2NQYA

Crystal structure of alkaline thermophlic xylanase from bacillus sp. (ncl 86-6-10) with complex xylotriose: xylotriose cleaved to xylobiose and xylose
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
206
structure length
206
Chain Sequence
b'EIVTDNSTGNHDGYDYEFWKDSGGSGTMILNSGGTFSASWSSVSNILFRKGKKFNETQTHQQVGNMSISYGANFQPSGNAYLCVYGWTVSPLVEYYIVDSWGNWRPPGATPKGTITVDGGTYDIYETDRTNQPSIKGVATFSQYWSTRRSKRTSGTISVSNHFRAWESLGMNMGDMYEVALTVEGYQSSGSANVYSNTLRINGNPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAMILY 11 XYLANASE
publication title Crystal structure of alkaline thermophlic xylanase from Bacillus sp. (NCL 86-6-10) with complex xylotriose: Xylotriose cleaved to xylobiose and xylose
rcsb
molecule tags Hydrolase
total genus 58
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2nqyA00
1UU6A 2BWCA 3VZJA 1C5IA 5HXVA 4XQ4A 3WR0A 4XPVA 1XNCA 4XQWA 2B45X 3AKSA 3B7MA 4HKOA 4HKLA 3AMQA 3LGRA 1C5HA 1OA3A 1HV1A 1QH7A 3O7OA 1UKRA 1XNDA 3RI9A 2BVVA 1UU5A 2DCYA 4HK8A 1HV0A 2B46X 3VGIA 2BW8A 3WP5A 2DFCA 2NLRA 2QZ2A 2DCZA 3AMMA 1H4GA 2BWAA 3WX5A 1ENXA 1OA4A 3WT3A 1REDA 1IGOA 3WQ7A 3WXPA 1H4HA 1XNKA 2NQYA 4HK9A 3LB9A 3AKPA 1UU4A 1OLQA 1TE1B 1H0BA 2B42B 1H8VA 3WQ1A 4S2GA 4H7MA 3AMHA 4XQDA 1REEA 1W2UA 1YNAA 1AXKA 4IXLA 1KS4A 3RI8A 1T6GC 4S2DA 3MFCA 3MFAA 1XYOA 1XXNA 2VGDA 4NPRA 2QZ3A 3VZOA 2DCKA 1BCXA 3EXUA 3VZLA 1KS5A 1XYNA 5K9YA 3VHNA 3WP3A 1F5JA 4HKWA 5K7PA 3VHOA 2JEMA 2VULA 1OA2A 1HIXA 3VZKA 2Z79A 3MF6A 3MF9A 1BK1A 3VL9A 2JICA 1XNBA 1OLRA 2DCJA 3VHPA 3WP6A 3M4FA 1H1AA 2D98A 3VZNA 2D97A 3ZSEA 2JENA 3AMNA 1REFA 1BVVA 3WP4A 5EJ3A 2F6BA 3HD8B 1M4WA 3VL8A 1PVXA 1QH6A 2DFBA 3WQ0A 2VG9A 3B5LB 3WY6A 1XYPA 3VLBB 3AKTA 4S2HA 3AMPA 4S2FA 2C1FA 3VZMA 2VUJA 3AKQA 1NLRA 3AKRA
chains in the Genus database with same CATH superfamily
3DECA 1JW6A 4OHXA 5C3OA 2TEPA 5J48A 3W5MA 3VDDA 1PVC2 2C4XA 1DQ4A 3HT2A 1C8NA 1D2QA 2ADEA 1Q8OA 2WAAA 4NAOA 4A4AA 3U4XA 1RUJ3 1CVNA 1UKGA 5DUXA 2W47A 1J84A 3O1OA 1IKQA 4NOTA 4UFLA 5FMCA 3I2KA 5J98B 2OVUA 1OUXA 1FV3A 3INAA 3KV9A 3U37A 4E27A 1W0NA 3VHRA 4OLLA 2WZR2 1N3OA 5FZ8A 1AZDA 3AMQA 4FAHA 1AL0G 4QKNA 3WEZA 5FXZA 1BLZA 1CD3G 2HWC1 5ACA2 1JH5A 1IS5A 1IKPA 2WAOA 2PMWB 3A23A 5EZWA 3S30A 1AL22 3VBOC 4D7YA 1COV2 3JB4C 4URTA 5T5OA 3ETPA 4AVAA 4XE9A 1GNHA 4BQWA 5LCWL 3B9IA 3FWEA 2V09A 4AFCA 4LHKA 1K5MB 2VMFA 3TN93 3K51A 1L3JA 1Q8PA 2XR4A 2VMIA 2HWB2 2AREA 2H6CA 2C9AA 4D69A 4Q4V3 4YVSC 1ZVFA 4JHTA 5LA9A 5IFPA 3N7MA 4OI0A 3PUIA 4DPNA 2XQXA 2LALA 2P37A 4XAEA 3BTXA 1HB3A 2W9XA 4LK6A 1CX4A 2QTWB 1DBNA 4AHZA 2XWJB 1S0IA 3NV2A 1SLBA 2VMGA 2Y26A 1FI2A 1S0JA 4MGYE 1DG6A 4DOUA 3IZOA 5FBZA 4TLGA 3MUZ1 1HXS1 1RUD2 4UW5A 4P5YA 3I97A 4CP2A 3AP5A 1MS9A 3KF5A 4OMCA 3SC7X 5JZGC 3PUAA 4GAZA 4BXSV 1UAIA 2YFZA 2UWBA 2VTXJ 5LK7B 2Q30A 4LT5A 5HI0A 2A6WA 3VZLA 1AR82 2MEV2 3I8TA 2BERA 4YGBA 5LW9A 3OYWA 3WP3A 4QQPA 3WDVA 4OULA 2D44A 1AR92 4MUVA 3ZM8A 2R061 2JEMA 4O7XA 3F2ZA 4IGPA 2VULA 3B69A 3ZIWA 4KWJA 5LEKA 4MGTA 1C8M1 5ANQA 5JR7B 1HDKA 4FAGA 5C4WC 5F8PA 5F7UA 2R041 4TXWA 4XJAA 2D40A 5FZOB 1QGLA 3BIWE 1UY4A 3WP6A 5CFDA 3SEPA 3VBUB 2ZA9A 2Y6GA 1K5JA 4N9IA 5DZGA 5BNOB 2RR11 1YQ5A 3AL5A 2B9UA 1A34A 2JENA 2ZABA 1WCSA 4IGQA 4X6QB 3WG3A 1AYN2 3FC0A 3H7YA 4CVUA 4Z2AA 2GNDA 5FLJA 1PM4A 2IUWA 5K4LA 1VB4A 1QJFA 2DWRA 3TB0A 2E7QA 1DLCA 5A3PA 2RJKA 4QPGA 5J09A 1LENA 3VBSC 4AHWA 4CXYA 1Y9GA 4D8MA 5K0UC 4N8MA 1UYZA 2ADDA 1XPWA 3JD73 4AVBA 2UURA 1O91A 1O6UA 5AFEA 2FDGA 1VLNA 1DHKB 1G7YA 1NXD1 1RTVA 1H9PA 3AL6A 4OI2A 2EIDA 5FZ9A 3SEEA 4MGQA 2XBO1 4AI3A 2DV9A 4DB5A 5EQUA 1JYWA 1JODA 2BNMA 5T5JA 1ND3A 2AEZA 2A7AA 3HMYA 5A7SA 2QQWA 1U0AA 2XJPA 2W1QA 1RUF1 3MIHA 4WM7A 5BV6A 1NT0A 3GM8A 2W68A 2ZMNA 3T3YA 1U12A 2KR2A 1CPMA 1D0GA 2OXBA 3L2YA 5C9AC 2FZ2A 4B1LA 2P3KA 4WZFA 1OA3A 4CSWA 4IEYA 4NHKA 5D2AA 3EHKA 4E4SA 1A3KA 1ZZBA 3DPRB 4FPKA 4CUBA 4HK8A 5A7OA 1G86A 1RUJ2 5JMCA 1A8MA 1WD3A 2XQRA 1JUIA 1V6MA 3H0OA 4IEPA 1T2XA 3NL1A 3OF1A 4KH9A 4W6XA 5JVVA 3H3UA 1PX4A 1UX6A 5EYYA 3ABZA 5FYUA 5A7PA 3WV6A 1WMXA 4CEWC 1I9RA 4GQ7A 4QX3A 3WX5A 5AVAA 2GAUA 3OGGA 4ES9A 1H4HA 2VCCA 1VRBA 1IS6A 2VPVA 2XVKA 3ZVXA 3VBFA 1MVQA 3ZYHA 2WO2A 1MQTC 1JZ8A 5J3UA 2FDHA 5A3LA 1HJFA 4AHYA 1LOAA 3KV6A 4WM8C 2K46A 4BMBA 5C3PA 3TN92 4CYDA 3O1MA 1GYKA 3AP9A 5EJ1B 4XDQA 1RXFA 3N7KA 4CDWC 1HLCA 3I3QA 5LBEA 4UFMA 3ES1A 3V0AA 2K0GA 5KXBA 1BBT3 1OKOA 2R0FA 3EO6A 3EJKA 2P3JA 2WYFA 1AUYA 3WNOA 3OUHA 1VB2A 2BZDA 4CXWA 1F5JA 2ZEWA 5A7NA 1TMF3 4HKWA 4XFBA 3WCSA 1Q8QA 1E5IA 1HW5A 4QXCA 1FNZA 4GJZA 4I30A 3OY8A 3Q8CA 4IW3A 4LE3A 4GH4A 3UETA 5FR3A 1JHNA 1UIJA 3KB5A 2H0BA 3NQHA 2HYKA 1W6OB 1OPMA 3H8RA 2QNKA 3VD5A 4CDXB 2DCJA 3CBNA 5FPAA 4EN7B 2J1SA 1QDCA 3E5QA 4RL7A 4XUOA 5CZKA 3WHUA 4AEKA 4BYYA 4E2QA 1JOJA 5FMDA 4CCJA 3RZMA 1MVEA 1QF3A 2NYYA 3D0JA 5KHIA 3I7DA 4NWWA 5L7OB 4BLIA 4PI0A 3I49A 4XBQA 3H8UA 2HBTA 4O65A 1SDWA 3MLJA 4QQLA 4RFT0 4YRDA 5FJHA 1S0EA 4F83A 2ZAAA 2DTWA 4QX5A 4UWDA 3T1LA 3ON7A 3WF4A 4NJ4A 5ISLA 2OQ7A 4E4ZA 2VAUA 4URAA 4JHZA 3R4SA 4F8AA 5LY1A 2R30A 2VJXA 1A78A 4SBVA 4CZSA 5KXEA 4E4HA 5G04L 1F4HA 2YFUA 2JG8A 4QB2A 2RDRA 1WMEA 1HRI2 3LFMA 