2NQYA

Crystal structure of alkaline thermophlic xylanase from bacillus sp. (ncl 86-6-10) with complex xylotriose: xylotriose cleaved to xylobiose and xylose
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
206
structure length
206
Chain Sequence
EIVTDNSTGNHDGYDYEFWKDSGGSGTMILNSGGTFSASWSSVSNILFRKGKKFNETQTHQQVGNMSISYGANFQPSGNAYLCVYGWTVSPLVEYYIVDSWGNWRPPGATPKGTITVDGGTYDIYETDRTNQPSIKGVATFSQYWSTRRSKRTSGTISVSNHFRAWESLGMNMGDMYEVALTVEGYQSSGSANVYSNTLRINGNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAMILY 11 XYLANASE
publication title Crystal structure of alkaline thermophlic xylanase from Bacillus sp. (NCL 86-6-10) with complex xylotriose: Xylotriose cleaved to xylobiose and xylose
rcsb
molecule tags Hydrolase
total genus 58
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2nqyA00
1M4WA 1OA4A 1UU5A 1YNAA 3WP4A 3VZJA 1BK1A 1H4GA 5K9YA 2JEMA 3WQ0A 1C5IA 3MF6A 3WQ7A 1H1AA 1XNKA 4S2DA 2B45X 3WP6A 3AKPA 3AMQA 2B42B 2VG9A 2VGDA 4HKOA 1NLRA 4HKWA 1OLRA 2Z79A 4HK9A 3VZMA 1TE1B 2DCYA 2JENA 1C5HA 3WP3A 3VZNA 4H7MA 3VHPA 1PVXA 5K7PA 1UU4A 1XYNA 4HKLA 3EXUA 1KS4A 2NQYA 1ENXA 1F5JA 3WP5A 3VZLA 1XYPA 3M4FA 4S2GA 3AKSA 1BCXA 1QH6A 1UKRA 2DCZA 3B7MA 2B46X 1UU6A 3VLBB 3VZOA 2C1FA 4XPVA 2BWCA 5EJ3A 3AMMA 1KS5A 1XNCA 2QZ2A 3MFCA 1OA3A 1XYOA 3LB9A 3MFAA 3VHNA 3RI8A 1OA2A 3VZKA 1H8VA 3ZSEA 2BVVA 2QZ3A 3WQ1A 1HV0A 1REFA 3WXPA 3AKTA 3RI9A 3WT3A 2F6BA 2VUJA 1QH7A 4XQWA 3HD8B 3O7OA 2D98A 1T6GC 3VL9A 2DFBA 2DCKA 3WY6A 2DCJA 3AKRA 1XXNA 3AMPA 3VGIA 1REDA 1REEA 3VL8A 1W2UA 3WR0A 2D97A 2NLRA 4IXLA 1HV1A 1HIXA 3AMNA 3AMHA 1IGOA 3WX5A 2VULA 3B5LB 3LGRA 4HK8A 1BVVA 1H4HA 2BW8A 4XQDA 3VHOA 4S2HA 3MF9A 1OLQA 2DFCA 1XNDA 3AKQA 4NPRA 1XNBA 1H0BA 2BWAA 4S2FA 4XQ4A 5HXVA 1AXKA 2JICA
chains in the Genus database with same CATH superfamily
3KT7A 3E5QA 1BMV2 5F5CA 4FXGB 4XJZA 5FBJA 1D2SA 2VXRA 4UFJA 2W1WA 2WSUA 1X33A 2EAAA 3DYMA 3IZOA 3BCWA 3BU7A 5LY2A 4CDUC 5L36A 1HXS1 2W46A 2VO5A 1JOBA 3K4DA 1LHVA 2VZ1A 4IESA 5K4LA 2IFRA 2QBXA 4CDUB 1DQ2A 4DXRA 1QF3A 4PBPA 1UY3A 2R041 4DNYA 1SLTA 5I91A 4EV0A 5SV5A 3R0RA 3BVCA 4NIGA 3VZMA 1TE1B 4LBMA 1XE8A 1J1TA 3AYDA 1YC61 5T5LA 3VZNA 1PMJX 3H1MA 2OIIA 2W94A 5ABJC 4BQ5A 1R091 1RXGA 2ZGQA 2VZVA 3FL7A 1HQNA 4I0WB 1OVSA 1XYNA 2MEV3 2W5FA 3SLIA 1B09A 4F8AA 2D93A 1ZRFA 3AP9A 4N9HA 5ABJB 2ZGKA 3I2JA 2XG3A 4WVZA 1Y9QA 4DZGA 1TG7A 1ZBA1 2VQAA 1JMUB 4DO0A 1CWPA 1PX3A 1MPXA 3CU7A 1DZTA 3H7YA 4QQ2A 1LTEA 5ERLA 2VZRA 1PGL2 4IV3B 2ZHLA 2WFPA 2A6ZA 3ZIXA 4I3GA 2QQOA 3MIEA 5A6QA 1PO22 4TTGA 1NCQB 1VMJA 4E4ZA 4WVWA 3ZFEB 1CX1A 2DBIA 3I97A 3NL1A 4K8FA 1ULDA 3CEWA 3DPRA 4PI0A 3AP5A 1Z0HA 4QD2A 1X9TA 5FFOC 5FPVA 1ND3B 3UKNA 3V64A 4K6BA 3KGLA 5J3UA 1CESA 4ZS2A 2XJPA 4NIDA 1AX0A 2YPDA 2QZ3A 1SMVA 4PT6A 1E5SA 4MSVA 4RN5A 4XFBA 4W6YA 5DABA 4L92A 3NKTA 3OGVA 3VBOA 4DEQA 1CQ9A 5DAQA 3UKVA 5CKNA 4LOTA 1IKPA 1IPJA 1RVF1 4CRQA 2VBBA 2VUDA 1RIRA 4P5YA 3POJA 2HWB2 1IKQA 1DHKB 1QJX1 1MEC1 4Y1VA 1OURA 2MHFA 4JCKA 4EYUA 2XR4A 1O8SA 4JDMA 4Q26A 4DUWA 3FFZA 5K0UA 4BIFA 5IK5A 2WYSA 2CYFA 4LO8A 1CZSA 3ATGA 3M2MA 4KGQA 3H3ZA 1UWWA 4ARYA 2Q1MA 2ZEXA 4OHYA 4J6GA 1W2NA 2CV6A 4I01A 4QKDA 1VPHA 4QGNA 2D6LX 1S55A 2Y0OA 1UX7A 2RS13 2LROA 5A33A 5IFTA 2P1BA 1N47A 4LKDA 1LHNA 1F9KA 3KF3A 4XJWA 4COUA 2HBTA 1CVNA 1MVEA 2JDNA 4CDWA 2YUEA 4CP9B 3HQXA 2B8MA 3WG4A 2JD4A 1LOAA 3A21A 4Q4Y2 2AZ5A 2WN2A 5JXJA 1VBE2 1SFNA 4D7TA 4PBOA 4AI8A 5CG8A 1O6UA 1UY0A 3MIGA 2FCTA 3V65A 2B7YA 5DZGA 1FOD1 4OHWA 3ZXDA 4BQYA 5FPBA 1WUVA 2ES3A 3ALQA 1H1MA 2ZZQA 1SEFA 4COYA 5JZGC 1LOGA 3M8LA 1UW8A 1YFYA 1KXGA 1D4M2 3KQ4B 3SC7X 5L19A 4B7EA 1US3A 5FYZA 4E9KA 1O4TA 4WM8B 4OUMA 3HIFA 2V5DA 2WINB 2GN3A 3DPRC 3H8OA 1AR93 3ZYFA 5A32A 5I0DA 4Y1YA 4WVVA 3D0SA 3LSEA 5JVVA 2DCYA 4M01A 4XDPA 3KWVA 3ZN6A 2EXKA 3TN92 4BWOA 2AENA 3E6CC 3VHPA 3H42B 2EIDA 4PIZA 1DBNA 4QQLA 3VBOC 4A44A 2JE9A 1WBLA 4BDVB 4Y26A 2D6KA 2VW0A 1QJU3 3ILNA 4OUEA 5LA9A 3RS6A 5HCBA 3ZXKA 3HN1A 4OVEA 3B69A 4GH4C 3O1PA 3VBOB 4Z92B 2VNGA 3T2QA 1RINA 1QQP3 3LEGA 5C4WA 5FPUA 3FE5A 4LBQA 5F3CA 5K0UC 2HWD2 4LA3A 2WO3A 4JDNA 3N7KA 5E16A 1I9RA 3NMBA 4V2WA 2ZBJA 5K0UB 3IAQA 3PIGA 3VDDC 2ZX1A 2E63A 3IDBB 2ARCA 2XVLA 3NJVA 1W0PA 3B3QE 3KV5A 1JOJA 3RVHA 5C7GA 3Q8EA 5JSOA 2VMFA 3FHIB 5F1RA 4UOJA 5BXXA 2RMU1 2WZPP 2E7AA 2OW4A 3ES1A 3JD71 4CDWC 2BUKA 4YM1A 2A71A 4NR1A 5C8CB 5FZIA 1WMXA 1WCQA 1SLBA 3TWIA 4AI9A 3BB6A 4Y20A 3PTYA 4WZCA 4LORA 4DPNA 4P14A 2AGSA 4ZU5A 3SH5A 4MLOA 1JUHA 1O5LA 1JW6A 5FY5A 2KD7A 1Q8SA 2VNRA 2A3YA 5A1AA 2X53S 3VDBA 1QDOA 2Q0AA 2VUJA 5IT6A 2VMDA 3LQCA 4XQWA 5JMCA 3LPGA 4E4DX 1F8VA 1V9U3 2JG9B 4FOVA 3LCPA 4QHBA 3QD6A 1DQ5A 3APBA 4IEUA 4XW3A 3AP7A 1W39A 3OGGA 5FZGA 4CSWA 1N3OA 2E7QA 4XXAA 1H6YA 5D2AA 2NMOA 1GOGA 5F9TA 4E4HA 2XH6A 4QPGB 2LS6A 1BBT3 1L3JA 2R042 4DXZA 4AF9A 3NJYA 1W2UA 4Q4X1 1N1TA 1CAWA 3OTFA 2B5HA 5FZCA 4MADA 5BPXA 5KR7A 1YIFA 3GZAA 4HSJA 3N7JA 1JZ7A 1X7NA 2GN7A 5FZ7A 5FZ1A 1BEV3 4QU2A 3ZN6B 4UFLA 5FRAA 3LSDA 4ZXKA 5KC6A 5L9RA 3K4ZA 4A3XA 2QQJA 3PTRB 4CU9A 1H2NA 4GXLA 1GBGA 2Z42A 5BY5A 3AL6A 4OCTA 5C4WC 1TNFA 5E8AA 4J1XA 3TBDA 4EQVA 1FV3A 2G1MA 5JSPA 4UAPA 4LJHA 