2NQTA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis at 1.58 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
346
Chain Sequence
VANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHPHLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAVWERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGYPTAALLALFPALAADLIEPAVTVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of N-acetyl-gamma-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP(+).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
total genus 115
structure length 346
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2nqtA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nqtA01
2PH3A 3S2FA 4BO8A 4CMIB 3GVPA 4LRSB 4PLYA 2OUIA 1SPXA 2Q46A 4DRYA 1AHHA 2O2YA 4PLZA 4S3MA 4H15A 4FFRA 4N5NA 1N2SA 2WJPA 1CEQA 1X1TA 1NQAO 4R1SA 1LRKA 4BNMA 3SVTA 2RIRA 1VL8A 2JKVA 2DUWA 4LW8A 5JAMA 1PU2A 2YHIB 4YCAA 4QECA 3ZWXA 3H8VA 4BO3A 3OJLA 4D3DA 4GWKA 2J6IA 2O3QA 4J1TA 2GERA 3D4PA 3ON5A 3ZW9A 2BGMA 1X14A 4J4HA 3HB4X 4E12A 3E5RA 5COBA 5A05A 1V0JA 1GFSA 1YL5A 2OP0A 3FN4A 3IS3A 1SOVA 2C5EA 1MB4A 4E5PA 4Z3DA 1K0UA 4WLUA 1V6AA 4IS2A 1ZBQA 1E6UA 3UICA 4DREA 1ZKMA 2FY8A 3NGLA 3WBFA 3E5MA 2AA3A 4GLOA 3AOEA 1Y5RA 4BNHA 2GZ1A 4U7WA 3VOSA 4BGVA 1XEAA 4D79A 4PG8A 1VC2A 3BMCB 3WJAA 3KZVA 4MKRA 3GLQA 5L4NA 1YH3A 2UDPA 1W8DA 3MJSA 1CRWG 3ASUA 1QLJA 4BMNA 4GL4A 4TZKA 1T2FA 3H5NA 1R0SA 3I4CA 4DC1A 3LDHA 1LDMA 1F17A 1V9LA 2PK3A 4PLPA 4FCCA 3P7MA 3WYBA 2WM3A 1GQ2A 2I6TA 2QW8A 3JYLA 3PP8A 2H1SA 3ZV4A 3K96A 3GZNA 5A02A 3RU7A 2JHFA 2O50A 4FOSA 4M89A 1ZZEA 3K5PA 4CM8B 3H3JA 3PDJA 1YOVA 4IJKA 4UVIA 5DNAA 2HDHA 3AY3A 1KC3A 4HNHA 1C0PA 1HF3A 4R68A 3EHEA 1BDMA 1OZAA 1U5CA 4GGPA 3OJOA 1XYGA 1E92A 2WEKA 3BZUA 3AM5A 1KETA 3Q6IA 4M8SA 3STHA 4BUCA 5F5NA 3IOYA 3KYBA 3W6UA 2FSVA 2BELA 3ZWOA 1PS8A 2P9GA 4BGIA 4QFCA 1YE3A 3I23A 2G76A 1E3SA 2QHXA 4ILKA 4QO7A 1HDRA 1I3LA 3AI3A 1I3NA 3P2YA 4UUMA 4W4TA 5DCWA 1ZH8A 1UP7A 2DPHA 3NTOA 3H65A 2YZ7A 5ER9A 1PL6A 1JU9A 4FGSA 3E9NA 3LT4A 3WR5A 3S2GA 4BNTA 1T24A 4RF5A 2G17A 3JSAA 1GYPA 4PVCA 4CQLB 4A26A 3G1UA 1P9LA 2B5WA 1WMAA 5TT1A 5BNFA 3KEQA 3WFJA 4LMPA 1EVYA 1JW9B 1RM0A 1E6EA 1M2WA 1PJLA 4DQUA 3K9QO 3RBVA 3RFVA 4KWHA 4YBZA 2GO1A 2RHRA 1NVMB 1GUFA 4QQRA 1HE2A 1BSVA 3EW7A 3QIVA 3H7AA 4B79A 4PLHA 4XX0A 4A0SA 5AVOA 4PG7A 3WGHA 2YDXA 1I5RA 3M1LA 5EINA 5CAEA 2UAGA 5JYFA 4Q3DA 4XGIA 3IQDB 2C5AA 1DIRA 1LTHR 1NVGA 1T2EA 3PLRA 4XGNA 5DOVA 3G49A 5IJZA 1J0XO 2R00C 4BNFA 1PR3A 3F46A 3W8EA 4HX5A 1PZEA 3D3WB 4B3HA 5L4SA 1QSGA 3K8ZA 1NWCA 4TSKA 2CVQA 3SC4A 2X1HA 1JAXA 1GYQA 5L53A 1ULSA 4R54A 4WNIA 4OSOA 4FW8A 1VKNA 4OH1A 3IP1A 4ALMA 4JJIA 5HBRA 2GR9A 1NP3A 4BNYA 2O3RA 3WBBA 2FMUA 1LI4A 5G0TA 1TT5A 2YY7A 1FDSA 2Y05A 4Q9NA 2O7QA 2VUTA 5G4KA 4AJ1A 3WTCA 4I5EA 1HEUA 2UV8A 5A1TA 3H3FA 2VZ9A 4NIMA 3MJCA 4R51A 2X9GA 5U9CA 4R41A 4RLHA 1K3TA 3PYXA 5JS6A 1PZFA 4DLBA 3D64A 2VYND 1RM5A 2XXJA 4IBOA 3IUPA 5ADHA 1HXHA 4ZJUA 2EXXA 4AJEA 1N7GA 4CPDA 3S2IA 1P0FA 4WLEA 3EZYA 1E3EA 1GV0A 5TC4A 3QWAA 1TT7A 2A4KA 1PJBA 2G5CA 5ENVA 2EERA 1LRJA 3ONFA 3DZIA 1FXSA 3QWHA 5JBIA 4D3SA 1EK5A 4KUGA 4TRNA 4NBRA 1H2BA 4G2NA 1HDGO 4UUNA 3UKOA 3RIHA 1A7KA 1Q0LA 3R6DA 1E1KA 5T64A 3WGYA 1Q7CA 5JO9A 4NI5A 3B20A 1KEVA 5TT0A 1JKFA 3CXRA 3RI3A 5ICSA 3T4EA 1UXHA 1YQDA 3KV3O 3JQGA 1WDLA 4RQTA 4R3NA 1FMCA 2EGHA 4J4BA 4Q39A 4CM7A 1L1FA 1XR3A 2V6MA 3VZQA 3ICCA 4D45A 4NBWA 1UZLA 3Q3CA 1JWAB 4E5NA 3UW3A 3ETGA 2EKPA 2BH9A 3RBXA 3ZNQA 4CMHA 5L40A 5G0WA 1VJ1A 4F6LA 5I9NA 1MP0A 3L4SO 1P44A 4CMJA 2NU8A 1Q1NA 3JQFC 2PTGA 3LC7O 4RLSA 3OQ6A 5HA5A 1AGNA 3UCFA 1C1XB 2AEFA 4GMGA 1WDKA 5DBIA 1IY8A 2PKRA 4DQVA 1HZJA 1E1MA 1WXDA 2HMSA 4CM4A 4NJMA 1B16A 1U4OA 2IZ0A 1I2BA 1EK6A 1MXFA 2P4QA 3BTOA 4L75A 4D0SA 1R12A 4IDFA 2PZMA 3ZHBA 3FI9A 3DBRA 5TS3A 4XIYA 4MVJM 1LDYA 4AVYA 1DC5A 1HYHA 1O6ZA 1P0CA 4FS3A 3ZWVA 4TRMA 5JYEA 3JQEA 4MDHA 2V6GA 3WGOA 1IHYA 2GZ3A 4MIEA 4I8XA 4OAQA 4CMEC 4BV8A 3GQVA 1ISMA 3WFIA 2WTBA 1N1GA 3W1VA 1F8GA 5T73A 4GSLA 3L0DA 3MEQA 2RHCA 2CVZA 4XZ3A 4RCVA 2IYPA 1Y5MA 4GX1A 2WYUA 4JX8A 4AG3A 2EGGA 1QORA 4ROSA 4HADA 2QRJA 2VHXA 5AXBA 4YRAA 2H5LA 1G6KA 5F3RA 2VTDA 1IE3A 4CM8A 1EQUA 2BFOA 4JP2A 1RJWA 2NQ8A 2NU9A 3KSUA 1OMOA 1GUYA 3C1TA 4IZHA 3EC7A 4CL8A 4ID9A 4E5KA 2WSBA 1DAOA 2XPCA 4BGUA 3JQ9C 2ZQZA 1ENYA 5JSFA 3UFXA 4ITUA 4ZICA 5A3JA 3DBHA 4GPD1 1GADO 1CF2O 4ND3A 5C37A 1X13A 3C7DB 4RVGA 5T5QA 1HRDA 1MUUA 3UUWA 4MKZA 3KHUA 2HK8A 3L4BA 4XEHA 2ZB4A 3WWZA 3Q9UA 3BAZA 2PA3A 4BO6A 3H4VA 4YRBA 1ZK2A 2VYVA 1R4MA 2NADA 3I6QA 4TZTA 2PGDA 4JBHA 3JYPA 4WJZA 2D59A 5A9TA 5COAA 2VRCD 1G0NA 3L6DA 5KKAA 4U0JA 3C3XA 4CMGA 2AG5A 2D5AA 1AHIA 3F5QA 3ULKA 4IGEA 3WLFA 1LNQA 1WAMA 4WLOA 3OF2A 4TMFA 2POQX 1PJ2A 4OOEA 4YDRA 3LVFO 1ZCJA 2CDBA 4UREA 3RU9A 5G4LA 3ITKA 3NJ8A 1HLPA 4IQGA 4AFNA 1N92A 1V3UA 2BGLA 4HFMA 4PZDA 2VUUA 4R1UA 4UVGA 2BMAA 5A06A 3RVDA 1ZEJA 3OBBA 3KVOA 3K6JA 3AUAA 3GOHA 3BMNA 3GFBA 4XQEA 4BO2A 2YFQA 5G0UA 4E21A 2PNFA 2HSDA 3A06A 3RKRA 2GSDA 4U6SA 4L76A 4DL9A 3C1OA 1A9ZA 5CG2A 1DEHA 3VZPA 4ALKA 2ZQYA 4GWGA 4GX5A 4FB5A 2YFHA 2FOIA 2HMWA 