4Q4W1 2QJVA 3WSOA 2A71A 5FPVA 3QCWA 4JGYC 1DQ5A 1B35B 1NZIA 1FPN1 4DUWA 2WZ8A 4L8QA 2PLV3 4XURA 4CCEA 2QQVA 3WNPA 3ZFGC 5FY9A 2IC1A 4AAPA 4DS0A 4TZDA 5JZGA 2D43A 1GZTA 4L97A 1PK6C 3ST7A 1UKRA 1LEDA 1GSLA 4RS5C 5IK7A 2DVAA 5LRRA 5IVFA 5BXXA 3T2QA 5HV4A 4Y20B 4MLOA 3DKQA 5HCBA 2A6YA 5C4WA 5DAQA 4AEDA 2RM23 2ZGRA 2VM9A 3LDBA 4LNVA 5I0UA 2VCAA 1LU2A 2KD7A 1AX1A 1QJU3 1XC6A 3AZZA 3OPWA 2NQYA 1FOD2 2R1DA 2LRPA 5FWJA 4B3NA 2JB8A 4BMEA 2PELA 5D8AC 2BNNA 2VQAA 2C9KA 4H2AA 3O14A 4YZ5A 4Y22A 4Q4X1 2NMNA 1YQ2A 4YZ3A 3WW3A 1IOAA 2J1RA 3GDBA 1F15A 3PDQA 4OCTA 1NA1B 4HN1A 5C8CB 2VTFA 4AI2A 2HWE3 1TEIA 5T54A 3VDAA 2WS93 1BYHA 1LGCA 4BHPA 3K46A 4HG6B 2VZ1A 1APNA 4Y5TA 5E16A 5CFCC 1VJ2A 2R0HA 2VUAA 4XIKA 1LU1A 5FAXA 2WNVC 1VMJA 3T2OA 2EIBA 1TME1 3I59A 3VBFB 4PLOA 4AFDA 5FY1A 4WBBA 5HBAA 2WO3A 4PT6A 3ZXEA 2E6VA 4CCKA 4XUNA 2OZJA 5FQ0A 3DXUA 2OX0A 3V65A 1BKZA 1ACCA 1R64A 2JG9B 3PUQA 1XNBA 1QNWA 2FMDA 5FZGA 5C9AA 2PFWA 3W5NA 5CBLA 1CONA 3KCYA 2YU2A 1CPNA 1QU0A 4DRVA 1RHI3 5F2SA 4DZGA 3ZKUA 3V0AB 1XBFA 1NX9A 2WSUA 1IPSA 2DVGA 1TMF2 1YO8A 2XWBB 5FZMA 4TLFA 2BBVA 2RS13 4PF5A 1SPPA 2EXIA 2JX9A 4MGSA 2QQIA 5IVCA 5ERLA 4CEWA 4DXTA 3LWCA 4YG6A 5JSRA 4RGKA 5DDJ1 2ZXQA 5F5CA 4DXRA 5CA6A 5HV0A 4AVVA 1Z7S1 2WA3A 1NLSA 5EPAA 3ILRA 3NNLA 4Y1ZA 1FXZA 2VOKA 2VCMA 4WVMB 4GMP3 1JS9A 3UT0A 5FYSA 1EP0A 2IVIB 1I1EA 3FHIB 3KM5A 4QX0A 4O9GA 4EROA 4ZZ5A 4X8NA 4AXOA 3HNBM 4WM8A 2WN3A 3VBOB 3LFIA 1GWLA 4KQ7A 1UYXA 1W3VA 4JGZC 3NNFA 3GBFA 2EAKA 5HXVA 1VMHA 3K48A 4LLOA 1ULDA 5FPXA 5F5AA 3BN6A 4F3JA 3O1UA 1JZ5A 3AKSA 4QU1A 3DF0A 3RVHA 4OMDA 1GP5A 1EAH1 1YQ6A 4PJYA 2WRAA 2JE9A 1MZEA 4DEQA 1ZM1A 4N43A 5DAWA 4YVSB 4C90A 4ZU4A 2OA2A 3BIEA 4ZS2A 5FPBA 1NE4A 4FPHA 1W2AX 3PVOA 5FOBB 4XJ9A 1LKNA 2QCSB 3M3OA 5KHKA 3PL0A 1H6YA 2FDKA 2VZQA 4QKFA 3BYWA 3U0ZA 1H2MA 2CDOA 2EAAA 2ARAA 1PIV1 1PMHX 4CCOA 4MHRA 1QOSA 1SFPA 4A42A 1UY1A 3PTRB 2Z2SB 3M7AA 1T6BX 1ENXA 1YUDA 2ZOEB 3HIFA 5JXJA 5JCTA 1DCSA 4BJ0A 4LBLA 4L11A 1NCQC 2Z4FA 1KITA 5FCCA 1VBC1 2BGCA 3QD6A 3MW2A 4DY3A 4HZFA 5JZGB 1KQRA 1FYUA 1WD4A 1UMIA 4GKYA 1NYWA 1DQ6A 3RSJA 1AYM1 1W8UA 5DUUA 3J7MA 5FDBA 1W6PA 1AJOA 2B42B 2BOJA 2TNFA 1H8VA 1RMU2 1ENSA 1CAWB 2W39A 1CJDA 2ZGSA 1NY72 2YV8A 3MPBA 5CIRA 1GOHA 2OKXA 3K3OA 4RQPC 4XCAA 3VBRC 1BQPA 2ZBJA 1CAUA 3C7GA 1PZ8A 1HN1A 4V2VA 1KS4A 3WDTA 1CZSA 4Q4Y3 5C4WB 2I45A 3H9AA 2A5ZA 2BDRA 1XXNA 3WZ1A 1MR5A 4HPKA 2VQUA 5KHGA 2W95A 1R1A1 4Q1RA 3S5QA 5LBBA 4R4XA 4FPCA 4PLMA 1OI6A 1JOPA 2ORXA 3RZLA 1F9KA 1ULGA 5T50A 1MPXA 5F1RA 5FV3A 1G9FA 4M0NA 1O8PA 2E9QA 3R4UA 4JGYA 4MHUA 5DXDA 1HRV3 3ZYIB 2HWE2 4Y22B 2ES3A 2VBDA 4YW2A 3WW1A 1LTEA 3AM2A 1OUSA 3T08A 1LGBA 3J8F2 2RS33 1YFUA 3VBSB 4P08A 5K0UB 1YFYA 3USUA 3U1XA 3BODA 5A6YA 5CU1A 2Q8CA 4BQ5A 4XF4A 3WG4A 4RD7A 4Z92B 1RUE3 4E2GA 4BU2A 3KT4A 1BZWA 1CIYA 1N1TA 3J7LA 2B5HA 5JOXA 2ZX3A 1S55A 2HEVF 2HLEA 3ZIXA 3WNLA 5KBFA 2A6ZA 1O5LA 1W04A 2B8MA 5GLVA 3ZXFA 1TZOA 1DYKA 3ZSKA 1UXZA 1WA6X 5CVRA 1RHI2 4KL1A 1Z78A 1EYBA 5C9AB 4FOVA 2TBVA 1W8TA 2VNOA 3AP6A 3BTYA 1QQP1 3M3CA 4PCRA 2WWUA 1TVGA 5E6HA 1PVC1 5IVEA 5FYMA 1C4RA 2PHTA 3VZJA 5FZ1A 4CU9A 1SCRA 2GNMA 4Y3OA 1HKDA 5I91A 1AR73 2C26A 1URXA 5IT6A 1AR62 2ARCA 1AX2A 1TQ5A 3CEWA 3DEMA 2PHFA 3QACA 4CEWB 4QM9A 2P6CA 2WZR1 4QPIC 5F3CA 3BALA 4M0HA 2ILMA 5CFCA 1HN0A 4LA3A 4UFIA 5ACA1 2WNVA 3LPFA 4OUEA 1NUKA 2VZRA 4YLZA 1SFYA 2WIIB 3K2OA 2VZOA 5FP7A 5AC93 1CZTA 1MQTB 5T55A 1G8WA 3E1F1 4YWAA 4BIOA 3LOIA 4XUQA 4A7YA 4XACA 2XKPA 4H3WA 4WM8B 4UOJA 1YHFA 4AFAA 4AI1A 5FOJB 4EWDA 3WF0A 4FTBA 1W3XA 5KHJA 4CDWB 1U5YA 1WW4A 4KBZA 1K5MA 1AL23 3M3EA 1UF2C 1COV3 3M70A 4NHMA 1REDA 1O7FA 1OC1A 3NJXA 4QMAA 5F2WA 4A45A 2CTVA 1W8NA 2WFF3 2GMPA 2VOWA 3SCFA 2GN7A 3CKHA 1C57A 1GANA 5KWRA 3ZDSA 1TE1B 2HWB3 4CCMA 5SV5A 3GHNA 3POEA 4PI2A 3BVCA 3SITA 1OQDA 2HWF1 3GZEA 2CY6A 4AVSA 4LXLA 4E4DX 2ZMKA 3I3DA 2OYZA 4NHXA 1WW7A 1LHVA 2BVBA 3KGZA 4QQOA 3V64A 1RUD1 1J3RA 4GIQA 1D4M3 4GWIA 1RUG2 1XYOA 2SLIA 4KU7A 4ARXA 5A6ZA 4HVQA 1AR81 1G9AA 2UU8A 2Y6LA 3WHTA 5A1AA 2O8QA 5T5PA 1RC6A 1CAXB 2YYOA 5LWBA 3DN7A 5I8SA 1WWYA 5GZCA 4CA9A 1JYVA 1W6PB 1X33A 4K6BA 5FP9A 4D7TA 1H2KA 1SLIA 4FPEA 4Q4Y2 4Y24A 1US2A 3O0WA 5IVYA 2MEV3 2BYVE 3UK9A 2G9FA 1XOYA 5C33A 1OLRA 1AR93 2PA7A 5C5UA 3D0SA 5FZOA 3FHQA 3SNMA 4BCUA 3O1VA 4V1PA 3PHMA 2GNBA 3ECQA 3VBUA 4NHYA 2EIEA 4Z82A 5BNOA 4IEVA 2WDBA 4QHBA 4MGZE 3E6CC 1YFWA 1F5FA 2W1SA 2WQ8A 2RS32 4HSJA 1JZ3A 3N4MA 2GP5A 4I09A 4JGYB 2R32A 1MS8A 3RYRA 2DFBA 3WOGA 3AB0A 1NCQA 1AYN3 4UT5A 4O61A 3ZFGB 1JZ6A 1DF0A 4WVWA 3AKTA 1RUE2 4OUMA 4ITCA 4B4RA 1VBA3 3WINE 3CZJA 1W9YA 2P2KA 1ASJ2 3LDKA 4XHXA 1PK6B 4ZPIA 5IVJA 4IL7A 1PZ7A 3C3VA 3NV1A 3VBHC 4E9KA 3CZUA 4RS5B 4HXCA 4YSFA 1RYYA 2IVJA 3HQXA 3ZFFC 4YW3A 3G7DA 3OGJA 1TNFA 4RQPA 3OEAA 2F4PA 3WD5A 3K75B 3MLKA 3PMSA 4NR1A 4UW6A 2PHLA 2Y0IA 4G4FA 5F6LB 4I0BA 2VVFA 4HLTA 5GLTA 4FT8A 1C5HA 1ZZ7A 4LPLA 1HV1A 4LBKA 4OYUA 1VBD3 2BVVA 1RUJ1 4HOOA 1NE6A 5D8AB 1QJY2 1AR72 4K7JA 1PGL2 4AFMA 3DPRA 1WCQA 2Q8DA 2BGOA 3P5BA 1MEC3 4UXAA 2J1UA 2XGXA 4BZ4A 2E26A 4K20A 3FLRA 4I3GA 4NUBA 3ROUA 4CU7A 2GN3A 3ZXLA 1SLTA 4Q0UA 4MGIE 4FPYA 4QQ2A 4ES8A 4FOWA 1UMZA 