5DN2A 4E2QA 1YQCA 3BIWE 3KV4A 3Q8CA 5JR2A 4LBQB 1O3SA 1LEMA 4YPJA 5FP8A 3WDWA 1UY4A 2ZMLA 3TNQA 2HKXA 3WQ0A 1X50A 4FOYA 2LTNA 2UU8A 2OZ6A 2RDQA 1ZZCA 4EZHA 4JKKA 5JAXA 3ACGA 3LIGA 3RG0A 4BZ4A 5A1FA 1SDDB 3MUY1 1NA1B 2AUYA 4CA9A 3O14A 3THCA 4FP3A 3VBUA 2MEV1 2ADDA 4GD4A 5F5QA 1G8WA 1RL3A 4FFGA 2VZUA 2GSYA 3D3AA 3I3BA 2C5DA 1EV12 3OGRA 1RUH3 4DOUA 4RHV2 3SITA 4XFGA 2J1EA 1C5HA 1CAXA 1ENSA 2ENRA 3A23A 3J7NA 2VQ0A 1DG6A 2R1BA 2R49A 4QB2A 3RWNA 4Q1PA 3WW2A 1M06G 2J7MA 5LCWL 2B4KA 4LT5A 3PNAA 4CDQA 2ZZJA 3WUCA 1F5JA 1J83A 3DL3A 3THPA 4LO4B 1GQGA 1ULOA 2WO2A 5ACA2 1RUI2 1CIYA 4D7SA 5FY7A 1LHUA 2VBDA 4YM2A 3HEIA 4CTEA 2DCZA 4WBBA 1QWRA 5CFCA 2RM22 1RMU2 3MW2A 1DLCA 1PO23 4W50A 2BERA 5FY0A 3ELNA 1CAWB 3WF4A 1F35A 3F2ZA 1PGW2 4Q2FA 3T4VA 4QHOA 2OUHA 4RGAA 4Y1UA 3ZSMA 1W8FA 5A7SA 4C1WA 2I74A 3ORJA 1XNCA 2Y0IA 4DEVA 1AYM2 1RHI1 2GU9A 5IWFA 2O14A 1R1A3 3VHNA 5L9BA 1S0CA 1L7RA 2OUJA 1MQTC 1UL9A 2HH9A 5T55A 5IUQA 2TEPA 3ZSLA 2R062 1IG3A 4Q4W2 2I07B 2QFEA 4Q8LA 1QH7A 4AVVA 2HWB3 1C8NA 4A3ZA 3LOBA 4IE6A 1PO12 1RUC1 4XUQA 1MZFA 4AGGA 1UIJA 1C1LA 2NMNA 2D5HA 3N9PA 4LA2A 5A7OA 1YXWA 3VBUC 3AJZA 3KVBA 3VD3A 2RJ2A 3ZYIB 1WA4A 1SLCA 1REDA 1LRHA 1PMIA 1OMIA 2TBVA 3PL0A 4WM7A 2Y34A 4FQZA 4MXWB 1AYN1 4M0HA 4QXHA 5T50A 3AMNA 3N3HA 4KBZA 3R4SA 5JCTA 2QQMA 4EN7B 5C3OA 5LZ6A 3ZIWA 3IB3A 3IAPA 3PUAA 4XABA 4XILA 3LGRA 1GNZA 3MIFA 1QY4A 3W20A 3VD9A 1CAXB 3CJXA 4RFRB 1CAUA 4CDQC 1UKGA 4Q4Y3 2XDVA 4C90A 1VBE3 1FNZA 1DYKA 1LGNA 2RDNA 4C8DA 4CVUA 2LM3A 4YZ3A 4B7KA 4CDQB 2HWE3 3ACIA 5GLWA 1PK6B 2XPJA 3FZ3A 1AXYA 1AR91 5A3WA 5KXBA 4CDXA 3BPZA 4XHBA 5L7OA 1CJDA 3D0JA 1N3QA 1H4GA 1PM4A 2QQLA 5DZFA 5B4XA 5CFCC 5K9YA 1D4M3 3AYAA 1PGSA 2O0OA 3NAPA 4IV1C 5E1RA 1X36A 4Y4RA 5CFCB 2WO1A 1QJU1 3JD72 4MGKE 5FZBA 2O1QA 2Y6KA 3B9IA 2AEYA 2EVXA 4QPIB 5FP3A 5CB7A 3TN93 4D0QA 1DQ1A 2VR4A 2YC2A 4AAPA 2D6NA 1LOBA 4QHZA 1BK0A 1QQP1 2CTVA 2W1SA 2O8QA 1AJKA 3MIBA 2CDPA 3JB4C 1OXCA 3T30A 2ZX0A 4LTAA 1OT5A 1COV2 1ST8A 3NNJA 4Z07A 1JOPA 3NNGA 4JKLA 2ZHKA 5HI0A 3C8XA 1CAVA 1J1LA 5GLTA 3HNMA 5CNAA 3BN6A 1HX6A 2FZ1A 1W6QA 1HQLA 2CL2A 4CXXA 4XF9A 2HWD3 5FXXA 4FXKB 1UYYA 3WW3A 3CZUA 3GJAA 4E2SA 4S2GA 3DF0A 4WM7C 1MS1A 4FPGA 3NQHA 1ZYBA 5EJ1B 5EPAA 4FAGA 3GDBA 3DKWA 4LBOA 2XJTA 4U2AA 4G9SB 1OF4A 2QQUA 4XIKA 1YLLA 4N90A 1A78A 1DDLA 4BIOA 2XKOA 4BQWA 2Z4FA 4UFHA 4L2NA 5GZEA 5A3TA 4IE4A 2QZ2A 3BPSA 1VRH3 1VRBA 4HONA 5GALA 2IVIB 1GFF2 2PAMA 4FFFA 1JI6A 5A7WA 3URFA 1H2MA 4AL9A 1QEXA 3LEMA 3MIHA 3KVAA 1BBT1 3HWJA 4FI9A 5C33A 5L7OC 4CDXC 4JGYA 4YW3A 5JOXA 1ULPA 3FWEA 4XFFA 2VY0A 3MEPA 4DB5A 4L8QA 4XC9A 4YZ2A 3NAPC 5A3MA 5JXIA 3OCPA 4QM9A 5CAZA 3KHCA 3M3QA 3WNXA 5AVAA 2YC0A 1SFPA 4BQ2A 1W6MA 3NAPB 1A6CA 4AHYA 2IFWA 3MICA 3VL8A 2QQKA 3VD7A 2UY9A 4JHZA 2GMMA 2WZR2 1HV1A 2R16A 3NO8A 2XQRA 3VBHA 4FPCA 2VNVA 4ZS3A 4BU2A 2A6YA 3ON7A 2E53A 1LECA 2ARAA 4Q5OA 5JI7A 3KB5A 4L97A 3T0AA 4A42A 5J48A 5HPOA 1HB1A 1AXZA 1H30A 2JWPA 4P5HA 4QT6A 3D6EA 3O1RA 1SACA 3MYXA 4ONUA 4Q4V1 4DXSA 5FYSA 1DU3D 3CF6E 2YDEA 1FNYA 1CAVB 1HKDA 1NG0A 2JE7A 4KMQA 3WF0A 1UU5A 2PMWB 1AHSA 2WL1A 4PI2A 1YCIA 2UY8A 4F83A 4OZOA 2GAUA 1FMD2 2PTMA 1RUH1 2VAUA 1JZ2A 2XUMA 5EQUA 5IVFA 1KD7A 3B9CA 3ZYHA 5I8TA 1K5JA 1ZX5A 2ZAAA 2P6CA 4XACA 2R073 4F7ZA 5D8AB 4OI1A 3B01A 5HXMA 3N9QA 1LU1A 1EV13 1UAIA 3POSA 4RHV3 2VJXA 3OBZA 1O7FA 1OFSA 3CJIB 1POV1 2VM9A 1ZZ6A 2V72A 4JVAA 4XF4A 5FZAA 4A7YA 3RZJA 1NZIA 4BHPA 3ILRA 1NCRB 4LBJA 4JGYC 4W65A 2WFF2 5A7WB 3TAYA 5IAVA 3PURA 1W90A 4K1ZA 3RRDA 1ZRCA 3W5MA 3T3YA 3M70A 5KXCA 2WNEA 1ENXA 1XU1A 2X5IA 2ZMNA 1WLWA 1XNAA 4JGYB 5DDJ2 3U14A 4I2OA 1NT0A 2VCCA 3MLLA 1Q8QA 4NIHA 2GC2A 2VOXA 2XVKA 1RUJ3 4MGYE 3HBKA 4JV4A 2YV8A 5FZLA 4AFAA 3N7LA 3WG3A 1R1A1 1RMU3 2RM23 3OBRA 4HG6B 5I8YA 1OD5A 5EWSA 4RQPA 4COZA 4NOTA 3SKJE 3VBHC 3DN7A 4NHXA 3K3OA 3P1IA 3MPBA 3CNAA 5FUIA 4PHZA 2CAUA 1G9DA 4P00B 3VBHB 5J37A 1AYM3 4QGLA 2WNUA 3A0NA 2NN8A 4BLJA 3A0KA 3KV6A 1A8DA 1J3QA 1PIV1 3DXTA 3KF5A 2AH2A 4D6RA 1EAH2 1GNHA 5C5TA 2RG4A 2Z2SB 3POEA 3WW4A 2R063 4E4SA 3WQ1A 5M0TA 2D5FA 1L7QA 2KR2A 3OPWA 4QB6A 3RMXA 3RI9A 3DYOA 2F6BA 4QXBA 4ISRA 2IXCA 3W59A 1QDCA 3HD8B 1AR81 3ST7A 2D98A 3MHZA 3LDKA 1NX9A 3J8F2 4Y1XA 4AWDA 1C4RA 1YI7A 2PHLA 2WN3A 2YBKA 5CVRA 5EYXA 2F4LA 1ONAA 1CX4A 2P6HA 1WW6A 2ET7A 4YG0A 4P9YA 4D6QA 3ZXAC 1IS4A 5F39A 5LBEA 4LULA 3WNPA 2W0XA 4PQ9A 1X8EA 3AJYA 2IC1A 1HRI1 2B9UA 2E33A 3GM8A 4H55A 4E8DA 4Z2WA 4M3CE 2FD8A 4HL0A 2HWE1 1PVC3 3Q8BA 1UNBA 1D2QA 5AC91 3ZM8A 3S7EA 3KM5A 4RL7A 4LLFA 2BW8A 2B39A 5C9AB 2RR11 4XJ9A 1JHNA 2Z69A 3NJZA 3PU8A 4S2HA 3VKOA 1W2AX 1JU4A 3JB8A 4FOQA 4AQSA 4DXTA 2DURA 3ZXJA 2X5IC 5LRRA 1H0BA 1Z78A 5F8PA 2ETEA 4MH0E 1UYXA 4LHNA 4NHKA 2UURA 1AXKA 2JICA 3NV4A 2UWBA 1WZXA 2VUCA 1W9TA 1VAVA 1M4WA 2GC0A 1YNAA 4IV3A 5CG9A 2JIGA 1ALYA 4HVRA 4K20A 2QQWA 1RUG3 2NM1A 4GAZA 4RQPC 4FPKA 5J7MA 3RYPA 1NCQA 1HRV2 1ULEA 1XNKA 4R4XA 4S2DA 3JZVA 4HOOA 3ZFEA 2WZEA 1BZWA 1UXXX 3TRSB 5A3UA 2A73B 2WNUC 1NLRA 3JBG1 4XURA 4OQ9A 5EV7A 4NMIA 3W9AA 2Z79A 2K46A 4ZHNA 2VD7A 1QJY2 2P5BA 5IVEA 3IKWA 3HNYM 2WNUB 3WP3A 3R05A 1W2OA 3WZ1A 1PVXA 3MUZ1 3BTYA 1O3TA 5FZOB 3BOWA 3HPNA 