5I7EA 3VDQA 4FQ8A 4XDYA 3PFWO 2PGLA 3TZCA 4GKBA 4YTEA 1R37A 2P2SA 5T8KC 2Z95A 4R16A 3KLMX 3PHGA 3TOZA 5TLSA 2JD2A 2WD7B 4IDDA 1QMGA 3G17A 4CR8A 3KB6A 5U1PA 1S7CA 1J49A 2DLDA 4M54A 2ZIZA 2Y0DA 5JPIA 2RBEA 2VHZA 2WWRA 2VN8A 2W90A 3K2BA 5F21A 4C7JA 3DBRB 1N1EA 1NYTA 1P45A 1U7TA 3EYWA 3I1JA 4BKRA 5LDGA 1U8FO 2ET6A 5FEUA 1I2CA 2DFVA 3O03A 3WQQA 2W98A 1DOHA 2H63A 3I9MA 1Z73A 4NNJA 2V65A 1KVQA 1NTOA 1JDJA 3F5SA 4IIVA 2DQ4A 4I9UA 1EUZA 3W6ZA 2I3GA 2ILTA 3FPLA 4U5QA 3F1KA 3HSKA 5KVSA 5EQFA 1LRLA 4XQ9A 2VHYA 1UUFA 1P1HA 3QE3A 1J6UA 1M76A 3ZWWA 3CMMA 2Y1EA 3H5AA 1ZVMA 1AXEA 1LDNA 2C20A 4A03A 2E6UX 3PJFA 5CHEA 4IMPA 5FWNA 3KYCB 2B5VA 1IZ0A 2VNSA 3P19A 1YGYA 4FFOA 3CIFA 2Y99A 1CERA 5IDQA 4DC0A 2NSDA 3F3SA 2Z1NA 4L73A 2VWPA 4CLRA 2XOXA 5KVQA 3RASA 3NX4A 3KO8A 3N7UA 3OIDA 3UCXA 1HE5A 4PZEA 1DIAA 1XQ1A 2X23A 2GGSA 5KJEA 3TZQA 3IL2A 3QV1A 3OECA 4PRLA 1R6DA 3LT2A 4XJTA 3RUHA 2AG8A 1OBFO 1HDOA 1ONNA 4J0FA 3CE6A 1YQGA 3ETDA 1O9BA 2JCYA 1M75A 1JVBA 4YJFB 1YVEI 2GD1O 1NR7A 1VE9A 2Q50A 3KM0A 5FF9A 1BW9B 1YB4A 3GUCA 1XKQA 2G82A 4AJNA 4NPCA 1R0LA 4DUPA 5KCZA 2OORA 4Q3CA 4H3VA 3B1KA 4N18A 5ES3A 1AUPA 3U62A 1D3AA 4OYRA 5TX7A 2AQHA 2HQ1A 3CPSA 4YJDA 1G0OA 1P3DA 3RC7A 1B26A 3SJUA 2VRCA 4NG5A 1X7HA 3VPHA 5IZ4A 2NV6A 4YQYA 2YHUA 1EMDA 1PJTA 4E31A 1ISJA 1ZXBA 2AEMA 3QVXA 4DXHA 5L95A 4OIMA 4GSKA 1NR1A 4CL3A 4R01A 1ONOA 1P1JA 4Z6KA 3V5NA 4BGEA 1X15A 2PKQP 3TZ6A 1WP4A 5L3ZA 3HFSA 4PLCA 4CLOB 4CUJA 1NVTA 2Q1WA 1JAYA 3FD8A 3RC1A 4WUVA 1VLLA 4GLLA 4TWRA 2HMUA 3GN2A 1EBUA 2EEZA 1I10A 4EUFA 5B4VA 3JQAD 4J7XA 4R1TA 2VWHA 4AJ4A 4BNJA 3JQ6A 2IXBA 4AJ2A 3LF2A 3VPGA 5CEFA 3HUDA 4KOAA 3E6AA 4YT8A 5EN4A 3F6YA 4DVJA 3AU8A 2R00A 1P77A 3SEFA 3DOOA 4AJJA 4J2OA 2VT2A 3U3XA 3Q1LA 1XU7A 3L9XA 3UH1A 5KTKA 3RC2A 4FIZA 2D0IA 2ZCUA 4ND4A 4CJXA 3EY4A 3H9JA 3GK3A 4GVXA 1H9AA 2Q22A 1KYQA 2FZEA 3Q9NA 4MPDA 1DFIA 2R2GA 5TQVA 4W6ZA 3PQDA 5EL0A 4WECA 1ULUA 4Z3KA 3PYLA 3EDMA 3OH8A 4A7PA 3ZWCA 5JLAA 4TKMA 4RDHA 2PV7A 3C8MA 4FBGA 4IY1A 3NT2A 1F06A 1FK8A 3KOUA 3W8DA 5BSGA 1SZJG 1FJHA 4CLXA 4DGSA 5IZCA 1E77A 4CM5A 3DZBA 4II3A 1GDHA 1SEPA 1U3UA 2EW2A 1O5IA 4D3FA 1BVRA 3VVCA 1Z7EA 1PWZA 2Y93A 1PEDA 3WLEA 1K5HA 5GZ3A 4J2HA 2QX7A 3K92A 3SLGA 1ADFA 4IJVA 3ZDFA 4H16A 4CUKA 4JCOA 3U5TA 1N9GB 3I52A 3LLVA 4L0QA 3GEMA 3RUAA 1YB1A 3GR6A 2RAFA 1VL0A 2WE7A 3NAQA 3RUDA 2EP5A 2I76A 4O6VA 2AE1A 3V8BA 3F9IA 4L4SA 5CDGA 2BRUA 3CINA 3EVNA 5KWEA 1C0IA 3GHHA 4E30A 4PLFA 3ABIA 1DIBA 2DBRA 3VVBA 1PJSA 3TQHA 4B4UA 1KBZA 3RUCA 5JCJD 3TF5A 4LCJA 1Y8QA 1U3VA 2X8LA 3I4FA 3Q0EA 1C0LA 2Q4BA 2X22A 3FNFA 3FTPA 4BHTA 3KYCA 2A94A 3QQPA 3PRJA 3QP9A 4B4OA 5HTOA 1ENOA 1ISFA 1SB9A 3GNQA 2G1UA 5HM8A 4Y6PA 1X7DA 1IPFA 5L7YA 4NK5A 2HRBA 4OQYA 3WGTA 1BW9A 2J5RA 3PHLA 3NJ4A 3GGGA 1DBVO 3LF1A 1E5LA 4W82A 4Q3BA 4NU6A 1Z6ZA 1UAYA 4CLDA 2V6FA 2VQ3A 4M1QA 5CPBA 2Q2WA 2DM6A 3OEYA 3A9WA 3GGOA 4H7PA 1GQYA 5AXDA 3GDGA 3DTTA 4W7HA 3QVSA 5EJ2A 4J6FA 4IS3A 2GZ2A 3F1LA 4XYEA 2EIHA 3KSZO 3VH2A 2I65A 3Q11A 2Y67A 4YAKA 4RPKA 3F4LA 3ROPA 9LDTA 1DJQA 1BXKA 1HSZA 4YACA 4G81A 4YPOA 1NFFA 1W6UA 4TVBA 3NYWA 5L7TA 5IDXA 3DZFA 3AW9A 4WE3A 1MV8A 4XGKA 1SNYA 3OP4A 4LK3A 4UVDA 4LSWA 3U4CA 4R69A 3BTUA 3G1TA 3BMOB 1XIVA 3KYDB 4MVJD 2A92A 4YJHA 4RJTA 3JQCA 4UUPA 1GQQA 2HKIA 3BHMA 1HDCA 3VDRA 4BKOA 2FP4A 2GDZA 4ZN6A 2JL1A 3N74A 4JXKA 2EG9A 2Y1OA 1PQPA 4OOFA 4WK6A 1YS4A 3SBOA 3W4KA 1GD1O 4A27A 2D5CA 2OOSA 2CNBA 1BMDA 2BI8A 3G0OA 5TJ9A 2BGKA 2IZZA 3BIOA 3EMKA 3RFXA 3EUWA 5JE8A 2SCUA 3NDRA 2Y1CA 1QV6A 3CMCO 2OZPA 3TZHA 3CKYA 4DQXA 5L7WA 4HBGA 4K1LA 3JQGB 1SC6A 4KQXA 2TMGA 5JAIA 4GGOA 3K31A 4OKIA 2WD7A 3PJDA 1Y9EA 4BOYA 2FSSA 5K6AC 4JN6B 4HXYA 2J3KA 3D7LA 4FJ1A 2ZB7A 1B7GO 1ISIA 1MC4A 3ZCXA 1ZK1A 3BHJA 4DBVO 1WPQA 1ZK3A 5LC1A 4LCEA 3ZNOA 4RQUA 1BHSA 2YUTA 1C1DB 2PZLA 4XYLA 1NNUA 4KWIA 1Y9AA 3MJTA 5DF1A 2VYNA 3A28A 3LZ6A 1BTOA 2O3TA 2O23A 3HZZA 4F6CA 4I5GA 3IUSA 3E8XA 2UUPA 1LSJA 5J9GA 2Y68A 2JJYA 5M6DA 3FWNA 1T26A 2NVBA 3DHNA 3GRPA 1AN9A 1WZEA 1N8KA 3TWOA 1LQUA 3UN1A 1NPTO 3H5RA 3HDYA 1H94A 3NKLA 1VRWA 4I1IA 2NUAA 5A5FA 3PQFA 4N5LA 3AI2A 4ESOA 4OMUA 3RD5A 2HU2A 2VUSA 3I5MA 4D7AA 3JQFA 4OJNA 4Z0HO 1YKFA 4BO7A 1R4MB 2P5YA 2PR2A 1H9BA 3FCOA 4O63O 3MWDB 4BNLA 4QFDA 2DPGA 2B69A 1K6XA 4ZU3A 4OQZA 3U4DA 3WOHA 4CM6A 2Q2VA 4E33A 1V35A 4ZA2A 5IAAA 1JWBB 4L4XA 3TDKA 1T1RA 5IFLA 2Q49A 3ROMA 1E7YA 1XWFA 8LDHA 3B1FA 2OFPA 4BL5A 4MVJE 3A4VA 1RYEA 1H0KA 3ZU2A 2O3UA 1H6CA 2TMDA 3NUGA 4E3ZA 3NTQA 3BMQA 3ZWPA 3S2EA 5A4DA 1SOWA 1BXZA 4CM4B 1U3WA 3GGPA 4N5MA 1HE4A 4PRKA 1SEVA 2O7SA 1ZFNA 2GN6A 2O48X 4YAJA 3SLKA 3ZGYA 1O94A 3ZHXA 4CR6A 5HRUA 5A03A 4EW6A 1YONA 3UAGA 4CODB 4QT0A 1CQIA 2ZYAA 1FDVA 2VOJA 4OGWA 4EITA 2P68A 1ADCA 3JYQA 3PPIA 2J3HA 3GUYA 3LC2O 3NDJA 4J7UA 3TNLA 4EJ6A 1KEWA 1QYCA 1DRVA 4DTIA 4IM7A 1LUAA 1Y7TA 3GFGA 1EE2A 5JCXA 2NU6A 5JDCC 1A27A 1IL0A 4BO1A 4MVJA 4DPKA 3KETA 1U8XX 2E82A 3VZRA 5DULA 1K89A 1ML3A 4A2CA 1ARZA 1HDYA 1UDCA 3V1YA 9LDBA 5G0SA 5ILOA 4I9HA 2CDCA 4CM1A 1WMBA 3BHIA 3R3JA 1GUZA 4DBZA 2O2SA 3CUKA 2W2LA 1P33A 4UAGA 3BTSA 4BMSA 4EJ0A 2RCYA 3WB9A 1PGPA 4NJMB 3PTZA 4FN4A 5TGDA 