2NR5A

Crystal structure of protein of unknown function so2669 from shewanella oneidensis mr-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
64
structure length
60
Chain Sequence
MMTKKERIAIQRSMAEEALGKLKAIRQLCGAEDSDMQEVEIWTNRIKELEDWLWGESPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein SO2669
publication title Structure of SO2669 protein from Shewanella onedensis Mr-1, a singleton of unknown functions.
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 24
structure length 60
sequence length 64
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2nr5A00
2GBOA 2ODMA 2NR5A
chains in the Genus database with same CATH superfamily
5BZBA 3IGAC 1KQSU 4TUYB 2C2AA 2IU3A 4DR5B 5B3SC 1V9PA 2Q9LA 2HVKC 1URFA 2LO1A 2RN9A 3ZMTA 1R1BA 3CRMA 1P7GA 1EM1A 3JATB 4EB6B 5HFLA 2UUBB 1SA0A 4X8AA 1Y76B 2R72A 4DRXA 5KLVH 4E4EA 5KHHA 3ZRWB 1TUEB 3EVKA 4J7KA 4UCUA 4DV6B 3JAWB 4NXMO 3E8BA 4JI3B 3ZS8C 2JGUA 4PHZA 4IT5A 5IJ0B 1QLEC 3WU2Z 2QWRB 3N2KB 4O4LB 2CTWA 4WFFA 2KG7B 1XL6A 4J42A 3SYCA 1KC8W 4ABMA 1IBKB 1AI4A 1Q8IA 4HAMA 1VQ5V 2RCVA 4GKKO 3CCLV 2YIAA 5L3EA 2BOCC 2XOKG 4FFKA 1VQKV 1Q6UA 2P7TC 4QNHB 1D5AA 3AK2A 4EFBA 3G4SV 1NH2D 3M8AA 4LWSA 2VQFO 4LF6B 1BL8A 4DV5O 1MZFA 2FB5A 4NXNO 1Y4MA 2PGGA 2ZD9A 2F4VB 3RYCB 3AG4B 2WLIB 1YF2A 1RFYA 3JCUZ 3SGIA 2UU9B 2YUAA 4BW9A 3OMNB 4UV8A 1K33A 3D36C 3UT5B 1FXKB 5H9CA 4IIJB 2CTQA 4OGQB 2AGAA 1TGOA 3IC7A 2W0XA 3JD0A 3KKYA 1XL4A 3F5TA 2WLJA 5K1XA 3FAVB 2M7WA 3SPHA 2GDSA 1G4YB 2QKSA 2CUGA 4FM2A 3RVZA 2F43G 2HG5C 5IWAO 4LF5O 5IYDO 1I5YA 5EZYA 5IY5B 4JYAB 3NXSA 2ETNA 1JFFA 1MZEA 5A9GA 4TQFA 4DV0B 4EKWA 5J2UA 4QE7A 1NBMG 2XAHA 3FYEB 2EIJC 1HNWB 1YXBA 1GM7A 4JV5B 1OCCC 3RVYA 3ZHQA 2UXCO 5FNVA 3CC7V 3OFNG 4CH6A 5J2TA 1NI8A 2LW7A 2E5LB 1AROP 1RPRA 3OR6C 5KX5A 2L6LA 1RP3B 3SYAA 1FFTB 3ABMB 3RFRA 1WA8A 4X66O 1SQFA 2HHHO 3CC4V 4HBNA 3A0RA 3RYIB 1ENVA 3S3WA 1OCOC 3ZHTA 1V55B 4G28B 5IJ9A 2UXXA 2QTOA 1WAZA 2CE4A 1AJPA 4I50A 1RPOA 1DLBA 1JVMA 1R73A 1OZ0A 2P22C 2P4VA 5K1PA 3DC5A 4IYIA 2ZE8A 5CA1B 4ICGA 2DW4A 5EBWC 3RYFB 2O57A 2HP8A 2EJRA 3QG5A 4MSWC 4JI2B 4DR4B 3CXHF 5CA0A 2CH7A 2F1MA 1P4RA 2F66C 2G38A 4KXRA 3LDCA 4FZ0A 4KP4A 1VQ6V 4I0XA 2YIBA 3ZN0A 1YDXA 2Y69C 3E35A 1NS1A 1AI6A 4GKJB 5KHGA 1JX9A 3L74H 1KMIZ 4YJ3A 