1NXMA 1IHMA 1CR7A 1RUD1 1WGPA 3J7LA 3T2TA 2X10A 4P9IA 4CZSA 1LEDA 3EJKA 4QKFA 3HOBA 2WS92 3LIHA 1DGWX 3MGUA 5FZ0A 2VU9A 3EB7A 3ZVXA 1AL22 3CHXA 4OYUA 3T4HB 3BIEA 2IUWA 4W4ZA 1ZZ9A 1G9BA 3UV9A 1NY71 4LPLA 1YI9A 4XPVA 5FO8B 4GB32 2YU1A 3HR9A 3AZVA 1DGLA 1OD3A 1OPOA 1GZWA 3NJXA 4W6WA 4CP9A 4N7UA 3OSDA 1AZDA 5JPMB 2VOTA 2EIGA 4YW6A 3PUHA 4OLLA 4KL1A 1H2LA 2BNOA 2DWRA 3ZSEA 3RWKX 4BXSV 5C3RA 5CEHA 3H8RA 1D0HA 1XBFA 1TME3 1YWKA 4IV3C 3R4UA 2BEOA 1TQ5A 3WV6A 5FMCA 1HQWA 1R083 2FDKA 3I54A 3RJ2X 4JQTA 3U10A 1NCQC 1UY1A 3T1LA 5IK8A 4KI5M 4WM8A 3ZFEC 1AR72 3H3UA 4LO6B 4XEZA 4YG6A 3AKRA 4B4PA 1YRZA 4M3CA 1ODNA 2TUNA 1ND3C 1V0AA 3E5XA 2YHJA 2JE8A 4XYXA 4ZONA 4YFZA 4HMZA 2WZR3 3GNEA 3IT8A 2NLRA 2QUOA 3ASIA 1MZ6A 4XAAA 1BHGA 4B29A 4DIQA 3G7DA 1FPN2 5H9QA 2CDOA 3AVRA 5FPZA 5FYVA 4JX0A 1LGCA 3NV3A 3IN9A 2BOIA 2I2SA 1VBA1 2OXBA 4Y1ZA 2YGLA 1LESA 1VB4A 3Q9OA 1IS3A 4UT5A 4XJ8A 1WLTA 4NHLA 2VVFA 2E9QA 3ZXEA 5FOBB 2DYCA 2WKKA 2PLV1 3WVJA 5I0SA 3O1MA 1DGRN 5J96B 4JAAA 2BGOA 1UZWA 4YG3A 4YZ1A 3MPPG 1GWKA 5FZ4A 5CIRA 1QHDA 1OF3A 2N7GA 2ZKLA 2R071 1ZBE2 5FYBA 3WP4A 4AI3A 3IDCB 4PIYA 5F2WA 5FYHA 3VUOA 4FP2A 3GALA 1ASJ1 1OUSA 1FMD3 4C0HA 1TMF3 5F6KA 5FO9B 4P9JA 3I49A 3MF6A 3WQ7A 1C28A 3HVDA 4Q0PA 1UY2A 4YARA 1JHJA 1RUE1 4OMDA 4QKNA 4AHZA 4QQHA 3OB8A 4X6RB 1BKZA 3I7DA 3JQWA 4FPHA 5FYUA 5C8CA 4NUBA 2HEVF 2HWF1 4I0BA 3RZZA 1GZWB 4O7XA 4R52A 4FOWA 5A7PA 1PIV2 4AYUA 5T5OA 3THTA 2ZGUA 5LASA 3VDCA 4N53A 2OVUA 3FHQA 5C3PA 3AX4A 4YFWA 1RUJ1 2VCMA 3KT4A 4CPBD 3FMGA 4CU8A 5JUVA 3USUB 1RB8G 1IS6A 2JG9A 1MZ5A 4XJUA 1CIWA 3GXUA 1AR82 1XSQA 1CZVA 4KH9A 4WM8C 4Q8KA 1XRUA 1C8M2 2W52A 3RSJA 4SBVA 4QPGA 3VZLA 3FJSA 3T2OA 2ARBA 1ZZBA 2ZHMA 1VBD3 3OJBA 3IM0A 1FXZA 4ZPIA 2BQPA 4A2UA 4AI0A 4AZZA 2EXIA 1AJOA 4IGOA 1WCKA 4URAA 1QH6A 3MW4A 4UYBA 4M3CB 1U0AA 1KFUL 4XE9A 1HRI2 1UD1A 1X9PA 3ZXGA 2NP0A 2RS53 1NLSA 2XQXA 5FDBA 1OQ1A 1Z7S2 2A7AA 3KHBA 5FPAA 4ES9A 3GCWA 4E27A 4YW5A 2ZOEB 3POFA 4MHRA 2XHNA 4K21A 3K77A 3V0AB 4GMP3 1OH4A 4KG0A 5A7QA 2E7TA 1EAH3 1RUF1 5DQ0A 1OC1A 2QVSB 2VQTA 5A1LA 2UWAA 4IQPA 1OA2A 4QDRA 3WF2A 2ZMKA 3ZMNA 2BVVA 3LFIA 2ZGNA 2B9VA 4Z82A 3S5AA 2JD9A 4ZXEA 4BB3A 3I3DA 5FYTA 3NV1A 4P9XA 2XLAA 2XBO3 2BBAA 4INDA 3HT1A 3ZPOA 4DY5A 2VOWA 2VCAA 3ACHA 4C0BA 2WA4A 5FK7A 4L0PA 1NA1A 1PVC1 5J1XA 3SH3A 1DQ4A 1S0DA 4IGQA 1YIPA 1AR61 3FX3A 2RS31 5C8CC 3POIA 3U37A 2BOJA 2W39A 3GHNA 5JI9A 1W99A 5LATA 3ZXFA 1T2XA 1WCDJ 2XJQA 3K4AA 4OHVA 4CCDA 1O91A 4RFT0 2R32A 4XTMA 3OUHA 3O1SA 5A7NA 4DY3A 2OPKA 4MX3A 3KQRA 4FPLA 2HWC2 4WVMB 2FMYA 3J7MA 1OH3A 2JG8A 4N43B 4Q27A 3U75A 1POQA 4TYSA 4N53B 5FXZA 3FBYA 1BYHA 2JG9C 1RUG1 4K9SA 4MGZE 4YGDA 1VBC1 1OKQA 5T52A 1VBB1 1WWYA 1XNBA 4CCNA 1HXS2 4LBKA 4QPGC 1NAEA 3LZZA 3H50A 5F5AA 1EUUA 4QX2A 5CKQA 4Q0UA 3WNMA 1N1VA 1XSRA 3T09A 3BODA 4A41A 1BK1A 4OZXA 2WZ8A 3RMYA 3ZLIA 5BNOB 1HRV3 3I8TA 1W3XA 4CP0A 5IVVA 4XBLA 1W04A 1C5IA 5EIYB 3INAA 1BXHA 5FKCA 4C91A 2B45X 3VV1A 4AG4A 3OGSA 2WNOA 2ORXA 2WQ4A 5FTTC 1QKQA 5FOJB 1R092 4R9DA 5DXDA 1B35A 1N1YA 4H3WA 4WV8A 3ZR6A 4DUXA 2FDIA 3SHRA 2OA2A 1O3QA 2VQUA 2G19A 3J9SA 3GGLA 1QJFA 4XBNA 4N7IA 2QQPA 1KITA 1ZBA2 1SPPA 3HN3A 5GZDA 2D7FA 2VZOA 4A6OA 1XE0A 1RTVA 1XC6A 2VC9A 1GNYA 2WRAA 3RFRA 4IEYA 4BISA 1CGPA 1KJLA 3H0OA 3PHMA 2A5ZA 1NA1C 3N36A 2XMLA 4IGPA 3IPVA 1XYPA 2K0GA 1AL23 3CKHA 4IE5A 4QQOA 4AQ6A 1UCXA 1D7PM 2P17A 3M4FA 4MXWA 5KHHA 2WT2A 5FO7B 1UO9A 4XCBA 1RITA 2VTFA 4N8MA 1J59A 1OQDA 3KCYA 1E5HA 3KMHA 4JRAA 4QB1A 3PMSA 2BWCA 4UF0A 2J1VA 2A6VA 2JG8C 1TME1 2PHXA 2VPVA 4BOWA 4NE9A 3MW3A 4CXWA 5D1IA 1JODA 1ZA4A 1Q8OA 1R081 2X8KA 4YVSA 2JG8B 2VMCA 1MZEA 3MFCA 1RVF2 2ZEYA 1YJLA 2D44A 1XB9A 5LB6A 4B1MA 3GBFA 3WDUA 2L9LA 1J3RA 1PK6A 2PLV2 1QJX2 1GWLA 1H8VA 3N9MA 5FQ0B 3UGHA 3VZKA 1J58A 1MEC2 3IDEA 2JDMA 2Z5WA 4B8EA 4BYYA 1PZ7A 3U11A 1E5IA 4LEJA 1IQAA 4D69A 5FJKA 1AUYA 3BI3A 3WT3A 1ASJ2 2VE1A 1W6OA 3OUIA 5IJRA 1YO8A 4FO9A 3SCHA 2V4VA 2ZGMA 4OI0A 4O9EA 3BUCA 1RUE2 5HCFA 3ZFFA 1E57A 3HQUA 2DTWA 3RPQA 3AMPA 1DYPA 2PHWA 2DF7A 4XUTA 1XPWA 4MHUA 5DAXA 5JMOA 3RZGA 5FYIA 4QPIA 1B35C 5LA0A 2JKBA 5FZHA 4N9IA 3J7HA 4QX1A 1RUNA 4IE0A 2I45A 2ZACA 3PMEA 2LALA 4XTPA 1MS5A 3RZKA 1B35B 4I0AA 3WDYA 2VULA 4QM8A 4CCEA 5IK4A 3AM2A 1S0BA 3PVNA 1IPKA 2JDYA 4LKEA 2CY6A 2PAKA 4HK8A 3LEIA 1SBDA 1XOYA 3WCRA 4DS0A 5H9SA 5FLHA 1FOD2 1SPPB 2W87A 1OVPA 2EIEA 5FKBA 5FBZA 2RE9A 4M0NA 3WG1A 3WNKA 2K2SA 2CHHA 4UWDA 1BJQA 1HN1A 2YYOA 5DMYA 1NUKA 1UOFA 2Y6FA 3W21A 4XDOA 1H9WA 1ZBE3 2RS11 1CONA 3LA2A 5F6LB 3U1XA 2ZCWA 2QQVA 2PYTA 2VOKA 2UYAA 1G7YA 1LOFA 3IPVB 3PUQA 4EZ4A 4XMIA 5JIAA 4EJRA 4HXCA 3FUOA 5AFEA 5LBBA 3OY8A 4NRQA 4W6XA 1JYWA 3T1MA 3PJYA 1D0GA 3AYEA 4SLIA 5LK5A 3ZYRA 1UOBA 3WQBA 1DQ6A 4UF0B 2YROA 2OKXA 1VIWB 2IXIA 2VGDA 4YVSC 1JZ8A 3GBWA 4HKWA 3UJQA 3KV9A 1HJGA 3KCXA 1UIKA 1PK6C 4MZUA 4AQ2A 2JENA 2Y8KA 4YVSB 2Y6JA 4LHSA 1DCSA 2XVGA 2ZGSA 3O5SA 4O61A 4HBNA 2A75A 4HPKB 3GZEA 3TYJA 3ROUA 3WLUA 4BMBA 3ZYPA 1U12A 4PF1A 2ILMA 2JDAA 3H1WA 2BPA2 4MUVA 2ZHNA 4KWUA 2DBNA 1C8M3 3IDAA 5FYYA 2RS51 3N9OA 5FY9A 3ZFFC 1VMHA 4ISQA 3RNSA 1W6OB 1WMDA 1YQ5A 1VAKA 5BYNA 3O1TA 5FK8A 1RUOA 4QPIC 1EPWA 3OPTA 