4YW6A 4HFSA 1E5SA 1GUIA 2DUOA 3WNKA 4A3XA 4HL0A 1XNKA 3AXEA 1ZRRA 1O4TA 2XUEA 3LEGA 5AC92 5CFCB 2ZZQA 1YI7A 3LB9A 2WFPA 3TEWA 5JDBA 1UU4A 4P9WA 2WNVB 1W8HA 1IQAA 3TN91 1Y9QA 4UI9L 2Y0OA 4COVA 4DO0A 1Y3TA 2F4LA 3AFGA 3M3IA 4OQ8A 3JB8A 3AYAA 2VH9A 5FY0A 5JIAA 1Y43B 1PNGA 4KG8A 4IEZA 2C5DA 4Q4V1 1P8JA 1DU3D 2UY9A 2XLFA 3GBGA 3PURA 4XVHA 5FO7B 4ATFA 5I93A 2XH6A 4XXAA 4CEYC 1UIKA 1PO12 3LZZA 3UV9A 2WFF2 2ATFA 4EQVA 2WNUC 3VKMA 2IZWA 4U36A 4XJ8A 3IIAA 4M3CF 2DYCA 3ZFEC 4YVWC 1BCXA 4CUGA 3OBTA 2ZTNA 2W52A 1X82A 3B02A 5FZ0A 5DPNA 1KEXA 2Y38A 2UYBA 2YROA 5K7PA 3MEPA 2RVAA 3FFQA 2G4IA 1HIXA 1D4M2 2Q1FA 3BCWA 4MXWA 1BK0A 4N53C 4N7IA 5T5LA 1WBFA 3CL1A 4FPOB 5FFOC 5FUNA 4LBNA 4BQ3A 3K4DA 1HQNA 1RVF3 1LODA 1W6OA 1WCKA 3KD4A 4HONA 5FUPA 3ZLIA 4CDXA 5FYBA 4AQTA 4AWDA 5IK8A 2Q8EA 2K2SA 2GNTA 1VE0A 3JQXA 4BM8A 3IBMA 3JUUA 4BDVB 5BNQA 1IS4A 5L7OA 1LECA 2A73B 3IDCB 3L9JT 3MIBA 3POJA 4JGZB 1ZYBA 2VW2A 4YZ4A 1WLTA 2KM2A 1FATA 1O59A 2ZCWA 1M4WA 3VB9A 5EXOA 2VY0A 4H55A 5CYYA 3WCRA 1MZ5A 3B5LB 5FXVA 1RXGA 1UOGA 4KI5M 3AX4A 2E51A 3CMGA 4KMQA 1JUHA 2ZJCA 1PGW1 1NQDA 3ZR5A 4TTGA 2J7MA 3TEXA 4EWEA 5FO9B 2JDPA 1F8VA 1UZVA 1XE0A 2O14A 2VUJA 1FMD2 4NIIA 5CG8A 4JTNA 5K8SA 1R093 4JAAA 1OOPC 3JD71 1W2NA 2YZ4A 5E1RA 2XL9A 1DGRN 1E5RA 1XNCA 4DEVA 2R073 3BI3A 1B35A 4CXXA 4D94A 3RZHA 1HRI3 3JXSA 3RDIA 4OZOA 1VBA2 2JECA 1NCQB 3U4SA 4GWNA 3ILNA 3KSCA 3KZ4C 4ZKTB 2JDYA 5JXGA 4K40A 2BFUL 2QDRA 1C1LA 4YPJA 4C8DA 4FXGB 2QQLA 1AX0A 3OG2A 3NAPC 3WP5A 3PJYA 2DFCA 4XUTA 2HWD2 2VMDA 1EPWA 4Y20A 4FBFA 5CISA 2VZVA 4RQPB 3VBRB 3KS7A 1YFXA 1PGSA 2JXAA 4GZ9A 1OA4A 4XABA 4A6SA 2ZPXA 1CX1A 3WT3A 1BHGA 5FY4A 5BUVA 1CR7A 4M3CB 2RS52 1VBD2 4FPGA 1DGLA 3MDPA 3N7JA 5DQ0A 1OPOA 4JDMA 2WINB 2RR13 3H50A 3J7NA 3ZSLA 1UQXA 5G05L 5A3MA 1MEC2 1ULPA 4TSVA 2ZX0A 4FFHA 1Q56A 4ZXKA 2DF7A 1FOD3 4AVTA 1ND2C 4QX1A 1HB2A 1W2UA 1NA1A 2G19A 2P5BA 2QQNA 2R6QA 3KQ4B 3WDXA 5C8CA 4LLFA 3S5AA 3WNMA 4QKDA 2J1TA 5D1IA 1GWKA 3NNMA 2Q1ZB 2D3RA 4RGGA 4ZY9A 3UKVA 1NQJA 1RUI2 2A3XA 2Y34A 4LBOA 2OZ6A 3NV4A 4MG2A 5J37A 2LS6A 3ILFA 1XSRA 1QOTA 4XMIA 2CWMA 1JXNA 1LOFC 1YQCA 2AZ5A 2E63A 2XMLA 2VXRA 2VZ3A 3ASIA 4MV2A 3AJZA 2AENA 1ZZ6A 3ACFA 5GZEA 3ZSMA 5FZ3A 2R1BA 3MF6A 1BBT1 1ODNA 3MF9A 2AH2A 4Q0VA 3VL9A 1JYCA 1HQLA 4C91A 2JICA 3IWZA 1W0PA 4EN9B 4RGAA 1VRH3 3KVAA 3MV11 4RHV1 3RS6A 5HCFA 3RYPA 4NRQA 1PMIA 1VBE2 2WL1A 2JG9A 2RDNA 1TMF1 2ZAHA 3RZZA 1ZBA3 3NMBA 2ET7A 4LORA 1Q8SA 5FZCA 4HANA 3A7QA 5L9BA 3B01A 4Y5SA 4OHYA 4AEMA 3WW2A 2WO7A 2Y8KA 2FBEA 4LQRA 3URFA 2SBAA 2Q8OA 1V9U1 5A3UA 4UFJA 4YGCA 3TBDA 4I02A 5KHHA 1QH6A 1A6CA 1RVF2 1WCUA 4QPIB 5LBCA 3VD7A 2LROA 4MXWB 1B09A 1XYPA 2W94A 1UYPA 4QPYA 1PO23 1LOBA 2HWC2 4GA9A 2X53S 4CDQC 4WVMA 4GWJA 1NCRC 1UNBA 3QLQA 1JI6A 2OUHA 4P9GA 2OT7A 4KGGA 1N1VA 1GWMA 3OGVA 3KT1A 4A7ZA 2PHRA 1RITA 4XIOA 5FYCA 4X6RB 1SLLA 4UFHA 3VBOA 4CTEA 1YQ8A 3FFZA 4E8CA 2EXKA 3QH7A 3R05A 4BA6A 3LA2A 3UGFA 4CEYA 4Q26A 4HKOA 4YGDA 2WNUA 3KMHA 1NAEA 3SCGA 4QDQA 3PUSA 4YVWA 3AXDA 2IXHA 5FZLA 1KFUL 3RRDA 2QQPA 3IKWA 2VU9A 4YVSA 1R092 3P1IA 1UU5A 4JRAA 3AJYA 1DLLA 2YXSA 2RMU3 1HV0A 2PLV1 2PHWA 2ZEYA 5EYXA 3HVDA 2R072 5DAPA 1NG0A 3THPA 2QZ2A 2NM1A 5BY5A 4N53A 3ZXKA 3MIEA 1O5UA 2BWAA 1HXS2 1IPKA 3CJIC 1HB4A 3ZDVA 5JSOA 2X05A 1Q8VA 1XE8A 5FMOL 1GZ9A 4I0WB 4IEWA 4JV4A 4EZHA 1HB1A 3LIHA 1XB9A 3AZYA 1LHWA 2PAMA 2VBPA 4O9EA 4CCCA 1KDKA 5FLIA 5GLZA 1DGWX 4PDWC 3LD8A 3SLIA 4BH9A 3AKPA 3HOBA 4XZPA 2R062 4QB6A 3PUHA 4P9IA 4WVZA 2RM21 3J4UH 4A41A 1NY71 3H1WA 4QT6A 3BGAA 2RDSA 3VDCA 4LO5B 1OQ1A 1QJU1 3W21A 3EB7A 2ZMLA 5GM0A 1CAWA 5LB6A 2A6VA 2G1MA 3NW4A 5T52A 3D82A 5CKMA 1D2SA 3MW4A 1IS3A 3QBQA 3LPGA 4BQXA 1FNYA 1RMU3 1WLDA 2RR12 1W9SA 3ETQA 5FJKA 2QQUA 5FZKA 3ZYJB 1ZNPA 2WR9A 2DCTA 5C3QA 1OQEA 4HVOA 1E5HA 3AP4A 1IHMA 1I5ZA 3VD9A 1UY2A 2K9ZA 2HWE1 5BNNC 1R083 5FRAA 2WS91 1CQ9A 1F31A 1OD5A 4IQPA 4DUVA 4Q1PA 4YZ2A 1QNYA 1S0DA 1XNTA 4IV1C 2PYTA 2WABA 3QH6A 5C70A 4IE7A 3CU7A 2JE8A 5A80A 1VBB1 2J1AA 1GZWB 4P5HA 3VBSA 5FYTA 5K0UA 4K8FA 3HNYM 4ZZ8A 2Z42A 2XBO2 5LK5A 3O12A 4AQ2A 2D98A 2JDHA 4M01A 1SBFA 4AVCA 1XE7A 3J8F3 5F39A 3SISA 1AXYA 4L0PA 3VBHB 3NAPA 3GZTB 3LEIA 2CGOA 5EFUA 1W6QA 3H3ZA 3MYXA 2VECA 1EPZA 3ZFFB 3S0MA 1N47A 4YG0A 2HBUA 1RUF2 2XJVA 1KD7A 1UY3A 3R4DB 1VRH2 4QHOA 2ZGTA 5HPOA 3WF2A 4CU6A 1W9FA 1RHI1 4RR3C 5GZFA 1YC61 3HBKA 2YB7A 4W6YA 1ZBA2 2X5IC 3AYCA 3SH5A 5L19A 2RS11 4HETA 3CF6E 1S0GA 2DVDA 4Y4YA 3N7LA 4GB33 1BEV3 2XKOA 1D7PM 4ASLA 2FMYA 4L2NA 2XOMA 5FMBA 3LA7A 2VZSA 4XF0A 3BOPA 2BRTA 3S7IA 2BBAA 2XONA 1QXPA 2D6MA 3UKTA 3H42B 5EHDA 3T09A 4D6SA 1H9WA 4EN6B 3WR0A 4W4ZA 4GMP1 1MZ6A 2FCVA 3DYPA 3I2IA 1OSGA 2XB6C 3TNPB 3B7MA 1X8MA 1PO22 1QKQA 2YC0A 2Y6FA 3SCHA 1W6NA 2PN5A 2QQJA 3I2DA 1AR63 2DBIA 4DMIA 4UW3A 3ZN5A 1QH7A 3A22A 3E5XA 4ORFA 2FZ1A 4NIAA 4U2AA 4QWNA 3MIFA 4XFHA 1MQTA 3IT8A 2BW8A 4F7ZA 4BQ1A 3KVBA 4JZRA 5E88A 1TNRA 3NV3A 5GJ6A 5A7QA 5C6CA 1IG3A 4OUSA 3K4AA 4Q0QA 3POSA 4XFFA 2R49A 4OHZA 2MNGA 5GLWA 2KXLA 4CEYB 3N9MA 4CDWA 1OFSA 2WNUB 3NJZA 2IXKA 1K3IA 1POV3 1WBLA 1QXJA 4YVWB 3ZFEB 2RMU2 5J36A 3ZYBA 4AGVA 2WLQA 1RUC3 3LDRA 1AVBA 1YCIA 2JDZA 3JBG3 4JC1A 