4DR1O 3WG7C 3AK3A 3K57A 1S3JA 3H1JH 4FZ1A 3LSQA 4DR6O 2WWWA 2M6YA 3VQWA 4WF9V 2DYRB 2XAGA 5BMVA 2DOSA 3UKMA 4K8XA 3K03A 1FJGO 4B08A 1GN4A 4J9ZB 4WFBV 1XQ8A 3E8GA 1S0VA 1M56B 5LGNA 4DV7B 1KU9A 3ASNB 4LF8O 3RN4A 4LC1A 2CGOA 2DN9A 3P3NA 2FTKA 2DYSB 4X65B 4PV1B 5EC2C 3C90A 4PELA 2EZOA 2WLHA 4JF3A 1B06A 1E79G 1GRJA 3K0GA 4PA6A 4JI1O 5KA5A 1Q6HA 4L8JA 2H94A 3OAAG 2BTOA 3CRAA 4TV9B 5IYZB 2P6JA 3G80A 3C3TA 4LFBO 1OJHA 3J81N 1PKXA 1M9NA 4FMTA 2VWJA 1PV0A 2IH1C 1BT8A 1YTFD 5B1NA 3ABLC 1IBLO 1GKFA 3JASA 1F23A 4GLXA 3T1CA 5KA6A 4BIZA 1AR5A 4LF7B 3TJTA 3WB0A 4IGGA 2YDEA 3BABA 4BR6A 4MVSA 2WLLA 3OD4A 4UVAA 2EIKC 3HR0A 4YIPA 2D2CB 3WB2A 2A0LA 4X1IA 2WLKA 5BR8O 2UUCO 3AG3C 5KUKA 2RQ6A 1MA1A 2VRZA 2Y0PA 1KBHA 4MTFA 4LF9B 4DYLA 4DUYB 4QGPA 4WFGA 3FX7A 1YSCA 1S5HC 1SQPH 2Q73A 1EBOA 1GAXA 1OCZC 2PYJA 1VF7A 1XNQO 5E1AC 1K5QA 2LJ2A 1I7FA 1XMOO 3E8HA 3O65A 4H0LB 4UFZA 4PDRA 4B3SO 1PM9A 3ZMVA 2E76B 1NJIW 3K79A 3JCZA 2XT9A 4MS2A 4JI5B 4CC5A 3CE2A 2XNDG 2NN4A 3RYHA 2B1IA 1SZTA 1SC5B 3SJBC 1E1QG 3D3IA 5JH7A 1J95A 5DEDA 1FFXA 1ZUQA 1O9HA 3KG2A 4X1KB 3CB2A 2PI5A 2BSKA 1YITV 4I55B 4UCTA 3AG2B 1NR1A 1PP9H 4TSFG 2LW1A 3ETDA 2A9HA 1N36O 2UXDO 3ZMUA 1I0HA 1VMGA 1K92A 1VQ9V 2E75B 4JI6B 4K8ZA 2ZXWC 1YHQV 1CEZA 3E86A 3MHSC 4X1YB 4MVMA 1K97A 3R66A 4UCVA 1LR1A 2P90A 2UUAB 3ABUA 5LA6A 2Z5UA 2CK3G 1I08A 3ETEA 1W59A 2B9ZA 4F6RA 1H2GA 1OCRB 1RSOB 3GB7C 1ZL8A 4HYOA 5FPOA 3LNMB 4MVZA 4DR3B 4JYYA 1M57B 3T1YB 1BE3H 4X20B 4LFAO 3CPWU 4OX9B 1FAFA 1UPGA 3H01A 3ZHSA 1O9GA 3H1HH 4YHHB 5L3GA 1Y74B 2ARHA 5JVDB 3CRQA 3AG4C 3ZEDA 3ASOB 1U96A 3APOA 1JCHA 1AVMA 1DF4A 2CAZC 3IJ4A 3BFRA 3U10A 1PL4A 1XUQA 2ZM6B 1I5XA 2ZIOA 1KP2A 3B40A 2ZR3A 1JR9A 1NVPB 4J41A 1N34O 3JD3A 2HR3A 1AP5A 2JGDA 2V4DA 4JYCA 2GUZB 3VQVA 1HR0O 3T1HO 5IY5C 4CS3A 2Q0OC 3GVMA 1K8AW 4U3JB 4WFAV 2EJ7A 3HKCB 3CC2V 3OW2U 4NB5A 3VQYA 4ZHQB 4U7NA 1DK1A 5LBQA 5C8YB 3OUFA 4O4JB 3ETQA 2VS0A 5JQGA 4DV1O 3JAKA 4QIWF 1SS3A 1MSWD 3I5DA 4CC6A 5KHKA 1WP7A 3K5NA 4TV8A 1GM8A 5EK0A 4P30A 1K3EA 3AEIA 1UFIA 1BGYH 2IJJA 3OGIB 4O2AA 4X62B 4H44B 1JOYA 3N27A 4WBNA 1NQTA 3ABMC 3QNEA 5B1BB 1RM1B 3IC9A 4FLWA 3LNNA 4JI4B 4DUZO 3CWBH 1VARA 1KYOF 1S72V 1QVFU 5GONB 4LF4O 3P3PA 1N32O 3SPCA 3TCUA 2DQ0A 1GN6A 3L70H 4TUYA 2JS3A 3APQA 1V55C 3LSUA 