QA 1UMJA 2AEJA 2IDEA 1AYEA 1HWJA 2YQ0A 1HW9A 2M0GB 4Q2MA 1H2UX 3H20A 1MN7A 3BREA 4M63A 3E01A 4RX6A 5A8KA 3EE3A 2UUAJ 4X4RA 2WVCA 4G6VB 5K8NA 3T1YF 1SI9A 1NJIT 4H4OB 3JB9k 1H6KX 4OYIA 3LW5C 4KC5A 1S12A 4ANEA 1GNKA 2GAHC 5L9NA 2M7SA 4RW7A 5KFMA 4NCBA 3I6PA 1K47A 1S1UA 1T8EA 4P52A 4DR6J 1T95A 1JLEA 4IDKA 2CADA 2DH8A 2PFDA 2DB1A 4UTGA 3S01A 4C3KA 1SQEA 3M9NB 3PW7A 2R8JA 3QATA 1OYEA 1F5AA 4CTAA 2JEJA 4F4KA 3AXKA 5D0GA 1W7WA 3DLGA 3K5OA 2IBOA 3VZIA 3BGFA 4DUYJ 3F44A 3W63A 4JI2J 5C42B 3J7Z5 4DV2J 2MHNA 2Y1RI 5B0AA 3GPAA 2WOMB 4RO0A 1EP4A 3HM9A 3QJLA 4X4NA 2F7VA 4H4MB 2R7XA 4YR3A 2D41A 2COLA 3HFZB 2G0JA 2BMBA 2NLWA 2BRKA 3MPYA 1U6FA 3KK1B 3UCZP 3H5SA 1EX8A 4ALZA 5CA5A 5KFNA 1ZETA 1HNZF 1N33F 3GCWP 2KVQE 2DNKA 2HG4A 3PYFA 3SI8A 3LGMA 2ASLA 1WTFA 4PYAA 2VBZA 2XCPA 1VRQC 2W1BA 1S99A 1MLAA 5IFMA 3OSNA 2ZH6A 2RHSB 3SSRA 3BBFA 4WU2A 1S6PA 1S7IA 1R8AA 2CPJA 2MPUA 4WK1A 4JI0F 5CABA 2IVMA 4C2MA 4K5RA 2VQFJ 3BO2A 1N6QA 1V3SA 3CJQA 3U27A 2J6UA 3C6TA 2MQLA 5HP1A 3M30A 3DOLA 1CJTB 1S6QA 2VL1A 2YNFB 4CZCA 3VVTA 2E1MC 2FHKA 3LF0A 4A8OA 3O6QA 3DRXA 4Z7YA 3R2DJ 1RT4B 4P2XA 3CGIA 2XI2A 1VBYA 1ZOTA 4Q44A 1VC6A 2UUBJ 3EMTA 4N7TA 5DM7Q 4KR0B 1YJWS 1U1RA 1PJ7A 3C8YA 3NY0A 3DNCA 1AUDA 3BH6B 4J7CA 3ZTSA 4QYZJ 1TKTB 2AJFE 1NK8A 2H65B 1TK8A 3NS7B 2LEAA 1YG0A 2RDIA 2W2MP 3AJ1A 3N9UC 2M88A 3HDSA 4IRKA 3QO9A 3R6GB 3K59A 4P2SA 1IM4A 1RT6A 2XS2A 1I51B 3VTIA 2KXNB 2QC3A 4CH7A 3RR8A 4RBVA 2ZE2B 4RNOA 2KG0A 4QIGA 1MN9A 4ZPDA 2ZKUA 2CJYB 3O44A 3DRSA 1RWXB 2LQJA 1HD0A 3I5AA 2VD3A 3M8QA 4NRUA 2YWEA 4NZ0A 3TA2A 2IJNA 4FXWA 1QTMA 2AJQA 3CJ8A 4NLDA 4P73A 2I38A 4NZ7A 4XAKA 2MQOA 2KRBA 2PEBA 5IT4A 1HBNA 5GMDA 4YB6A 3UQSA 2UXDJ 5L1KA 3BQ2A 4JI8J 2R2SA 2HFOA 4E8UA 5IWAJ 1OY9A 1URNA 4PG4A 2YWKA 4TQRA 2DO0A 2HPUA 2Y0SD 3HD1A 3PM9A 3KJQB 4MIWA 4O4GA 4CQ1A 1M5KC 4EO8A 1I3OB 3QSYB 3UR0A 1FEHA 3L4BC 5H9FJ 4HL9A 3D6TB 5HATA 4NEZA 4R5PB 4ZVRB 5KTQA 5DQIA 5CD4H 3PW5A 5IWAF 1UW9A 3KWMA 2VG6A 3CMAS 2DY1A 2LYVA 2AQ4A 1L5UA 4Y2AA 2L9NA 1PSDA 5LMNF 3MMAA 3ENQA 3PEHA 1QAXA 2NXNA 4ZPVR 3ULHA 2OD6A 2QL5B 5KFVA 3PRBA 4ITSA 3GQCA 3DRPB 2UVVA 3X1LB 1MG7A 4R8UA 1APSA 3TRGA 1Q81T 1LOUA 1X8DA 1XIQA 5DG7A 4AFFA 1K73T 3CCSS 1N0UA 1RWUA 3AA8A 2EFGA 5J1NA 2OUGA 1XJWB 2FJWA 2CQ1A 1FKPB 2KHDA 4I64A 1ZS6A 5U47A 4FVCA 3RRGA 1U8WA 2CYYA 4JB8B 2OI2A 2ZKTA 2B51A 3SQOP 1NZ8A 3W7BA 3C14A 4PQUA 2ILYA 2DISA 3CO0P 1F9EB 2RMLA 4OX7A 3OTOJ 1PKUA 4IFYA 2ZH7A 2AU0A 1QJHA 4KKOB 1VRTB 1WEYA 1GK8A 2B5JA 2UUWA 3GYXB 4KBIA 5L1LA 4F4XA 1X4BA 1VK3A 3AOAA 4FNIA 3W2WA 4YB5A 3DLLQ 1ZH5A 1YBTA 1GX6A 4IG3B 1SQGA 2JDJA 2EWHA 3S8SA 5FLXU 1S77D 4USIA 4M5HA 1JLAA 1S9EB 1TQLA 4FPRA 1CBKA 3L9ZA 4I1TA 4MIBA 4UUWA 3BS9A 5FDLB 3HHLC 3VAJA 2K7KA 2QG9B 4JI0J 1RDRA 4J37A 4FKXA 5H9EJ 2YX1A 1FI4A 4OZLA 3PV8A 3HJFA 4Z7CA 2W25A 1TTHB 1VGYA 2A18A 5D4LA 4RR5A 3TAMB 2GVZB 4NX9A 5FIIA 1LK7A 2BYCA 2FC8A 3JQJA 2IM2A 2L9DA 1SH2A 3CJ0A 3ETMA 5T7LB 4DZ6A 3KHHA 4F4WA 4LF6J 3R6LB 3V6JA 4NLWA 4ZVOB 1VQ7S 1EARA 2XTJP 1FJGJ 3FFIA 2FYXA 2BKNA 2Y0BB 1DTQB 4DV1F 2PI5A 3H4DA 4X4VA 1TL3A 4DSEA 2BXJA 4DX5A 1Q7YT 4HH0A 2GJ2A 1PBUA 2XZWA 4WKRA 2BM0A 3FCWA 1RT3A 3TVZA 5LSRA 5DGBA 1Z4UA 1NK4A 2L3MA 5KOXA 2FVRA 3T1HF 2V8PA 5GAEI 4TN2A 1RTDA 5HP1B 1JK9B 2DNHA 4DFMA 5A76A 2LDIA 4WIIA 1ZZNA 2AX1A 3C15A 3TZXA 2ZH4A 2I2YA 2UUAF 1NLKL 5HLFB 2F4FA 2FJDB 4MKYA 4J9SA 3MPWA 2AEMA 1VYAA 2RUGA 4LRBA 4OQJA 2DCLA 3NLCA 2O3DA 4LSLB 3OHBA 2AGPA 5IT9U 1LXJA 2F4VJ 4OZ1A 2GJFA 2VONA 3SBMA 5HAOA 2DD8S 4JI6J 2N7CA 3DLEA 2KTQA 3IWNC 1VQMS 3VCDA 2J5AA 1W25A 4KE5A 2V4JB 3DYAA 3UCGA 4CT9A 1NB7A 3OUYA 1WHVA 2IJRA 3KK1A 1NH8A 1O0PA 3O8WA 4A4JA 4KGXB 3GG0A 4WFZA 3K58A 2Y8WA 4KHPJ 3PJXA 2WONA 3L7OA 4I68A 2DPIA 1Q8BA 1HR0J 2ZBPA 2GMLA 2VIHA 3MM6B 3JTPA 2AJ4A 4I2PB 3MGJA 1FF2A 2ZZTA 2ZZMA 3LP1A 3BYPA 4LSZB 3CO9A 3FK4A 2AX0A 4A8XA 3CC4S 1WTBA 2L41A 1LXNA 3P5TL 1J5EJ 4ZN1A 2H4WB 2XSJA 4AT1B 4HACB 4A8KA 4DV7J 1FA0A 3AHPA 3CEDA 2KM8C 2H51B 1ACMB 3H0PA 2JWNA 3D6MB 2KM8B 4P75A 4LBHA 2VG5B 4MKVA 2HGMA 2PN6A 3PCOB 1YJUA 4NA2A 2NUUG 4DR5F 4ZCLA 4M5GA 3WC2A 2QLBB 2DEIA 4KRWA 5I42B 2JC0A 2DNQA 2XGQA 2C2DA 1FXLA 2ZUAA 4LRAA 4ED7A 3RTVA 2DYAA 3MM9B 4GO7X 1Z1ZA 2LA4A 2FHMA 1AZSB 2VFTA 1XMQJ 4M5DB 3M8PA 3UPFA 