4Y26A 4YM3A 3WQ1A 4LEJA 2GZWA 4P9XA 3CHXA 1NOVA 2VNVA 4B8EA 2PQQA 4CDUC 4Y5Z0 4BOWA 2D6OX 1W8FA 4IXLA 4N53B 3ZPYA 3VKFC 3S6PA 4MH0E 3B00A 1VAKA 2VW0A 1FAYA 3WDYA 1LEMA 5A3NA 4NPRA 5DMYA 3B9CA 2QZ3A 4XXPA 4KG0A 3WUDA 2JWPA 1AF9A 1ULFA 4W65A 1UL9A 4HVRA 4M4RA 4CU8A 3N9NA 1JU4A 1OLME 2JIJA 3SH3A 1RUG3 4R9AA 1VR3A 1F2NA 1CAXA 4ZONA 3PIGA 3KQRA 1H8TC 3Q8AA 2Z79A 4OFGA 4XETA 4YFZA 1ZRDA 3U07A 1AJKA 1WW6A 4M3CE 1V70A 5HXMA 5EWSA 2WNEA 1SLCA 1U5XA 3SXWA 3MV01 3GYDA 3POFA 5LASA 5J7MA 2EA7A 1ZBE3 4XAAA 5IK4A 3VKNA 4KBBA 5FZEA 1HRV1 5FIXA 4AI0A 5GZGA 1R082 5JWPA 2YC4A 4LMFA 2RJ2A 5A3WA 2RS31 3U78A 3HQUA 1LJ7A 5I0RA 4XFAA 1FPN2 3WP4A 1W0OA 1OOPB 4LIUA 3TYJA 3HJRA 1W2TA 5EJZB 2EXJA 1XU1A 2AACA 5B2GB 2PTMA 3LEMA 4XOGA 5LATA 2BV4A 1ZA7A 3VLBB 5FZIA 4PDWA 5A32B 3ZFGA 1ZZ9A 5IVVA 3ZYPA 4S2FA 2ZX1A 2UYAA 1LULA 3I3MA 3A0KA 1STMA 4P00B 4XJUA 3MI8A 3O0VA 4Y33A 4JDNA 1PK6A 4CCDA 2QQMA 2XHKA 4XYXA 4OI1A 1SQ4A 5A33B 4CP9B 1W9TA 4QXKA 1C5IA 3NAPB 4RS5A 5GLUA 3HR9A 2B9VA 4INDA 4Q8KA 4XTPA 3VN4A 1W6QB 4ASMB 4QKBA 4XPVA 1ASJ3 3W59A 2Y60A 3X29B 1UOJA 4CP1A 2B45X 3P3PA 1HX6A 2FDIA 4NRPA 2C0ZA 3V0BB 3CLPA 1WMDA 1BEV2 4GB32 4LIVA 4P14A 4MYEA 4R9BA 3RG0A 3LGRA 4HSLA 3DCQA 1QY4A 5T3NA 4LKDA 1AR71 5JOYA 1N3QA 3VDDC 1U5ZA 4DIQA 3ZX7A 1XNAA 1S0BA 3HWJA 1LESA 1SBDA 5FPZA 4W50A 4KGQA 5D8AA 2NLRA 1ENRA 2DCZA 3OD0A 5IAVA 4ZU5A 1PX3A 3W20A 5C3SA 4MXVA 1NKGA 3IAQA 1HJGA 2D6KA 3BPZA 1ND2B 2P17A 4C0HA 2H6BA 5F3EA 1QJY3 4CPBD 1O8SA 3AVRA 4JRLA 5AC91 2WZPP 2PQSA 4BK5A 1V6LA 2A3YA 1W6NB 1MZFA 1OVSA 1ZZCA 3MUY1 4ZS3A 2Z5WA 3P3NA 3CQOA 5C3RA 5FYVA 2IXCA 1EY2A 4YW7A 1R1ZA 3PTYA 3EMRA 3T2PA 1H0BA 3PMEA 4I01A 3T0DA 1W6MB 4XW3A 1AL21 1COV1 2J1VA 1RUH3 4UBHA 3TOJA 4AOCA 3N9LA 1CJPA 3QOPA 1DIWA 1UZWA 3WDWA 2ZHNA 2V4VA 2DU0A 1AXKA 2WFF1 3PLQA 4IE6A 3NNGA 1D4VB 4QPWA 4YM1A 5DABA 3RI8A 3T0AA 4B1MA 1LCLA 4XDOA 5L9VA 2YG0A 2VGDA 2HWB1 2Q0AA 2EIGA 2JDMA 2CDPA 2YGLA 4GULA 4UF0B 1CAVB 1RUC2 2J22A 2GSYA 5DG2A 5BPXA 1KS5A 1ZX5A 3JBG2 2YDEA 1EUUA 1PO13 3T4VA 3CJXA 1ZRCA 1H1MA 2CYFA 4MX3A 3ZYFA 1D4M1 1S1AA 2XPJA 1KGYA 2VQTA 4GJYA 1EV13 3I2HA 4JVAA 5M0TA 4FO9A 3OB8A 3HQRA 5SV8A 1QJX3 1SDDB 1VIWB 4BISA 5F3GA 4UAPA 5AVPA 4LO6B 3AFKA 2B39A 3VDBA 4M00A 4CDQB 5IATA 1YRZA 1NCRB 3D8CA 3RPQA 3B93A 3PVBB 4ET7A 1WLWA 1WMFA 2MEV1 4Q29A 3ZR6A 2WQZC 1J58A 5FY8A 1AR91 3W9AA 3MO4A 4EN0A 4AK3A 4JGZA 3VL8A 1EAH2 3OSDA 4QU2A 4Q0PA 1ZBE2 2ZEXA 4I3PA 5CFDC 3GGLA 2AR6A 2W1UA 2Y33A 2BNOA 2VBBA 4ONUA 5JSPA 5FREA 4CPBA 1CESA 4AGRA 3RZKA 3R0RA 1KXGA 3LOBA 1I5PA 2Y6HA 5LEJA 5H9QA 2CGNA 3ZXJA 4FPJA 4OI4A 4YG3A 4NHLA 1Y4WA 4QPGC 1O4ZA 3VKLA 1AYN1 3WF1A 3GZUC 5JIUA 2P3IA 2C6SA 2GP3A 1UCXA 4CDUA 4JDOA 5JI9A 2FD8A 1SMVA 3E6BA 1UO9A 4B7KA 1VBA1 3CJIB 3V56A 2W3JA 4NIDA 5CAZA 1FMD3 3RMYA 2V73A 4AAXA 4BLJA 3NWKA 5CEHA 1PZ9A 2KA3A 5GALA 4ZHNA 4A44A 1AYM2 1K45A 2YPDA 3OGRA 1XNDA 4IEXA 4PDWB 5JI7A 4IV3B 1UOFA 1SG3A 1DZRA 2DCYA 1ND3C 3D5OA 1IG0A 1W2OA 2B46X 1H2LA 4IE0A 1VMFA 1XJAA 3FUQA 4WM7C 1WLCA 3C7OA 1ZA4A 2VOTA 3GALA 5BNPC 1OLMA 2YU1A 3LIGA 3KF3A 2ZHMA 1S2BA 1VBD1 5KR7A 4IETA 3VBRA 4NMIA 2GDFA 1JMUB 2CSGA 2HWD3 3UYJA 2FCTA 2H0VA 2OPWA 1MEC1 4M3CA 1W9WA 4NE9A 1YJKA 2ORZA 5BNNB 4YGEA 4NPLA 5FPUA 2VVDA 3MIGA 4E2SA 2RS53 3S57A 4SLIA 2YY1A 4HMZA 2OQ6A 2W08A 4IV1B 2ZHLA 1OURA 4XQDA 1G9BA 2EF6A 3BB6A 3GCWA 5JXHA 3MFAA 1YIPA 1QXRA 4MSVA 4K8RB 4RFRB 3AZXA 4QHZA 2W1WA 5FZAA 4COWA 5FP3A 4LUMA 1O3SA 2ETEA 3I2GA 5GKAC 4TN7A 1LR5A 1JBCA 3EXUA 4FP2A 4YM0A 3ACLA 1RUH2 1JN2P 2ARXA 3TWIA 2JDAA 3FE5A 4A2UA 1RUI3 1S2EA 3ZKYA 3VD3A 2UY8A 5I0SA 2VO5A 1S0CA 4R4ZA 1V6NA 4UYBA 3BOWA 3ZXGA 5DAXA 4D7SA 4DINB 4W8JA 2W87A 4RR3B 4XILA 5DUWA 2JD9A 1CWPA 2X09A 4A7KA 3O1RA 2X5IB 3LF7A 3VUOA 4CRQA 1ALYA 1UD1A 1QQP2 3WNXA 5FK8A 2V72A 4A6OA 4B7EA 2P34A 5EIYB 2WO1A 2JIGA 2D3PA 3ZSEA 2JDKA 2X29A 4PIZA 1X50A 1VBE3 1BVVA 2GC0A 3PNAA 4GH4C 1EV12 1OBNA 1JZ7A 4BB3A 1RVF1 1QJX2 2VZUA 2XL7A 4HN0A 4KWKA 4AW7A 3E5UA 4AHXA 1X8EA 5FBJA 3WY6A 4XJZA 3THCA 1WZXA 1U5IA 2V5DA 2WNOA 4UFKA 5A7WB 4QPIA 1Q5OA 2CNAA 4Q8LA 4FOYA 4YW1A 3KHBA 3KV4A 3TAYA 2E31A 1KRIA 3VZMA 2ZX2A 2O8OA 4B4PA 1OF4A 5C8WA 1OF3A 1GQHA 3ZN6A 2HWC3 4GALA 4L92A 5H9PA 1WCDJ 4EWAA 2OS2A 3POYA 4ATEA 3BUCA 2WN2A 4XQWA 5IJRA 5I0TA 3OGSA 2WUHA 2XLGA 3N9PA 5EV7A 3POIA 3J9SA 2GH8A 3IDBB 2X8KA 4GKXA 4JKLA 1L7LA 4KU8A 1GMMA 5DAVA 2XVLA 3R6SA 4EZ4A 2FCUA 3GCXA 3I4IA 2JG8C 4P9YA 4WZCA 5IWFA 1BMV2 1R091 1WKYA 3O7OA 4DUXA 4Q2FA 2OIIA 4LBQB 4PIXA 1UW8A 3AYEA 2ZGOA 3NKGA 2R071 4FQZA 2HWF2 1GKBA 3H7JA 4G3YC 4QX7A 1HRI1 3DYMA 1J59A 1X7NA 1FX5A 4TYSA 1YXWA 1IZ3A 2W91A 1GBGA 2WT2A 1LB2A 3HN3A 2JE7A 4LITA 1DYPA 3JZVA 2LUWA 4MADA 3IDAA 3VKOA 3AVSA 4CDUB 1SFNA 2LTNA 2J1EA 3FBMA 4Y4RA 1GQGA 4K21A 1Z0HA 4LBJA 2YGMA 5F6KA 3HNMA 4XUPA 5A3OA 2XJRA 4CCLA 4DRRA 3FUOA 1DQ0A 3OJBA 4IESA 3ACHA 3N36A 2VUCA 1HXS3 2C24A 1Y7BA 5FMOS 3K3NA 4PQQA 1LOCA 4J6GA 4BQ4A 2XJTA 2ERFA 2IFRA 4QAWA 5JMOA 2ENRA 1L7QA 1ONAA 2WWSA 3APBA 4ISQA 1V00A 4FPFA 4IE4A 4AEDC 2ZGUA 4S2GA 1H8TB 2Z69A 3D3AA 3UGHA 1RUNA 1QMJA 3BU7A 1MS5A 1QHDA 2VR4A 2GALA 3IM0A 5DZEA 5LA2A 3U10A 1GICA 2D6LX 2R063 4I0AA 5FYIA 4XEZA 