3ZFFB 1HB2A 2RMU2 1UKRA 4LUKA 4CP2A 4GZ9A 2QKDA 3J26N 5BNQA 1GZ9A 4HT1T 2FDJA 3I2DA 4CCOA 3S57A 4LBLA 1Z7S3 5CU1A 5EJ3A 4PLNA 1G9CA 3EYPA 1ENRA 2ZEWA 2BNNA 4Q0VA 4MVTA 1KS5A 1Q8VA 2XBO1 4QPWA 3L9JT 2Q8EA 4CP1A 4XF3A 1OA3A 1XYOA 2WR9A 3O0XA 1GP4A 3SKVA 3QH6A 3WUDA 3RI8A 1JYIA 3OD0A 4A45A 3MLKA 1SBFA 3OBTA 4MG2A 4LXLA 5F2SA 4Y4YA 2RDRA 2JDUA 4IEZA 1LOFC 4QXCA 1CJPA 4IEVA 5FIXA 4Q4X2 1A3KA 2X29A 5EHDA 2DCKA 3PJQA 3S30A 2ZTNA 1LODA 2P3KA 2RVAA 5D8AA 5DG2A 3OY8B 2X09A 4FBFA 2DU0A 3DV8A 4XUNA 4AEDA 2IXHA 3PVOA 3AXEA 3CJIA 2D97A 3HQRA 3MV01 1A34A 5ANQA 1W9FA 2ZEZA 1V9U1 2E51A 2WT0A 2HWC3 4OMCA 1NCRA 2ID4A 1DFQA 3WHTA 3ZKYA 3NNLA 3E6BA 1LOCA 1LULA 4GMP0 1OSGA 3NW4A 1HN0A 2OQ7A 2Y38A 2VTXJ 3RYKA 3SEPA 1QNYA 2WSVA 1HXS3 3USSA 1ULCA 4XQ4A 2DDUA 2NYYA 2W1UA 1ZRDA 1BEV1 2YY1A 1V6IA 2XOMA 5C3SA 1HJFA 4META 2R043 2AACA 4HN0A 5FMBA 2XJUA 3VZJA 4AHXA 1BLZA 2MEV2 3B00A 4ITCA 4O65A 1GWMA 3KT1A 1UMIA 5JXGA 2NZ9A 5EXOA 1WD4A 3JXSA 5FPXA 2J1SA 4Z2AA 1JYTA 4IEWA 4GJZA 3DYPA 3K75B 4LLOA 5FAXA 5LEKA 1I5ZA 1QGLA 5I8SA 4C1XA 2W3JA 1BMV1 4E2GA 1R093 2VMGA 1UZYA 1F31A 3AMQA 3AZXA 3S7IA 4XETA 3ZN5A 2VECA 4UFMA 3Q8FA 1FX5A 1PHMA 4URTA 1ZBA3 3CDZB 1F4HA 5FP7A 4FFIA 1I5PA 2GMEA 2P4EA 1W06A 1HB3A 3UYJA 2OPWA 4Q0QA 2YFUA 3PIJA 4AVBA 1LR5A 2XGXA 3AK0A 4YW4A 5KWRA 1YJKA 2WIIB 1QXRA 2P2KA 5D8AC 4Y5SA 2WYFA 3UKTA 4GWIA 3ACFA 2Q8OA 5LA2A 4AEDC 2BGPA 1CD3G 5T3NA 2FQPA 3OG2A 5KHKA 2W47A 3CJIC 5TSWA 1W0OA 3OYWB 1IPSA 4OUSA 1RHI2 1W8OA 4IEQA 2D6PA 4KWLA 4AEDB 4HLTA 4KGGA 5GJ6A 2JJ6A 1NCRC 2ZS6B 1O4YA 3BTAA 2PHRA 3G6JB 3VKFC 4AK3A 4TN7A 5J36A 5T5PA 2Q5TA 5LA1A 1Y43B 4RR3A 3ZMOA 3WD5A 2G9FA 4BK4A 5C9AA 1DZQA 2Q1ZB 3ILFA 1NOVA 4CUBA 1HLCA 4RA0A 1JBCA 4Z8BA 4LOSA 2CNAA 1RVF3 2KA3A 1PGL1 4LBNA 3JCIA 4K3UA 1QJX3 2JDPA 4FPOB 5G05L 1UYPA 1RUC2 5FMDA 1PO21 3OEBA 5LBFA 1K45A 4CCJA 5KHIA 5ACA3 1RUI3 1MS0A 2V4AA 4QX5A 1HV0A 1Y7BA 3POWA 5B2GB 5A6ZA 3RJRA 4BA6A 4IETA 4NVPA 1Q8PA 1SLLA 1AX1A 4BQXA 1MS4A 3C2UA 4BM8A 4K40A 1AYN2 4BMEA 2DFBA 4Y24A 1OOPB 2Q1FA 3H9AA 2ZA9A 2DCJA 4ARXA 4JZRA 1XXNA 1ZZ7A 3PVBB 5DUXA 3VGIA 5KBFA 3FLTA 1YQ8A 3BU0A 1WMEA 5FZKA 3VKLA 4D8MA 3LDRA 1GOHA 1W3VA 1YUDA 2VZTA 3RGBA 3FUQA 2HWB1 1IZ3A 1TNRA 4D94A 4BQ4A 3GYDA 1IGOA 3C7OA 2ET1A 4PDWB 5FZOA 3WF1A 1QXJA 3NNMA 1ND2B 2CGOA 3H1YA 3M3CA 3C7HA 4JGZA 4CCCA 4ASLA 1OI6A 3UNPA 1X8MA 3U0ZA 2XHKA 4Q4W3 2NPIA 2DVAA 3ZPYA 1AR92 4GWMA 1ENQA 2F4PA 2VNOA 1PO13 2DFCA 5FLIA 2PQSA 4NPRA 4GJYA 5LWBA 4BK5A 4IE7A 1K12A 5HXVA 4CUAA 3AB0A 1GYKA 1TEIA 1S0FA 2BGCA 4K7JA 4XUOA 1OPMA 1UMZA 2IZWA 5IVCA 1PX4A 1QJU2 1O59A 1LJ7A 3UK9A 1C3HA 2BVBA 2ZGLA 2WAOA 4Q4Y1 1VE0A 2BRTA 1BVP1 2YG0A 1VBE1 5F5IA 5GZCA 4JHTA 1NYWA 4BQ1A 5KXEA 3VBSB 3AFKA 1QJEA 1QQP2 2CU5A 4G4FA 4RR3C 3THDA 5C9AC 5BNNB 1K42A 4QGMA 3I3QA 4BPZA 3AKPA 5FUPA 2DUQA 4UFKA 5CA6A 1QMJA 2DVBA 1QU0A 4RR3B 5DAWA 4XBQA 4IL7A 3LOIA 1KGYA 3PDQA 5JOYA 2GMPA 2O8OA 1D4M1 4ZU4A 5GLZA 3AL5A 4HZFA 4JQRA 1GU3A 3EBRA 3OOXA 4H7MA 2CAVA 5A3NA 4Z1VA 2GH2A 3HJRA 4NO4A 5FYMA 2QDNA 4I09A 2W91A 4XDQA 3TN91 2YBPA 2ARXA 3SQOA 1V6MA 3BYWA 1FI2A 4XFAA 3MI8A 4LHKA 1FAYA 3ENRA 5IHRA 2G9ZA 5DAPA 1GMMA 2V73A 3WF3A 2RMU3 1LU2A 5HV4A 3AKSA 3JD73 1EY2A 3VD4A 3ZKUA 4KWJA 4GULA 5FP4A 1PMHX 4P9WA 3DECA 1V6OA 1G9AA 3O1OA 2RDSA 1IS5A 2PHTA 3P3PA 1SDWA 4JGZC 4CCKA 1QNWA 4M4RA 3RZMA 2R1DA 1DYOA 4FPJA 1JS9A 2HWD1 4AVSA 3SISA 1COV3 2CGPA 4LHLA 1BBT2 2WT1A 2OS2A 4YVWA 4JGZB 5IVBA 4EN8B 3BOPA 1AX2A 2ZJCA 4H7LA 4PLOA 1PM7A 1H1IA 2JB8A 1VMFA 3D82A 4X8PA 3UL2A 1UZ0A 2VZQA 5I93A 2BFUL 3UT0A 1TZOA 2VW1A 2DUOA 3RZLA 2VOVA 1SBEA 1KDKA 1TVGA 3SXWA 5JOZA 4QDQA 1WA6X 4NRMA 1LHWA 2R30A 4QQPA 1PNGA 3VL9A 1VRH1 4EROA 2DUPA 4NAOA 1GZCA 4RGKA 1R1ZA 3ZFGA 5H9RA 4LKFA 3ACLA 4LBQD 4AR2A 2CSGA 5KHJA 1W8NA 5CKMA 4LQRA 1WCSA 3HT2A 4COVA 1AF9A 4PLMA 3BALA 3BGAA 4Q4V2 1S1AA 2QJVA 1IQDC 3ZYBA 4F3JA 2Y60A 3D5OA 3USUA 4B3NA 5HBAA 3EHKA 3BTZA 2Q8CA 1H9PA 5FYCA 4RS5A 1OKOA 2C24A 1GQHA 2SBAA 3MF9A 1O5UA 5C6CA 4NWVA 4OULA 4MGTA 2HYKA 4K1YA 4LR4A 4QWNA 1RUH2 3PVEA 3FLPA 1IG0A 1ZRIA 2AR6A 1WCUA 1GOFA 2PHFA 3U4XA 1W9SA 3T0DA 4ZZ5A 1GICA 3O0VA 1EYBA 4TZDA 2WABA 5FZMA 2RHPA 4QX3A 1O4ZA 3I59A 1JZ4A 5A3PA 4IEXA 3U78A 1J3PA 3LE0A 4EE2A 2OQ6A 3UGGA 4YSFA 1V6NA 1W6PB 5FZEA 2JIJA 2HBUA 1QIQA 1GP6A 4BCUA 1KJRA 3V0AA 1U5YA 2GC1A 1W0NA 3DCQA 3NKGA 2Q30A 4TLFA 4YVWC 2H6BA 2XL9A 5GZGA 3I3MA 4EN0A 4AFBA 4HK9A 4O9GA 1ZZ8A 5JZGA 3IIIA 2A6WA 5F7UA 4KG8A 2BNMA 4YVWB 2PAEA 2HJIA 4HVQA 3ZR5A 2JDZA 4CU6A 1P8JA 3N4MA 5JOWA 4LMFA 4HSLA 1Y4WA 4Y5TA 4R8HA 3VN4A 5L73A 1IOAA 1MR5A 5LW9A 3W5NA 1OBNA 4I02A 1N1SA 4KWKA 5B4NA 1R1A2 1EV11 3U07A 1YQ6A 4RHV1 1MS8A 1QOOA 2Y64A 3QLQA 2YGMA 1V00A 2XL7A 4XMAA 4XXPA 1ZM1A 2DVDA 2P3YA 2ZX3A 2HLEA 3ZFGC 5GKAC 5G04L 3AZZA 1XJAA 4L11A 4UI9L 4WZFA 4Y22A 4Q1RA 1GKBA 3OBAA 4EWAA 3WDXA 4KBBA 1RHI3 3ZFGB 1DP0A 2DCTA 3HMYA 2WBKA 4GH4A 2GNMA 2WNVA 4GALA 2ZGPA 4GQ7A 4EWEA 1CPNA 3VLBB 1G6NA 1U5ZA 4WVMA 4N43A 2X05A 5GZFA 3VKNA 3MLJA 4LO5B 1QJZA 1RUI1 3R6SA 3ZN4A 5ACA1 1MACA 3I2OA 2QTWB 2YU2A 4RS5C 3UGFA 2WFF3 3LAGA 5A70A 4R4ZA 2XJVA 4CEWA 2EIBA 4ASKA 3VDDA 2RM21 1RMU1 2IVJA 3MFAA 1RUC3 3NWKA 