4KPYA 4ED1A 3QGPA 2B5JB 2KT3A 3DDKA 1CQMA 3LP2B 4L76A 2QA4G 1OMSA 3PR4A 4ES1A 2HYIB 1HHTP 1XNRJ 5DLFA 1VHFA 1SJRA 4I7FA 1ZAXA 1WOSA 2QN6B 3MWBA 2IIHA 3C14B 3W5YA 2E7WA 2MB0B 2RH3A 3FUYA 4LVOP 3D9BA 4Y34A 1JLQA 2G0IA 2P6SA 1TZ0A 4IOBA 3ZTQA 5HROB 2RKIA 2JHEA 4ED0A 3CD6S 3KLGA 2MMYA 2ZM6J 1NJWA 1X5SA 2ZUGA 4HDGA 1KNZA 1FFSB 3RRKA 3OL9A 1G1XA 1HW8A 1FJCA 2BJ7A 2HZAA 2ZBQA 1NDKA 3PW0A 2V6AA 3LANA 2E1CA 4ECYA 4KHPF 3PX6A 3LGNA 1C1CA 3D1HA 3RJMB 4TY9A 2CPDA 2LFVA 2V69A 4DV2F 4DFJA 1T3NA 1DHMA 3I5CA 2OFGX 1AA1B 2DEJA 2XO6A 1MW7A 1X4HA 2B43A 2EC2A 1YJVA 4ZPBA 3JYTB 1RWKB 3LGHA 5D6GA 1XNQJ 2DJWA 1RU2A 1CC7A 4G1IA 1FRHA 4LR7A 2PMHA 1FKOA 1M90T 3LAKA 4QWDA 1YTYA 3KK2A 1U1QA 1RBAA 4RW7B 4CCHA 3Q8VA 5IC4B 2ZWOA 1VJWA 2Z57B 4DR1J 3WC0A 4F8RA 5A8RA 3G8QA 3LWMA 3N4WA 4WZQA 1PAEX 2YH0A 2JH3A 3MR5A 4E0DA 1LFWA 4UY85 3SXLA 3Q8PB 3JQMA 5E3AA 4QW9A 1SJFA 4TNOA 3KYLA 3TX8A 1U8SA 1VHIA 4AQYJ 3NNCA 4K0KF 4M1KA 3A8EA 4DSIA 5F3TA 2DHAA 5THWA 2JFDA 3QWUA 2QYCA 4EMDA 1JXLA 1UVIA 2D7SA 4OL8A 5D4PA 2WONB 3VQTA 1UVNA 4EFAC 3NNHA 2HFZA 1OY6A 4CO3A 3QJPA 3V4IB 3GV5B 3ZTRA 1IKXA 1P1LA 3ENVA 3M05A 2EEYA 3A3OB 4WE1A 1KSPA 4KV8A 3BGOP 2CQGA 4ID5A 2GZOA 5KFEA 3ELHA 1RHRB 3VAFA 1U26A 2V4RA 3QMQA 5IV4A 4XO0A 2Y9HA 3GCXP 1HBOB 1TL1B 3HVTB 2Y1IA 3P96A 8ATCB 1F2GA 3BGLA 1KWMA 2K2PA 1WKLA 2OLWA 2HHHJ 2G9OA 5LT5A 2J6SA 3PXGa 5JUMA 3CCLS 3CC7S 2FY8A 4ZMMA 5KFDA 3HT3A 1NMEB 4M95A 4QYRA 4OYZA 1GMUA 3GMGA 1M1KT 2XG8A 1CJTA 1S6QB 1PAUB 1RWMB 3V81B 1U1PA 1BQXA 2YWGA 4LIRA 3NGKA 1KHWA 2R7SA 4JUZA 5AE2A 4CLYA 1VQ9S 1A6LA 2DHXA 3KNAA 1OPIA 5KFGA 2J9CA 2MKJA 2BW2A 4YY3J 3HSZA 2BVZA 2RUSA 3UNGC 4B3RF 3D4JA 5CCLA 3IR6B 5A8WB 1AXQA 1TL3B 3A4TA 1IXKA 3ITHB 1Q1KA 1XR5A 1S0VA 3FFIB 5DG8A 2QMUB 4HDHA 2W9CB 1RISA 3ZNJ1 2HSEB 3MR7A 4CP5A 4DS4A 1QSYA 1NM2A 2GAGC 1UJ4A 2EI5A 1BWEA 1C0TB 1RAEB 4ECRA 4DX7A 4F02A 2OPRB 2QA1A 4GKKJ 5K8PA 1R0AA 3DI6A 5J2PB 4CLSA 2U1AA 1LQ9A 2VFUA 3CJ2A 3QO9B 2UV8A 1N5TA 4JI5F 3PY8A 2VOPA 3DHXA 2HRYA 3N79A 4Q7AA 3TUJC 4K5SA 3A13A 4AE5A 4DWIA 3TOQA 2VB6A 4X62F 3D28A 4GKKF 4IFYB 2VA3A 1CSJA 2W2PP 4ZP8A 1JLEB 1YBUA 3AFGA 4HVZA 4IDKB 1IBLJ 4DR7J 2VH7A 1YBAA 2VASA 2ALZA 1N34J 2PGCA 4DX8H 2WSCC 1IQTA 4USJC 5KT5A 3A12A 3FQLA 5DZ7A 2D1CA 3W61A 3CCMS 2CA9A 4RU2A 3QZ7A 4DV1J 3P45B 2AGQA 1D1UA 1RHMB 1RE1B 2EFVA 5ETLA 2W2OP 4B9NA 3CB4A 2XSFA 4K59A 4WFXA 3R1HA 4TU7A 5F9LA 1YJNS 2H1YA 2FJVA 1F6TA 1N5QA 4AXJA 4Y2MA 4OX8A 5A8WA 3T1HJ 1N52B 2HNZA 4QOTA 3IP0A 4C6AA 3HPOA 3QIPB 3LWLA 4NYOA 4JV5F 1PIEA 3TAQA 5EDWA 4GVLA 5GAGU 1F60B 4C8KA 2VPXB 3W8GA 2E1AA 3MTJA 2G0CA 2YNIA 2KT2A 1WC1A 3CT9A 3HSDA 3KDOA 5DDRC 2VG6B 2UVRA 4DR4J 5E0OA 4M5NA 2GIFA 1F0XA 4Q8FA 3CD5A 5HBMA 3OXGA 2XYPB 5CXTA 4PAAA 4ED4A 1AUSL 2I0XA 2DNGA 2M5YA 3AJDA 4CDIA 3OW2R 4DSFA 1Q8IA 2HVIA 1ROFA 2LECA 4LF6F 4O0NA 2FLOA 2ZH3A 3NGUA 4IO9Q 4DLEA 4DL6A 3C3LA 2GGPA 2OP5A 1HQEA 1RAOA 1GX5A 1CJKB 1IBMJ 1HNWJ 3F0NA 1SQFA 3VGUA 1SUQA 3J81Y 4R0JA 2J0SD 2C42A 3NOCA 2DGVA 4QIVA 1BY9A 2HNYA 4DSLA 4G3IA 1X9WA 2F1FA 3TEGA 4JI1F 3EVOA 4LQ3A 2A6OA 1BMQB 1NJXA 2ZBIA 2LXFA 2Q79A 5IT0A 2DXDA 3DLKB 2NXEA 2R2TA 1YVFA 1JJ2R 4NE9C 1WSVA 4I0WA 2XB2D 3HP6A 1FD8A 1VLYA 3HHLB 3EGWB 1WC0A 3JTOA 1D8YA 1WDTA 1T9TA 4LVNP 4DLGA 1UFKA 1U1MA 4PG5A 4J90A 1LW2B 1LNQA 2IBKA 2ILZA 1X5PA 3H5UA 1YX2A 2FVPA 4OV1A 1VRUA 2V2VA 4GC6A 5LMUF 4ZKAA 2FHJD 4I2QB 1S9FA 2NZCA 3KLFB 4DV6F 1WNEA 4UOCA 3RAXA 5KG7A 4ETZA 3NAHA 1U0HB 5HANA 3N0VA 2O67A 3SQGB 4C4WA 5KFZA 2RSQA 1N36F 1VCTA 2KDOA 4TYBA 3A8JA 1WI8A 1UZDA 3DOLB 4ZLJA 1SC4B 3BSNA 1VBXA 2OPQA 1QAYA 3DGPB 4OMFG 2MEWA 5D15A 4CYUA 1CJUB 2CQ4A 1HNVA 4ECUA 1B99A 1S1WA 2CVEA 2OD4A 3CJ3A 2XM3A 3K5LA 5I3UB 1Y4ZB 3QNWB 4BDPA 3HZEA 4FNHA 2Z0GA 1CJVA 1Y3KA 2OAUA 3G87A 3GYNA 3UO0A 2YWFA 2XBPA 4MK9A 4DPUA 1LWEB 4R8UB 4QWCA 2KRRA 1LWFA 1PCAA 3V4MA 1FRMA 2JEFA 2Y8YA 5B0CA 1IKVA 2CQ0A 4ES3A 4H4KC 1UVLA 3T9NA 2ZJRQ 1I6JA 4F67A 2V63A 4MYUA 4OYPA 5HSPA 2AYGA 4CLKA 2EK6A 1PJ6A 1O5JA 3NNAA 3RU0A 1OO0B 3MOJB 2BJ1A 4NLXA 3MAAA 4DX6A 1VI7A 1YZ7A 2P9GA 5D0EA 3EVWA 3W2VB 4RWWA 4ANCA 2AW0A 1ZYQA 2HQGA 2O01C 1EZZB 1RWWB 2QL9B 4I6AA 3T5JA 4K2XA 3OL8A 4M5JA 2UU9F 5C42A 3ONQA 3NMRA 3IS9A 2JC1A 3A8KA 4ERDA 3KUHA 3UDCA 2UUBF 1KFDA 3HKZD 