3HBZA 4LKSA 1JTZX 4JKKA 4XFGA 5FYHA 4PHZA 5IFTA 1N3PA 1C8M3 4K9SA 3RWKX 2I74A 2EXHA 2QQKA 3RFRA 5BYNA 3TEZA 5C71A 2R043 1GV9A 1I6XA 2ZHKA 1YJLA 1FOD1 2W92A 3T4HB 1JYXA 3J7HA 5I8YA 2BJSA 3H8XA 4KWLA 1QIQA 1OKQA 3MPPG 4ASKA 1JHJA 1N1YA 2DDUA 2RJLA 2XJQA 2WT0A 4NPMA 5HCAA 1N1SA 1V0AA 2N7GA 4IUGA 4XF3A 3USSA 2WQ4A 3FZ3A 4AI9A 2D5FA 4OHVA 1YLLA 5JR2A 4A3ZA 3BTAA 2YC2A 1GZWA 4FSJA 4L9BA 3ZPOA 4CUCA 3ZMOA 1DGWA 1MS1A 4P02B 1KJRA 2D97A 3U14A 2W5FA 3WVJA 4YARA 2VCBA 3CIHA 3A21A 4CUAA 3GNEA 4LHSA 1CZVA 2ZEZA 4BPZA 1WUVA 3VBHA 1VRH1 1KFXL 5J96B 2XBO3 1W8OA 2ZGPA 5BNPA 1VAMA 3ZYRA 2CWSA 2CL2A 4LHLA 3ZFFA 1UPIA 2UWAA 3M2MA 1ZBA1 3MICA 3KCCA 2B7YA 5KC5A 2JKBA 3BKZA 3JCIA 1OT5A 3O1TA 4R9DA 3PJQA 4V2WA 3SKVA 2BEOA 1RUF3 1UPSA 3GXUA 1MACA 4N7UA 4JKMA 3RZJA 4LULA 4PLNA 3VDDB 1PMJX 2ZKNA 2XUMA 1O4YA 1W8ZA 2Y6KA 2JDUA 1OH3A 1W99A 2EICA 5F9TA 1SZBA 1PO21 1UZZA 2WZEA 4QDSA 4LO4B 4DXSA 5FKBA 2VXJA 4JTOA 1LNSA 2E53A 2VMEA 3JQWA 2AUYA 4XDPA 3U11A 1D0HA 5IAXA 2CAUA 2D6PA 2B4KA 3PU8A 3WUCA 2I2SA 2JJ6A 2NPIA 2Y6JA 3P6BA 1HQWA 4IGOA 2HEYF 3KT7A 4DQAA 2NP0A 3N35A 3ALQA 4W6WA 2XVGA 2IFWA 5CKQA 5FZ4A 3VGIA 3IN9A 4Z1VA 5ABJC 4ISRA 1YIFA 2MPFA 2RV9A 3OTFA 4Q4V2 4BQYA 3POBA 1K42A 3FBYA 4RN5A 3SHRA 3LKJA 5L9RA 3L2HA 3UESA 3ZN6B 4EN8B 1ULOA 3WW4A 5FXXA 2FDFA 4YW5A 3SH4A 1LHUA 4N43C 2W46A 4EV0A 4RHV3 3WXPA 2HH9A 1WGPA 2RMU1 3BTZA 1OHFA 4RSUA 5A6XA 2CAVA 1GOFA 2IWGB 2PAKA 3ZFEA 2VOXA 1X9PA 3RJRA 2W2IA 5H9RA 2WYSA 2HJIA 3ZMNA 2OUJA 3ZOIA 2QE3A 1DQ1A 1WA4A 4LE4A 1O3TA 1YI9A 2ZGKA 4H7LA 1ENQA 1GFF2 1V9U3 1QWRA 3OD4A 2G9ZA 2AC1A 1REEA 4AI8A 5B4NA 4WV8A 3PIJA 3LE0A 2O1QA 2BP6A 3GF6A 3MFCA 1AXZA 4FXKB 4IDZA 1J1LA 1LRHA 3GHMA 4GXLA 4LA2A 4C1WA 4D3WA 2V5YA 2NZ9A 5B4XA 4AQSA 3NO8A 1GP6A 4PBOA 2XG3A 1W8WA 3B94A 4IEOA 2GC2A 3VZOA 3RYKA 3KWVA 3OYWB 3M8LA 4NROA 2E7AA 4PF1A 4Y1YA 2NN8A 3LAGA 3VHNA 2RE9A 1J1TA 1X9TA 2A70A 3FJSA 4QX2A 4IV3C 4B4QA 2VC9A 1S4CA 4OHWA 4Y1VA 5JPNB 1MS0A 1RMU1 1O3QA 1JZ4A 4QB1A 2E32A 4R8HA 1C8M2 2QFEA 5DUVA 5CFDB 1PGW2 2Q4SA 5L36A 2D5HA 3DGTA 1JU3A 1R081 2R042 3WLUA 1LGNA 3B3QE 3NVCA 5L73A 5LY2A 4HT1T 5FKCA 5FPLA 1W39A 3OBRA 1DFQA 1RIRA 4MVTA 2EVXA 3JD72 3IIIA 2P6HA 1REFA 1W28A 4J25A 2P3YA 4QPGB 2EALA 2VL4A 1YEWA 2VNGA 1ZZ8A 5FY5A 2QUOA 1DP0A 1IPJA 2LM3A 1OOPA 4Q4W3 2DTYA 3RZGA 1E57A 1NLQA 1SBEA 3DXTA 3J8F1 3WG1A 4C1XA 4FFIA 4KWUA 2GH2A 3IDEA 4QGMA 4EYUA 4KNCA 4YNIA 1O3RA 1FPN3 4XCBA 2DVFA 4COUA 4QGNA 5JXIA 4K1YA 3T2TA 5A32A 5J1XA 2Y64A 4BQ2A 3RWNA 2HKXA 3E6DA 4YYOA 3AYDA 1ND3B 4E8DA 4COYA 3IPVA 4Y1UA 1F35A 3LA3A 5A33A 2WWJA 3GBWA 1J3PA 1GP4A 3ITQA 4WM7B 3WDUA 1Q43A 1QEXA 3JU9A 3OPZA 4NRMA 3D6EA 4AQ6A 1M06G 4GB31 1BEV1 4RYDA 5BNPB 2F17A 3RJ2X 4YFWA 4N9HA 3RQ0A 3NJYA 3MBWA 5GZDA 1UY0A 4HKLA 3SQOA 3V0BA 5FYZA 3UL2A 2RDQA 1G9CA 5ANNA 3NRUA 4XF1A 1RL3A 1S2KA 3ZXAC 1G9DA 3T1MA 2FQPA 3WNNA 4Q27A 1US3A 4GWMA 4Y1XA 3ZXDA 3N3HA 1ULCA 2RHPA 5F32A 2HYXA 3PU3A 1FT9A 3DYOA 3O0XA 2G9GA 1AR61 2QKDA 1H4GA 3MIDA 4XMAA 5FP4A 4Q4X3 3MW3A 1VBB3 4J1WA 2BGPA 2R7EB 1ND2A 1IGOA 1GU3A 2A6XA 3PVNA 4XC9A 2CHHA 5IHRA 3IAPA 5A70A 1TG7A 1XU2A 3LCPA 3WF3A 1OD3A 3ATGA 2YBPA 2ZGQA 4FOQA 1SLAA 5CB7A 1I3HA 5APAA 4PQ9A 4IERA 5LBFA 1BBT2 2VMCA 4GD4A 1LOFA 1TME3 4NO4A 1K5MC 1W6MA 4EE2A 4LK7A 4XTMA 5A6QA 4G9SB 4LO7A 4RHV2 4PBPA 3G6JB 1POV1 2GMMA 2QQOA 4S2DA 1VPHA 3H1MA 1FV2A 4OQ9A 4XFCA 3KGLA 3C7HA 3I2FA 5LA0A 3C7FA 1ST8A 1RUC1 4BXFA 1SEFA 4JX0A 1GNYA 3JBG1 2DVBA 4AL9A 5JOZA 3FHAA 4BE3A 4LOSA 4UF0A 1CAVA 1YWKA 1DZQA 1V9U2 2OW4A 4FQ4A 2AYHA 3OY8B 2CGPA 3FX3A 1DQ2A 4GH4B 1K12A 5CG9A 3ME2A 4J1XA 3VZKA 5KXDA 4C0BA 4Q0SA 1CIWA 1J83A 4X8PA 3ZN4A 3ACGA 4IEUA 1W05A 4NAMA 3KV5A 1IQDC 1ULEA 1XQNA 3C8XA 3GJBA 5DDJ3 3FN9A 1NZCA 3I2OA 1LHNA 1RUG1 2IXJA 4YZ1A 1H1AA 5FLHA 3VZNA 1Z7S3 4FCAA 1OFNA 1S0FA 2BUKA 1SACA 3C7EA 2WSVA 2QVSB 4M4PA 4R52A 4BK4A 2GU9A 3FLPA 4CDQA 4YW4A 2ZX4A 5ABJA 1NCRA 2VW1A 3ZSJA 4ARYA 4LJHA 3AMNA 3T30A 4P9JA 2GMEA 3THTA 4IE5A 4XBNA 1ZREA 3AC0A 1ZBE1 3GJAA 5KXCA 2ZZJA 1SHWB 3T0BA 3WQ0A 4Q4Y1 4L99A 2WC2A 3H3LA 5FP8A 4MGKE 1X36A 4QDRA 1C3HA 3I3EA 2PHDA 3OUIA 4NVPA 4S2HA 4WVVA 2JB4A 2JG8B 3VBUC 1DZTA 3KHCA 5BNOC 5IW0A 1EAH3 4JQRA 1PNFA 2PLV2 1GQPA 1F4AA 1NLRA 3AZVA 2BWCA 2FHRA 3HEIA 2Q5TA 2WJSA 4AZZA 3ELNA 3I54A 3K77A 4Q4W2 2CV6A 4FFFA 3MZHA 1QJZA 1V6JA 2TUNA 2XXZA 3U75A 3C2UA 2BU9A 2J42A 5JPMB 2JD4A 5E89A 1CN1A 1DDLA 5DG1A 1PIV3 3CJIA 2XJUA 4GMP0 1JYNA 2VZPA 4R9CA 3RGBA 1SCSA 2IXLA 4D6QA 3WG2A 4Z8BA 1RUE1 1VAVA 2XHNA 2RM22 3O1PA 1ASJ1 3LQCA 3A0NA 4FTSA 4EJRA 1VBC3 3J26N 4IV3A 3K4ZA 2P1BA 1QJU2 5LZ6A 4AEDB 3Q8BA 2PAEA 4D6RA 3IPVB 1AYM3 3AMMA 3ACIA 4NWVA 1POV0 4IEQA 1QJEA 2O0OA 3OOXA 3WQ7A 4XJWA 3AZWA 5FYYA 3H1YA 1RJ7A 4D0QA 5IYYA 4XFIA 4TWTA 1V6IA 1V6OA 2ZKLA 1L7RA 2ET1A 4HK9A 3MLLA 5DN2A 4CE8A 3DPRC 2BPA2 2WS92 3IB3A 4NIHA 1DYOA 1EUTA 3BPSA 3D4KA 2WLPA 4ZXEA 3Q8FA 1R1A3 1JYTA 1QJY1 4AE2A 1PGL1 1NXMA 5BNNA 2YUEA 4Q4X2 5IUQA 1ODMA 4H7MA 3AMHA 5F5QA 1VBB2 2VQ0A 3I2JA 4N90A 1GR3A 1YNAA 3VV1A 1WW5A 1BVP1 2QBXA 3H8OA 3GZAA 2XLAA 3MHZA 4IV1A 1UZYA 1T6GC 1KDMA 2AEYA 5FZBA 4NN0A 2OPKA 2D93A 4I2OA 3AP7A 3I59B 5CADA 2WT1A 3KLSA 4XHBA 3SMHA 