4IDZA 3C7GA 4RS5B 5DDJ3 3UETA 4XFIA 4NIAA 4ATEA 5CBLA 4DINB 1PGW1 2ORZA 1REFA 1E5RA 3EO6A 5BNOA 3S0MA 4XJAA 1AYM1 2Y6GA 3JUUA 3VHRA 1AYN3 1LENA 1D4VB 1SQ4A 2V09A 3IIAA 2WLQA 3I59B 3TOJA 2P3JA 1NKGA 1OFNA 2HWE2 2QNKA 5FZ8A 3ZO0B 3BTXA 2R061 1UPSA 1JH5A 1H8TA 2JDKA 4Q4W1 4X6QB 5AC92 2XONA 2W2IA 1XE7A 4LUMA 5FWEA 3W58A 5FZ9A 5FZFA 2RR12 1ZVFA 4AGVA 1DGWA 1PO11 4AW7A 3E5UA 4YLZA 4E8CA 3P6BA 1LNSA 3WHUA 5LRSA 5FWJA 2GP3A 3MZHA 2ZX4A 3AZYA 5GLVA 5JZGB 1VR3A 2E6VA 2D6MA 4CE8A 1H4HA 3NSTA 2QE3A 4PJYA 4FPEA 3TNPB 1EP0A 2WAAA 5LEJA 1OLQA 3J8F3 1XNDA 1RXFA 3DPRB 3FLRA 4YZ4A 2P37A 3B02A 2BYVE 2DV9A 1G9FA 1XNTA 5IFPA 1KDMA 4ASMB 1U5XA 2VW2A 3TEXA 2QDRA 1LGBA 2FDFA 4JTNA 2EXHA 2D6OX 2WNVC 1CPMA 1HW5A 3I2FA 3JBG2 4Q29A 3CL1A 4Y22B 5A80A 4AI2A 3TEZA 4N43C 2WQ8A 4ZY9A 2G9GA 3CMGA 4ZZ8A 3LEKA 4N53C 4COWA 1RJ8A 5KC5A 4GH4B 3OEAA 4RD7A 4W8JA 2WNVB 4XHXA 4OI2A 3SNMA 5C71A 1UOGA 4AGRA 4UW5A 5FY4A 4CEWC 1QOSA 3I2HA 3QCWA 5FQ0A 1OLRA 1QXPA 1RUD2 4HFSA 1A8MA 4CEWB 2YC4A 1UZZA 3I2IA 3VDDB 3ITQA 5K7PA 2J42A 2J22A 4AE2A 5FMOL 1UU4A 4NHYA 5BNOC 5JIUA 3ZDSA 3IMMA 5A33B 2UWCA 4FPYA 3A22A 2YZ4A 4YNIA 2H6CA 3ZSJA 3EXUA 2W92A 3LD8A 3H8XA 5FXVA 1V6LA 4QX8A 5FV3A 4CDWB 1VRH2 4NPLA 1NY72 4Y3OA 5DZEA 3WP5A 5LY1A 1URXA 3F95A 1H8TC 1S0GA 4M00A 1COV1 3CO2A 5A3LA 3WEZA 5JDBA 5J09A 2W08A 1K3IA 3O12A 4QKBA 5JR7B 1H8TB 4AEMA 2B46X 1YEWA 2IXKA 1QJY3 3GHMA 2JX9A 3JU9A 2H0VA 4XZPA 3VZOA 4HVOA 2HEYF 4QU1A 2ZGRA 4QAWA 1DGRA 3N7MA 1OUXA 1ZRRA 1I1EA 3CQOA 3N9LA 1NE4A 3K51A 1SCSA 3U4SA 1CN1A 3WSOA 1U5IA 2BZDA 2J1TA 5IK7A 1PZ9A 4YW1A 4NROA 1WW4A 5A32B 3OUJA 2WS93 5EYYA 4XVHA 1UF2C 2VZ3A 5CISA 1LKNA 1F4AA 2GNBA 2GNTA 2MNGA 5FZDA 2C6SA 3L2HA 4H2AA 1SFYA 4QX0A 5LK7B 2WA3A 3AP6A 4G3YC 4KQ7A 2ZKNA 1Q5OA 4DRRA 1HB4A 1VB2A 5E6HA 2ADEA 2VMEA 4CXYA 3E1F1 2WLPA 4GB33 1MQTA 2ZGOA 4YW7A 4GWJA 3T2PA 1CZTA 4EWDA 4M4PA 4RGGA 2QQNA 5C4WB 3OPZA 1O3RA 3OF1A 1GP5A 4HANA 3FFQA 1S2EA 5K8SA 3WNNA 1VBA2 4AQTA 1C57A 4LITA 2Q4SA 2BP6A 4Q4V3 4XAEA 2D3SA 1ZNPA 1NXD1 2XLGA 4HPKA 3RYRA 5IW0A 1I6XA 2VL4A 4CPBA 4Y33A 2P34A 2V5YA 2LUWA 1SZBA 3LWCA 3KSCA 4FAHA 4BQ3A 2R072 3VB9A 1FYUA 4V2VA 2LW8A 2WZR1 4ATFA 5KXDA 1ZREA 4QX7A 5DUVA 3ZX7A 3O1UA 2A3XA 1JXNA 1N3PA 2D3RA 1AR73 2BWAA 3KLSA 1DF0A 4S2FA 4YM0A 1GSLA 1RGSA 3QBQA 2VBPA 3FBMA 1JU3A 2BFUS 4Y20B 4AFDA 4D7YA 4ZU7A 5JSRA 4AFMA 4B4RA 1MS9A 3SH4A 4H14A 4UBGA 2XWJB 5DG1A 4QDSA 1W28A 2HWF2 2C9KA 2DVFA 3GF6A 2XKPA 1JYNA 4FTEA 1POV3 2PFWA 3NRUA 1QOTA 1H1AA 1WW7A 1Y9MA 2GZWA 3JQXA 3LF7A 3K2OA 4OFGA 4YGEA 1FPN3 4A4AA 5E89A 2H0BA 3KCCA 4UFIA 1NE6A 2FZ2A 2JB4A 1RUJ2 2VG9A 4FCAA 2ZABA 3K3NA 4P02B 4PF5A 3CIHA 4UXAA 5JWPA 2W68A 3PUSA 4MV2A 1JZ3A 1FMD1 5CFDA 1TMF1 5FREA 1ULFA 5ISLA 2DU1A 3AVSA 2FDGA 2MPFA 4IV1A 3D4KA 1LOEA 2VMHA 1NZCA 4PQQA 2BTVC 1FATA 2DVGA 2J1UA 3T08A 2ZGTA 3CBNA 2VH9A 5F37A 2A6XA 4GKYA 4PCRA 3WOGA 4ZKTB 2Q8DA 5CADA 1UMHA 4AEKA 2R7EB 1JYCA 1US2A 2OZJA 1OHFA 4HKLA 4IERA 4AVAA 1JZ6A 3ETPA 4DRVA 2NQYA 5DAVA 4P9GA 4FTSA 3X29B 2OYZA 1W9YA 4CEYA 1W03A 1HDKA 3PUIA 4KU7A 2FCVA 3P5BA 2WFF1 3B94A 1MQTB 3C3VA 2J1RA 4QPYA 3UESA 4NIIA 1S0IA 4LE3A 1JYXA 4J1WA 2RJKA 1FV2A 4IEPA 2WWUA 1PIV3 4NHMA 2ZPXA 1UU6A 1RUF2 5DDJ1 2Y6LA 5IVJA 4FSJA 1DLLA 1JUIA 4MGSA 1UXZA 1VAMA 4AFCA 1GLHA 4JDOA 4AOCA 3O1VA 2QCSB 3WNOA 4MGQA 1I3HA 1VBD1 4XFCA 2KM2A 1PNFA 4NJ4A 1NLQA 1L7LA 4LO7A 2G4IA 3EMRA 4YWAA 3VBRA 2K9ZA 1AR83 3WNLA 3VBUB 4JKMA 3PU3A 3LB9A 5FY8A 3V0BA 3M1HA 1SCRA 1G86A 2ATFA 2ZAHA 1YFWA 2KXLA 2VZPA 1PVC2 1WD3A 2HYXA 4XIOA 1UX6A 1S0EA 2JKXA 2R0HA 3ABZA 4J25A 1AR62 3AKTA 2RS32 1UPIA 2VMIA 1RC6A 3KS7A 2YFZA 5FPLA 4GMP1 5DUWA 1O8PA 4A7KA 3WINE 1HRI3 1EAH1 1T6GC 4EN9B 4LE4A 3A7QA 4LNVA 4AEJA 5F3GA 3OGJA 5AC93 2F17A 2DTYA 4JTOA 4QMAA 3K48A 2GP5A 3NVCA 3TEYA 4B1LA 3GZUC 4OQ8A 2RR13 3Q8AA 4MO3M 4P08A 1REEA 5C3QA 1UQXA 1RUG2 1SHWB 3AXDA 5CFDC 4K8RB 3J8F1 3M7AA 4YZ5A 5GM0A 4XF0A 1VBC2 2JDHA 1VP6A 2GC3A 3AMHA 1VBB2 2XWBB 5FXWA 3AYCA 1W2TA 5CFDB 2EALA 3H7JA 1W8UA 2VUAA 3S5QA 4RYDA 3M3EA 2BDRA 2WWJA 2XB6C 3C7EA 4IV1B 3C7FA 4M3CF 4ES8A 1RYYA 1GQPA 4R9CA 2EXJA 5DPNA 4KU8A 4FFHA 2WC2A 1LCLA 4XCAA 3FN9A 4CEYC 1F15A 2VZSA 5L9VA 4LKSA 4YW2A 4MOAA 2PQQA 3ZSKA 3OYWA 1T6BX 1OA4A 4D3WA 3JBG3 2FDHA 4CEYB 2CGNA 1FT9A 2E31A 1XQNA 4XOGA 1W8HA 2VXJA 4P9LA 4YRDA 3HBZA 2LRPA 4I3PA 5A3OA 2JEMA 4CYDA 5EFUA 4L9BA 1UN1A 1SLIA 4CUGA 5T54A 3S6PA 2J1AA 5EP9A 3WP6A 2AEZA 2C0ZA 4YGCA 2B42B 3VBRC 4RSUA 2VVEA 2W9XA 1GR3A 4HKOA 4NPMA 5JLVA 1UYZA 1RUD3 4LK7A 1AL0G 2WUHA 1HRV1 4WM7B 2A1XA 4A6SA 3VBRB 3NNFA 4AVTA 5HCAA 5F32A 4TWTA 2FHRA 5BUVA 3V0BB 4FTBA 3IBMA 4YYOA 1ULGA 3FHAA 1OOPA 4LK6A 5BNPA 5LBCA 1QJY1 3VKMA 2A3WA 4D6SA 1CAUB 5BV6A 1STMA 2YB7A 4Y5Z0 3H3LA 4IUGA 2C26A 3RQ0A 1TME2 4TXWA 4AI1A 3KD4A 5I0UA 3D8CA 1BCXA 3POYA 1KQRA 4X8NA 5CZKA 4CU7A 2XJSA 1R082 4PDWA 2W95A 2OX0A 1ND2A 2WS91 2WQZC 3VBFA 4CDXB 5L7OB 2XXZA 1J84A 2YXSA 5FY1A 4DQAA 4AXOA 4NRPA 5H9PA 1AL21 1K5MA 2EAKA 3M3OA 2C9AA 4XF1A 1WKYA 2PHUA 3K46A 1V70A 5KHGA 1W6NA 2PHDA 3KGZA 1AVBA 4GB31 3OD4A 3WCSA 4QXKA 1ACCA 2D40A 2PA7A 4NAMA 3ES4A 4PIXA 3MO4A 5FMOS 3DGTA 3LA3A 2CWMA 3WXPA 3ZYJB 3ZDVA 5HV0A 2VTXA 