4RVFA 5I7VA 4RORA 4ALJA 1F14A 1ZO8A 3TFOA 4FFPA 4A5OA 3E03A 1NXQA 1GCUA 1V3TA 4NR0A 3QLJA 3ANMA 2E4AA 2OGUA 3INTA 1H6AA 4BO4A 1E7MA 4KMSA 2DTEA 3FPCA 3DMYA 4X54A 1EEHA 3S55A 1DPGA 1U7HA 3DBLA 5DCYA 1JTVA 2IDZA 3QWIA 2PWZA 5JY1A 3E9MA 3WX0A 4K9DA 1NX6A 1Y8RB 3G79A 3AFMA 4FJ2A 3GVIA 3CTMA 3TSCA 5IDYA 5I8ZA 4A10A 3S1LA 3QRWA 4J1NA 4EYEA 5A9SB 4F46A 3D0OA 4I9NA 4DIOA 4Y67A 1T25A 4BKUA 4J9UE 5FFFA 2ZJ0A 4WOJA 2YQ4A 3IJRA 3GVCA 2AXQA 1D8AA 4ZHSA 1E1LA 3OM9A 3VKVA 2E48A 3O9ZA 5EMHA 1UDAA 2BLLA 4GKVA 5CDUA 1CWUA 1ZJYA 3MJVA 3JQDA 4AICA 1DIHA 3RCBA 3WG9A 5GMOA 4CLOA 2ZK7A 1X1EA 3F4BA 2BFPA 1T4DA 4LSMA 2RH4A 3QJ5A 4W7IA 4BNIA 5I7FA 1RM4A 3JQBC 4MJLA 1E1NA 1QP8A 3AOGA 4YAEA 4PLWA 1DFHA 1IYZA 3L77A 1U4SA 3IKVA 5IF3A 2DU8A 4ZQBA 1A4UA 3MOGA 4EI2A 3GNSA 4TROA 1ZEMA 4O0LA 2EV9A 5A9SA 2W4QA 1DHTA 2HO5A 5DBFA 5KNLA 4JLWA 4PG5A 2AMFA 2YDYA 4CR7A 1S6YA 1PR9A 3DBLB 1KY5A 1CYDA 1BVUA 5G0VA 3MCVA 5BSFA 1E7SA 1PSDA 4R5MA 2BI7A 3DB2A 4YJFA 4C7KA 1KVRA 3GEGA 3ZN2A 3TFQA 2IODA 2JCXA 2ZTVA 3DMTA 1OC2A 1LSSA 2EJVA 5C7IO 1XHLA 1LC3A 5C7LO 4NHEA 2X4GA 1PGOA 2CVOA 3P2OA 5T67A 4BIIA 3RUIA 2Q1TA 2HK9A 5B4TA 3DR3A 3B1JA 3DDNA 4KZPA 1LX6A 2D1YA 3ZV6A 1UXIA 2PLAA 3JD2A 4ND5A 1LBEA 3PWKA 3GA0A 5T6BA 5L4LA 2AW5A 3D4NA 3GY0A 1ZK4A 4OHUA 3MZ0A 1Z7BA 3C7AA 3VC7A 3KSDO 4W9NC 4B7CA 3ORFA 1MXHA 3UVEA 1H2HA 7ADHA 5ITWA 4K6FA 2B36A 5C3MA 1IUKA 5IN4A 5L9AA 5F5LA 2ZTLA 4BKQA 3HDQA 1CDOA 1P1RA 1YBVA 4R4JA 2YW9A 4KTTE 4ZQFA 2I5PO 3A1NA 2C07A 4Y6SA 3DONA 3M1AA 3V1TC 5IXSA 2X9VA 2VZ0A 1ISHA 3TL2A 2FRDA 2OXIA 1H6DA 1YOVB 1Z45A 4MIOA 5JYAA 4GX2A 4Z0TA 1A7AA 4LN1A 3JQ7B 2CUKA 2NWQA 2ZYDA 5TRTA 3PQEA 1QG6A 5CDTA 4CV2A 2GYYA 2Y0EA 4B8WA 4NU5A 4FR5A 4N54A 1A72A 1DLJA 3I9LA 2JFFA 4U8GA 1PX0A 5EERA 1TVEA 3GG9A 4D43A 1YDEA 5AOVA 5L45A 1TLTA 2HUNA 3JQ9A 1AXGA 1E3LA 1NQTA 1HT0A 1DO8A 1GL3A 2VWGA 3BMCA 4JIGA 3GH3A 4YWJA 4YB8A 3WGIA 3C24A 1B8UA 3T4XA 3H2ZA 3X2EA 1NASA 3FR7A 3DAGA 4XYGA 4N7RA 3PWSA 5KIAA 1E3WA 1VJ0A 4XB2A 3U49A 3I9NA 4EBFA 4FC7A 4IQ0A 1GV1A 1XCBA 2HAEA 4UEKA 3AUSA 3DZGA 3M2PA 4AL4A 1PJCA 4WLNA 3DOJA 1TEHA 1F12A 1LU9A 4GMFA 2FR1A 2HJSA 1E7RA 4FFNA 4CUZA 3FBTA 1XQ6A 1Q7GA 4ALNA 2EKLA 3F47A 3OJ0A 4I08A 5KVCA 3GNTA 4Z0PA 3V2HA 3ZU5A 4CQMA 4RF4A 4FSHA 5TJHA 1EZ4A 2A9FA 4WCFB 4Z9XA 2PFGA 4ZRMA 2OL4A 3VKUA 2QYTA 1QYDA 1ZSYA 4RDIA 3PJGA 4II2A 1PJ4A 3OA0A 3L9WA 3WYCA 4G65A 3UF0A 2ZJ1A 4OSPA 3LLSA 3O38A 4DPMA 2ZTUA 1VJTA 1X0VA 2OHXA 3JYNA 3WIDA 2PH5A 2NVUA 2Y1FA 1EVIA 3ZHYA 2PZKA 4CM9A 1DC4A 5ICMA 2AQIA 3MJ4A 4Z9FA 1LLDA 3M6IA 5T8KA 4E5YA 4RF3A 4M55A 3EAGA 1SAYA 3QWBA 2QQ5A 3DBVO 1DXYA 1E0DA 3AY7A 2B37A 1NHGA 4IJUA 1EVZA 2YV3A 3IDSA 4CQMD 5DN9A 3NT5A 5AYVA 2HJRA 2GUGA 3IP3A 1HETA 5KOIA 3AI1A 3LSYA 4TVOA 1YRLA 3GRKA 4DWVA 5DP2A 4B4VA 1O95A 2I3AA 1EE9A 4OL9A 3WIEA 3QVTA 2X0RA 2GN9A 3ZWBA 4PCVA 1ZJZA 1PTJA 3DHEA 1G1AA 2ZYGA 4BNWA 1YWGO 1CJCA 4WGGA 5A3VA 3EVTA 1FDWA 2W2KA 1EBFA 3R3SA 3L6EA 2CSUA 3TPCA 2D3TA 4WCDA 4XQCA 1FDTA 3DEYX 4R9RA 3VH3A 3NGXA 4W9NA 4FFLA 3B70A 4MP6A 4UUOA 5IZCC 1XSEA 1FDUA 4FDAA 1DFGA 1YJ8A 2JD0A 2W2LD 3LK7A 1EVJA 4ALLA 4F45A 3PEFA 3WDSA 2PZJA 2I9PA 3FWZA 3AOEC 2J3IA 3QW2A 5LCXA 3HB5X 1VSVA 1ZW1A 4MVJG 4PG4A 4J1SA 1QXSA 4YAIA 1LDGA 2H9IA 4XRRA 4YR9A 3C7CB 2VCYA 4RF2A 2LDXA 3E9QA 1A4IA 2DTDA 4Y9DA 4RL6A 4BNUA 2XXBA 4EUEA 4QX6A 5L51A 5MGBA 3H6KA 3HDHA 3H9GA 2Y1GA 5U4QA 3HN2A 1D7OA 4DPLA 3CSDA 2OBYA 3JQ7A 4HY3A 1I2ZA 1O0SA 3KUXA 3JD0A 3RBZA 4WASA 1B3BA 2C7GA 3PK0A 5K6AA 3RAJA 3U4IA 3CEAA 3WXBA 1KERA 4PG6A 1ZSVA 1HE3A 4YAGA 3NEPX 2O4CA 2IXAA 1BG6A 4U6QA 5DZSA 3U09A 1J5PA 2CF6A 4BNKA 4URFA 5KKCA 3TRIA 2I66A 3GF4A 1RYDA 2Y0CA 5JO0A 2J8ZA 3M2TA 7MDHA 2WMDA 5GZ6A 2Q3EA 4DA9A 1DDOA 3D5TA 3KLPX 3DHYA 4WKGA 5JXWA 1Y6JA 4JNKA 4OM8A 1QYWA 3PIDA 4WLFA 3WWYA 3W4IA 1WDMA 3FNHA 4PLVA 4YJGB 1E3WB 2B35A 3I9KA 4BNVA 3LT1A 3VHRA 3A14A 4LMRA 2DUUA 2NNLD 4NMHA 5IXYA 4OO3A 4TKLA 5A5EA 3K30A 1U9JA 1JN0A 1A71A 3SJ7A 4UVHA 3RKUA 2P9CA 3PHIA 1R66A 4E2YA 2IYOA 1ZK0A 5B37A 1Q2XA 3WQRA 5EESA 2DBVO 3OQBA 3PHJA 4KTVE 1T1SA 2C54A 4YT2A 1LLQA 2D2IA 3JQ8A 5BSEA 4K28A 4R3WA 4J49A 3VPFA 3OIGA 4GX0A 4RVUA 2Y1DA 3INRA 4BNGA 1NQ5A 1IZ9A 1CQJA 4IDBA 5BNIA 4CLRB 2FN7A 3JQAA 4J90A 3QY9A 1PS0A 4XR4A 1ORRA 3ADOA 5ER6A 1KS9A 3OFSA 3DOCA 2XAAA 4JJFA 2X9NA 4B3IA 1CETA 3I83A 4NH4A 4HNGA 1X7GA 1GEGA 4EGFA 3FTNA 1O8CA 4S1VA 1LDEA 1HLDA 2Y66A 4XR9A 1MGOA 1H5QA 1DHRA 2X0IA 1OAAA 1TI7A 2FPPA 4FJ0A 4MVJH 2YYYA 2PD4A 3ICPA 1SBYA 5JY6A 1W0CA 1M6WA 3D3WA 2VYVD 4J1QA 2ZKLA 3VTFA 3D4OA 4EDFA 4FOOA 2EJWA 3PJEA 2AQ8A 4NDNE 1GTMA 2X7HA 4QO8A 1R4NA 1ADBA 3FSRA 1MLDA 4MVJP 1B8VA 3HADA 1DJNA 1LLUA 4UEJA 1XA0A 4CM3A 3HNPA 1LLCA 5DBGA 3ITDA 2V7PA 2QRKA 4RPGA 4RPHA 4PZCA 1SMKA 2B4RO 3QHAA 5CDYA 2CY0A 3DZKA 4XQGA 5JAQA 1YL6A 4TQGA 1GEEA 1YJQA 2QZZA 4LVCA 4CLEA 3QVOA 2BD0A 3JD1A 3ZZNA 4AJLA 5B1YA 1ENPA 3VAZA 4IINA 4CMBA 3V2UA 1L7EA 3SXPA 3HHPA 3K2EA 1M66A 5CEJA 3ZHZA 1JA9A 1VKOA 1I32A 3ASVA 1XU9A 4YRDA 1YBMA 1E3JA 1ZMOA 4K26A 4JQCA 1R0KA 1PWXA 2DTXA 1QLHA 4MP8A 4PVDA 4INAA 4WPGA 5KJCA 4YQZA 1LA2A 3ONDA 3E1KA 3FRJA 1SCUA 4IJWA 5BSHA 1QRRA 2NM0A 1MFZA 