1RUH1 5D21A 4LBQD 3UJOA 2DURA 2FDJA 2GC1A 1UYYA 3NJVA 1TME2 3EQEA 4FP3A 5FQ0B 4QX8A 3PVEA 3Q9OA 2ZACA 4LBMA 5FZ6A 4MZUA 2PXJA 1OA2A 2DUPA 3OPTA 3OCPA 4META 1H6XA 2VD7A 2X10A 5FZFA 3ENRA 5C7GA 2W0XA 4LTAA 1PM7A 5FZHA 2ZGNA 2NMOA 2RS12 3UKNA 5TSWA 1PHMA 2YMZA 2VVEA 4RR3A 4AEJA 1UOBA 5IVBA 5IK5A 3N9QA 3THDA 1PO11 3I3BA 3M4FA 3VHPA 1V6KA 4JCKA 4XF9A 2X5IA 5A1LA 4P9LA 1UWWA 3DV8A 4LUKA 5C5TA 1J3QA 1SPPB 2V4AA 2YHJA 3LSDA 2E33A 2IXIA 3ES4A 2Q1MA 3HAGA 3OEBA 2A1XA 1EV11 2VZTA 1UX7A 3POGA 3OBZA 2XJSA 2P4EA 2LW8A 3TEYA 3EBRA 4FFGA 1QJX1 3M3QA 3UGGA 4AF9A 3O1SA 1AHSA 1QQP3 3M1HA 5EJ3A 3N9OA 2F6BA 1PVC3 3CDZB 3Q8EA 2VNRA 4H14A 4LHNA 2QDNA 4DFSA 3HN1A 3O5SA 1XRUA 2XDVA 2YBSA 4Q5OA 5DDJ2 5DZFA 5FZDA 4CDXC 1W90A 3FLTA 1LOEA 5FUIA 1JYIA 1Z7S2 2D6NA 2R16A 5A7WA 1UN1A 4RA0A 4LKFA 3ZYGA 2C1FA 2WZR3 3CNAA 1G6NA 5L7OC 3ORJA 2BOIA 1QOOA 3E97A 4AYUA 1UU6A 1OVPA 1W06A 3OBAA 5ACA3 3HT1A 5FZ7A 4BIFA 1OXCA 1OH4A 2D7FA 2ZGLA 4FVVA 5ABJB 1GNZA 1W03A 4XQ4A 5EP9A 1LOGA 3A4UA 1MS3A 3AK0A 4AFBA 5JLVA 1BMV1 3F95A 5F3IA 1Y9MA 4N43B 1LHOA 4OVEA 3S7EA 1GLHA 4XZUG 1LAJA 4DNYA 5JAXA 2PHXA 2JDNA 4CP9A 5LA1A 3RI9A 2L9LA 5AFBA 1RB8G 3NKTA 3NSTA 4LBQA 4COZA 5JUVA 5CNAA 4FPLA 1FMD1 5LRSA 1UXXX 1B35C 1ZRIA 4K3UA 3UNPA 2BTVC 4OZXA 3BU0A 3DUIA 1PIV2 4AGGA 5FO8B 4CCNA 1POQA 1QDOA 4FTEA 4ZU7A 3TNQA 2HWF3 1VP6A 2MHFA 2WA4A 2ZGMA 4QGLA 3RNSA 4DY5A 5A3TA 1RUD3 1H2NA 1VALA 2WKKA 5FTTC 4MOAA 3FL7A 1ZRFA 1VBC2 5CKNA 2UWCA 1OLQA 4QXBA 2PHUA 4UBGA 3NNJA 1GZCA 1Q3EA 1AR83 1H1IA 5FY7A 2ARBA 2DU1A 3MGUA 1XSQA 4Z2WA 1CAUB 4AG4A 1UZ0A 2WBKA 2HWD1 2VUDA 2JKXA 1JOBA 1H8TA 3ZO0B 4LR4A 3FMGA 4HPKB 4PIYA 2BFUS 4HBNA 4YM2A 1HRV2 2YPJA 3KCXA 3TRSB 4QXHA 1KJLA 5FWEA 2DCKA 4BWOA 4NIGA 5FK7A 2RS51 3W58A 3OUJA 2A75A 1R1A2 1XYNA 3HPNA 4UW4A 5K9YA 4LO8A 2GC3A 1JZ2A 3VHOA 1DGRA 4QM8A 5FXWA 1A8DA 1NA1C 2HEWF 5A1FA 5C8CC 3DL3A 1YYNA 1BK1A 4K1ZA 3USUB 3UJQA 5I0DA 4MO3M 4DXZA 1MS4A 5F5IA 1RUOA 5H9SA 3LSEA 2CU5A 3IMMA 2D3SA 2A3WA 4FI9A 3RMXA 1BJQA 1UMHA 4QD2A 4XBLA 3WQBA 1RUI1 2YBKA 3DKWA 3VBFC 4CP0A 5F37A 1RJ8A 4Z07A 1CGPA 4LOTA 3POWA 5E8AA 5JOWA 4LKEA 1C1FA 3CO2A 3SKJE 1BXHA 4AR2A 4JQTA 1C28A 2DUQA 1GOGA 4QQHA 5I8TA 5KC6A 2ZS6B 2VMHA 3HD8B 2AGSA 2VTXA 2I07B 2BQPA 1PVXA 2VOVA 2DBNA 2JG9C 3EYPA 2RG4A 2VG9A 2E7TA 1RINA 3IMNA 3VD4A 1OMIA 3AMPA 4B29A 1VBE1 1H30A 5HCHA 1RGSA 2ID4A 3LEKA 2VE1A 3AKQA 3AKRA
chains in the Genus database with same CATH topology
4OHXA 1JW6A 5J48A 2TEPA 3VDDA 1PVC2 3HT2A 1DQ4A 1C8NA 1D2QA 1Q8OA 3U4XA 1RUJ3 1CVNA 1UKGA 5DUXA 1IKQA 4NOTA 5J98B 2OVUA 1FV3A 3INAA 4E27A 3VHRA 4OLLA 2WZR2 1N3OA 1AZDA 3AMQA 4FAHA 1AL0G 1CD3G 2HWC1 5ACA2 1JH5A 1IS5A 1IKPA 5EZWA 3VBOC 4D7YA 3S30A 1AL22 1COV2 3JB4C 4URTA 5T5OA 4AVAA 4XE9A 1GNHA 3B9IA 3FWEA 2V09A 4AFCA 4LHKA 1K5MB 3TN93 3K51A 1L3JA 1Q8PA 2VMIA 2HWB2 2AREA 2H6CA 2C9AA 4D69A 4Q4V3 4YVSC 1ZVFA 3N7MA 4OI0A 4DPNA 2LALA 2P37A 1CX4A 1DBNA 4AHZA 2XWJB 1S0IA 3NV2A 1SLBA 2VMGA 2Y26A 1FI2A 1S0JA 4MGYE 1DG6A 5FBZA 1HXS1 1RUD2 4UW5A 4CP2A 3AP5A 1MS9A 5JZGC 1UAIA 5LK7B 2UWBA 4LT5A 2Q30A 5HI0A 2A6WA 3VZLA 1AR82 2MEV2 3I8TA 4YGBA 3OYWA 3WP3A 4QQPA 3WDVA 4OULA 2D44A 1AR92 4MUVA 2R061 2JEMA 2VULA 3B69A 3ZIWA 4KWJA 5LEKA 1C8M1 5JR7B 1HDKA 4FAGA 5C4WC 2R041 4XJAA 2D40A 1QGLA 3BIWE 3WP6A 5CFDA 3VBUB 2ZA9A 4N9IA 5DZGA 5BNOB 2RR11 2B9UA 2JENA 2ZABA 1WCSA 4X6QB 3WG3A 1AYN2 3FC0A 3H7YA 2GNDA 5FLJA 1VB4A 3TB0A 2DWRA 2E7QA 2RJKA 4QPGA 5J09A 1LENA 3VBSC 4AHWA 5K0UC 3JD73 4AVBA 2UURA 1O91A 5AFEA 1VLNA 1DHKB 1G7YA 1NXD1 1RTVA 1H9PA 4OI2A 2XBO1 4AI3A 2DV9A 4DB5A 2BNMA 5T5JA 1ND3A 2A7AA 3HMYA 1U0AA 2XJPA 3MIHA 1RUF1 4WM7A 5BV6A 2W68A 2ZMNA 1U12A 1CPMA 1D0GA 3L2YA 5C9AC 2FZ2A 2P3KA 4WZFA 1OA3A 4IEYA 4NHKA 3EHKA 4E4SA 1A3KA 1ZZBA 3DPRB 4FPKA 4HK8A 1G86A 1RUJ2 5JMCA 1A8MA 1WD3A 3H0OA 1JUIA 1V6MA 4KH9A 4IEPA 3NL1A 3OF1A 4L97A 4W6XA 5JVVA 3H3UA 1UX6A 5EYYA 3WV6A 4CEWC 1I9RA 4GQ7A 3WX5A 5AVAA 2GAUA 3OGGA 4ES9A 1H4HA 2VPVA 1IS6A 2XVKA 3ZVXA 3VBFA 1MVQA 1MQTC 5J3UA 5A3LA 4AHYA 1LOAA 4WM8C 4BMBA 3TN92 4CYDA 1GYKA 3AP9A 4XDQA 3N7KA 4CDWC 1HLCA 3ES1A 3V0AA 2K0GA 5KXBA 1BBT3 2R0FA 3EO6A 3EJKA 2P3JA 1AUYA 1VB2A 1F5JA 3WCSA 1TMF3 4HKWA 4XFBA 1Q8QA 1HW5A 1FNZA 4I30A 3OY8A 4LE3A 4GH4A 1JHNA 1UIJA 3KB5A 2H0BA 2HYKA 1W6OB 1OPMA 2QNKA 4CDXB 2DCJA 4EN7B 1QDCA 3E5QA 4RL7A 3WHUA 4AEKA 4BYYA 4E2QA 1JOJA 1MVEA 1QF3A 2NYYA 3D0JA 5KHIA 3I7DA 4NWWA 5L7OB 4BLIA 4XBQA 3H8UA 1SDWA 3MLJA 4QQLA 4RFT0 4YRDA 4F83A 1S0EA 2ZAAA 2DTWA 4QX5A 3T1LA 4E4ZA 3R4SA 4F8AA 2R30A 1A78A 4SBVA 4CZSA 5KXEA 2JG8A 1WMEA 1HRI2 4Q4W1 2QJVA 2A71A 3QCWA 4JGYC 1DQ5A 1B35B 1FPN1 4L8QA 2PLV3 4TZDA 3ZFGC 4DS0A 2IC1A 5JZGA 2D43A 1PK6C 3ST7A 1UKRA 1LEDA 1GSLA 4RS5C 5IK7A 2DVAA 5LRRA 5BXXA 4Y20B 4MLOA 5HCBA 2A6YA 5C4WA 4AEDA 2RM23 2ZGRA 4LNVA 5I0UA 1LU2A 1AX1A 1QJU3 3AZZA 2NQYA 1FOD2 2R1DA 4B3NA 4BMEA 2PELA 5D8AC 2BNNA 2VQAA 3O14A 4YZ5A 4Y22A 4Q4X1 2NMNA 4YZ3A 3WW3A 1IOAA 1NA1B 4HN1A 5C8CB 4AI2A 2HWE3 1TEIA 5T54A 2WS93 1BYHA 1LGCA 4BHPA 1APNA 5E16A 5CFCC 1VJ2A 2R0HA 2VUAA 4XIKA 1LU1A 5FAXA 2WNVC 3I59A 1TME1 3VBFB 4PLOA 4AFDA 5HBAA 4WBBA 3ZXEA 2E6VA 2OZJA 5FQ0A 3V65A 1BKZA 2JG9B 