1RAJA 4H4MA 1XMQF 3SCJE 1JLGA 1JLAB 1S9EA 1RCOB 1HBNB 2FC9A 2MZSA 3CJ5A 3HJVA 3CPWR 1R0AB 3RR7A 2R7TA 5E7OB 1LFPA 5AXKA 4U9RA 2J76E 2O5DA 3EZ5A 1RT7A 3W62A 4ELUA 1GMWD 1RLDA 4XTTA 3SCIE 4KGKA 3GIRA 3SDEA 1T3OA 2V67A 3J7A1 4KKOA 5BYSA 2YX4A 3GE9A 2X7IA 2YKOA 3GSIA 3UNYA 2IY5B 3PKMA 3BH7B 2VUGA 3KLFA 4OHXA 1SIWB 2H5IB 1HYSB 4L3KA 1TL5A 1DARA 1VK8A 2FUG9 2IRUA 4EWTA 4KO0B 3DMJB 4BBYA 4YB1P 4UQGA 3D68A 1BC6A 2C22A 2R7QA 1MROA 1PBAA 2XI3A 3I5BA 3FJ2A 4NA3A 5CCMA 2D69A 4DI6A 1OIAA 5HK4A 2H9ZA 3H5YA 1C4CA 2PO4A 3WX4A 3EJMA 2FB0A 5BXIA 1UVJA 2EKYA 5DDQC 3GB0A 4PWUA 1GFWB 4WFYA 2WK4A 2GHPA 2ABYA 2YQ3A 3MECA 1YKWA 3Q8YA 5KFAA 4O3PA 4IO1A 5J2MB 2AGOA 4JI7F 1BLUA 4DV0J 2IYGA 5HVHA 3POTB 5D0RA 3OFGA 3R5GA 2J0QD 1YLXA 2HWHA 4ILRA 2Z58B 3MCMA 1NK5A 3BPSP 2E1PA 2BKOA 2KYXA 1SVDA 2V4JA 2CPEA 3DYAB 2CJBA 1L3KA 2CQCA 2LA6A 3AA9A 2CWXA 3LOUA 4G1PA 3WBZA 3DCAA 2HHVA 2YPZA 5KT3A 4LFBJ 2BQ3A 1U2FA 1XR7A 3PRDA 2GHVC 1TL4A 2CZ9A 3V4IA 2W01A 1AZSA 4K4ZA 2VFSA 4QZVB 1IJFB 2CJKA 5GADU 2LQ8A 3TJ9A 3J7YI 3H42A 4UOHA 4KH1B 3G2XA 2Q6BA 4ZVUB 4B3TF 2PMWA 3QYYA 4B9MA 4CLWA 2AT1B 2E9ZA 3LQVA 4O44B 2R7VA 3HLUA 4LR8A 5LSOA 1T05B 4FDFA 4BC9A 3PX4A 4B17A 1D0EA 2EFOA 3OVAA 2DGSA 1EP4B 2W2QP 4ZK7M 4CH1A 2M4MA 3OFHA 2N4CA 1FWKA 2VDHA 3HHEA 5CZXA 3M9MB 2VKZG 1S10A 2DNPA 2LU2A 4C3MA 4YEAA 3T1YJ 5L9XA 2KFZA 2QO3A 2MLXA 1Q7LB 1UJ6A 4NWBA 4TKTA 4I2PA 2R9LA 1NH7A 3BO4A 2JVRA 2YTCA 2H5JB 3VQSA 4ILMA 1YIJS 1T7PA 4L75A 5T7LA 1CULB 4MTPA 2DCUB 1UWBA 2XS5A 1WOPA 1HWLA 4WTOB 2FLLA 2QZ8A 4ZVGA 2RRBA 5A8KB 1NCLA 3DLKA 3CVKA 1N4LA 3IAM9 2FZGB 2D3UA 4WJBA 1I5OB 1RT5A 2NR0A 5DQHA 2LKZA 2J7UA 3IS9B 2QJ3A 2V68A 2X51A 5AT1B 4N47A 1FESA 1NJYA 2RDJA 5J2PA 4RW9B 5J1EA 1KN6A 4P74A 1ZBTA 1P27B 4PG6A 3AQOA 3EGZA 3GJQB 3BDPA 3SMZA 3A3PB 4MKBA 1JLQB 2QRRA 3IBFB 2DRBA 5FJ4A 4TY8A 1FE0A 3I31A 4M5KA 3LP0B 4F36A 5L46A 1HNZJ 2CG4A 4LBIA 4OFZA 3GFYA 5F8JA 4Q2LA 7AT1B 3MAAB 3IA0A 2OHDA 1Q5YA 4RW8A 4OHVA 1RHJB 2AIRB 1FNOA 3J7ZT 3FC9A 4F3MA 5E3PA 3RB0A 2NPIA 4YOEA 4Q0BB 6FDRA 4HT5A 3Q8QB 4JV1A 3W8PA 3EX7B 1KVKA 2VICA 2KXHA 4JV0A 1H2TZ 4IUFA 3ENAA 3OT9A 1D9FA 3MM7A 1YZ6A 2OPPB 4DR2J 4FS1A 1VQLS 2ZJPQ 3AXMA 2IMOA 2ADBA 2V34A 2J9DA 3MMAB 2FVCA 5B08A 2PT0A 2WW4A 3FRYA 4DL4A 2CRLA 4CLPA 1YHQS 4J5OA 2ZOFA 3KG4A 1YRUA 3PYDA 1WC6A 3EDRB 5CAAA 2QFJA 2UVUA 1K1SA 4F2RA 5KG6A 4QIEA 2E5LF 1NO8A 1RQ0A 2YWHA 4DCJB 3R2CJ 4CNYA 2CQIA 4RNFA 3ZXWA 3MR3A 2AYBA 2V2KA 1S1TB 1WEZA 2Q6CA 3M4XA 4I67A 1U25A 4PPZA 2HS0A 4JI4F 2DR6A 4P9SA 4DCPB 4OI0A 2VODA 1CLFA 4JI7J 2FZCB 4OX9J 3VGSA 3P49B 1EJ7L 3N5FA 2WTFA 1OS5A 2B6AB 4DV0F 1RA7A 1BWVA 3QFHA 4ZN3A 4FF4A 3A1YG 2XHWA 3M8QB 1RKJA 4Q0BA 3MCSA 3U1NA 1KVJA 2CPHA 4RL1A 3RYLA 1X4CA 4KAIA 4DMZA 3FBFA 4A8QA 1H98A 2V9WA 4OV6A 4X4UA 5SUHA 1HWUA 1R8PA 2AF6A 3UVJB 5F8GA 4PQUB 2W7PA 1T02A 2ASYA 2JLFA 3MR2A 4E98A 2ZE2A 3CJSA 4C0OC 5EUHA 3H2LA 1VC5A 4PWDB 1RT6B 5DO2A 5F8MA 2UXCF 5AJ3J 4LSNB 3P4UB 3TP2A 5BJRA 4K4TA 1EIYB 1XC9A 1IBCB 4WFBQ 1JIHA 1D8ZA 2IPOB 1UA1A 1WG1A 1UFLA 5C24B 2UUTA 1IBKF 3CULA 4C8ZA 3NGRA 5L38A 2E7VA 2QMWA 4CO2A 2HFVA 2V5HG 4LF7F 2UVWA 1DQ8A 1TK0A 1RT2A 2JNJA 3CDAA 2UXCJ 1Q4RA 1N8RT 2YNIB 5K20B 3JYTA 4NZ6A 4QW8A 4S0MA 4RBTA 3R8YA 3GV8B 2QA4S 1M5OC 1QY7A 1BQMA 1X4EA 2A2CA 2NREA 5JVGQ 3ZZTA 3V6HA 5B0BA 3UD3P 3CCES 2F8HA 5DG9A 1OY8A 1NK6A 1N32F 3C6TB 3T19A 2W8LA 3UE2A 4AQYF 2D3ZA 1RI7A 2HQCA 2M8DB 2FGCA 3CNQP 1QE1A 3KUGA 3CSKA 4ES2A 4YQWA 2KFYA 2XMMA 2V94A 4LQ9A 3LALA 3J80Y 2R8GA 4LUBA 1WELA 2W4CA 3Q2SC 2RRAA 3U1MA 4Y2KA 4MAKA 1S0NA 2HVZA 2OKQA 1S9GA 2KU7A 3QT5A 4UUXA 1CS4A 3MEEA 3R7NB 3D0IE 3MURP 2HFSA 2MLYA 3LPYA 2ZOGA 3Q8SB 4J9RA 2F9DA 5KFKA 4A8SA 3UWTA 2CAJA 3MM8B 3TNVA 2KH9A 3I9V9 4ECSA 1VQ6S 3ILOA 5J1EB 3WIVA 2Z2ZA 3DDIA 4IG3A 1O6XA 1WHYA 3JSMA 1WKKA 2GV1A 2OTLS 2NQPA 2KVIA 2WOMA 1KOHA 2PA8D 3BGUA 2K3KA 1VRTA 3RW6A 1FD2A 2YVSA 3EVMA 2FJAB 1FK9B 3FBCA 1TUWA 3IM9A 3NBPA 2BBEA 3I56S 2F5GA 1REVB 3SV3A 1HNXJ 1QAJA 1K0TA 3FSYA 2DGOA 2JVOA 4OYMA 1TVRB 1RTJA 1RAAB 3DM2B 2EBEA 1U09A 1SJ1A 2FLNA 2HGNA 4F7VA 2YKQA 2RS8A 2WSEC 1R8HA 1RJJA 4C11A 4TXSA 2MKCA 5B0EA 1UZHA 2DNMA 2XSJB 4NLPA 1AT1B 5D3GA 3C6UB 3RZAA 1PJ5A 2G1HA 4EEYA 1MSWD 3NCRA 3MCOA 4ZVEA 2QIFA 2ROEA 3N6LA 3LP1B 