2E37A 1Z75A 5IG2A 5KJFA 1NFRA 1PQWA 4J4TA 4JJGA 3JYOA 3QA9A 4TRJA 2NVWA 2YV2A 3HE3A 4DYDA 5BR7A 4BO5A 3JQ8B 2EWMA 2OBNA 1XGKA 1BRMA 5TSDA 3H9QA 2GRAA 1PGQA 1UXKA 4MP3A 4EEZA 3W4JA 2UVDA 4M87A 1VPDA 1OI7A 1UZMA 1R16A 1UZNA 2Z5LA 3P5SA 2JAHA 1VL6A 2JHGA 3UOGA 2AEJA 1Z74A 5AXAA 2ZCVA 4DMLA 5BNTA 1GPJA 3AUUA 5THKA 2Q1UA 2FPGA 5MDHA 2PY6A 3KRTA 1F8FA 3O8QA 3WYEA 3ANNA 5KJ6A 2J3JA 3K73O 4E13A 2WE8A 1NWHA 2QIOA 3GZNB 4XJSA 1WNTA 3RUFA 5JDIA 4CMKA 3MTGA 5ITVA 4AJHA 3GN1A 1NPYA 5JFOA 4MKXA 1BWSA 3GVXA 3HQ4O 3RWBA 2B4TO 3IKTA 1WLYA 1X0XA 1GPDG 2VNAA 2QZ9A 1JVSA 2YHIA 4JP3A 1A5ZA 1K6IA 3QSGA 3ZNNA 3AM3A 1NFQA 4XA8A 3WMXA 4L8VA 4DYVA 3RJ5A 1B2LA 3W8FA 3PI7A 1ZXLA 3R0IA 3PGXA 4BNZA 1HL3A 1I36A 4PLGA 4IPTA 1I3MA 3T7CA 4R5HA 1I24A 1YDWA 4Y6RA 1F0YA 1W4ZA 4YJGA 3DFUA 3KBOA 1RWBA 1Y1PA 2HCTA 2JFHA 2Q99A 2I99A 2RH8A 4C4OA 1T2CA 3GMDA 3ZI0A 1DAPA 3C85A 3EK2A 4JGBA 1DRUA 1PS9A 4Z9YA 3UCEA 1E5QA 1I33A 2IEBA 4BO0A 4RZIA 2PD6A 3V2GA 2D4AA 3RFTA 3PHHA 4E2WA 2WD8A 1ZIDA 4E2ZA 2X0NA 1PL7A 4M49A 5GZ1A 2QRLA 1AE1A 4I5FA 4J9VA 3H9UA 5JC1A 4GQAA 4E6PA 1ZUD1 1GZ3A 1XLTA 1C1DA 3AWDA 3FR8A 2HMVA 1C1XA 2GN8A 1E7WA 4ND2A 3U0BA 2GLXA 4BB5A 1ID1A 3X2FA 3OJEA 4E0BA 5HS4A 3WNQA 4CQLA 2UYYA 4DIBA 1E7QA 3VH4A 4B7XA 2HLPA 4D42A 4YA6A 1EFLA 2CDAA 1HYEA 3ENKA 3KEOA 1I30A 3RC9A 5CP8A 4D0RA 2CFCA 3JD4A 4XDZA 3RJ9A 4A73A 5HWSA 4YXFA 4CV1A 2FWMX 8ADHA 4F3YA 3U4HA 1R4NB 3BA1A 3ENNA 4HUJA 1U1IA 4O59O 5COQA 1BDBA 3DO5A 2JD1A 3I9JA 2NACA 4NBVA 5THQA 5CFZA 3PIIA 1DSSG 4HKTA 4RVSA 5JYDA 4MINA 1ONPA 2DC1A 4NFHA 1UDBA 3ZU4A 4BKPA 1MX3A 5ILGA 2OO5A 3DWFA 3ZH2A 3GZ4A 3TJRA 3DMTC 1LXCA 2A35A 3MWEB 3ANLA 3ZNPA 2X86A 3U9LA 2P91A 1YO6A 3D5QA 4BO9A 2EP7A 4P22A 6ADHA 3WGZA 4YJHB 1QYVA 3AUTA 3N58A 2CD9A 1KVSA 3DAPA 2OMEA 1I8TA 3ETEA 1RM3A 3CZRA 5CDSA 3OMLA 4WCFA 3NTRA 2VHWA 1PJ3A 3GPIA 4IDGA 1EDZA 1VM6A 3OQ1A 1GY8A 1E6WA 3RSHA 5KVVA 1ZMTA 5B12A 4OXNA 1LEHA 1GCOA 1WW8A 3UXYA 3R1IA 4CMCA 1XDWA 4W99A 4QSMA 2IEDA 1DLIA 1PZGA 1WWKA 2X5JO 1TT5B 3RROA 2WYWA 2IZ1A 4KUEA 3I6IA 1YXMA 2C59A 1BXGB 2QG4A 4WCFC 4CV3A 2ZB3A 4J91A 4LGVA 2P9EA 2X6TA 4AJPA 5B4UA 2ZTMA 2VT3A 3FBGA 4FC6A 1SB8A 3FHLA 3Q2KA 3DQPA 1N5DA 2GCGA 1ISGA 2DFDA 3DTYA 4OXKA 1EUCA 3EGOA 1PQUA 3ROKA 4UULA 3IC5A 4Q3AA 1NM5A 5CG1A 4O5OA 1U5AA 4FGWA 1U28A 1J4AA 3PWZA 3DBHB 2WDZA 5JDCA 4WEOA 1XG5A 3JCZA 3BTVA 3WMWA 3L4BC 4ZQGA 1Y8QB 2C29D 4M86A 3ZW8A 1OFGA 5JC8A 2B83A 4JBGA 4XYMA 3SC6A 3HFGA 5C7OO 4UVEA 4B8ZA 2NU7A 5DP1A 1P1KA 3NRCA 4IGFA 3CH6A 3NDIA 1L7DA 4NK4A 1HZZA 4J43A 2BHLA 2DBQA 3I9OA 2CF5A 3WNVA 2DBZA 3MJEA 3WGQA 1C14A 4CMIA 1LQTA 2Z1MA 3WJ7A 5KJ1A 4NBTA 1NPDA 4ND1A 5TF4A 1V3VA 4PGFA 3E18A 4TRRA 4ZQEA 4P4GA 1P1FA 4P4LA 1HSOA 5K0ZA 2O4UX 4XD2A 4KUHA 1U2DA 4CLHA 3PDUA 2BKAA 3DFZA 4PFJA 1Z82A 2C7VA 2X5KO 1WZIA 3GHYA 1MG5A 3RQSA 1B8PA 1C0KA 4WLVA 3INGA 1HDXA 2EW8A 3OJFA 5HS6A 4PLTA 4RO0A 2JCVA 2UUOA 1PZHA 3BXXA 4QTZA 3GAZA 2O3SA 5I8WA 1DC3A 4KQWA 1WVGA 1VI2A 4ALIA 4CV0A 1W73A 2VHVA 5DCUA 3QWFA 3PGJA 2BFMA 4YEDA 2NTJA 3MTJA 5FYDA 4IXTA 2H6EA 1KC1A 4AJOA 3JTMA 3I3OA 3GDOA 1DB3A 1NBOA 4NZ9A 1YL7A 3HG7A 2AQKA 4MOWA 4OXYA 1XELA 3TOXA 3WTBA 4BNNA 3WSWA 1EUDA 3ROQA 1OOEA 1EQ2A 1ADGA 3GEDA 3HDJA 5F1OA 1B3RA 1KIFA 1ZSNA 3LYLA 3WQSB 4IQ8A 3PLNA 4ZQHA 4HFRA 4NQZA 2LDBA 5JCJA 3NT4A 4IDAA 2R6JA 2NQTA 3OEWA 1I0ZA 1GYRA 1ZNQO 5FI3A 2AHRA 1FF9A 3Q2IA 2FR0A 2JFGA 5I7SA 1B0AA 3AY6A 1B14A 4DLLA 4YT4A 4BNXA 1UP6A 3O8QB 4J3FA 1SO8A 3WS7A 1LSUA 4P4NA 2V6BA 3ZWYA 3WSVA 3B6ZA 1QKIA 2FPIA 5G2OA 3TZKA 4RGBA 5JMWA 3O4RA 2D8AA 4O1MA 1UP4A 4MO2A 5A9RA 3VH1A 3QVWA 1O89A 4KDFA 4Y8VA 3GT0A 4J16A 4MVJI 3H9EO 4ZVVA 1N9GA 1Q0QA 2YQ5A 4LISA 4GH5A 5EQDA 3WGGA 4ONEA 4R1NA 3JD3A 5DDIP 4KDEA 3GPDG 3HWRA 3GMSA 2C2XA 4NBUA 4XWYA 3D1LA 1U2GA 3SX2A 4IXWA 4NJOA 5H83A 5EPOA 4GAEA 3DZHA 2Q4EA 4LVUA 4YYZA 1MG0A 5JNLA 2PGJA 2YV1A 1IOLA 5BT9A 2HK7A 4DMMA 2FHSA 4IIUA 1Y8RA 5F1KA 3HJAA 5JMPA 3ZWNA 1QYXA 1LSOA 1LC0A 2EHDA 3DL2A 5G4KB 1T2AA 5H82A 4EUHA 5I9LA 1C3VA 4AJIA 4L74A 3L07A 2DT5A 4GVLA 1TB4A 4BVAA 3PXXA 1MC5A 1JLLA 3TN7A 4P8RA 3LQFA 4R9SA 3PVZA 2GN4A 4BQRA 1PGJA 4RVDA 2BF7A 3RUEA 4E2XA 4B7UA 1D4FA 5H81A 4E4YA 4B4WA 5AXCA 5GY7A 1T2DA 1GU7A 1EFKA 2I67A 3JV7A 4GBJA 5DOZA 1A9YA 2P5UA 1LJ8A 3HN7A 5C5IA 1M6HA 1E3IA 2NTVA 2B0JA 4BQPA 3TL3A 3ONEA 1UXJA 3V1UA 2J5KA 1GZ6A 2JAPA 3BYZA 4BMVA 1TXGA 2XF8A 2IE0A 3H2SA 4D46A 4RZHA 2PKQO 3OIFA 1PJQA 4B3JA 5A04A 3S8MA 3T7EA 1HTBA 4E5MA 1TA4A 4DLAA 2VZ8A 3GC6A 4EJMA 5I9MA 1N7HA 3AJRA 3VTZA 1IULA 1UXGA 1KY4A 4XKJA 4XRGA 4NFSA 4QEDA 4IDCA 1M67A 1UR5A 3EZLA 5ENDA 2X5OA 2BFAA 2X0JA 4FFMA 4CMAA 2DAPA 1HYGA 5BQFA 5TIIA 3FNEA 3LU1A 4PN3A 2PD3A 1Q7BA 2GF2A 1GR0A 1KEPA 3MOIA 1H6BA 3DXFA 4YT5A 3JQAB 1DRWA 2O3JA 3PFFA 1QR6A 4CMEA 1HKUA 1HWYA 5IDWA 2FZWA 1GAEO 2G0TA 2E49A 3UHAA 4BS9A 1KVUA 2Q2QA 5K9ZA 2HRZA 2DKNA 1IB6A 2EF1A 3O26A 3ZV3A 2GASA 2IRWA 3GVHA 5DT9A 1KOLA 4PIVA 2F00A 2VOEA 3LT0A 1JKIA 3OHSX 3IJPA 1DIGA 1PL8A 3IMFA 4OKNA 1BGVA 4JK3A 3D3EA 4Q3NA 5JAZA 3LC1O 1CIVA 4XB1A 3OICA 4P38A 5F1PA 1BXGA 2HMTA 2Q1SA 1NAHA 4GI2A 3GAFA 1NAIA 1B15A 2ZATA 1KEUA 5AQ1A 3JQBA 3E48A 