3HAGA 3I4IA 3ME2A 4UBHA 3M3IA 1JZ5A 4AAXA 1W9WA 1EUTA 3LKJA 3O7OA 3MDPA 2YPJA 4JRLA 3SCGA 1S0JA 2A70A 3VBSA 1UZVA 1LB2A 1OLME 5BNNA 1YYNA 2XJRA 5DUUA 3WDTA 1JTZX 4R9AA 3LPFA 5T5JA 3J4UH 2SLIA 1KFXL 2R6QA 1DZRA 1W6QB 4ET7A 1VBA3 2C4XA 4GA9A 1MS3A 3LFMA 3WR0A 5E88A 4TSVA 1XU2A 1TMF2 3T0BA 1X82A 4IXLA 2ERFA 2JECA 3DXUA 2BBVA 1AR71 2PLV3 3WX5A 3B5LB 4BH9A 1MEC3 2XUEA 5F3EA 3GBGA 5FCCA 4MGIE 2RS12 1BVVA 1WW5A 4NWWA 4AHWA 2FMDA 1WLDA 3POBA 1JN2P 1ASJ3 1OOPC 2QQIA 4UW3A 3VHOA 5BNPC 1JYVA 2E26A 4TLGA 1ZA7A 5FR3A 3AKQA 2D43A 1GZTA 3E97A 1RUE3 1FPN1 3CZJA 5BNPB 4OHXA 3GZTB 3MIDA 4MXVA 4V1PA 3WDVA 3HNBM 4FT8A 3I2KA 4ORFA 3AZWA 3ZOIA 2D3PA 2HWF3 1YFUA 1SG3A 1UOJA 3AC0A 4PDWC 3TEWA 3PLQA 3UJOA 1F2NA 5FUNA 3VBFC 1ND2C 2RJLA 5C70A 3WW1A 1VLNA 3H8UA 3POGA 4XUPA 2PELA 1VALA 3BKZA 4R9BA 2R0FA 3SMHA 3O0WA 4L99A 2WDBA 2EA7A 2XLFA 1K5MC 1VBD2 3VBFB 2EF6A 1ZBE1 3A4UA 2P3IA 1YFXA 1FOD3 3SCFA 1OQEA 1W6MB 4IEOA 2IXJA 3WG2A 5FZ3A 3GJBA 1K5MB 5APAA 1H6XA 2W1QA 5GLUA 3ETQA 3DEMA 1VJ2A 3EQEA 1YHFA 4B4QA 4MYEA 2WWSA 4FPFA 2GALA 2RS52 5I0TA 2HEWF 3ZYGA 4UW4A 4EN6B 1W6NB 3QH7A 2IWGB 3MV11 4GWNA 1NQJA 1APNA 5D21A 5IVYA 1F5FA 3L2YA 2AYHA 2VVDA 1Q43A 2GH8A 4FQ4A 2AC1A 2Y26A 5CYYA 3VBSC 1GUIA 3GCXA 1LAJA 1V6JA 4AVCA 4DMIA 4GIQA 1KS4A 5BNNC 3TB0A 3QACA 4Q0SA 2YBSA 2IXLA 3LA7A 2CWSA 2GNDA 3MBWA 5AFBA 1ODMA 1RJ7A 1DQ0A 1Q56A 2BV4A 3QOPA 3ECQA 2FBEA 1W8TA 3FC0A 1POV0 3B7MA 2XBO2 1RUF3 3LDBA 5ANNA 5EJZB 4BLIA 1SLAA 1Y3TA 1C8M1 4UW6A 3IWZA 4CDUA 5JPNB 2C1FA 1W8ZA 2VCBA 2BJSA 4HN1A 2YMZA 3N35A 3RDIA 5IAXA 4YGBA 2UYBA 3AMMA 4FVVA 5FP9A 5HCHA 4A7ZA 1KEXA 3I2GA 4XZUG 4OI4A 4BE3A 1EPZA 1R64A 4GKXA 3V56A 4OHZA 3N9NA 4HETA 5SV8A 1W8WA 1Z7S1 2EICA 1OLMA 2FCUA 1BQPA 3RZHA 1AR63 1DIWA 2Y33A 2JXAA 2RS33 1C1FA 4LIVA 3VD5A 5C5UA 3VDAA 5ABJA 1W05A 4I30A 1KRIA 5FJHA 4CCLA 1NQDA 2PN5A 1W6PA 5IATA 1GV9A 4BJ0A 1WMFA 3NV2A 5C8WA 1V9U2 5F3IA 3IMNA 3KZ4C 3WY6A 3DUIA 1Q3EA 2Y6HA 2ZX2A 4DFSA 2E32A 2X5IB 5I0RA 5IYYA 3CLPA 2GDFA 1MVQA 1V6KA 3B93A 4JC1A 5FLJA 2WJSA 1VBC3 2PXJA 3I3EA 1VBB3 3P3NA 1S4CA 1HIXA 1S2BA 3AFGA 3E6DA 5AVPA 2AREA 4CCMA 1YQ2A 5J98B 2OT7A 1GANA 3DKQA 2BU9A 4RQPB 4U36A 1ND3A 4NN0A 1Y9GA 2RV9A 1BEV2 1WBFA 3R4DB 2ZXQA 1S2KA 4XFHA 4XQDA 5A6YA 4IW3A 4Q4X3 5EZWA 2WO7A 1H2KA 1LHOA 5JXHA 3ZXLA 1PZ8A 4YM3A 2TNFA 4LIUA 4BXFA 4KNCA 2HWC1 4CUCA 5A6XA 1WLCA 3SEEA 3AP4A 5FZ6A 4DUVA
chains in the Genus database with same CATH topology
3KT7A 3E5QA 1BMV2 4FXGB 4XJZA 1D2SA 2VXRA 3SHRA 2WSUA 1X33A 2EAAA 3BCWA 3BU7A 4CDUC 5L36A 1HXS1 1LHVA 4IESA 4CDUB 2IFRA 1DQ2A 1QF3A 4PBPA 2R041 4DNYA 1SLTA 5I91A 4EV0A 5SV5A 3R0RA 3VZMA 1TE1B 4LBMA 1XE8A 1J1TA 3AYDA 5T5LA 3VZNA 3H1MA 2OIIA 5ABJC 1R091 2ZGQA 1HQNA 4I0WB 1XYNA 3SLIA 2MEV3 1B09A 4F8AA 2D93A 1ZRFA 3AP9A 4N9HA 5ABJB 2ZGKA 2XG3A 4WVZA 1Y9QA 4DZGA 1ZBA1 2VQAA 3CU7A 1DZTA 3H7YA 4QQ2A 1LTEA 1PGL2 4IV3B 2ZHLA 2WFPA 2A6ZA 3ZIXA 4I3GA 3MIEA 1PO22 1NCQB 4E4ZA 4WVWA 3ZFEB 3NL1A 4K8FA 4X8PA 1ULDA 3CEWA 3DPRA 4QD2A 3AP5A 1Z0HA 5FFOC 3UKNA 5JOXA 1ND3B 3V64A 4K6BA 3KGLA 5J3UA 1CESA 2XJPA 1AX0A 2QZ3A 1SMVA 4MSVA 4XFBA 3VBOA 4W6YA 4L92A 3NKTA 1CQ9A 3UKVA 1IKPA 1IPJA 1RVF1 4CRQA 1RIRA 2HWB2 1IKQA 1DHKB 1QJX1 1MEC1 4Y1VA 4JCKA 2MHFA 4JDMA 4Q26A 3FFZA 5K0UA 4BIFA 5IK5A 2CYFA 4LO8A 3ATGA 3M2MA 4KGQA 3H3ZA 2Q1MA 4OHYA 4J6GA 2CV6A 4I01A 4QGNA 2D6LX 1S55A 2Y0OA 2RS13 5A33A 1N47A 1LHNA 1F9KA 4COUA 4XJWA 1CVNA 1MVEA 4CDWA 2YUEA 3HQXA 2B8MA 3WG4A 2JD4A 1LOAA 4Q4Y2 2AZ5A 1VBE2 1SFNA 4D7TA 4PBOA 4AI8A 5CG8A 3MIGA 3V65A 2B7YA 5DZGA 1FOD1 4OHWA 3ZXDA 1WUVA 2ES3A 3ALQA 1H1MA 2ZZQA 1SEFA 4COYA 5JZGC 1LOGA 3M8LA 1UW8A 1YFYA 1KXGA 1D4M2 5L19A 4B7EA 4E9KA 1O4TA 4WM8B 4OUMA 3HIFA 2WINB 2GN3A 3DPRC 1AR93 5A32A 4Y1YA 4WVVA 3D0SA 3LSEA 5JVVA 2DCYA 4M01A 3ZN6A 2EXKA 3TN92 4BWOA 2AENA 3E6CC 3VHPA 4PIZA 4QQLA 3VBOC 1DBNA 2JE9A 1WBLA 4Y26A 2D6KA 2VW0A 1QJU3 3ILNA 3RS6A 5HCBA 3ZXKA 3HN1A 4OVEA 3B69A 4GH4C 3VBOB 4Z92B 2VNGA 1RINA 1QQP3 5C4WA 3FE5A 4LBQA 5K0UC 2HWD2 4LA3A 4JDNA 3N7KA 5E16A 1I9RA 2ZBJA 5K0UB 3VDDC 2ZX1A 2E63A 3IDBB 2XVLA 1W0PA 3B3QE 1JOJA 5JSOA 3FHIB 5F1RA 5BXXA 2RMU1 2WZPP 2E7AA 2OW4A 3ES1A 3JD71 4CDWC 2BUKA 4YM1A 2A71A 4NR1A 5C8CB 3TWIA 1SLBA 3BB6A 4Y20A 3PTYA 4WZCA 4DPNA 4P14A 2AGSA 4ZU5A 3SH5A 4MLOA 1JUHA 1O5LA 1JW6A 1Q8SA 2VNRA 2A3YA 2X53S 1QDOA 2Q0AA 2VUJA 5IT6A 5JMCA 4XQWA 4E4DX 1F8VA 1V9U3 2JG9B 4FOVA 3LCPA 4QHBA 3QD6A 1DQ5A 3APBA 4IEUA 4XW3A 3AP7A 1W39A 3OGGA 1N3OA 2E7QA 4XXAA 5F9TA 2NMOA 2XH6A 4QPGB 1BBT3 1L3JA 2R042 4DXZA 4AF9A 1W2UA 4Q4X1 1N1TA 1CAWA 3OTFA 2B5HA 5BPXA 1YIFA 3GZAA 4HSJA 3N7JA 1X7NA 2GN7A 1BEV3 4QU2A 3ZN6B 5FRAA 3LSDA 4ZXKA 5KC6A 4A3XA 1H2NA 4GXLA 1GBGA 2Z42A 5BY5A 5C4WC 1TNFA 5E8AA 4J1XA 3TBDA 1FV3A 5JSPA 4E2QA 1O3SA 3BIWE 4LBQB 1LEMA 3WDWA 2ZMLA 3TNQA 2HKXA 3WQ0A 1X50A 4FOYA 2LTNA 2UU8A 2OZ6A 1ZZCA 5JAXA 3RG0A 4BZ4A 1NA1B 2AUYA 3O14A 3VBUA 4FP3A 2MEV1 5F5QA 1G8WA 1RL3A 2GSYA 2C5DA 1EV12 4DOUA 1RUH3 4RHV2 3SITA 4XFGA 1C5HA 1CAXA 1ENSA 2ENRA 3RWNA 2VQ0A 1DG6A 2R1BA 2R49A 3WW2A 1M06G 4Q1PA 4LT5A 3PNAA 4CDQA 2ZZJA 3WUCA 1F5JA 3DL3A 3THPA 4LO4B 1GQGA 5ACA2 1RUI2 4D7SA 1LHUA 4YM2A 4CTEA 2DCZA 