1XNBA 1QNWA 2FMDA 5C9AA 2PFWA 5CBLA 1CONA 3KCYA 4DRVA 1CPNA 1QU0A 1RHI3 4DZGA 3V0AB 2WSUA 2DVGA 1TMF2 1YO8A 2XWBB 4TLFA 2BBVA 2RS13 4PF5A 2EXIA 2JX9A 4CEWA 3LWCA 4YG6A 5JSRA 5DDJ1 5CA6A 4AVVA 1Z7S1 2WA3A 1NLSA 3ILRA 4Y1ZA 1FXZA 2VOKA 4WVMB 4GMP3 1EP0A 1I1EA 3FHIB 3KM5A 4EROA 4O9GA 4X8NA 4AXOA 4WM8A 3VBOB 4KQ7A 4JGZC 3GBFA 2EAKA 5HXVA 3K48A 4LLOA 1ULDA 5FPXA 4F3JA 3AKSA 3DF0A 1EAH1 4PJYA 2JE9A 1MZEA 1ZM1A 4N43A 4YVSB 4C90A 4ZU4A 2OA2A 1NE4A 4FPHA 3PVOA 5FOBB 4XJ9A 1LKNA 2QCSB 3M3OA 5KHKA 3U0ZA 1H2MA 2EAAA 1PIV1 1QOSA 2Z2SB 3M7AA 1ENXA 1YUDA 2ZOEB 3HIFA 5JCTA 4LBLA 4L11A 1NCQC 1KITA 5FCCA 1VBC1 2BGCA 3QD6A 3MW2A 4DY3A 4HZFA 5JZGB 1KQRA 1FYUA 1WD4A 4GKYA 1NYWA 1DQ6A 3RSJA 1AYM1 5DUUA 5FDBA 1W6PA 1AJOA 2B42B 2TNFA 1H8VA 1RMU2 1ENSA 1CAWB 2W39A 1CJDA 2ZGSA 1NY72 2YV8A 3MPBA 5CIRA 4RQPC 3VBRC 1BQPA 2ZBJA 1CAUA 3WDTA 1PZ8A 1KS4A 4Q4Y3 5C4WB 2I45A 3H9AA 2A5ZA 1XXNA 3WZ1A 1MR5A 4HPKA 5KHGA 1R1A1 4Q1RA 4R4XA 4FPCA 4PLMA 1OI6A 1F9KA 1ULGA 5T50A 5F1RA 1G9FA 4M0NA 3R4UA 2E9QA 5DXDA 4JGYA 3ZYIB 1HRV3 2HWE2 4Y22B 2ES3A 4YW2A 3WW1A 1LTEA 3AM2A 1LGBA 3J8F2 2RS33 1YFUA 3VBSB 5K0UB 1YFYA 3USUA 3BODA 5CU1A 4XF4A 3WG4A 4RD7A 4Z92B 1RUE3 4E2GA 3KT4A 1BZWA 1N1TA 5JOXA 2B5HA 2ZX3A 1S55A 2HEVF 3ZIXA 5KBFA 2A6ZA 1O5LA 2B8MA 5GLVA 3ZXFA 1DYKA 3ZSKA 5CVRA 1RHI2 4KL1A 1Z78A 1EYBA 5C9AB 4FOVA 2TBVA 2VNOA 3AP6A 1QQP1 3M3CA 4PCRA 1PVC1 1C4RA 2PHTA 3VZJA 1SCRA 2GNMA 1HKDA 5I91A 1AR73 5IT6A 1URXA 1AR62 1AX2A 1TQ5A 3CEWA 3QACA 2PHFA 4CEWB 4QM9A 2WZR1 4QPIC 3BALA 4M0HA 2ILMA 5CFCA 4LA3A 5ACA1 2WNVA 4YLZA 1SFYA 2WIIB 5AC93 1MQTB 5T55A 1G8WA 4BIOA 3LOIA 4A7YA 2XKPA 4H3WA 4WM8B 1YHFA 4AFAA 5FOJB 4EWDA 4FTBA 5KHJA 4CDWB 1U5YA 1WW4A 1K5MA 1AL23 3M3EA 1UF2C 1COV3 3M70A 4NHMA 1REDA 1O7FA 4QMAA 2CTVA 2WFF3 2GMPA 2VOWA 3SCFA 2GN7A 1C57A 1GANA 5KWRA 3ZDSA 1TE1B 2HWB3 5SV5A 3GHNA 3SITA 1OQDA 2HWF1 2CY6A 4AVSA 4E4DX 2ZMKA 2OYZA 1WW7A 1LHVA 2BVBA 3KGZA 4QQOA 3V64A 1RUD1 1J3RA 4GIQA 1D4M3 1RUG2 1XYOA 2SLIA 4KU7A 4HVQA 1AR81 1G9AA 2UU8A 3WHTA 2O8QA 5T5PA 1RC6A 1CAXB 2YYOA 3DN7A 5I8SA 5GZCA 1W6PB 1X33A 4K6BA 4D7TA 1H2KA 1SLIA 4FPEA 4Q4Y2 4Y24A 3O0WA 2MEV3 2BYVE 3UK9A 2G9FA 5C33A 1OLRA 1AR93 2PA7A 3D0SA 3SNMA 4BCUA 4V1PA 3PHMA 2GNBA 3ECQA 3VBUA 4Z82A 5BNOA 4IEVA 4QHBA 4MGZE 3E6CC 1YFWA 1F5FA 4HSJA 2RS32 3N4MA 4I09A 4JGYB 2R32A 1MS8A 3RYRA 2DFBA 3WOGA 3AB0A 1NCQA 1AYN3 3ZFGB 1DF0A 4WVWA 3AKTA 1RUE2 4OUMA 4ITCA 4B4RA 1VBA3 3WINE 4XHXA 2P2KA 1ASJ2 1PK6B 4IL7A 1PZ7A 3C3VA 3NV1A 3VBHC 4E9KA 4RS5B 4YSFA 3HQXA 3ZFFC 4YW3A 3G7DA 3OGJA 1TNFA 4RQPA 2F4PA 3WD5A 3MLKA 3PMSA 4NR1A 4UW6A 2PHLA 2Y0IA 4G4FA 5F6LB 4I0BA 2VVFA 4HLTA 5GLTA 4FT8A 1C5HA 1ZZ7A 1HV1A 4LBKA 1VBD3 2BVVA 1RUJ1 1NE6A 5D8AB 1QJY2 1AR72 4K7JA 1PGL2 4AFMA 3DPRA 1MEC3 4UXAA 2XGXA 4BZ4A 4K20A 3FLRA 4I3GA 3ROUA 2GN3A 3ZXLA 1SLTA 4Q0UA 4MGIE 4FPYA 4QQ2A 4ES8A 4FOWA 1UMZA 4HFSA 2DUOA 4A3XA 5AC92 4HL0A 1XNKA 3AXEA 1ZRRA 1O4TA 5CFCB 2ZZQA 1YI7A 3LB9A 2WFPA 5JDBA 1UU4A 4P9WA 2WNVB 1IQAA 3TN91 1Y9QA 4COVA 2Y0OA 1Y3TA 3AFGA 3M3IA 3JB8A 3AYAA 2VH9A 5JIAA 1Y43B 1PNGA 4KG8A 4IEZA 2C5DA 4Q4V1 1DU3D 2UY9A 2XLFA 3GBGA 5FO7B 4ATFA 5I93A 2XH6A 4XXAA 4CEYC 1UIKA 1PO12 3LZZA 3UV9A 2WFF2 2ATFA 2WNUC 3VKMA 2IZWA 4U36A 4XJ8A 3IIAA 4M3CF 2DYCA 3ZFEC 4YVWC 1BCXA 3OBTA 2ZTNA 2W52A 1X82A 3B02A 2Y38A 2UYBA 2YROA 5K7PA 3MEPA 3FFQA 2G4IA 1HIXA 1D4M2 3BCWA 4MXWA 4N53C 4N7IA 5T5LA 1WBFA 3CL1A 4FPOB 5FFOC 4LBNA 1HQNA 1RVF3 1LODA 1W6OA 1WCKA 3KD4A 4CDXA 4AQTA 4AWDA 5IK8A 2K2SA 2GNTA 3JQXA 4BM8A 3IBMA 3JUUA 5BNQA 1IS4A 5L7OA 1LECA 2A73B 3IDCB 3L9JT 3MIBA 4JGZB 1ZYBA 2VW2A 4YZ4A 1WLTA 2KM2A 1FATA 2ZCWA 1M4WA 5EXOA 2VY0A 4H55A 3WCRA 1MZ5A 3B5LB 3AX4A 2E51A 1JUHA 2ZJCA 1PGW1 1NQDA 5FO9B 4EWEA 1F8VA 2VUJA 1FMD2 5CG8A 4JTNA 5K8SA 1R093 4JAAA 1OOPC 3JD71 2YZ4A 5E1RA 2XL9A 1DGRN 1XNCA 2R073 1B35A 4D94A 1HRI3 3RDIA 1VBA2 2JECA 1NCQB 4ZKTB 4GWNA 3ILNA 3KSCA 3KZ4C 4K40A 2BFUL 2QDRA 1C1LA 4FXGB 1AX0A 3NAPC 3WP5A 3PJYA 2DFCA 2HWD2 1EPWA 4Y20A 4FBFA 4RQPB 3VBRB 3KS7A 1YFXA 1PGSA 2JXAA 1OA4A 2ZPXA 3WT3A 5BUVA 1CR7A 4M3CB 2RS52 1VBD2 4FPGA 1DGLA 3MDPA 3N7JA 1OPOA 2WINB 2RR13 3H50A 3ZSLA 5A3MA 1MEC2 4TSVA 2ZX0A 1Q56A 4ZXKA 2DF7A 1FOD3 4AVTA 1ND2C 3WDXA 1W2UA 1NA1A 5C8CA 2R6QA 4LLFA 5D1IA 2Q1ZB 2D3RA 4RGGA 3UKVA 1NQJA 1RUI2 2A3XA 4LBOA 2OZ6A 3NV4A 5J37A 3ILFA 1QOTA 4XMIA 2CWMA 1JXNA 1LOFC 2E63A 2AZ5A 2VXRA 3ASIA 4MV2A 3AJZA 2AENA 1ZZ6A 5GZEA 3ZSMA 2R1BA 3MF6A 1BBT1 3MF9A 4Q0VA 2AH2A 3VL9A 1JYCA 1HQLA 4C91A 2JICA 3IWZA 1W0PA 4EN9B 4RGAA 1VRH3 4RHV1 3RS6A 5HCFA 3RYPA 1PMIA 1VBE2 2WL1A 2JG9A 1TMF1 2ZAHA 3RZZA 1ZBA3 2ET7A 1Q8SA 4HANA 3B01A 4OHYA 4AEMA 3WW2A 2FBEA 3URFA 2SBAA 2Q8OA 1V9U1 3TBDA 4YGCA 4I02A 5KHHA 1QH6A 1A6CA 1RVF2 4QPIB 4MXWB 1B09A 1XYPA 4QPYA 1PO23 1LOBA 2HWC2 4GA9A 2X53S 4CDQC 4WVMA 1NCRC 3QLQA 2OUHA 4P9GA 4KGGA 1N1VA 3KT1A 4A7ZA 2PHRA 1RITA 4XIOA 4X6RB 1SLLA 3VBOA 4CTEA 3FFZA 2EXKA 3QH7A 3R05A 4BA6A 3LA2A 4CEYA 4Q26A 4HKOA 4YGDA 2WNUA 3KMHA 3SCGA 4YVWA 3AXDA 2IXHA 1KFUL 3RRDA 2QQPA 3IKWA 2VU9A 4YVSA 1R092 4JRAA 1UU5A 3AJYA 1DLLA 2YXSA 2RMU3 1HV0A 2PLV1 2PHWA 5EYXA 2R072 1NG0A 3THPA 2QZ2A 2NM1A 5BY5A 