4IDEA 4IMRA 3BMQB 3E82A 3DAFA 5LDHA 4RPJA 4CQMB 2Q45A 4ZD6A 2B4QA 3FNGA 5FI5A 4CM9D 4D44A 3OA2A 1Q0HA 4E32A 4L9RA 1PIWA 4NFYA 4WEQA 5J23A 3GDFA 1IPEA 4QXMA 2CMDA 1K6JA 4DIFA 1I01A 5JDIC 3KXDA 4RV9A 2GNAA 3ZU3A 4MVJF 4IZIA 1V8BA 4G5HA 2YJZA 3C1AA 1RPNA 2FR8A 3FF4A 4U0KA 3UGKA 2VWQA 4BB6A 4JROA 4D41A 2P4HX 2C0CA 4RVHA 1P1IA 1OC4A 4HWKA 4LRTB 4HP8A 1K2WA 4EZBA 1IHXA 3DC2A 1H93A 2C2YA 6LDHA 4XCVA 3PZBA 2VRBA 2NTNA 4J0EA 2W8ZA 1Y81A 1RKXA 3AFNA 2WYVA 4JBIA 5IN5A 2OP1A 4FD3A 3OSUA 4IUYA 3ST7A 4I5DA 4RPLA 3AK4A 4FPXA 1JQBA 1MA0A 4J7CA 3VPSA 1NQOA 4KP7A 5CPFA 4Y98A 1UH5A 2QYSA 1P31A 2NLOA 1KVTA 4L4RA 5TNXA 4WNCA 4MIYA 3ZWMA 2GPTA 2CZCA 1I3KA 1NHWA 1U3TA 1JKJA 4BV9A 1DC6A 1GZ4A 3IAHA 4ZGWA 1ENZA 2DVMA 3WICA 2W2KB 4HFNA 4YVFA 5JW6A 4ZRNA 1T4BA 5EIOA 2X58A 2F1KA 1R15A 2AE2A 1P74A 3AM4A 4UEOA 4AJKA 1MFPA 3OETA 1UAGA 3PYMA 3BMOA 3DZJA 1YB5A 3KYDA 4XYBA 5T57A 3L6OO 4K6CA 2C82A 3BMNB 2VTEA 4EEXA 3PZRA 1QV7A 3AU9A 3VZSA 3ADPA 4HFJA 1D1TA 1PGNA 4XIJA 2J5QA 3ZWAA 1YQXA 3NV9A 1VSUA 4WOKA 1HDZA 2ZB8A 3ZV5A 3COSA 4Q3EA 4HV4A 1LDBA 3KTDA 3VPXA 5CEEA 3GG2A 4QUKA 1D1SA 2EKQA 1YBAA 3CZMA 1EDOA 1UJMA 3G3EA 3IIEA 2NVUB
chains in the Genus database with same CATH superfamily
3PKZA 4JYBA 5AFSA 2QY9A 3HKDA 1SCIA 3RYTC 4BO8A 1IEWA 3GVPA 1KAHA 3DQZA 1IEVA 1L4KA 2QSZA 5F33A 4QBHA 4DRYA 1XCMA 1AHHA 5FBKA 4PLZA 3V8NA 4H15A 3DS8A 4FMBB 4URYR 4YMTA 1TECE 1RXCA 1LRKA 4BNMA 3MTDA 1AS3A 1TZMA 1CS4C 4JZYA 1VL8A 3R0QA 4H4EA 2A1TR 1Z62A 1PU2A 1LVGA 2WAYA 3H8VA 5J4LA 1CYEA 2FZCA 2O3QA 3OCJA 5ALPA 3D4PA 4GD3Q 4BTEA 1F2VA 3ON5A 4DR4B 2WP8J 3ZW9A 2ACKA 3G2NA 2RC6A 3HB4X 4GMXA 4WAUA 4E12A 3KT8A 3PT9A 4UZFA 2ZPTX 1ORWA 1YULA 2QENA 4N3GA 1YL5A 2WYOA 2OP0A 2ZTHA 3SQMA 5F7XA 4Y2SA 3GP8A 1MB4A 3EPJA 1P1CA 3H9CA 3O8LA 3Q5DA 2J5XA 4C2AA 4E5PA 2HHHB 5BR8B 2VBFA 1ZBQA 1VI5A 5KX5B 1RXEA 2ECKA 4LOKA 1EFRA 1BWPA 3DW1X 2V98A 1BDIA 2XHEA 4FONA 2O7RA 1ZKMA 1M1UA 2OGSA 1TX4B 3NGLA 4AK9A 3WBFA 2VFAA 3EJ6A 4K46A 1Q83A 4XM0A 3DA8A 3PCRB 4U7WA 5AI5A 3TLEA 5M5BA 4D79A 1VC2A 4FDMA 1XQ9A 3KZVA 4I1OA 2XJ4A 1AZLA 3HV2A 2R8YA 2UDPA 3RR2A 2Q3JA 3ASUA 4HLDA 4GNKA 4FFWA 3DYIA 4GL4A 4PAMA 3VBCA 4TZKA 4L95C 1R0SA 3I4CA 3K2QA 4DC1A 1SUDA 2IGTA 1C8VB 3G88A 4KMOA 5KHOC 4PTLA 1I1HA 3E2IA 5DW3A 5J5VA 2YIJA 1T10A 4F3TA 3CSSA 2WM3A 4L27A 3TCXB 4K2HA 1G3MA 2BEJA 3O8CA 2ABWA 3K96A 4EABA 3SY8A 4BASA 5A02A 1RAAA 3UJ7A 2NUPA 2WW8A 2JHFA 3T7IA 3R6TA 1DWPA 5GOTA 1U7WA 2X41A 3U7GA 2FW1A 3IVAA 1WB5A 1KE2A 1MVOA 1VMAA 3Q3IA 2BUBA 2X2OA 3B5JA 4CM8B 1C29B 3CKMA 2KHZA 2VDOB 3GPCA 5FWAA 3FGNA 3IO3A 3I62A 3HKBB 1YOVA 5AIAA 4EG7A 2Q9UA 1R8YA 2GNOA 4E22A 5CYGA 1HF3A 2UYCA 4LDNA 1GKUB 3H11B 3CLRD 3N0XA 4GBED 3VO1A 1TF5A 2JFXA 4KAFA 4PR3A 5B5SA 2H9AA 1ATZA 1JILA 2YICA 1N0IA 4ZI2A 1KETA 3MAJA 1FRZA 1PFYA 2LWIA 2O8FA 2IYVA 5J43A 2ZSKA 1WBBA 3OESA 4P83A 1NU6A 3L8GA 5DN6A 4PAOA 1D6MA 1XE3A 2BISA 2P9GA 2GN2A 3FWPA 4BBPA 1CDEA 3PTAA 2C8VA 2GK4A 4G97A 1TTPB 1KJ9A 3RANA 1II9A 4ILKA 4QO7A 3ZQJA 1I3LA 3N59A 3P2YA 2FF7A 3R7BA 1UBKS 2L2QA 2ZJ7A 4LZWA 1NSYA 1GNTA 3H65A 4FYPA 1PFKA 2RARA 4RL4A 5JVDA 1XMOB 3QFSA 4Y9SA 1UJNA 2QRQA 3DL4A 3KDAA 3IESA 1L8OA 3IRVA 3LT4A 4HGPA 3G02A 4RF5A 1ND5A 4BE9A 4HAOA 3TUIC 4O4HA 4TTQA 2PMEA 3DE7X 4PVCA 2IH2A 1U98A 5AJHA 4AC9A 1O58A 3GFQA 2Q1YA 4K9OA 3FKQA 5BNFA 4LDPA 4MAAA 4OLBA 2PAFA 4NPAA 1TMYA 2RI1A 1RM0A 1E6EA 1JJIA 1M8PA 3CRZA 3DV9A 1C8KA 3UHJA 3RU3A 4DFDA 1H0RA 3DMNA 4YBZA 1F60A 1A2OA 4LSGA 2RFLA 1GUFA 4K87A 1SQ5A 4OQEA 3EW7A 3U3KA 1NF2A 5JANA 2JIDA 5ECWA 4CDNA 3TBKA 1L1EA 4PG7A 2OZKA 4FGKA 1UBEA 4EO7A 1I5RA 5BORA 1DAGA 2VJQA 2W0MA 4YMWA 2DGDA 3F96A 5AVSA 3C6YA 2A0WA 2DE0X 2OYSA 4JJ4A 5AKGA 2I4NA 3M7IA 3W5JA 1OGIA 1E0AA 4UHDA 5CR9A 1XZDA 3Q8LA 5MFZA 4XGNA 5IJZA 3PLRA 1UIRA 1PLJA 2Z2IA 2G40A 3G49A 4M0UA 4EFMA 1F6BA 1J0XO 4CF5A 1BROA 2BGUA 5J4HA 3QKIA 4B17A 3W8EA 1RCFA 4B3HA 3LUGA 2ORYA 3MAGA 2IX3A 2DFNA 3HXMA 3NHYA 4ZDKA 3EEQA 1LGYA 1N34B 1JAXA 1ZH4A 2CK3D 2UU9B 1BXRA 2W2XA 1A8QA 3O2SB 3CT6A 1SG9A 4OSOA 2GPBA 2OSVA 4FW8A 5DNCA 2JLBA 4BVGA 1Z4IA 3HJCA 4MA0A 2NO1A 4OH1A 5JCOA 4DBLC 1A77A 4JJIA 1LBTA 1Q44A 2GR9A 4JVMA 4EW1A 1NP3A 2QAGA 2O3RA 4UQLA 3ZHVA 2XWQA 1OFTA 2YY7A 2Y05A 2O7QA 2ORIA 2FSHA 3G2MA 3JALA 2UV8A 3TFQA 3WXMA 4CTOA 3REFA 5A1TA 4R51A 4M37A 5BW4A 1JQJC 1OKKD 4JLUA 3RODA 5JS6A 5JSZB 1CW2B 1G8GA 1TO1E 1GTG1 2FMFA 2OXRA 3QBJA 1YZNA 2XXJA 4NULA 1MJFA 4KO2S 5ADHA 3QPDA 1HXHA 2UZ3A 3N2ZB 3L8FA 4JGIA 1DBQA 4AUMA 1N7GA 1S8NA 1O9GA 1I72B 2BM8A 2JDID 3UV6A 4CKBA 3EZYA 1E3EA 1Y4AE 5TC4A 3ZGLA 1NVWQ 4M9QA 2GA8A 3SS9X 3FDXA 1BU8A 2R7MA 1PJBA 2CUNA 5KYGA 2ODPA 3JAKA 5ENVA 3AB3A 1M6YA 4IP0A 3ONFA 2VYFA 3DZIA 4JLMA 1MENA 1Z0FA 3QWHA 3HA7A 4KUGA 4Q1CA 3CVYA 2LBPA 4EPTA 3NBXX 4DCMA 1HDGO 3A70A 1A7KA 4PFSA 5DWQA 2YJ5A 3WGYA 4IGKA 1Q7CA 2IZ5A 4S04A 5JO9A 3GXBA 4TS9A 1XZPA 3JZDA 4NI5A 5B3AA 1VMIA 1BKSB 1IM8A 5TT0A 5GOZA 1GFIA 2R1TB 3FFTA 3T4EA 5ICSA 3R40A 9GPBA 4KNYA 4EEKA 2XB2A 5CJJA 3E2PA 1KYXA 1WDLA 4YN3A 1W0JA 1T4MA 1VCOA 1UMBA 3ML1A 4Q39A 3ZWQA 4CM7A 1Z3CA 4JR2A 3JQPA 3WNZA 4R0MA 1QWSA 1SUPA 4NBWA 3NBMA 5DSTA 2EKPA 2BH9A 