5G0RB 2I6WA 3ZZ0A 2C2MB 2DH9A 3TI0A 2WBMA 1KEKA 2XMAA 2K06A 3C19A 3GR1A 5HVGA 3WDOA 3S6EA 2A0FB 2N3LA 3PVXA 3GSDA 2WRMA 1JXEA 2DGQA 1O8BA 4TLRA 5KFLA 3UDLA 1UTAA 1V6HA 2Y1JA 1FFWB 3O5TB 2B4PA 2VA2A 2LP4A 2ZM6F 4OI2A 4EBCA 4F0HA 3OL6A 1YWXA 2DXFA 4V19X 3R5DA 2BJ9A 4DL7A 4X64F 1IR1A 2O66A 4RNHA 4FYXB 2C2KB 4TVAB 1B0PA 5KFFA 1VS3A 2M8HA 5SZTA 3I4HX 2M70A 1U2RA 4X65F 1VQOS 4I7FB 3FKBA 1DZ5A 1Z2ZA 1AROP 2VG7B 2AMCB 3KKFA 2BM1A 4F26A 4PKDB 2V4QA 2ZNYA 4ECWA 2BJ8A 3NGSA 4DV7F 3TARA 3M6VA 4DSKA 2ZHOA 5HLFA 1HNVB 3F73A 1EAYC 2APOA 4ZJQA 3BM7A 3M8PB 3QLHB 5F41A 3UCUP 5GAHU 2IC3B 5A6PA 2MGZB 2X1AA 4LF8J 4N76A 2IYIA 5KG2A 3WHIA 3UVJA 1JQGA 3QZ8A 2MDAA 1HNWF 2BKPA 2KXFA 2DHSA 1CQNA 4ID8A 1Y10A 2F8MA 2HZVA 4AUKA 1SB6A 3TUZC 2J7KA 5CYQA 2V9KA 4KGMA 3ISND 1J5OA 1R6YA 2J0WA 1A7GE 3OLBA 3RB6A 2UUCJ 3VHQA 2H3EB 1N48A 4J9LA 2I5JA 2F63A 1NJZA 3V2UC 1RLCL 4NYZA 2MZJA 1VOMA 5L1IA 2BRLA 1VFJA 3AB4B 2ATCB 1UEUA 1P9YA 2B8PA 4OYAA 1AB8A 2R8KA 1FRLA 2C2OB 4O3SA 2GO8A 4QWEA 3HHLA 3TA1A 4TLQA 4ZCIA 2JRSA 1R27B 2HS3A 4X62J 1NAQA 1OYDA 3Q22A 1BHNA 1G4CA 3HX9A 2CZVC 4DS5A 1NPRA 4CLZA 3FZ2A 1PYSB 4MJKA 1FDBA 1YI2S 2JEGA 2AJ0A 3NWGA 5CQGA 5I4MA 3VAGA 4DPWA 2I8EA 3DXSX 4NI2B 1UA0A 1RGVA 1DBDA 1WG5A 3NGTA 4B3MF 3EZUA 2DRDA 3CWJA 1N36J 1RWVB 2BACA 3C2PA 2RVJA 4U6PA 3ILIA 1L3UA 3KLHA 4F04B 2DHGA 2R3VA 2F9JA 2CDRB 5HROA 1X4GA 2BUNA 3MEEB 5HBMB 1FKAF 4YDXA 3ZNUA 3GG1A 5AE1A 1U1LA 3X3UA 4KT0C 3JAMY 2VKRA 5ETOA 4NEYA 2IRYA 1H7WA 1NXIA 3D54A 3ENWA 3FCVA 3KLGB 4J9PA 4F4ZA 2R8HA 2IVYA 1EQ0A 1KLNA 2EXUA 1FRIA 1FJEB 4BHQA 3HKWA 1NSKL 1NU4A 4GMKA 3OJSA 3U1LA 1VBKA 4DV5F 3TQ1A 1U6BA 2C2RA 1YGYA 2DIVA 4NRTA 2C28A 1QSLA 2GNKA 4J91A 5EN1A 3CCVS 2VPWB 4O3OA 4URGA 2XLKA 2M9KA 3H40A 1KQSR 3M1VA 4YMEA 5HJXA 1XQIA 4LF8F 3THTA 5LXRA 2BANA 4QU7A 2E5HA 3GP9A 3OR2A 4CO0A 3R5BA 5KFCA 5J2NB 5KT7A 3QAEA 4ZITA 1V9OA 5H1SV 1CJUA 3MFHA 4AL6A 3C66A 3QPIA 4JP8A 3SQGA 2YKMB 4X2BA 1REVA 2AZ3A 2I9SA 2CPXA 5KT2A 1TVRA 1OQ6A 3THPA 5K14A 5KFIA 4X64J 1L3SA 1PYTA 2OIHA 4WP8A 4UT4A 5FLXY 3PKYA 2DXEA 1EHWA 4RW4B 3ET6A 3H25A 1ZA1B 2PD1A 4HACA 4UOFA 4QR1A 1C0UB 3G6ES 3W66A 2JLGA 5C25B 3KOAA 4HKQA 1NKCA 1MNEA 4IQXA 3VF0B 4AYBD 3FEZA 2X1FA 3K8WA 3I32A 4LF4F 1U4BA 2HKEA 2UP1A 1TAUA 1Y9OA 4FZVA 2GX8A 4JV5J 5KG4A 3IC1A 1VQYA 1IBKJ 1V5IB 1Y5IB 1S9GB 5LJ5Y 2QEXS 4K0KJ 2R4FA 2RRNA 3D6HB 5ETKA 2HNYB 4EZ6A 3NEKA 4DU8A 4LSLA 1KQGB 1FDNA 2L9WA 1RB0A 2CNLB 2OSRA 3IAS9 2NPFA 3CIZA 3H2UB 3TZWA 1S76D 3CMQA 3I9ZA 3T5KA 1VC0A 3GTYX 4BC7A 2WVFA 4YR0A 5K9FA 4DFKA 4MK8A 3AB2B 5IS2A 1B7YB 1UWAA 3BZQA 5ETSA 1LW0A 1C2PA 1FX4A 3BBBA 1URRA 4F4YA 3CMES 4DQRA 2L48A 1HBMA 1U2CA 3Q8UA 3IR5B 1HLWA 1OSCA 1G3OA 1SL2A 2J8AA 2IVFB 5A2QY 3KLVA 3I87A 3OTCA 4FBTA 4HHUA 5IT9Y 3BF4A 3U02A 1KD1T 5HI7A 3SIPB 3FNNA 1IWAA 3OD2A 2QX0A 4O4GB 4O0IA 3KFWX 3DU5A 2N3OA 2XLIA 4DSJA 3TR5A 4I4BA 3DMJA 1UETA 3BN7A 4X4TA 1U47A 1I94J 1Z2LA 1JNZB 2LEBA 2Q43A 4YR2A 4CO4A 4LF2A 1G6BA 2XZDB 3NKYA 3G8TA 2LDYA 2YKNB 3GZ7A 4WTYA 4I6WA 1HD1A 4GO5X 1KR4A 4V1Ak 2MQNA 2K7JA 2MZTA 1F3FA 3K0JA 3AD9C 2V2ZA 1Q5VA 4NCGA 3ZC4A 4RNMA 4J9NA 3IWLA 2DNNA 3D3BJ 4C3LA 3PFOA 1JKHA 2XYGB 5GMEA 2B6AA 2KJWA 1YRXA 4CIOA 1ZTTA 4LF5J 3FZBA 2AHOB 2RNEA 3CCRS 2HQ3A 1S6OA 3N6MA 1VIOA 4NA1A 3QSIA 1QVGR 3M2UB 2XLJA 3DI6B 3JQKA 1CJKA 3JSMB 4ZP9A 3W64A 4RUCA 5L8RC 4KY3A 3RGIA 3W2WB 1S6UA 3D66A 4HHJA 2HHPA 4B02A 4JV2A 1C0TA 5KFJA 1IKWB 4KPCA 2LQ5A 3OR2B 4DUZF 1C4AA 1HPZB 1RABB 2HBRB 2IHR1 2RIJA 1E6YB 2G13A 2PIIA 1HL6A 2LXIA 4USMA 1B0TA 3MZIA 1Y3JA 1Y0HA 5D78A 5MLCV 3KK3B 3OLAA 1NK7A 4J9VA 2K8GA 4WWSA 1MMNA 5GAHI 3PYEA 4LRDA 4DR7F 2RS2A 4LF1A 1IN0A 4ETXA 2CPIA 2Z2LA 2R42A 3DXBA 3VWSA 3M8WA 3QIPA 5HMXA 3DHWC 1DQ9A 4NMLA 1TMJA 1LWCA 4C0HA 4G65A 1FCAA 3CDEA 4D3GA 1T05A 5J1PA 1QLNA 1N88A 3GYGA 1F9HA 1TELA 3M6UA 3BQ0A 5IOLA 4CLFA 3OXFA 2HBZB 4P6QA 1KOOA 4KHMA 3MAQA 3JSRA 4MFBA 5B09A 3MFIA 1X4AA 4DQPA 2F4VF 5LOQA 4J9MA 3PIOQ 3OSPA 2EC0A 4O4RA 3HT0A 4A47A 1B4SA 1JJCB 2MSTA 4U96A 5KT4A 3FSXA 4CWBA 4M5DA 2DHHA 1RTIA 3IRXA 2L08A 1HFEL 4PUOB 2B56A 1WF0A 1X4FA 1P9QC 3QGHA 4X84A 5ETTA 4Q5VA 1VQ8S 2YXLA 3BKFA 1F1BB 2R7OA 3RB3A 3HULA 2J0XA 4U7UK 4LSNA 4CI0B 1TU0B 1JKHB 3AH6A 3FMWA 4YY3F 3OXLA 1UWBB 5ETQA 