4WBBA 1QWRA 5CFCA 2RM22 1RMU2 3MW2A 1PO23 3ELNA 1CAWB 1PGW2 4Q2FA 2OUHA 4RGAA 4Y1UA 3ZSMA 4C1WA 2I74A 1XNCA 2Y0IA 1AYM2 1RHI1 2GU9A 1R1A3 3VHNA 1S0CA 2OUJA 1MQTC 1UL9A 5T55A 5IUQA 2TEPA 3ZSLA 2R062 4Q4W2 2I07B 2QFEA 4Q8LA 1QH7A 4AVVA 2HWB3 1C8NA 3LOBA 1PO12 1RUC1 1MZFA 4AGGA 1UIJA 1C1LA 2NMNA 2D5HA 4LA2A 1YXWA 3VBUC 3AJZA 3ZYIB 1WA4A 1SLCA 1REDA 1LRHA 1PMIA 1OMIA 2TBVA 4WM7A 4FQZA 4MXWB 1AYN1 4M0HA 5T50A 3AMNA 3N3HA 3R4SA 5JCTA 4EN7B 3ZIWA 4XILA 3LGRA 1GNZA 3MIFA 1QY4A 1CAXB 3CJXA 1CAUA 4CDQC 1UKGA 4Q4Y3 4C90A 1VBE3 1FNZA 1DYKA 1LGNA 2LM3A 4YZ3A 4B7KA 4CDQB 2HWE3 5GLWA 1PK6B 2XPJA 3FZ3A 1AXYA 1AR91 5KXBA 4CDXA 3BPZA 4XHBA 5L7OA 1CJDA 3D0JA 1N3QA 1H4GA 5DZFA 5CFCC 5K9YA 1D4M3 3AYAA 1PGSA 2O0OA 3NAPA 4IV1C 5E1RA 1X36A 5CFCB 1QJU1 3JD72 4MGKE 2O1QA 3B9IA 2EVXA 4QPIB 5CB7A 3TN93 1DQ1A 2D6NA 1LOBA 1QQP1 2CTVA 2O8QA 1AJKA 3MIBA 3JB4C 2ZX0A 4LTAA 1COV2 4Z07A 2ZHKA 5HI0A 1CAVA 1J1LA 5GLTA 5CNAA 1HX6A 2FZ1A 1W6QA 1HQLA 2CL2A 4XF9A 2HWD3 4FXKB 3WW3A 4E2SA 4S2GA 3DF0A 4WM7C 1MS1A 4FPGA 1ZYBA 4FAGA 3DKWA 4LBOA 2XJTA 4U2AA 4G9SB 4XIKA 1YLLA 4N90A 1A78A 1DDLA 4BIOA 2XKOA 5GZEA 4L2NA 2QZ2A 1VRH3 5GALA 1GFF2 2PAMA 3URFA 1H2MA 3MIHA 1BBT1 3HWJA 5C33A 5L7OC 4CDXC 4JGYA 4YW3A 3FWEA 4XFFA 2VY0A 3MEPA 4DB5A 4L8QA 4YZ2A 3NAPC 5A3MA 3OCPA 4QM9A 5CAZA 3M3QA 3WNXA 5AVAA 2YC0A 1W6MA 3NAPB 1A6CA 4AHYA 2IFWA 3MICA 3VL8A 2UY9A 2GMMA 2WZR2 1HV1A 2R16A 3NO8A 3VBHA 4FPCA 2A6YA 1LECA 2E53A 5JI7A 5J48A 3KB5A 4L97A 1AXZA 1H30A 4QT6A 4P5HA 3D6EA 1SACA 3MYXA 4ONUA 4Q4V1 1DU3D 3CF6E 2YDEA 1FNYA 1CAVB 1HKDA 1NG0A 2JE7A 1UU5A 1AHSA 2WL1A 1YCIA 2UY8A 4F83A 2GAUA 1FMD2 2PTMA 1RUH1 2XUMA 1KD7A 3B9CA 5I8TA 1ZX5A 2ZAAA 4F7ZA 2R073 5D8AB 4OI1A 3B01A 1LU1A 1EV13 1UAIA 3POSA 4RHV3 1O7FA 1OFSA 3CJIB 1POV1 1ZZ6A 4JVAA 4XF4A 4A7YA 4BHPA 3ILRA 1NCRB 4LBJA 4JGYC 4W65A 2WFF2 3TAYA 4K1ZA 3RRDA 1ZRCA 3M70A 5KXCA 2WNEA 1ENXA 1XU1A 2X5IA 2ZMNA 1WLWA 4JGYB 5DDJ2 4I2OA 3MLLA 1Q8QA 2GC2A 2VOXA 2XVKA 1RUJ3 4MGYE 4JV4A 2YV8A 4AFAA 3N7LA 3WG3A 1R1A1 1RMU3 2RM23 3OBRA 5I8YA 1OD5A 5EWSA 4RQPA 4NOTA 3VBHC 3DN7A 3MPBA 3CNAA 2CAUA 1G9DA 3VBHB 5J37A 1AYM3 4QGLA 2WNUA 3A0NA 2NN8A 4BLJA 3A0KA 1A8DA 1J3QA 1PIV1 2AH2A 1EAH2 1GNHA 2Z2SB 3WW4A 2R063 4E4SA 3WQ1A 2D5FA 3RMXA 3RI9A 2F6BA 3W59A 4ISRA 2IXCA 1QDCA 3HD8B 1AR81 3ST7A 2D98A 3J8F2 4Y1XA 4AWDA 1C4RA 1YI7A 2PHLA 5CVRA 5EYXA 1ONAA 1CX4A 1WW6A 2ET7A 4YG0A 4P9YA 3ZXAC 1IS4A 4LULA 2W0XA 4PQ9A 1X8EA 3AJYA 2IC1A 1HRI1 2B9UA 4H55A 4Z2WA 4M3CE 4HL0A 2HWE1 1PVC3 1D2QA 5AC91 3S7EA 3KM5A 4RL7A 4LLFA 2BW8A 2B39A 5C9AB 2RR11 4XJ9A 1JHNA 2Z69A 3NJZA 4S2HA 3VKOA 4FOQA 3JB8A 4AQSA 2DURA 3ZXJA 2X5IC 5LRRA 1H0BA 1Z78A 2ETEA 4MH0E 4LHNA 4NHKA 2UURA 1AXKA 2JICA 3NV4A 2UWBA 1VAVA 1M4WA 2GC0A 1YNAA 4IV3A 5CG9A 4HVRA 1ALYA 4K20A 1RUG3 2NM1A 4RQPC 4FPKA 5J7MA 3RYPA 1NCQA 1HRV2 1ULEA 1XNKA 4R4XA 4S2DA 3JZVA 3ZFEA 1BZWA 3TRSB 2A73B 2WNUC 1NLRA 3JBG1 5EV7A 3W9AA 2Z79A 1QJY2 3IKWA 2WNUB 3WP3A 3R05A 3WZ1A 1PVXA 1O3TA 3BOWA 1NXMA 1IHMA 1CR7A 1RUD1 1WGPA 3T2TA 4CZSA 4P9IA 1LEDA 3EJKA 2WS92 1DGWX 3MGUA 2VU9A 3ZVXA 1AL22 1ZZ9A 1G9BA 3UV9A 1NY71 1YI9A 4XPVA 5FO8B 4GB32 3HR9A 3AZVA 1DGLA 1OPOA 1GZWA 4W6WA 4N7UA 1AZDA 5JPMB 2EIGA 4OLLA 4KL1A 1H2LA 2BNOA 2DWRA 3ZSEA 1D0HA 1TME3 1YWKA 4IV3C 3R4UA 2BEOA 1TQ5A 3WV6A 1HQWA 1R083 3I54A 3RJ2X 3U10A 1NCQC 5IK8A 3T1LA 4WM8A 3ZFEC 1AR72 3H3UA 4LO6B 4XEZA 4YG6A 3AKRA 4B4PA 1YRZA 4M3CA 2TUNA 1ND3C 3E5XA 2YHJA 4XYXA 4YFZA 4HMZA 2WZR3 3GNEA 3IT8A 2NLRA 2QUOA 3ASIA 1MZ6A 4B29A 3G7DA 1FPN2 5H9QA 5FPZA 1LGCA 3NV3A 3IN9A 2I2SA 1VBA1 4Y1ZA 2YGLA 1LESA 1VB4A 3Q9OA 1IS3A 4XJ8A 1WLTA 4NHLA 2VVFA 2E9QA 3ZXEA 5FOBB 2DYCA 2WKKA 2PLV1 3WVJA 5I0SA 1DGRN 5J96B 4JAAA 4YG3A 4YZ1A 3MPPG 5CIRA 1QHDA 2ZKLA 2N7GA 4AI3A 2R071 1ZBE2 3WP4A 3IDCB 4PIYA 3VUOA 4FP2A 3GALA 1ASJ1 1FMD3 4C0HA 1TMF3 5F6KA 5FO9B 4P9JA 3MF6A 3WQ7A 1C28A 4Q0PA 4YARA 1RUE1 4AHZA 4QQHA 4X6RB 1BKZA 3I7DA 3JQWA 4FPHA 5C8CA 2HEVF 2HWF1 4I0BA 3RZZA 1GZWB 4R52A 4FOWA 1PIV2 4AYUA 5T5OA 3THTA 2ZGUA 4N53A 2OVUA 3AX4A 4YFWA 1RUJ1 3KT4A 3FMGA 3USUB 1RB8G 1IS6A 2JG9A 1MZ5A 4XJUA 1CIWA 1AR82 4KH9A 4WM8C 4Q8KA 1XRUA 1C8M2 2W52A 3RSJA 4SBVA 4QPGA 3VZLA 3FJSA 2ARBA 1ZZBA 2ZHMA 1VBD3 3OJBA 3IM0A 1FXZA 2BQPA 4A2UA 4AI0A 2EXIA 1AJOA 1WCKA 1QH6A 3MW4A 4M3CB 1U0AA 1KFUL 4XE9A 1HRI2 1UD1A 3ZXGA 2NP0A 2RS53 1NLSA 5FDBA 1OQ1A 1Z7S2 2A7AA 4ES9A 4E27A 4YW5A 2ZOEB 4K21A 3V0AB 4GMP3 4KG0A 2E7TA 1EAH3 1RUF1 2QVSB 2UWAA 4IQPA 1OA2A 2ZMKA 3ZMNA 2BVVA 2ZGNA 4Z82A 3NV1A 4P9XA 2XLAA 2XBO3 4INDA 3HT1A 4DY5A 2VOWA 4C0BA 2WA4A 1NA1A 1PVC1 3SH3A 1DQ4A 1S0DA 1YIPA 1AR61 3FX3A 2RS31 5C8CC 2W39A 3GHNA 5JI9A 3ZXFA 1WCDJ 2XJQA 4OHVA 1O91A 4RFT0 2R32A 4XTMA 4DY3A 2OPKA 4MX3A 3KQRA 4FPLA 2HWC2 4WVMB 2FMYA 4Q27A 2JG8A 4N43B 4TYSA 4N53B 3FBYA 1BYHA 2JG9C 1RUG1 4K9SA 4MGZE 4YGDA 1VBC1 1OKQA 5T52A 1VBB1 1XNBA 1HXS2 4LBKA 4QPGC 3LZZA 3H50A 4Q0UA 1N1VA 3BODA 1BK1A 4OZXA 3RMYA 5BNOB 1HRV3 3I8TA 4CP0A 4XBLA 1C5IA 3INAA 1BXHA 4C91A 2B45X 3VV1A 4AG4A 2WQ4A 5FTTC 1QKQA 5FOJB 1R092 4R9DA 5DXDA 1B35A 1N1YA 4H3WA 4WV8A 2OA2A 1O3QA 3J9SA 4XBNA 4N7IA 2QQPA 1KITA 1ZBA2 5GZDA 2D7FA 1RTVA 4IEYA 