2MT9A 2C9BA 4IIGA 4IJ5A 4MMXB 5L40A 4GPTA 3KG2A 1VJ1A 3IUJA 1TYCA 1Z0SA 2CB0A 2JJ8A 5KYVA 1CY4A 3M5CA 3R4VA 5C51B 2Q0SA 3IQIX 4PYRA 5BRJA 3OQ6A 4CQNA 3BZBA 1GRCA 1C1XB 3D31A 1JLHA 4ZODA 1S0UA 1T4CA 1WDKA 1FNDA 2BFEB 3EQ2A 3M1YA 4GR5A 5DBIA 1PNRA 3FOCA 1IM2A 2R48A 1E1MA 1JQDA 3DLIA 4PZ0A 1G2PA 4EB0A 1B16A 3GPBA 4Q7JB 5D6OA 3HLTA 3EUFA 1Y0BA 3BTOA 4WESB 4WSOA 3ZHBA 5AUNB 1SVSA 3ZCPA 5I9SA 4UFOA 3IBFA 1OREA 4UPVA 1QBKC 4XIYA 1X39A 1B76A 1UEJA 1Z5VA 1DEAA 1HYHA 2AKYA 2X8BA 2ZI6A 5I47A 2JI9A 2OBMA 1DUIA 5IFKA 4BN0A 2Q3DA 5JYEA 1D9XA 4MDHA 5JMTA 3WGOA 1RQGA 5TARA 2PGIA 2PZFA 3W79A 4BMYA 3KZCA 3THXB 3O7MA 3PVSA 2YWJA 3WFIA 4F2PA 1E9DA 2WTBA 1DIOB 1NVXQ 1J06A 4JOQA 4GPEA 3W1VA 1WD7A 4GSLA 3Q15C 2AF3C 1P91A 1FUYB 2GVDC 2C5HA 5J2TA 2EZUA 1NOIA 3L06A 2ON6A 4PYQA 4RCVA 1N2OA 1Y5MA 2H92A 2IYPA 1CRQA 4JX8A 2YHSA 1QORA 1V8OA 4ROSA 5JZSA 4HADA 1FFEA 2D06A 2QRJA 2VHXA 3E0QA 5AXBA 2FWPA 4YRAA 5HOEA 4DADA 1VG8A 5F3RA 5BR1A 3RAFC 4QREA 1EQUA 2WSSA 3IT1A 4BFTA 4QGGA 2YN0A 3S7TA 1Z7YA 1JKJB 4JP2A 3U13A 1FNSA 1JEQB 1P5JA 2H4WA 2OZVA 2RI6A 3D7KA 4OLJA 4QGHA 5LWHA 2Z2XA 3EC7A 4IUCS 5FJJA 3RHTA 1NBAA 3EEIA 1POXA 4ID9A 5AW0A 1QUEA 2XUOA 1RC0A 2VSYA 2XPCA 2DUNA 3JQ9C 4ZPXA 3UFXB 3ZXSA 4RTLA 2ZR7A 3ZIDA 2O8EA 4GPD1 2C61A 2W2OA 1VIDA 3OIUA 5EJ6A 4HLUC 1JDZA 5T5QA 1RJ9B 3BIWA 8MHTA 1HRDA 1SELA 2G71A 3BDAA 4YDHB 2PUWA 3UUWA 3NC1C 5FIUA 4X8HA 4YP5A 1NVAA 4RA6A 3RVKA 2PA3A 2YBDA 1WKCA 4YLYA 1ZK2A 5DGCA 2VYVA 1TVKB 3T9CA 3PUHA 3I6QA 3DNMA 4GNRA 2CJFA 1RABA 1C81A 2QRNA 3JYPA 4TV9F 2XA1A 3VSCA 3L7OA 5ALDA 4DIUA 4DUGA 1PR1A 1NJ5A 2PT9A 1GKIA 3OPNA 5KKAA 1CEXA 3VHXB 3W5IA 2X0FA 3ZZMA 4G4SP 3RS5A 4CMGA 4F06A 4BVBA 4F11A 2D5AA 3KR0A 5EE0A 3WLFA 2PX4A 1VE1A 4AKSA 1FP4B 4B48A 3OE5A 1ISSA 3B8EA 4M3NA 4BKMA 2XF2A 1QVWA 2I8LA 1YCDA 3FCYA 1PJ2A 2BGIA 4O02B 3WC4A 4OOEA 5JHHB 2QUIA 2C2GA 3UJDA 3ZH9B 1P0QA 2HMYB 2DOKA 5G4LA 3KQHA 2QRUA 1OBCA 4AFNA 3TUJC 1LTQA 1V3UA 4YMVA 4LXUA 4I3GA 3L82B 5A06A 3NANA 4XTCS 1EFHA 2HZ7A 1ZEJA 2NSLA 2WIJA 3UTDA 2QXUA 3KVOA 3AUAA 1G5HA 4FXOA 2HNBA 4IVPA 5EPEA 3T5TA 3BMNA 4C6HA 2YFQA 3II6X 2GETA 3IALA 1Z6PA 4E21A 2O2EA 2XDYA 3KWFA 3M1IA 2XZPA 4F38A 4DL9A 3C1OA 4TZ6A 1B0PA 3LBFA 2QX6A 4MUNA 1PN3A 4GWGA 2XE8A 2BMFA 2DH6A 3V3KA 3O2NA 3OG9A 4FSDA 4L6AA 4P93A 3LBIA 2ESRA 3VPAA 3RRYA 2JJ2A 2PXHA 3PFWO 4MEBA 1Q3KA 2PGLA 3NIGB 3O95A 2JBAB 4MKHA 4R9VA 5DE3A 3ILYA 3T9FA 1E5TA 3TZCA 5JQGA 1RJFA 2ZWIA 2RSLA 4QJIA 3TOZA 4C0BA 5TLSA 2JD2A 1TNDA 4LF9B 2NT4A 2GKSA 3CY6A 2WLTA 3WKAA 2VHJA 2AR9A 5GV7A 4KPEC 4PC2A 3G9UA 1S7CA 3ROZA 1J49A 3HO1A 4P0TA 5T41A 1P80A 5D8DA 2JIZD 1VTKA 5JPIA 2VHZA 3OQIB 1R4ZA 2O6HA 4GZ5A 3AL2A 2VN8A 1U63A 3UV3A 1U2DC 1KWGA 4ZYXA 3EAQA 1N1EA 1XD2A 2FSPA 4RSGA 1U7TA 3I1JA 5CHYA 5E9AA 3RABA 3ETHA 4AP9A 2HCBA 4F1JA 3GP5A 1FS5A 1GDDA 1VHWA 3E58A 4ZI7B 1QGAA 1QVVA 3WLLA 2BSQA 2IY7A 5DHFA 4US2R 4TZ0A 2J85A 3TLJA 4GE0A 4LYYA 1F6DA 2V65A 1KVQA 3ROFA 4IIVA 3DLHA 1N8NA 4I9UA 1EUZA 1DCTA 1JYSA 2ILTA 4OQDA 1AB6A 2O52A 2ZP1A 5KVSA 2IIVA 4PAWA 5IT4A 1Y3BE 3QVMA 3RM3A 4XQ9A 3K0FA 3TZBA 4JFAA 2PH7A 2VHYA 5K2OA 3G9TA 3VJKA 3KJZA 4TQAA 1HL7A 3D8NA 1M76A 1PZMA 1SK8A 3QNUA 1DNPA 5E9JA 5KSOA 2WUVA 5EIXA 3H5AA 2OILA 4HLQB 1GZSA 2P65A 1U2RA 2NPIA 2XTAA 1XYVA 1SCKA 2RH5A 3LXRA 3KYCB 4OIFA 1IZ0A 2Q5JA 5IJWA 1T9GR 3OC6A 1EFPA 3CIFA 2WI8A 5FAKA 1AKVA 1E2DA 3A4MA 1FYDA 1PLLA 2Q5OA 4AX8A 4QODA 3QKSA 5KVQA 3GUVA 4QICA 2AR7A 2EQAA 3NX4A 1MW8X 4LWOA 4F97A 2D54A 1NW3A 5M29A 1HE5A 3MWGA 2GTPA 4KIFA 4QL3A 4IVNA 1XQ1A 4IX9A 2GGSA 2WUFA 1L4LA 1SXJD 1V25A 2FR8C 3PIRA 1TW3A 1HMYA 4PRLA 2GHQA 1R6DA 1P2BA 3LT2A 2C84A 4LOIA 3U44B 5T3UA 3MCZA 5CNJA 2NSYA 1OBFO 3AF2A 3GLHA 4EY8A 3FAZA 3L0OA 3FA2A 2EFHB 5IAGA 5IC6A 1ODCA 1O9BA 3UWOA 1M75A 2HU5A 1L5WA 1T3HA 5LU9A 1YVEI 5FF9A 3MD0A 1YB4A 3H19A 4BEJA 1E2PA 1JQAA 4PV7A 2G82A 2YY5A 4J94A 5E4TA 4DUPA 5HIKA 3F9RA 3RSGA 1OROA 1E6MA 3B1KA 4N18A 4V0RA 1C4KA 3G85A 3DV2A 4RLFA 1D3AA 1RRVA 2ZDQA 4B1FA 1AIPA 3FHOA 3L3BA 1KK3A 4C03A 3EP3B 3OC0A 3SJUA 4NG5A 1X7HA 1C3EA 1M9NA 2LIVA 2JIMA 4JUBA 4NCHA 4OL0A 3ZGZA 4PPNA 3QVXA 2QSUA 3OMWA 4G5YA 4OIMA 1G5PA 4UM9D 4BV3A 1R0WA 4HNSA 1XQVA 3N8HA 2CWDA 4CL3A 3OM0A 1JAHA 3IO5A 1P1JA 4OK6A 2QLLA 5LM3A 3PNQA 3CW2A 4I36A 2ZS8A 3TNYA 4BGEA 4YMUA 3VUEA 2XMPA 1WP4A 1U8EA 5JECA 3UHOA 1NVTA 1PP4A 3KYJB 1D2RA 5LYYA 3T12A 5EJ4A 3MJHA 3UMSA 3NAGA 3C6MA 2XDQA 1VLLA 4TWRA 3KQTA 2WK1A 2LPMA 1GR1A 2LP4Y 5SZIA 4IYRA 5F4BA 2EEZA 2V7GA 2WSLA 2BEVB 1T3TA 3G9XA 2J0VA 3LUBA 4G5FA 4J7XA 4Q9HA 1JGTA 1FVOA 3JQ6A 3MTQA 1E2LA 3HDTA 4AJ2A 4TQUS 5E1BA 2QRZA 5AHKA 2Q6TA 5JU6A 4KOAA 2YXNA 7YASA 1GL6A 1N5LA 2VXOA 4AJJA 4J2OA 4QARA 4HZUB 3L1KA 1KI6A 4OI2A 4RXUA 1ZL2A 1YAJA 2NYAA 3TTWA 4FIZA 1HH4A 1E6CA 4GRDA 5CDHA 2LE0A 3W2GA 2MINB 3MMPA 5T7BA 1XXHA 5B58T 4ND4A 5G53C 3W6NA 1ST3A 1OF1A 3EY4A 1GXSB 3NHFA 4B9EA 3CLUD 3C3MA 1OV6A 4FSXA 1KYQA 4NZNA 4BC1A 1V95A 2IYAA 1E6LA 2V9PA 3IQWA 4FYMA 3Q9NA 3H4IA 4M1SA 4RK1A 2R2GA 5TQVA 1R6VA 1Y7IA 2CDNA 2PSEA 1M2OB 3KWJA 1W85A 3SQXA 1XWWA 3I0NA 1W85B 5ISMA 1A9SA 4I8DA 4WECA 5KPDA 3FDZA 2AHOA 1N7IA 3EDMA 4MRRA 2C00A 1B73A 