2ERRA 2DR8A 3KMSA 4JI3F 4CYUB 3PW2A 1R8BA 1FEEA 1RADB 2HVDA 1EETA 1SV5B 3QT7A 1PGZA 2M2BA 4B08A 3SYZA 2PA3A 1XNQF 1MWZA 3IGNA 4N41A 2EKNA 3P5BP 1U24A 3HHNB 5HMWA 3MEDA 2GC8A 3GONA 4HEA9 3UW1A 1PC5A 3MF5A 1UAWA 3QBCA 5E33A 3NWRA 4CM0A 4I2QA 1TK5A 4A48A 2GGPB 2YKAA 4RU9A 3RBDA 4EBEA 1FWPA 4WP3A 3S7RA 4ELTA 1J5OB 2RD5C 4EYHB 2V8GA 3I0SA 4O44A 3PNIA 3ZZOA 4AD6A 3PR5B 3KLEB 1S1VB 1I1GA 4ZVHA 1UW4A 4RLEA 4X4SA 4B3RJ 2WSFC 2IJFA 4ELVA 1S59A 2RB7A 1U48A 3AY0A 3ZTOA 2Z30B 2FHJA 3V81A 2DBBA 5E3RA 1R8CA 2BW7A 2IAJB 4CO5A 3PYGA 3RBXA 2QFIA 2P5VA 4C7QA 4FXDA 1SC6A 3R9LA 1SXLA 2HNZB 3G6XA 4FYDA 3H4BA 4WXWA 1F2HA 2U2FA 4Y3CA 2ZH2A 2EVZA 4DG1A 5K5MA 1N6QB 3DRRA 2OPSB 1UKUA 3RG6A 4B9TA 4RBUA 3JSBA 2F40A 2B4VA 2MY7A 4RUAA 2CIMA 4IRCA 4FYYB 3IO1A 2G2OA 4JOUA 4GKJJ 4G1QB 3NXZA 5J2MA 2XZTB 2HQIA 2MQMA 2PEHA 3HSJA 4DPYA 4ZLPA 4KB7A 4Q45A 1VDHA 4LF9J 1H72C 5E3CA 5E2QA 5E5NA 5D77A 1BQNA 3KLHB 2HHTA 4J9KA 2XNQA 5F8LA 3TW0A 4NASA 5K8OA 2Q1LA 1REGX 1RTZA 3E8OA 3SFGA 4ZJLA 2NZ4A 2E5GA 2VFVA 1R43A 4GVBB 1HQ2A 2HS4A 1NK9A 3L95X 1HBUA 4BS2A 4UW2A 1YITS 3EPIA 2W9BA 2HLUA 4NLOA 1IKYB 1JLCB 2IDLA 3R5AA 1RXOB 2A3JA 3OFEA 4PXCA 5G0RA 1R89A 5KG1A 2VOOA 2E44A 1FTRA 4DL5A 3CJKA 2EPIA 3I96A 4B9VA 1F3VA 5CHCB 1VQ5S 4WPAA 3QRQA 2E9TA 3T5HA 2OJ3A 1FKOB 2ZBRA 2KB2A 3NBPB 4LIWA 4XPCA 3SDEB 3KDNA 3EGNA 2VF3A 1JJHA 2GW8A 4JI8F 4YFUA 5J2QB 2FQQB 4U7UD 2RU9A 4USVA 2PC6A 3CJRA 1EKSA 3HVAA 2XMWA 4KQZA 3GFHA 3GJTB 1HMVA 2BE2A 1LWXA 3MPUB 4IG0B 3TA0A 2IM0A 1DRZA 3M32B 2MTLA 1UEKA 3MD3A 1HWKA 2LMIA 2HK2A 1KTVA 1RZMA 2CKWA 2W4DA 5DLGA 3PW4A 3DOKA 2KT5A 1XTZA 1S5ZA 3P3DA 4YB7A 2NSBA 2ZVIA 8AT1B 3DFEA 4NXNJ 1FVQA 3AAWB 4P10A 2Y3YA 4D3HA 3GJSB 4ED3A 4DFPA 4MMOA 2W9AA 2NSCA 4DV3F 1NZAA 4J9QA 3O1LA 1VISA 3BB5A 3C46A 2OTJS 1SC3B 1KQKA 3EYZA 4K4VA 4DBQA 1YQHA 4DOZA 2HHWA 2QYGA 1LWEA 3DRPA 1HQEB 3W5XA 1KFSA 4IOAQ 4ZCKA 4WCEQ 5KFPA 3NL0A 1N5SA 4QU6A 4L72B 1HARA 3BR8A 3K5NA 1W26A 3IG1A 1CJVB 1RAIB 4DV4J 4CLLA 3MR6A 1J5EF 2FJBB 3DU6A 1RU1A 1GEHA 1Q8KA 5CYMB 1FRXA 3PDNA 1SH3A 3DRYA 1K0VA 2CQHA 3K5MA 2CJ9A 3OTDA 3IBCB 3IN5A 3HXMA 3HVRA 4JYAJ 3AQPA 2HNDB 2ROPA 3I0SB 4DR5J 3H8YA 5DJBA 1S49A 2KZMA 4DUTA 3MAHA 3G6YA 2N4DA 4ZVSB 4ECZA 5IC6B 1KP6A 1T0TV 2OMOA 4ECVA 2R2RA 3CCQS 2VU5A 4WYLA 3FSIA 4Y2IA 2HK3A 4U67Q 3KNGA 1N34F 5IM0B 4MH8A 3MM6A 1GXLA 5L1JA 1IR2A 1OSDA 3QAUA 1DURA 3PHEA 4ZDNA 4PG8A 3KHGA 3UD4P 3MEGB 2QGFB 4J9OA 2OO4A 2N82B 4OI3A 1HNXF 1GMWA 1UFWA 5IQQA 3W3SA 3K7RA 3LO3A 2ZHAA 2Z8QA 1R31A 3QJJA 2UXBF 4FF1A 1TL7A 5KOWA 4NLYA 2HMIA 1MU2A 1RTIB 2W7AA 3HHLD 2DKOB 1FDAA 2EG1A 2MJUA 2RAQA 4R0EA 1KDNA 4UF4A 3IXQA 1SUQB 3NS5A 3PX0A 3RB4A 5GMKa 3R27A 2YY3A 3M6XA 4NCGB 3Q24A 1L3TA 3G8SA 5H9EK 3TJ8A 1B64A 4OZ3A 5KT6A 2ADCA 1WWHA 2H5EA 2DH7A 3ZZRA 1RT4A 1S1XA 5L39A 2LCWA 3C15B 3NGDA 1DLOB 2EG2A 3G86A 2BE7D 3NG8A 4BWJA 1KS2A 4ZPWR 1G2EA 3L7UA 3BGRB 4EU0A 4A8YA 4W90B 4ZLLA 2HHQA 2RQKA 1KKHA 4QWAA 1QTNB 5J2NA 2GO9A 1U1OA 4K8RA 2KJVA 4MK7A 1TFYA 2BANB 2VDIA 4K7QA 4XDDA 4WK3A 5F8HA 3JAMU 1ZZFA 4OZ5A 4DEZA 2VPYB 3BSCA 4M5IA 1KQFB 2VZ9A 2IFXA 3GJRB 1WHWA 2VJVA 2JSXA 3PEJA 1HNIA 1SJ4P 3Q23A 3O3LA 3VGVA 1RUSA 3KK3A 2MKYA 3DOMA 4OHZA 3EDQB 2F8EX 2MYFA 3GU0A 3IWXA 5HL7Q 4FPIA 4NLRA 3TAMA 3MCNA 1HBOA 1TL1A 1NPKA 3BBCA 3HVTA 8RUCA 5M2UA 5DQGA 4JYAF 4NYPA 1DFDA 3N28A 1WI6A 1NDLA 3CUNA 3M2RA 1T03A 3AOCA 1K44A 4DPXA 1VQKS 2R2UA 2PMZD 5FDLA 1CEZA 2RF2A 4CLTA 2HBYB 1Q8LA 3M7VA 2XMJA 4OYOA 4P72A 3BQ1A 5DZ6A 2CNNB 5IQ6A 3RW7A 1JXVA 1X31C 2H4YB 2A1BA 2OPRA 1S0OA 4DR4F 4DPTA 3UI3A 3OHAA 2WVBA 3DDNA 3VGTA 3CC2S 4DV4F 4OYWA 1CULA 2OEKA 4OHWA 3MM8A 4FF2A 4M5LA 5I42A 3BN4A 1RP5A 5CH7B 3VAHA 2EFPA 4Z2XA 3WX8A 1NNDA 3MEGA 4WKYA 1NPPA 1NDCA 3FGVA 3W1YC 3T5LA 3K17A 4OX9F 1C0UA 3C16A 5KFQA 1XBWA 3ITHA 4OIXA 4YHHJ 1D9DA 1PYOB 5LSLA 1JLBB 3S1TA 5JMNA 5T14A 4A8MP 2HIYA 2V8DA 3GIMA 4LFAJ 1Q79A 3NOGA 4DQSA 1RYSA 3PTWA 1JNRB 1K9MT 2P2CB 2B8QA 3AODA 1FVSA 1VBZA 1PILA 4O3RA 1HA1A 5DDPC 5BR8J 2QLJB 3AT1B 2AYMA 1NKEA 4B3MJ 1M1HA 3RAQA 3JS9A 3ILJA 4XIUA 1HI8A 2NXCA 3CXCR 3QWPA 2DITA 2XMKA 4JI5J 3K89A 5CYQB 3KHLA 2KI2A 3OFFA 5EWFA 1B7FA 3TJAA 5BYQA 4JI2F 3DOMB 3QRPA 1S72S 4X4QA 4Z37A 2OEJA 2EK1A 1KLMA 1HHQA 1S79A 3MPVA 4H54A 4ICLA 