4N53A 3ZXKA 3MIEA 1O5UA 2BWAA 1HXS2 1IPKA 3CJIC 5JSOA 1Q8VA 1XE8A 5FMOL 1GZ9A 4I0WB 4IEWA 4JV4A 3AZYA 1LHWA 2PAMA 4O9EA 1KDKA 5FLIA 5GLZA 1DGWX 4PDWC 3SLIA 4BH9A 3AKPA 4XZPA 2R062 4WVZA 4P9IA 2RM21 3J4UH 1NY71 3H1WA 4QT6A 4LO5B 1OQ1A 1QJU1 5GM0A 2ZMLA 1CAWA 2A6VA 3NW4A 5T52A 3D82A 1D2SA 3MW4A 1IS3A 3QBQA 1FNYA 1RMU3 1WLDA 2RR12 3ETQA 3ZYJB 1ZNPA 2DCTA 1OQEA 4HVOA 3AP4A 1IHMA 1I5ZA 2K9ZA 2HWE1 5BNNC 1R083 5FRAA 2WS91 1CQ9A 1F31A 1OD5A 4IQPA 4YZ2A 4Q1PA 1QNYA 1S0DA 4IV1C 2PYTA 3QH6A 3CU7A 1VBB1 1GZWB 4P5HA 3VBSA 5K0UA 4K8FA 2Z42A 2XBO2 5LK5A 3O12A 4AQ2A 2D98A 4M01A 1SBFA 4AVCA 1XE7A 3J8F3 3SISA 1AXYA 3VBHB 3NAPA 3GZTB 2CGOA 5EFUA 1W6QA 3H3ZA 3MYXA 2VECA 1EPZA 3ZFFB 3S0MA 1N47A 4YG0A 1RUF2 2XJVA 1KD7A 3R4DB 1VRH2 2ZGTA 1RHI1 4RR3C 5GZFA 4W6YA 1ZBA2 2X5IC 3AYCA 3SH5A 5L19A 2RS11 4HETA 3CF6E 1S0GA 2DVDA 4Y4YA 3N7LA 4GB33 1BEV3 2XKOA 4ASLA 2FMYA 4L2NA 3LA7A 4XF0A 3BOPA 3S7IA 1QXPA 2D6MA 3UKTA 1H9WA 4EN6B 3WR0A 4GMP1 1MZ6A 1OSGA 2XB6C 3TNPB 3B7MA 1X8MA 1PO22 1QKQA 2YC0A 3SCHA 1W6NA 2PN5A 3I2DA 1AR63 4DMIA 4UW3A 3ZN5A 1QH7A 3E5XA 4ORFA 2FZ1A 4U2AA 3MIFA 4XFHA 1MQTA 3IT8A 2BW8A 4F7ZA 4BQ1A 5E88A 1TNRA 3NV3A 5GJ6A 5C6CA 4OUSA 4Q0QA 4XFFA 3POSA 2R49A 4OHZA 2MNGA 5GLWA 2KXLA 4CEYB 4CDWA 1OFSA 2WNUB 3NJZA 2IXKA 1POV3 1WBLA 1QXJA 4YVWB 3ZFEB 2RMU2 5J36A 4AGVA 2WLQA 1RUC3 1AVBA 1YCIA 2JDZA 3JBG3 4JC1A 4Y26A 4YM3A 3WQ1A 4LEJA 2GZWA 4P9XA 4B8EA 1NOVA 2PQQA 4CDUC 4Y5Z0 4BOWA 2D6OX 4IXLA 4N53B 3ZPYA 3VKFC 3S6PA 4MH0E 3B00A 1VAKA 2VW0A 1FAYA 3WDYA 1LEMA 4NPRA 3B9CA 2QZ3A 4XXPA 4KG0A 3WUDA 1AF9A 1ULFA 4W65A 1UL9A 4HVRA 3SH3A 1RUG3 4R9AA 1VR3A 1F2NA 1CAXA 3KQRA 1H8TC 2Z79A 4OFGA 4XETA 4YFZA 1ZRDA 3U07A 1AJKA 1WW6A 4M3CE 1V70A 5EWSA 2WNEA 1SLCA 1U5XA 3SXWA 3GYDA 5J7MA 2EA7A 1ZBE3 5IK4A 3VKNA 4KBBA 1HRV1 4AI0A 5GZGA 1R082 5JWPA 2RS31 1LJ7A 5I0RA 4XFAA 1FPN2 3WP4A 1W0OA 1OOPB 3TYJA 2EXJA 1XU1A 5B2GB 2PTMA 4XOGA 3VLBB 4PDWA 5A32B 3ZFGA 1ZZ9A 3ZYPA 4S2FA 2ZX1A 2UYAA 1LULA 3A0KA 4XJUA 3MI8A 3O0VA 4JDNA 1PK6A 4OI1A 2XHKA 4XYXA 5A33B 1SQ4A 4QXKA 1C5IA 3NAPB 4RS5A 5GLUA 3HR9A 4Q8KA 4INDA 4XTPA 3VN4A 1W6QB 4ASMB 4XPVA 1ASJ3 3W59A 3X29B 4CP1A 2B45X 3P3PA 1HX6A 2C0ZA 3V0BB 3CLPA 1WMDA 1BEV2 4GB32 4P14A 4MYEA 4R9BA 3RG0A 3LGRA 4HSLA 1QY4A 5T3NA 1AR71 5JOYA 1N3QA 3VDDC 1U5ZA 3ZX7A 1S0BA 3HWJA 1LESA 1SBDA 5FPZA 4KGQA 5D8AA 2NLRA 1ENRA 2DCZA 3OD0A 4ZU5A 4MXVA 2D6KA 3BPZA 1ND2B 2P17A 4C0HA 2H6BA 1QJY3 4JRLA 5AC91 2WZPP 1V6LA 2A3YA 1W6NB 1MZFA 1ZZCA 2Z5WA 3P3NA 2IXCA 1EY2A 1R1ZA 3PTYA 1H0BA 3PMEA 4I01A 1W6MB 4XW3A 1AL21 1COV1 4UBHA 1RUH3 3TOJA 1CJPA 3QOPA 1DIWA 3WDWA 2ZHNA 2WFF1 2DU0A 1AXKA 3PLQA 1D4VB 3RI8A 4YM1A 1LCLA 2VGDA 2HWB1 2Q0AA 2EIGA 2YGLA 4GULA 1CAVB 1RUC2 2GSYA 5DG2A 5BPXA 1KS5A 1ZX5A 3JBG2 2YDEA 1PO13 3CJXA 1ZRCA 1H1MA 2CYFA 4MX3A 1D4M1 1S1AA 2XPJA 1EV13 4JVAA 4FO9A 5SV8A 1QJX3 1VIWB 5AVPA 4LO6B 3AFKA 2B39A 4M00A 4CDQB 1YRZA 1NCRB 3D8CA 3RPQA 3B93A 3PVBB 1WLWA 1WMFA 2MEV1 4Q29A 2WQZC 1J58A 1AR91 3W9AA 4EN0A 4AK3A 4JGZA 3VL8A 1EAH2 4QU2A 4Q0PA 1ZBE2 4I3PA 5CFDC 2AR6A 5JSPA 4ONUA 2BNOA 5FREA 1CESA 4AGRA 3R0RA 1KXGA 3LOBA 5LEJA 5H9QA 2CGNA 3ZXJA 4FPJA 4OI4A 4YG3A 4NHLA 4QPGC 1O4ZA 3VKLA 1AYN1 3GZUC 5JIUA 2P3IA 4CDUA 1UCXA 5JI9A 4JDOA 1SMVA 3E6BA 4B7KA 1VBA1 3CJIB 3V56A 5CAZA 1FMD3 3RMYA 2V73A 4BLJA 3NWKA 1PZ9A 2KA3A 5GALA 1AYM2 1XNDA 4IEXA 4PDWB 5JI7A 4IV3B 1DZRA 2DCYA 1ND3C 3D5OA 2B46X 1H2LA 3FUQA 4WM7C 1WLCA 1ZA4A 3GALA 5BNPC 2ZHMA 1S2BA 1VBD1 4IETA 3VBRA 2GDFA 2HWD3 2H0VA 1MEC1 4M3CA 1YJKA 5BNNB 4YGEA 2VVDA 3MIGA 4E2SA 2RS53 4SLIA 2YY1A 4HMZA 2W08A 4IV1B 2ZHLA 4XQDA 1G9BA 2EF6A 3BB6A 3MFAA 1YIPA 1QXRA 4MSVA 3AZXA 1O3SA 4COWA 4LUMA 2ETEA 5GKAC 1LR5A 1JBCA 3EXUA 4FP2A 4YM0A 3ACLA 1RUH2 1JN2P 2ARXA 3TWIA 3FE5A 4A2UA 1RUI3 5I0SA 2UY8A 1S0CA 4R4ZA 1V6NA 3BOWA 3ZXGA 4D7SA 4DINB 5DUWA 4RR3B 4XILA 4A7KA 2X5IB 3VUOA 4CRQA 1ALYA 1UD1A 1QQP2 3WNXA 4B7EA 2P34A 2D3PA 3ZSEA 2X29A 4PIZA 1X50A 1VBE3 1BVVA 2GC0A 3PNAA 4GH4C 1EV12 1RVF1 1QJX2 2XL7A 4HN0A 4KWKA 4AW7A 3E5UA 4AHXA 1X8EA 3WY6A 4XJZA 1U5IA 4QPIA 1Q5OA 2CNAA 4Q8LA 4FOYA 4YW1A 3TAYA 1KRIA 3VZMA 2ZX2A 2O8OA 4B4PA 5C8WA 1GQHA 3ZN6A 2HWC3 4GALA 4L92A 5H9PA 1WCDJ 4EWAA 3POYA 4ATEA 4XQWA 5I0TA 5EV7A 2XLGA 3J9SA 2GH8A 3IDBB 2X8KA 4GKXA 4KU8A 3R6SA 2XVLA 1BMV2 3I4IA 2JG8C 4P9YA 4WZCA 1R091 3O7OA 4Q2FA 2OIIA 4LBQB 4PIXA 1UW8A 3AYEA 2ZGOA 3NKGA 2R071 4FQZA 2HWF2 1GKBA 3H7JA 4G3YC 1HRI1 1J59A 1X7NA 1FX5A 4TYSA 1YXWA 1IZ3A 1GBGA 2WT2A 1LB2A 2JE7A 1DYPA 3JZVA 2LUWA 4CDUB 3VKOA 1SFNA 2LTNA 3FBMA 1GQGA 4K21A 1Z0HA 4LBJA 2YGMA 5F6KA 2XJRA 4DRRA 3FUOA 1DQ0A 3OJBA 4IESA 3N36A 1HXS3 1Y7BA 5FMOS 1LOCA 4J6GA 2XJTA 2ERFA 2IFRA 2ENRA 1ONAA 2WWSA 3APBA 4ISQA 1V00A 4FPFA 4AEDC 2ZGUA 4S2GA 1H8TB 2Z69A 1RUNA 1QMJA 3BU7A 1MS5A 1QHDA 2GALA 3IM0A 5DZEA 3U10A 1GICA 2D6LX 2R063 4I0AA 4XEZA 3HBZA 1JTZX 4XFGA 1N3PA 1C8M3 4K9SA 2I74A 2EXHA 5BYNA 2R043 1GV9A 1I6XA 2ZHKA 1YJLA 1FOD1 5I8YA 4KWLA 1OKQA 3MPPG 2XJQA 1N1YA 5HCAA 2RJLA 2WT0A 1N1SA 2N7GA 4XF3A 3USSA 2WQ4A 3FZ3A 2D5FA 4OHVA 1YLLA 3BTAA 1GZWA 4FSJA 4L9BA 3ZMOA 1DGWA 1MS1A 1KJRA 2D97A 3WVJA 4YARA 3GNEA 4BPZA 1WUVA 3VBHA 1VRH1 1KFXL