1CGPA 1KJLA 3H0OA 3PHMA 2A5ZA 1NA1C 3N36A 3IPVA 1XYPA 2K0GA 1AL23 4QQOA 4AQ6A 1UCXA 2P17A 3M4FA 4MXWA 5KHHA 2WT2A 5FO7B 1RITA 1J59A 1OQDA 3KCYA 3KMHA 4JRAA 3PMSA 2BWCA 2A6VA 2JG8C 1TME1 2PHXA 2VPVA 4BOWA 3MW3A 5D1IA 1ZA4A 1Q8OA 1R081 2X8KA 4YVSA 2JG8B 3MFCA 1MZEA 1RVF2 1YJLA 2D44A 3GBFA 3WDUA 1J3RA 1PK6A 2PLV2 1QJX2 5FQ0B 1H8VA 3VZKA 1J58A 1MEC2 3IDEA 2Z5WA 4B8EA 4BYYA 1PZ7A 3U11A 4LEJA 4D69A 1IQAA 1AUYA 3WT3A 1ASJ2 1W6OA 1YO8A 4FO9A 3SCHA 2ZGMA 4OI0A 4O9EA 1RUE2 5HCFA 3ZFFA 1E57A 2DTWA 3RPQA 3AMPA 1DYPA 2PHWA 2DF7A 4QPIA 1B35C 2JKBA 1RUNA 4N9IA 2I45A 2ZACA 3PMEA 2LALA 4XTPA 1MS5A 1B35B 4I0AA 3WDYA 2VULA 4QM8A 5IK4A 3AM2A 1S0BA 3PVNA 1IPKA 2CY6A 2PAKA 4HK8A 1SBDA 3WCRA 4DS0A 5H9SA 5FLHA 1FOD2 5FBZA 2RE9A 4M0NA 3WG1A 2K2SA 1BJQA 2YYOA 2RS11 1H9WA 1ZBE3 1CONA 3LA2A 5F6LB 2ZCWA 2PYTA 2VOKA 2UYAA 1G7YA 1LOFA 3IPVB 4XMIA 5JIAA 4EJRA 3FUOA 5AFEA 3OY8A 4W6XA 3T1MA 3PJYA 1D0GA 3AYEA 4SLIA 5LK5A 3ZYRA 1DQ6A 2YROA 1VIWB 2IXIA 2VGDA 4YVSC 3GBWA 4HKWA 3UJQA 3KCXA 1UIKA 1PK6C 4MZUA 4AQ2A 2JENA 4YVSB 2XVGA 2ZGSA 3O5SA 4HBNA 2A75A 4HPKB 3TYJA 3ROUA 3WLUA 4BMBA 3ZYPA 1U12A 2ILMA 3H1WA 2BPA2 4MUVA 2ZHNA 1C8M3 2RS51 3ZFFC 4ISQA 3RNSA 1W6OB 1WMDA 1VAKA 5BYNA 1RUOA 4QPIC 1EPWA 3ZFFB 2RMU2 1UKRA 4LUKA 4CP2A 2QKDA 3J26N 5BNQA 1GZ9A 4HT1T 3I2DA 4LBLA 1Z7S3 5CU1A 5EJ3A 4PLNA 1G9CA 1ENRA 2BNNA 4Q0VA 4MVTA 1KS5A 1Q8VA 2XBO1 3L9JT 4CP1A 4XF3A 1OA3A 1XYOA 3O0XA 3QH6A 3WUDA 3RI8A 1JYIA 3OD0A 3MLKA 1SBFA 3OBTA 4Y4YA 4IEZA 1LOFC 1CJPA 4IEVA 4Q4X2 1A3KA 2X29A 2DCKA 3PJQA 3S30A 2ZTNA 1LODA 2P3KA 5D8AA 5DG2A 3OY8B 4FBFA 2DU0A 3DV8A 4AEDA 2IXHA 3PVOA 3AXEA 3CJIA 2D97A 1V9U1 2E51A 2WT0A 2HWC3 1NCRA 1DFQA 3WHTA 3E6BA 1LOCA 1LULA 4GMP0 1OSGA 3NW4A 2Y38A 3RYKA 1QNYA 2WSVA 1HXS3 3USSA 1ULCA 4XQ4A 2NYYA 1ZRDA 1BEV1 2YY1A 1V6IA 4META 2R043 4HN0A 3VZJA 2XJUA 4AHXA 2MEV2 3B00A 4ITCA 3KT1A 2NZ9A 5EXOA 1WD4A 5FPXA 4IEWA 4LLOA 5FAXA 5LEKA 1I5ZA 1QGLA 5I8SA 4C1XA 1BMV1 4E2GA 1R093 2VMGA 1UZYA 1F31A 3AMQA 3AZXA 3S7IA 4XETA 3ZN5A 2VECA 1FX5A 1PHMA 4URTA 1ZBA3 2GMEA 4Q0QA 4AVBA 1LR5A 2XGXA 3AK0A 4YW4A 5KWRA 1YJKA 2WIIB 1QXRA 2P2KA 5D8AC 3UKTA 2Q8OA 4AEDC 1CD3G 5T3NA 2FQPA 5KHKA 3CJIC 5TSWA 1W0OA 3OYWB 4OUSA 1RHI2 4IEQA 2D6PA 4KWLA 4AEDB 4HLTA 4KGGA 5GJ6A 2JJ6A 1NCRC 2ZS6B 1O4YA 3BTAA 2PHRA 3G6JB 3VKFC 4AK3A 5J36A 5T5PA 2Q5TA 1Y43B 4RR3A 3ZMOA 3WD5A 2G9FA 5C9AA 1DZQA 2Q1ZB 3ILFA 1NOVA 1HLCA 4RA0A 1JBCA 4Z8BA 2CNAA 1RVF3 2KA3A 1PGL1 4LBNA 3JCIA 4K3UA 1QJX3 4FPOB 1RUC2 1PO21 5KHIA 5ACA3 1RUI3 1MS0A 4QX5A 1HV0A 1Y7BA 3POWA 5B2GB 3RJRA 4BA6A 4IETA 4NVPA 1Q8PA 1SLLA 1AX1A 1MS4A 3C2UA 4BM8A 4K40A 1AYN2 4BMEA 2DFBA 4Y24A 1OOPB 3H9AA 2ZA9A 2DCJA 1XXNA 1ZZ7A 3PVBB 5DUXA 3VGIA 5KBFA 3FLTA 1WMEA 3VKLA 1YUDA 3FUQA 2HWB1 1IZ3A 1TNRA 4D94A 3GYDA 1IGOA 2ET1A 4PDWB 1QXJA 1ND2B 2CGOA 3H1YA 3M3CA 4JGZA 4ASLA 1OI6A 1X8MA 3U0ZA 2XHKA 4Q4W3 2NPIA 2DVAA 3ZPYA 1AR92 4GWMA 1ENQA 2F4PA 2VNOA 1PO13 2DFCA 5FLIA 4NPRA 5HXVA 3AB0A 1GYKA 1TEIA 1S0FA 2BGCA 4K7JA 1OPMA 1UMZA 2IZWA 1QJU2 1LJ7A 3UK9A 1C3HA 2BVBA 2ZGLA 4Q4Y1 1BVP1 1VBE1 5GZCA 1NYWA 4BQ1A 5KXEA 3VBSB 3AFKA 1QQP2 4G4FA 4RR3C 5C9AC 5BNNB 4QGMA 4BPZA 3AKPA 2DUQA 5CA6A 1QMJA 2DVBA 1QU0A 4RR3B 4XBQA 4IL7A 3LOIA 5JOYA 2GMPA 2O8OA 1D4M1 4ZU4A 5GLZA 4HZFA 4JQRA 3EBRA 4H7MA 2CAVA 4Z1VA 2GH2A 4NO4A 2QDNA 4I09A 4XDQA 3TN91 2ARXA 1V6MA 1FI2A 4XFAA 3MI8A 4LHKA 1FAYA 3ENRA 2V73A 2RMU3 1LU2A 3AKSA 3JD73 1EY2A 4KWJA 4GULA 4P9WA 1V6OA 1G9AA 1IS5A 2PHTA 3P3PA 1SDWA 4JGZC 1QNWA 2R1DA 4FPJA 2HWD1 4AVSA 3SISA 1COV3 2CGPA 4LHLA 1BBT2 2WT1A 4YVWA 4JGZB 4EN8B 3BOPA 1AX2A 2ZJCA 4H7LA 4PLOA 1PM7A 1H1IA 3D82A 3UL2A 5I93A 2BFUL 2VW1A 2DUOA 2VOVA 1SBEA 1KDKA 3SXWA 5JOZA 1LHWA 2R30A 4QQPA 1PNGA 3VL9A 1VRH1 4EROA 2DUPA 1GZCA 1R1ZA 3ZFGA 5H9RA 3ACLA 4LBQD 5KHJA 1WCSA 3HT2A 4COVA 1AF9A 4PLMA 3BALA 4Q4V2 1S1AA 2QJVA 4F3JA 5HBAA 3D5OA 3USUA 4B3NA 3EHKA 1H9PA 4RS5A 1GQHA 2SBAA 3MF9A 1O5UA 5C6CA 4NWVA 4OULA 2HYKA 4K1YA 4LR4A 1RUH2 3PVEA 3FLPA 2AR6A 2PHFA 3U4XA 1GICA 3O0VA 1EYBA 4TZDA 2RHPA 1O4ZA 3I59A 4IEXA 1J3PA 4YSFA 1V6NA 1W6PB 4BCUA 1KJRA 3V0AA 1U5YA 2GC1A 4TLFA 3NKGA 2Q30A 4YVWC 2H6BA 2XL9A 5GZGA 4EN0A 4AFBA 4HK9A 4O9GA 1ZZ8A 5JZGA 2A6WA 4KG8A 2BNMA 4YVWB 2PAEA 2HJIA 4HVQA 2JDZA 3N4MA 5JOWA 4HSLA 4R8HA 3VN4A 5L73A 1IOAA 1MR5A 4I02A 1N1SA 4KWKA 1R1A2 1EV11 3U07A 4RHV1 1MS8A 1QOOA 3QLQA 2YGMA 1V00A 2XL7A 4XMAA 4XXPA 1ZM1A 2DVDA 2ZX3A 3ZFGC 5GKAC 3AZZA 4L11A 4WZFA 4Y22A 4Q1RA 1GKBA 4EWAA 3WDXA 4KBBA 1RHI3 3ZFGB 2DCTA 3HMYA 4GH4A 2GNMA 2WNVA 4GALA 2ZGPA 4GQ7A 4EWEA 1CPNA 3VLBB 1G6NA 1U5ZA 4WVMA 4N43A 3VKNA 5GZFA 3MLJA 4LO5B 1QJZA 1RUI1 3R6SA 3ZN4A 5ACA1 1MACA 4RS5C 2WFF3 3LAGA 4R4ZA 2XJVA 4CEWA 3VDDA 2RM21 1RMU1 3MFAA 1RUC3 3NWKA 4RS5B 5DDJ3 4ATEA 4XFIA 5CBLA 4DINB 1PGW1 1REFA 3EO6A 3S0MA 5BNOA 4XJAA 1AYM1 3JUUA 3VHRA 1AYN3 1LENA 1D4VB 1SQ4A 2V09A 3IIAA 2WLQA 3I59B 3TOJA 2P3JA 1OFNA 2HWE2 2QNKA 3ZO0B 2R061 1UPSA 1JH5A 1H8TA 5AC92 4Q4W1 4X6QB 1XE7A 4LUMA 3W58A 2RR12 1ZVFA 4AGVA 1DGWA 1PO11 4AW7A 3E5UA 4YLZA 5LRSA 3WHUA 3MZHA 2ZX4A 3AZYA 5GLVA 5JZGB 1VR3A 2E6VA 2D6MA 1H4HA 3NSTA 2QE3A 4PJYA 4FPEA 3TNPB 1EP0A 5LEJA 1OLQA 3J8F3