3I55S 5LMNJ 1RT2B 5CYMA 4ZLNA 2C3YA 2DRAA 1WACA 3FEYB 4WIQA 4I6YA 1H0HB 3GFXA 3MMJA 5BR8F 2FPHX 3EGVA 6AT1B 4NLGA 4IOCQ 4DV6J 1GXUA 5M2PA 5F3ZA 3PACA 2DK2A 2GMJA 1D9AA 2G2YA 4QCLA 4OJ1A 1S0MA 2HWTA 4E2FB 2B7CB 3OR1A 3SCLE 4K4XA 1WF2A 3FEXB 4CM2A 4LFCF 3K8VA 3J80U 1S7HA 4PXBA 2CZ4A 3MECB 2B9XA 1HIYA 4DL3A 1U1KA 4PWWA 3D5MA 2ZH8A 4DR2F 2XEXA 5IV3A 4DR3J 1DY3A 2BE9B 3UD5A 3M32A 3OJUA 2UUCF 2BV3A 3HFKA 1RTHB 2VQEF 1KC8T 1XNRF 3M8YA 3TYTA 3R97A 1LEOA 1RWNB 2XWYA 1RWPB 4DL0C 4QIWD 1X9SA 3TUPA 4DDFA 4KGZB 4X4PA 1SIZA 1MU2B 5HQMA 2GIQA 3MM9A 1GAOA 1RT5B 2R7WA 4KJIA 2MQPA 4F3QA 2V2QA 4BWMA 2AKWB 1JLFA 1E6YA 1SH0A 4OI1A 3HK2A 2CJXB 4ZVQB 1HWIA 2CWKA 2XMVA 3B4DA 3W65A 2Q3PA 3KG0A 2NXUA 4CTAB 1X0FA 2IA0A 4P7VA 1VLOA 3G82A 1E6VA 2KYZA 2B9YA 2CQBA 4HH1A 2QMXA 4C11B 3G6VA 2ZC4A 3NRBA 1ZM4A 1E6VB 2A6MA 3QT8A 4ZP7A 3SSSA 2VPZB 1T9UA 3E51A 3T9ZA 4X65J 4NXMF 1RTJB 3DM2A 4NL5A 1JLGB 3Q8RB 5KFBA 2ZJQQ 3SEOA 4EUVA 4FKYA 2QTWA 4M5MA 2HIQA 3HZGA 4PR6A 3B82A 2DPJA 2WB1D 3M1VB 2XNRA 2VBXA 3RUBL 3W9HA 1NSAA 1C1CB 4IH7A 3QT6A 1S6PB 3FVYA 2GMHA 3KMQA 1AFJA 1JJ4A 2FIUA 3LUYA 4QR0A 1X0PA 4KSEB 3EPGA 1VQ4S 2KHCA 5KFXA 3OBIA 3CIMA 4JI3J 1T9YA 1VR6A 2X1BA 1F9FA 3IGVA 4DQIA 1ZPVA 3A3NB 4IFVA 5EGYA 4DF4A 3V5RA 4WF9Q 4AXIA 1WEXA 1SJQA 4CH0S 4Y65A 3J7YU 2HQDA 4DR1F 1SKSA 1H7XA 4HTIA 2YBVA 3F56A 4LRCA 3AD8C 2OPSA 3I82A 4FP9A 4OLOA 2R7UA 4NLQA 4C8NA 5HQ8A 1S48A 5DS7A 1RACB 5ETNA 3M8RA 4Q43A 1N54B 1BXNA 2R8IA 1IBLF 3L7PA 2G4BA 4K4UA 3LP2A 2QLFB 2UV8G 2E7XA 2RQCA 1S1WB 5I3QA 2C3PA 4RW9A 2GQ2A 1NHVA 2IAJA 4NLVA 3T41A 1KONA 2BJEA 3JXOA 2LLZA 1MMLA 4FXVA 2OPQB 3DGPA 3W5ZA 3ZZZA 1ITPA 3PJ9A 1RTDB 1TL7B 2MZRA 2D74B 4RPFA 4YUDA 2UXBJ 2ZITA 3T3FA 4EZ9A 1K1QA 3M2VA 2OELA 4OZJA 1BUXA 2HRTA 2XULA 2AYEA 3HO1A 1GXTA 4B3OB 1P1TA 3D0HE 3G82B 1FXDA 2V0NA 4L3NA 2DY9A 1L3VA 5LL6d 3OTEA 3MXHP 3I0RA 3KLEA 5ETMA 3M2UA 3I0RB 3BJYA 1ZM3A 3OPKA 4ECXA 5KFWA 3M9OB 2KKHA 1UVKA 1IVZA 4QIFA 4PRFA 2BZ2A 4ED2A 2BR0A 1T11A 2ZEJA 4OX6A 3UDVA 5KFOA 1UVMA 4GKJF 1CG2A 2HQFA 4USHA 3N01A 2CNOB 4Y0FA 1Y5LB 3KJNB 4A46A 1YRTA 2B9WA 3MEDB 1JWWA 4LMZA 1FFGB 2HVHA 2CJAA 1FHTA 5KFHA 1BE4A 1IR0A 3DRSB 2GQQA 4R25A 4WBFA 2PE8A 4OLPA 5M2RA 2CQDA 1IKYA 3TZYA 1FRKA 2LVWA 3GR0A 4RKUC 5LXYA 4CO1A 1FJ7A 3BV8A 4PUOA 2BJ3A 2CXEA 3DN9A 2DGTA 4ZHRB 3UFCX 4NXMJ 1X60A 2NS1B 2GFFA 5AXNA 4A8WA 3HD2A 4DUZJ 1JX4A 2EFNA 4EI2A 1ZM9A 3P8BB 1RK8A 2CG8A 2MHEA 2VG7A 1T03B 2VV5A 3AJ2A 4ZPCA 3V6KA 3HCXA 2JLEA 4RW6A 4OYXA 3H5XA 1B3TA 1EQMA 2IA6A 4QPXA 1U0SA 4WYWA 1D09B 5LM7E 5F8NA 3CTRA 5HMYA 2ZH5A 2B0GA 2PI4A 2X1GA 2JEIA 1FKPA 1I94F 2ACYA 4DV3J 5JVHQ 1Q53A 1RT3B 3B6BA 3GIIA 1Q86T 2XYHB 2WZ1A 4L73A 4ZIVA 2BA9A 2Z56B 1ZM2A 1IM6A 2Z4PA 4EK2A 3PFEA 3E2EA 3DRRB 3HF5A 2AJ2A 1U45A 5DDOC 1FTCA 3EXCX 4OI4A 2V8VA 2UU9J 3KJVB 4IKAA 3B4MA 1VJQA 3R7SB 5CYJA 1NB2A 3ILLA 3SCKE 3VR1A 4DN0A 3MUTP 4WP9A 1PO6A 1RT1A 4Y00A 2AEFA 4K50A 2DNRA 3D7SB 1AW0A 4M94A 5HN0A 4ED8A 2EBGA 2CFXA 2E5IA 2GVZA 1M0SA 4OHYA 1FDDA 4QPTA 1Y5NB 2W7OA 3HVWA 1S1VA 3BR9A 3HMJG 2DTJA 4MYTA 4DN9A 2HHUA 2VBYA 1G7CB 2WB4A 3BKUA 2XGPA 1W2BR 4ZJOA 3QGGA 2K3IA 4ZPAA 2DR5A 4ZP6A 3RBEA 2ZOMA 2ZFHA 2QL7B 3NP5A 4QYZK 5E3QA 2W9BB 1VRUB 3CCWA 3FDSA 1T9VA 3Q89A 4I56A 1Q78A 3IBWA 5KFSA 3A8IA 4QBUA 7FD1A 3HFVA 2XQCA 1QUPA 4X66F 3OTBA 1V3RA 1FWLA 5F8IA 2V8HA 2MXYA 1BQNB 2GS8A 3DLBA 1Q95G 2YKMA 2XMUA 2FTRA 1CS4B 2X3DA 4ENOA 1S1UB 4LFAF 1XN9A 1SL0A 4LRFA 2ZC3A 5DGAA 2XY6A 4FN5A 4H4OA 4PPDA 1SJ3P 2UXDF 1KTQA 3IRXB 1SPBP 1IKVB 1PG5B 2DGUA 2N7YA 4Y28C 2CNKB 2P9CA 1LWFB 1X5OA 2HNDA 1YSJA 1DTTA 1DJ0A 3V6DA 2ATLA 3CJTA 3CDWA 1QSSA 3M2VB 3WZ0A 3KLIA 2FGOA 3TUIC 4FF3A 1EB0A 1MWYA 3PHTA 3D3CJ 2HFUA 5ETRA 4ZVFA 1ULRA 1LK5A 2DO4A 1HBMB 1YJ9S 3MDFA 4JI1J 1WKJA 2P8IA 2OPPA 2WVDA 1FNMA 2YNHB 1LW0B 1LWCB 5HQLA 1TKZA 2K1RB 1U0HA 4ZVPB 5A2QU 4K2JA 3TZZA 4UY8T 4KV8B 2H48B 4EO6A 2HRUA 2VC0A 5IXUA 3FMBA 2OMLA 3G9CA 1IQZA 3R7BB 3AOBA 4PWDA 4XDCA 5AJ3F 2G1DA 2MZQA 2YQ1A 3MMBA 3RRHA 2QLXA 1HPZA 2HGLA 2YX7A 2MKHA 4C97A 3ISZA 2XMTA
chains in the Genus database with same CATH topology