3G8YA 5IT5A 3SX0A 3R7LA 4FBGA 3NT2A 1YR6A 1FS4A 1JPNA 2OO7A 1FJHA 5CA0A 1LNSA 4HWPA 4J8PA 1FJXA 4DGSA 4KQIA 3WLJA 1P0MA 2NVOA 4Z86A 5IZCA 3ACBA 4JI6B 4D4MA 7REQA 1KEEB 1X42A 1XNJA 2B4YA 1VIYA 1SXHA 1U3UA 5HXAA 3HUEA 4XXHA 2CL0X 1O5IA 4PX2A 4OP2A 1V11A 1EIZA 2W42A 1UMCB 2QPOA 2QX7A 2DJ5A 4J2HA 521PA 4MO9A 1PNQA 1OI2A 5HMMA 3U39A 3ZDFA 2BC9A 3M4JA 3V9PA 3LUDA 3IUBA 1AB5A 2C2WA 3U5TA 3LLVA 3GEMA 3TUZC 2IDKA 2F43A 2IOYA 1II8A 2ASVA 4GUDA 3V8MA 2RAFA 3WGJA 2ZTSA 4OHOA 1BH6A 4LBVA 5KYUA 1L6IA 4ZQCB 2QTWB 1KO4A 2O7NA 2EP5A 1CQIB 3FNRA 4NS1A 3WRVA 4FU0A 3DE0X 3IOBA 4L4SA 1QANA 13PKA 4HQKA 5IEBA 5CDGA 2WKSA 2X2EA 3CINA 1IVNA 1NMYA 1RWNA 1C0IA 3MCTA 5AW8A 5KWEA 4PLFA 1DIBA 2DBRA 5BPHA 2AK2A 3SYMA 1DEKA 4CG1A 5JCJD 3T1TA 2R9VA 2WJ6A 4LCJA 2JK1A 2R8XA 1BE6A 1SOMA 2R7KA 4HNTA 5JTUA 3Q0EA 1C0LA 1VMDA 3FLMA 1ZOSA 3RHFA 3K1YA 1LI5A 2PCLA 4BHTA 3KYCA 4OJKA 3QQPA 1I1NA 2C98A 4N7MA 2KM1A 3R6LA 1ENOA 2XBLA 1DWOA 2L0XA 1SB9A 1OQAA 2G1UA 3B9BA 3MELA 4QUAA 5DHPA 2HA7A 5L7YA 3GAAA 4P3XA 4AMYA 1M7HA 1N2IA 4OQYA 3TE6A 4TV8A 4QYXA 2J5RA 3KVVA 3PHLA 2QJFA 3NJ4A 1PNOA 2D2VA 2HM7A 1DKLA 1I1OA 2PTHA 3GGGA 4QUHA 5ESRA 3X1MA 1MEOA 3HXOA 3AEUA 3L7LA 2QROA 4DQLA 1OXKB 4Q3BA 3AR3A 2HJWA 5DN6D 4R2HA 3ZIAD 4CDGA 1N2CE 1RQNA 1YKSA 4CIXA 2XA9A 1ZA2A 4M7RA 2FQYA 3VBEA 4CLDA 2G1JA 3WK7A 2NO5A 3MTBA 1CNMA 1EHCA 1KFBB 3OLYA 2JGIA 1DBPA 4HLCA 4GXNA 3WAGA 1GKLA 2IPOA 4I9FA 4ZARA 3ZCSA 3DTTA 3UB2A 5J2TF 3O0DA 3QVSA 2CNWD 4LJ6A 3SFVA 4IS3A 4XYEA 4BIMA 2E4WA 3OZCA 2GUWA 2Y67A 1TFRA 2X1MA 3SC2B 1W76A 4LVNA 3F4LA 3ROPA 3TE7A 4YAKA 3O3MB 3WSTA 9LDTA 3MPUA 1ZC4A 2BI4A 2FI1A 3L5OA 3OT1B 4XEUA 5E6RA 4J0CA 1K75A 2I7VA 2AWNA 5DJ5A 1W6UA 1NN5A 1DXOA 1O5TA 2J3EA 3BREA 4ZVRA 3AX6A 3EXEB 3MD9A 5IDXA 3DZFA 1SWWA 3AW9A 1MV8A 4LQDA 5KX5F 4ZT2A 1AT1A 4EHLA 2WUEA 2F6RA 4AUKA 2PUFA 1SKAA 3BMOB 3KYDB 4MVJD 2QMEA 5JXGA 2A92A 1C2TA 1F2TA 1LH0A 4Q9IA 4YJHA 1RTTA 4V0LA 5B6IA 3I5UA 1WHSB 1T43A 3GUZA 4HAIA 5FNVF 4BKOA 1Z9BA 4CIBA 4YH1A 1I79B 2JL1A 3ZZUA 4KGZA 4MW2A 1LBIA 4OOFA 4E94A 1YS4A 4ARAA 2UVPB 3PGA1 5A5VA 5LNK1 4C0KA 2WJWA 4XIIA 1B2RA 2G1PA 3N0RA 2OOSA 4UHCA 5CLHA 5KHLB 1BMDA 3G0OA 3BIOA 3AHCA 4O1HA 1DQYA 1O6FA 3O4GA 4AF8A 5G0WA 3SZMA 4YMIA 2A0KA 3HVKA 4X24A 3P26A 1IJBA 3E53A 5SV2A 1JYFA 2Y1CA 4L78A 3EOAI 3F71A 3VR3A 1P81A 3TZHA 3CKYA 4DQXA 5L7WA 2YVLA 4AMBA 4LF5B 4LTDA 4EELA 4KQXA 4RTNA 2TMGA 2YW2A 3GFSA 3N9IA 5JAIA 2WM9B 3LPCA 1WCYA 4OKIA 3LHKA 1UFOA 3D8HA 4ZCPA 2GN1A 2OBFA 3IQEA 4JN6B 4ZJPA 5K6AC 2UUBB 3D7LA 2CSXA 2ZB7A 1K4MA 5AKZA 1HNXB 2R8ZA 4QU5A 5F3WB 3BHJA 3PD0A 3PB3A 1KGSA 1STOA 3O73A 1ZK3A 2BKVA 3L0ZA 1Z4QA 3PQVA 2H2AA 5HJ2A 3DWEX 3T5BA 2ZFUA 4BBJA 1C1DB 1DKUA 4XYLA 2NU7B 4QT4A 3QU9A 4CT0A 2PBZA 5ALNA 3A28A 3S68A 2QM7A 3UWDA 4KFRA 2CLDX 4CG3A 5LP6A 5F9FA 2GJ9A 2Y4NA 3PKIA 5GJWC 3I6MA 2P6UA 4I5GA 3IUSA 3M5PA 4IG4A 1EK2A 3EG9B 1GG2A 2G1AA 4PYIA 5JEEA 2RC5A 2JDIA 3TQIA 3RE1A 2XGMA 3OQHA 1JIKA 1T26A 4QPJC 5IDVA 4BVJA 4XM1A 3LXUX 3BSFA 4QOFA 2MR5A 1CU1A 1KGDA 3AHGA 5SICE 5CFQA 2ZXEA 2ZEJA 3NHMA 4HQ0A 3UUGA 3GLUA 4UNRA 4RIEA 3OHMA 5LPNA 2V8OA 3HBNA 1RHRA 2Q1XA 3NKLA 1N3LA 4AYTA 4LFBB 2R2AA 2EL7A 4N5LA 4IIXA 1U5BA 3UG6A 1QHIA 2HU2A 3ELUA 1T9HA 2NMVA 2VUSA 2ZS9A 1W88B 3DULA 3I5MA 4MV8A 5ALEA 1PG5A 2AFIE 2YY6A 4OJNA 1ZGBA 4JBLA 4EH1A 3QPVA 1SG0A 2P5YA 4LY9A 4YCMA 1H9BA 1USUA 5J4VA 2CK3A 4I4IA 4OQZA 4ZU3A 5JIBA 4R2LA 4E33A 1Y7LA 4OSEA 3TDKA 4E6EA 1J2YA 2Q49A 1AUOA 2G06A 2HSEA 2ID8A 3FMFA 1IJKA 1C0EA 3QEJA 4NAHA 3ZEAA 5EJ8A 3E15A 4PZAA 5EVCA 4BL5A 4PSAA 4MVJE 1G3QA 2EDCA 1CS0A 3MS7A 3O94A 4FZVA 1RJEA 4WY2A 4R0VA 3DZDA 2TMDA 4I9GA 3U37A 1PYGA 4Z1MD 1NW4A 2H65A 2ZCJA 2QX8A 5CVJA 3EFEA 4CF3A 4PZLA 5LYJA 1NF3A 2BSXA 3AYZB 1CP3A 4HGOA 2V3WA 3CO5A 221PA 3G9QA 3HYTA 4P86A 3WKDA 3AR2A 2O48X 4YAJA 4CR6A 4WMLA 4I4LA 3W3AH 2RBGA 5AMXA 4B2YA 3SDSA 4CEIB 3KSMA 1CQIA 5FTJA 4ZVPA 4NYIR 3WIBA 3DOIA 3HH8A 4QRHA 4QXPA 5FOTA 4OGWA 1DX6A 1UIMA 1N6LA 1WO8A 3MWYW 2YZMA 3FRIA 3JYQA 1Q1BA 5ENZA 4X7PA 2J3HA 1P7VA 3LC2O 2ZIGA 2F3PA 4FKZA 3VDXA 2PPLA 3NOOA 4N3CA 4IM7A 3SKXA 1WBJB 4ZO6A 1EE2A 5JCXA 1Z4PX 3PFKA 5F9HA 1NU8A 1IL0A 1YMVA 2IYYA 3ICQB 2HBQA 4MVJA 3KETA 4WFQA 2E82A 2MINA 4A2CA 4M99A 1UDCA 2QF7A 2K2WA 2QVYX 2XYGA 3AJDA 4QOSA 9LDBA 3AV3A 2SCUB 1WMBA 2P2YA 1YRYE 2WRZA 2PT6A 3BHIA 2O2SA 1U6IA 1ZI8A 3QYJA 4BDTA 3CUKA 1SHKA 3G5AA 2CV2A 1DZ3A 2VDNB 1FFGA 3D8UA 1F48A 4FN4A 4JJKA 1Z35A 3CPHA 2R3SA 5U4XA 5I7VA 2Q6OA 1ZO8A 5AJYA 4EYGA 4YCDA 1DMRA 1V3TA 2ALJA 4NR0A 3QLJA 3RRNA 3UXMA 2JFWA 1IXKA 1SKYE 2E4AA 2OGUA 1R8JA 2PFKA 1EFVA 3MSXA 3KKMA 3WK6A 4OQ4A 3K0CA 3SC3A 3S55A 1QZTA 3WL8A 1IN5A 3DO6A 3DBLA 3MA0A 3V4FA 2VTBA 5EP1A 2DFTA 1NC3A 4QBKA 1FLNA 4K9DA 1D2AA 1EQAA 3G79A 3R0ZA 1TAUA 4I2VA 1T29A 5C52B 1MGPA 1EH5A 3DWGA 5IDYA 5I8ZA 3G8AA 4P4UA 1KAEA 1K7YA 1OYVA 3D0OA 3TTUA 3VX4A 3JZAA 1XB2A 3MFYA 4IIBA 4F46A 2RD2A 4DIOA 3L18A 4Y67A 2JEYA 1F7UA 4TTPA 5MGNA 4QAJA 1YI1A 2ZITA 3CRW1 2RK6A 3EXHC 4C3OB 3KB2A 4HQFA 2GM3A 2E48A 3NATA 3O9ZA 4P3YA 4OV6B 2GBPA 3PPYA 3OPQA 2B30A 2AK3A 3NMUF 1N6NA 2JGKA 3BGIA 3EBPA 4OG2A 4LQ4A 2J07A 1CWUA 1ZJYA 