3TANA 5GADI 4NCAA 3SSQA 3TO8A 2WCXA 5B0GA 5AXMA 2MZ1A 1FRJA 2VQFF 1NEEA 1N56A 2QT7A 2ZDOA 5C25A 1HR0F 4ZA1A 3DOKB 1TKXA 2JL9A 1QVFR 4M8LA 4Y6IA 1TV6A 2RF2B 4LJMA 3D1OA 4N5SA 3VAMA 1ZPWX 2ZH9A 3T5HA 4IG0A 4F25A 2D9PA 1TKTA 2SXLA 4MKAA 1M5PC 1OQ3A 4NLUA 2JOQA 1U1NA 2AV5A 5DM6Q 4JI6F 1XR6A 4QR2A 1NHUA 5G4DA 5LJ3Y 3PIPQ 1Q82T 2MY8A 4Y2CA 3G4SS 4F3OA 3BDEA 1F5BA 2UZAA 2DR9A 1YJTA 2O1PA 2YNFA 5HMZA 3T1AA 3ZFVA 4C0BA 4B9SA 1X7VA 4TYAA 1RT7B 4DUYF 2BOPA 2IC3A 1RKIA 5F0WA 1KRPA 2FLPA 3BSOA 3VAIA 1XK8A 3LAMA 3GV7B 1QM9A 1HBUB 3IG1B 4F50A 2C2EA 3Q2TC 3NMAA 4ZOSA 3BO3A 3O2IA 1IJEB 1Y00A 5A6WA 4X4OA 1XEZA 4DJBA 4YDDB 4ECTA 1FE4A 4KFBA 4RW8B 4B9LA 4O3QA 5BYRA 2GQCA 4PG7A 3MM5A 4N77A 1FJGF 3GFZA 1GH8A 5JJBA 1BD6A 1UP1A 2M52A 2DNYA 3OR1B 1IKWA 1N0VC 2HHHF 4EGLA 1XERA 3TAPA 1VQNS 2VBWA 3MTKA 2KN4A 4R5PA 1NK0A 5JXSA 2QSWA 2W24A 4HYKA 4RW6B 4DG1B 1HQUA 3QGIA 4KIAA 3CF5Q 1HHSA 5IZHA 3LH2S 5HO4A 2FY1A 2MKSA 2B4UA 2Q66A 3OVBA 4LF5F 1AFIA 5D3GB 1QUVA 4ZHRA 2QE5A 3D0GE 2VG5A 2FD2A 4FBUA 2EFQA 2B7BB 2DIUA 3NS6A 4EYIB 2BQUA 1UL3A 5KFRA 1X9MA 4IH6A 2CPZA 1GTHA 1JLFB 1GTEA 3VZHA 3E01B 1Q81T 4DL2A 3M8SA 1R7IA 5A8RB 4U7CA 2A2DA 2E1RA 1OPZA 3OL7A 2WHOA 2CPFA 3H2VE 3DC2A 4GC7A 4V19J 2IM3A 5ADZA 4QWBA 5AE3A 1CVJA 4B3OA 2KFNA 2MSSA 4XK8C 3B8HA 5MAOA 3L09A 4NXNF 4UQTA 2XY5A 1KVIA 2PSZA 1EETB 1SV5A 1ZTWA 4BCAA 4DR3F 2ZBCA 1M5HA 3HHDA 3HI9A 3H59A 1CPZA 2AWZA 4TU8A 2QA2A 3QLHA 4X2BA 5D4NA 3K2YA 5A0YB 1FXRA 5F9NA 4PCQA 3ZZYA 2FJEB 3OQ2A 2ZD1A 3M30B 4OZ0A 1TKDA 2LQ9A 1TR0A 1O51A 3CCTA 2YNHA 2HHSA 4DPOA 1K8AT 4IQMA 3ETOA 4H4KA 3DLHA 3CE8A 3R5CA 4YP3A 4MFBB 3GIJA 1KLMB 4ICLB 2YH1A 2J9DE 3CDUA 3POTA 4ILLA 2MJNA 3DLJA 5EWEA 4RNNA 1TUVA 2OFHX 1GT8A 3MM7B 2KG1A 3D2WA 4A8FA 3PJWA 2DNZA 4IFVB 3ZZPA 4K4YA 4AL7A 2MKIA 2P6TA 2RJZA 2E9RX 1C1BA 1KHVA 4CT8A 4KHRA 3Q0AA 4ATNA 3VAKA 3THVA 1NKBA 3PZPA 1XWLA 2XWXA 3VALA 2QLWA 5E41A 3P6YC 2CDQA 1JLBA 2C3MA 1DTQA 4YHHF 2ZH1A 5FD1A 1N5YA 3DLGB 1IBMF 2J6TA 1HNWF 1DLOA 4WXOA 2DGXA 2XC9A 2YNGB 1VQPS 2FJXA 3CJKB 3N5BA 3CCUS 3SV4A 4URQU 2XS7A 1D3WA 4QJVA 1JLCA 1HI1A 2OSQA 1GQEA 4QQBA 2A10A 2ZZNA 1TP7A 3L3CA 4EBDA 2JFKA 2I5JB 2HW3A 4JBCA 1DQAA 1U6ZA 4AL5A 1HQUB 2C3OA 5GAGI 5KG3A 1S97A 2KZZA 1TV6B 2YKPA 2DGWA 2X3GA 1RTHA 4G1QA 1V3ZA 3HHKA 3R3TA 5IM0A 1ZAWA 2W8KA 4RUHA 1F5CA 4C98A 4HI2A 2LU1A 3CD0A 2YKNA 1B0VA 3MMBB 1QE1B 2GA7A 2WAQD 3PO4A 2JZ5A 4KTQA 3JTNA 3MMCA 1MMDA 1H38A 5EWGA 3SZ2A 2DNLA 3PO5A 4F2SA 3FCHA 2WBRA 1BQMB 2LQBA 5I3UA 2PFFB 1WF1A 5ITHA 1WHXA 2RILA 2J9EA 2J7WA 1UJ5A 1JB0C 1FT8A 5D4OA 5KFTA 1WG4A 3T6JA 4WFAQ 3IRWP 3KLIB 2MKKA 3CJ4A 1IUJA 4OJ3A 1S1XB 1NRKA 5C24A 2D3OR 4DR6F 1DTTB 1S4FA 4C9DA 4I69A 4B3SF 3I4PA 3M6WA 2BDPA 5F0UA 4ECQA 5B0FA 3MI7X 3MEKA 4L6V3 5GAEU 1H3DA 3KHRA 2DR7A 5KAKA 2Z2MA 1SL1A 1P6TA 2GCFA 1ZAVA 3RAMA 4WE1B 1LW2A 4ED6A 2RQMA 3GILA 5EX0A 2E29A 3U7JA 4WFNQ 4ZCMA 2M3DA 2NYIA 2CJQA 3NCQA 5CZVA 2I1RA 4K4SA 2JX2A 3UR3C 1QAIA 4HT7A 1FK9A 1HMVB 1ELOA 5GVQA 3N6NA 1X4DA 4N8OA 1LV5A 3KTQA 2D9OA 2RT3A 4K4WA 3M2RB 4FS2A 2IMWP 2E66A 4LF9F 3GWCA 3NCPA 1JMTA 3CCJS 2EW9A 4OJGA 4RWXA 4RZRA 1XMOF 1FERA 4RW4A 4O23A 2POKA 1S1TA 4HI1A 3OTOF 2E5JA 3K5PA 1P8GA 4DHVA 4TQSA 3G96A 3B78A 2CQPA 2YNGA 4C8YA 1R3NA 4PXDA 3ISNC 2BABA 1RYRA 1N5YB 1SKRA 3GIKA 2B3TB 4P7TA 3SFUA 4OJHA 1A9NB 1RT1B 1Y7PA 4N8NA 5B0DA 2IM1A 2BJDA 2HAIA 3V6DB 1LKZA 3R1LA 2OH2A 3IR7B 3MMCB 1HNIB 1DAXA 1RA6A 1FNXH 1XMBA 2HWIA 1T94A 3KJVA 4NPOA 4NLSA 3BGRA 3MD1A 3ICLA 4TU9A 3LP0A 2JJ4D 3C6UA 4IH5A 2ASJA 3BEGB 1BGXT 4XPEA 2FVQA 1YJRA 5T41A 5C5JA 7FDRA 2DT9A 4O3NA 3FRZA 3MUVP 2RKIB 3MUMP 3QIDA 2GHWA 2RE1A 1TAQA 3MM5B 2W4PA 2VC1A 2B4OA 4KFBB 2ZVSA 2HHXA 1U7LA 4IR9A 2HMIB 2ZD1B 1H2VZ 5K8MA 1WD6A 2F3JA 1IKXB 4FVMA 1TKXB 5B7WA 3ZZUA 2BQRA 2DNOA 2QSFA 2PDAA 3H98A 3OV7A 2C3UA 2KO1A 1HI0P 2FHOB 4KO0A 4LT6A 3BSAA 2FVSA 1HYSA 3JSYA 5K14B 4IYQA 4LFBF 3FQKA 1CC8A 4C8LA 2FDNA 3F41A 1VQSA 4PQAA 2W9CA 2R7RA 4IR1A 4W92B 5D8HB 2DVIA 1FO1A 1M5SA 1SKWA 2CQ2A 2HFNA 2GIRA 2HZCA 1TFWA 3D1QA 3EUNA 3TVYA 2AD9A 1VMBA 1C1BB 3T6BA 4CNZA 4PXEA 2ASDA 5KFUA 4N56A 2NUHA 2XY7A 2QV6A 2P9EA 3EXYA 3K57A 5AXLA 3KK2B 2LEPA 3KG1A 2XCAA 4B9UA 5I3PA 5KFYA 4ZS6A 3NAIA 5EHHA 3OVSA 2AP6A 4ED5A 3US5A 3W2VA 2LXUA 2CPYA 2MQQA 4DF8A 2ZNZA 4C8OA 1UEVA 6FD1A 1W2IA 5KG0A 3IFEA 2RU3A 3OUYB 3MHYA 2MGZA 4HTJA 5DRKA 4C8MA 3DLEB 4WU3A 1SBRA 4ID5B 2CVIA 