4KXVA 5FOSA 4AICA 5GMOA 3B2QA 3F4BA 3LLUA 4DSZA 4E1BA 3WB1A 3V34A 1T4DA 2PZ8A 1YZGA 4BNIA 4YCLA 2B5OA 3JQBC 1S8OA 4MJLA 3PU6A 1QHYA 1QONA 2H9YA 2A8YA 2XNKA 3FUCA 4NECA 3FMGA 3TZLA 2N46A 1IYZA 1JPUA 5FBWB 3I05A 4Z4FA 1U4SA 1UKAA 5IF3A 1K5DA 1I6KA 2A3RA 3MOGA 1KZGB 2XUPA 4PQGA 4EI2A 1R0ZA 2VT7A 1W30A 2YMLA 4YJ3F 5ELXA 4RZXA 5KNLA 4D9MA 1M0WA 5AK0A 3QEKA 4Q6WA 3USZA 1EK1A 4X71A 2DBYA 3PXDA 1ZU4A 4N3BA 1FBNA 4PANA 4CR7A 2KS6A 1U0TA 2TMYA 3EUEA 2RHWA 3L7KA 5B3JC 4AWXA 1VPVA 4KN9S 4FLFA 1BVUA 2XOKD 4MWCA 3MCVA 5G0VA 3W2FA 4JWTA 2QTLA 3HPRA 1RD4A 3BJIC 2XMGA 4W1RA 4CL0A 5CBKA 1JFSA 1KVRA 1JMVA 1JFRA 1RI4A 3N7AA 2HWKA 3F7TA 3L02A 3AFIA 2JCXA 2JGDB 2BDTA 1OC2A 4OVKA 5CXXA 3R76A 5C7IO 2CYAA 1LC3A 5C7LO 1XK6A 1SU6A 1MB2A 2X4GA 1PGOA 4N9QA 1W6RA 2ZYVX 4BIIA 4ER0A 5BSKA 2Q1TA 3H42B 5B4TA 3AHHA 3DR3A 1BHJA 1D0IA 4N40A 3RS0A 5IHPA 2FGKA 2QX9A 4E88A 2G28A 1CQZA 3ZV6A 3QOYA 2PLAA 3JD2A 1LBEA 3H16A 3NOQA 1HT1E 3G2IA 4LZOA 4TMYA 4V0NA 4ZZ3A 2W2PA 3UPUA 2AW5A 2PX6A 2ZU6A 3N70A 3RQIA 5LNK6 2WFLB 3CZ9A 1U6JA 1JX6A 1Q11A 3I64A 4FGUA 4UASA 3CLTD 5CFRA 1GVNB 1ZS9A 1HM5A 1KJNA 1T91A 3KOWA 1G8HA 2BMJA 5ESWA 4E15A 2O8FB 1TM1E 4JJAA 1H2HA 7ADHA 2N3ZA 2QJTA 4JEHA 4I19A 4UCXA 3ZOZA 3T35A 4UE3S 2Q5FA 4MARA 4DUZB 4F85A 3HDQA 1P1RA 4YUZA 4DLYA 3H8SA 3F6BX 2YC2C 4G1UC 2RGDA 2WU8A 4YPVA 1WDWB 3A4LA 4Y6SA 4YY3B 3VNAA 2ZAYA 3SQWA 1GTRA 3L1IA 5FPKA 3A4YA 2PA0A 2B1RA 1JIJA 2LD4A 1FNNA 2QTVA 5CH3A 3IDOA 4Z0TA 4OHRA 1W5BA 5HCUA 4EIWA 4MI6A 4FMCB 3OZBA 4QJ4A 2E2WA 3OLWA 1RPTA 5EUCA 1QDLB 5TRTA 1FL9A 2GYYA 1XNGA 4N12A 2XZDA 3MUNA 4BVLA 4CV2A 2NUPB 4CIAA 2IBTA 1M34A 4FR5A 4BTLA 4X8MA 3EP9B 1A72A 1DLJA 2YXPX 3I2GA 5IANA 1TVEA 1WKBA 2IY8A 3GG9A 1XLUA 4ZEXA 4D43A 5CA1F 1YDEA 4UOEA 1E6KA 2B82A 1AGRA 1XNHA 2OLKA 5LMCA 4MKGA 3BAFA 2HUNA 3EWNA 3BF8A 4D8WA 1AXGA 3FSGD 1E3LA 4KLRA 4G5SA 2ZE6A 4LXIA 3NBQA 4YCJA 5DLDA 3W7BA 1CUSA 1RQXA 2LKCA 3GELA 3GJSA 5F12A 4ECAA 1TYAE 3GGSA 1CDZA 4PHHA 3RW9A 4AO6A 3QLVC 1MOSA 1R0RE 2VWGA 1SBNE 3HP1A 4NX2A 4AN4A 4FYIA 4BATA 3GH3A 4D2IA 2PUHA 3L93A 4ZMRA 3W9YA 1KMCA 1B8UA 1TA9A 3D6TB 1XJWA 1RHQA 1ZUHA 3EW9A 3BH6A 3T4XA 1IVSA 5FP0A 1R9JA 3H2ZA 1QQAA 3X2EA 3Q85A 1NASA 2Z3VA 3PGMA 3M82A 8GPBA 2C5BA 1PSWA 2Z8XA 2B4AA 3JZFA 2DQZA 3PWSA 4N7RA 1E3WA 1VJ0A 4CF7A 3OPYB 4EBFA 2ZRJA 3PC7A 1XCBA 3L6CA 3BRQA 1ULZA 4JP5A 2B98A 1RC8A 1SBCA 3LX6A 2P3QA 2WTAA 5AW4A 1TM5E 3O6VA 3TEMA 1E5XA 1LU9A 1MAVA 1Q95A 1QG0A 1JDSA 2HJSA 2FR1A 2NQ2C 2V97A 3K9NA 4FFNA 3ZIUA 4CUZA 2PYDA 2GBIA 4LNHA 4EKYA 5ICEA 4G0VA 4V0KA 4B7AA 3MCWA 4S1OA 2XCOA 5EKSA 5I45A 4CN9A 4CQMA 2F9MA 4RF4A 4G37A 3STXA 1TQ4A 2PWAA 3PHCA 4HNUA 3ZJVA 3CNOA 3T1YB 3ROXA 5EZQA 4L8LA 2VDMB 1VL1A 1L5HA 3WGKA 3GLVA 3RTBA 2PFGA 2PXXA 3FTCA 1ZJWA 1SCQA 3VKUA 2QYTA 3NJRA 4HDCA 2QZSA 2GZDA 3B9RA 3BD6A 1GAWA 1KDPA 3ND8A 4KYIB 2O06A 1R74A 3L9WA 3OX1A 5AWFC 2SICE 4DLTA 3GPLA 3IPLA 3OCCA 3P9SA 2ZJ1A 5ADUS 1RQPA 1T9DA 1TU0A 2V9ZA 4TV9B 2NN3C 3UMRA 2WWVD 3K4PA 2NVUA 5K8UA 3GFPA 5GVRA 1P9OA 5T6MA 3T7AA 4X91A 1G4HA 1UEIA 1R0YA 2AXPA 1XI2A 2AQIA 4CM9A 1JKMA 4HNAA 4PYNA 4QHTA 1QGUB 2BMWA 4NV3A 4KR7A 3INYA 4PU0A 5DYYA 4L8FA 5T8KA 3R74A 3OQOA 3ABZA 2R1VA 4HS4A 1M73E 1HE1C 4MUXA 1DXYA 1V11B 3QBEA 5EEGA 4A8PA 5D3MA 1KMHA 4EY5A 4YV2A 3GYGA 4IJUA 4BWYA 5BWNA 3GLFB 2YV3A 1FJGB 3I45A 4IIHA 5BV1A 2G7ZA 3NU1A 1JFFB 5EMMA 5AYVA 4LJKA 2AS0A 1HMPA 1N2GA 1J33A 4H0NA 1Z26A 3AI1A 3LSYA 2FFBA 1YRLA 2VF5X 4NENA 5KOIA 2YFKA 4TTJA 3R5XA 3ZZ1A 3LLCA 2BFEA 2X9QA 1E64A 1N1DA 3KOYA 3LY8A 3ZWBA 2V4MA 3K35A 1H2RS 3PGVA 4DT1A 3MMXA 1YWGO 4WGGA 5A3VA 1LBHA 1FDWA 1X7XB 2QU7A 4WDRA 5AJTA 2DHRA 2FFJA 2WAMA 4MQEB 4GBMA 1EA5A 1WUTA 2D3TA 4WCDA 2PKEA 1JTEA 1XEXA 2WMYA 4FB4A 3C3CA 3B70A 3T5GA 4PHFA 4D6YA 4FDAA 4P84A 4LV6A 1YJ8A 3ONNA 3FNQA 2QVGA 1MVNA 3OE7A 1G8AA 5B55A 3AOEC 2B4KA 2J3IA 4OBXA 2IWHA 2KSQA 2GBGA 3GRFA 2JFUA 3WL4A 2C95A 1QXSA 4LF8B 5DXFA 4YR9A 1K5PA 1NJSA 2Z8YM 3P71T 2Y76A 3NC0C 4CWAA 1L5ZA 2QK4A 2LDXA 1NC1A 4WHMA 2DTDA 1JALA 2Y2VA 4RL6A 3B5IA 4U02A 4BX0A 1XTZA 2IEIA 4BMXA 1BS9A 1ODSA 4X97A 5DMXA 2Q0QA 3NG1A 4V38A 1AS0A 2ID7A 5KC9A 4UC0A 1EP1B 3DW3X 5DBOA 4EF5A 3L7IA 3OT4A 4DPLA 2XVZA 3SR3A 1RSZA 3JD0A 3QVVA 4TV9A 2D2FA 1E5VA 5HKKD 3STWA 1B3BA 2O8BA 3ESRA 3PK0A 3DL7A 3LJKA 2ZIXB 2EQ5A 3WMRA 3CG0A 3AG6A 4RVNA 1UMKA 2FWBA 5FD8A 2YJ4A 3HJBA 1HE3A 4ZEMA 4AZTA 2O4CA 2SHKA 1BG6A 1Z6XA 2X42A 4L8YA 3U09A 5JJ5A 5REQB 5GONA 4QDUA 5KTOA 2JLZA 4YYEA 5KKCA 3GLFA 3TRIA 1N4DA 1YU6A 2I66A 1FIUA 1A88A 2WWFA 2FVYA 2VAVA 2Y0CA 2J8ZA 4H0CA 3UC5A 3W6PA 2I6UA 1KR5A 5GZ6A 2Q3EA 3EVGA 1Y5LA 1FVHA 1BX3A 4WKGA 1REQB 4ZEVA 4KVFA 1I2DA 4NCAA 3WWYA 3UAYA 3TLCA 4FHEA 4J16C 3UK7A 5HZKA 4NSNA 3AXTA 4PLVA 5BT8A 1E3WB 4X0EA 4ARCA 3HA3A 3ERCA 1NRIA 2NNLD 3VM6A 1ZH6A 4H08A 4RKYA 1U9JA 3Q8KA 2VDLB 3LP8A 2VR1A 3W2HA 3SJ7A 2CLOB 2P9CA 4C0JA 1CUBA 4BLVA 3OO0A 1R66A 2AI1A 3DDOA 1BXRB 1S3SA 3REGA 3UA4A 1Q2XA 5A3RA 1YVPA 4GLFA 3A11A 3OQBA 4FP9A 3WK4A 1R8XA 2D2IA 3EP6B 2AUTA 4IFBA 5CDFE 2O1WA 1KDZA 2P1DA 2PRYA 3OIGA 4ZTUB 3THSA 1CUEA 3H6GA 4D5EA 2NZWA 1PJRA 2V7UA 1OFUA 2XVXA 3HABA 4WZAA 5GV8A 1CQJA 2CN1A