2VFRA 1Q16B 4OZNA 4IRDA 3CD7A 3G71S 2WW8A 5A0YA 2GJIA 3CCZA 1PC4A 2ROGA 4NOHA 2AJ1A 2ZDPA 1TKZB 2K1RA 2IRXA 4NLTA 4OI6A 1TK5A 3CDBA 4TY8B 4MIAA 5DETA 1U49A 1X5TA 4ZPTR 1J2VA 1M5VC 5EX3A 2RQ4A 4WZMA 2BE2B 1OWXA 1N5VA 1VIXA 2CQ3A 4HLBA 5KG5A 1MROB 2HLTA 3E3XA 3MOZA 4URSA 2XO7A 5J2QA 1UMJA 1HWJA 1HW9A 2M0GB 4Q2MA 1H2UX 3H20A 3BREA 4M63A 3E01A 4RX6A 5A8KA 4X4RA 4G6VB 5K8NA 3T1YF 1NJIT 1SI9A 4H4OB 3JB9k 1H6KX 3LW5C 4KC5A 3CCQS 4NCBA 1GNKA 5L9NA 5KFMA 2M7SA 4RW7A 3I6PA 1S1UA 1T8EA 1T95A 1JLEA 4IDKA 2DH8A 3S01A 4C3KA 2DB1A 3NL0A 3PW7A 3M9NB 1SQEA 2R8JA 4CTAA 1F5AA 2JEJA 4F4KA 3K5OA 3DLGA 2IBOA 3VZIA 3BGFA 3F44A 5C42B 3J7Z5 2MHNA 2Y1RI 5B0AA 3HM9A 2WOMB 4X4NA 1EP4A 2F7VA 4H4MB 2R7XA 4YR3A 2D41A 2COLA 2NLWA 2BRKA 3MPYA 1U6FA 3KK1B 3UCZP 3H5SA 4ALZA 5CA5A 5KFNA 1ZETA 1HNZF 1N33F 2DNKA 2HG4A 3SI8A 3LGMA 2ASLA 1WTFA 2VBZA 2XCPA 5IFMA 1S99A 2ZH6A 3OSNA 3SSRA 4WU2A 1S6PA 1R8AA 2CPJA 2MPUA 4WK1A 4JI0F 2IVMA 4C2MA 4K5RA 3BO2A 1N6QA 1V3SA 2J6UA 3U27A 3C6TA 2MQLA 5HP1A 3M30A 3DOLA 1S6QA 2VL1A 4CZCA 2YNFB 2E1MC 2FHKA 3LF0A 4A8OA 3O6QA 3DRXA 1RT4B 3CGIA 2XI2A 1VBYA 1ZOTA 4Q44A 1VC6A 5DM7Q 1U1RA 1YJWS 4KR0B 3C8YA 3DNCA 1AUDA 4QYZJ 1TKTB 2AJFE 1NK8A 1TK8A 2LEAA 1YG0A 2RDIA 3AJ1A 3N9UC 2M88A 3HDSA 4IRKA 3QO9A 3K59A 4P2SA 1IM4A 1RT6A 2XS2A 2KXNB 3VTIA 3RR8A 4CH7A 4RBVA 2ZE2B 4RNOA 2KG0A 4QIGA 4ZPDA 2ZKUA 3O44A 3DRSA 4NRUA 2LQJA 1HD0A 3I5AA 2VD3A 3M8QA 4NZ0A 2YWEA 3TA2A 2ZHBA 2IJNA 4FXWA 1QTMA 2AJQA 4NLDA 2I38A 4NZ7A 4XAKA 2MQOA 2KRBA 5IT4A 1HBNA 4YB6A 3UQSA 5L1KA 3BQ2A 2R2SA 2HFOA 4E8UA 1URNA 4PG4A 2YWKA 4TQRA 2DO0A 2HPUA 2Y0SD 4CQ1A 3PM9A 4MIWA 4O4GA 1M5KC 4EO8A 3UR0A 1FEHA 5H9FJ 5CD4H 4HL9A 4R5PB 5KTQA 5DQIA 3PW5A 5IWAF 3KWMA 2VG6A 3CMAS 2LYVA 2AQ4A 1L5UA 4Y2AA 2L9NA 1PSDA 5LMNF 3MMAA 3ENQA 3PEHA 1QAXA 4ZPVR 3ULHA 2OD6A 5KFVA 3PRBA 4ITSA 3GQCA 3DRPB 2UVVA 3X1LB 1APSA 4R8UA 3TRGA 1LOUA 1X8DA 5DG7A 4AFFA 1K73T 3CCSS 1N0UA 1RWUA 3AA8A 2EFGA 5J1NA 2FJWA 2CQ1A 1FKPB 2KHDA 4I64A 5U47A 4FVCA 3RRGA 2CYYA 2ZKTA 2B51A 3W7BA 4PQUA 2ILYA 2DISA 4OX7A 2RMLA 2ZH7A 4IFYA 2AU0A 1QJHA 4KKOB 1VRTB 1WEYA 2B5JA 2UUWA 3GYXB 4KBIA 5L1LA 4F4XA 1X4BA 1VK3A 4FNIA 3W2WA 1ZH5A 4YB5A 3DLLQ 2E9ZA 3S8SA 1GX6A 4IG3B 2JDJA 2EWHA 1S77D 4USIA 1JLAA 1S9EB 1TQLA 4FPRA 4EBCA 4I1TA 4MIBA 4UUWA 5FDLB 3BS9A 3VAJA 3HHLC 2K7KA 4X4UA 1RDRA 4J37A 5H9EJ 2YX1A 4OZLA 3PV8A 3HJFA 2W25A 1VGYA 2A18A 5D4LA 3TAMB 4NX9A 5FIIA 1LK7A 2BYCA 2FC8A 3TVKA 2IM2A 2L9DA 1SH2A 3CJ0A 4F4WA 5T7LB 3KHHA 3V6JA 4NLWA 1VQ7S 3FFIA 1DTQB 4DV1F 2PI5A 3H4DA 4X4VA 1TL3A 4DSEA 2BXJA 1Q7YT 4HH0A 2GJ2A 2XZWA 4WKRA 2BM0A 1RT3A 3TVZA 5LSRA 5DGBA 1Z4UA 1NK4A 2L3MA 5KOXA 2FVRA 3T1HF 5GAEI 4TN2A 1RTDA 5HP1B 1JK9B 2DNHA 4DFMA 2LDIA 4WIIA 1ZZNA 2AX1A 2ZH4A 2I2YA 2UUAF 4MKYA 5HLFB 2FJDB 4J9SA 3MPWA 2RUGA 4OQJA 2DCLA 3NLCA 2O3DA 4LSLB 3OHBA 2AGPA 1LXJA 4OZ1A 2VONA 2DD8S 2N7CA 3DLEA 2KTQA 3IWNC 1VQMS 3VCDA 2J5AA 1W25A 4KE5A 2V4JB 3DYAA 3UCGA 4CT9A 1NB7A 3OUYA 1WHVA 3KK1A 1NH8A 1O0PA 3O8WA 4A4JA 3GG0A 4WFZA 3K58A 3PJXA 2WONA 3L7OA 4I68A 2DPIA 1Q8BA 2GMLA 3MM6B 3JTPA 2AJ4A 4I2PB 3MGJA 1FF2A 2ZZMA 3LP1A 3CO9A 2AX0A 4A8XA 3CC4S 1WTBA 2L41A 1LXNA 3P5TL 2XSJA 4A8KA 1FA0A 3AHPA 3CEDA 2KM8C 2JWNA 2KM8B 2VG5B 2HGMA 2PN6A 4NA2A 1YJUA 2NUUG 4DR5F 4ZCLA 3WC2A 4KRWA 5I42B 2JC0A 2DNQA 2XGQA 2C2DA 1FXLA 4ED7A 3RTVA 3MM9B 4GO7X 1Z1ZA 2LA4A 2FHMA 2VFTA 4M5DB 3M8PA 3UPFA 4KPYA 4ED1A 3QGPA 2B5JB 2KT3A 3DDKA 1CQMA 3LP2B 2QA4G 2HYIB 3PR4A 4ES1A 1HHTP 5DLFA 1VHFA 1SJRA 4I7FA 1ZAXA 3MWBA 2E7WA 2MB0B 2RH3A 4LVOP 4Y34A 1JLQA 2P6SA 1TZ0A 4IOBA 5HROB 2RKIA 2JHEA 4ED0A 3CD6S 3KLGA 2MMYA 1NJWA 1X5SA 2ZUGA 4HDGA 1KNZA 3OL9A 3RRKA 1FJCA 1G1XA 1HW8A 3PW0A 3LANA 2E1CA 4ECYA 4KHPF 3PX6A 3LGNA 1C1CA 3D1HA 4TY9A 2CPDA 4DV2F 4DFJA 1T3NA 1DHMA 3I5CA 2OFGX 3JYTB 1MW7A 1X4HA 2B43A 4ZPBA 1YJVA 5D6GA 2DJWA 1CC7A 4G1IA 1FRHA 2PMHA 1FKOA 1M90T 3LAKA 4QWDA 1YTYA 3KK2A 1U1QA 4RW7B 4CCHA 1VJWA 3WC0A 4F8RA 5A8RA 3G8QA 3LWMA 3N4WA 4WZQA 2YH0A 2JH3A 3MR5A 4E0DA 1LFWA 4UY85 3SXLA 3Q8PB 5E3AA 4QW9A 1SJFA 4TNOA 3KYLA 3TX8A 1U8SA 3NNCA 4K0KF 4M1KA 3A8EA 4DSIA 5F3TA 2DHAA 5THWA 2JFDA 3QWUA 2QYCA 1JXLA 1UVIA 2D7SA 4OL8A 5D4PA 2WONB 3VQTA 1UVNA 4EFAC 3NNHA 2HFZA 4CO3A 3QJPA 3V4IB