4BAYA 5KHIA 1V54B 2XAFA 4IL6Z 4K0KB 4Z1VA 3EFFK 1J5EB 4B3MO 3L9DA 4YY3B 2OTJV 3JATA 2KKWA 3CX5F 1XOUA 4EB6A 1Q81W 1Y76A 2GSMB 5H5NA 2D3OW 2XUMA 4GX0A 3L75H 3ZRWA 4Q6GA 1L1FA 1ZTEA 2A3QA 4JI8B 2Y4UA 2JS5A 3JAWA 5B5EZ 3JARB 2W6JG 1N4CA 2UXNA 2Q69A 1FPOA 1IZ3A 5IJ0A 4NR1A 3N2KA 4O4LA 4CH5A 1TUBB 2KG7A 1WLEA 3BPZA 4GUNA 4G2KA 1XREA 5LYJB 1NH2B 3O9OA 5B1AC 4MW3A 3MDSA 2X6BA 4PA4A 2ADPA 4I4TA 3OMIB 4P9PA 4EEQA 5LHGA 4G27B 1GM9A 2LP7A 3E2EA 2X6CA 4PA9A 3DC6A 2CGNA 2VQEO 4QJFB 4FK5C 2MW2B 5LXTB 2EIMB 2ITCC 3FB8C 2ILMA 4LH6A 2YC0A 3H1LH 4DV4B 5CBHA 2ITDC 2DYRC 4IHJB 1GTOA 3RYCA 4FPPA 5LMNO 2CDYA 2WLIA 1B04A 1JQ0A 3N2GB 3U11A 3EXAA 1B3QA 4B3TO 5IT9N 1IBMB 1M56C 5CBFA 1FXKA 3WB1A 3SDLA 3STLC 3ASNC 4BWAA 1YZBA 3JAMN 2BTQB 3FAVA 4KHPB 2WA3A 3QF7A 2LGWA 4DR5O 2DYSC 2DJVA 2AXTZ 2HJDA 4NTWA 2K9PA 5EBMC 2XHBA 1GH6A 3BAAA 2EX3A 4GYCB 2UUBO 3OMAB 3HKDB 3VOUA 3Q4HB 3BHPA 3OTFA 4JI7B 2MK3A 4TQDA 1H2SB 4FJCC 4DV6O 3GWOA 1I94B 5JWPA 1H2MA 4JI3O 3K0DA 5AG2A 2KQXA 4DO2A 5B66Z 2ODMA 3BA8A 1SQVH 1SESA 2YICA 4A5UB 4FM0A 4J9YB 2E3CA 3CMAV 3B77A 4J7JA 3DTUB 3U0ZA 3SYQA 1QR9A 2QWOB 1IBKO 3UO2A 3ZMSA 1EN4A 2BOBC 2QR4A 4DXWA 4DV3B 3JALB 1VQ4V 4UB6Z 1PNKA 3RWRD 1G6UA 4R6ZA 4NVPA 1U97A 3ABKB 3FB6C 5KAFZ 1AJNA 1P7BA 4LF6O 1H2NA 1XI1A 3RYIA 2ADQB 5LGTA 2AZ0A 1BSMA 4ZKIA 2ZE5A 1ZX3A 2OCCC 2F4VO 2UXBB 1G8MA 3MAQA 1KB9F 3SYPA 3FYIB 2UU9O 2BE3A 3AG7A 4RUFA 1JMKC 3ML0A 3QO7A 3CXCU 2YIBD 1SQBH 5CA1A 2NR5A 2ZDIC 4CH4A 3W7TA 1MABG 3S3XA 3M99B 3RYFA 1H38A 3TXQA 1VQMV 1HW7A 2OTLV 1JPXA 4J11A 2RMKB 1YJ9V 4JZ2A 4JYAO 4DR7B 2YXYA 1Z2GA 4ZI7B 5CB4B 3D8CA 4DV0O 1XNRB 3TGUH 4N23A 4HNAB 1HNWO 1X59A 3AG2C 4UV9A 3K5MA 4Q20A 4B7EA 2DMXA 3SJCC 4JV5O 2Q68A 3SYOA 2QKAA 3CCEV 4DR2B 4MVUA 2GBOA 1YI2V 2PY5A 4R8CA 2E5LO 4FFBB 1XDCA 1R6TA 2HLDG 4AQYB 1KKCA 4WFEA 5E79Z 4Z2WA 1OCRC 3KCXA 4PJ0Z 3OM3B 1WB8A 4B3RB 3ZMZA 1R6NA 1M57C 2QTSA 1IURA 3HKEB 2WSSG 5LMUB 3C3SA 2CTPA 4RO2A 4JI0B 1NTMH 2LGQA 4GX5A 4TOIA 5LP6B 3CCSV 3FD9A 3L73H 3CJHB 3SJQC 4AILC 3CYOA 3ASOC 4MVRA 3LSSA 3ZIAG 3CRRA 3LDEA 4O4HA 2PI4A 1K73W 2FL4A 1AR1B 1N33B 3SPGA 1EZJA 1YTFB 3P30A 3K9SA 1K34A 1CXZB 3L71H 4TV9A 1BHBA 5IYZA 2E74B 1HNXB 4JAAA 2IJHA 1BZKA 4JI2O 5CBGA 5EYPB 4DR4O 2F95B 2AHYA 1Q6IA 2W6IG 3CMEV 3KZIZ 2P4KA 2R9AA 2NNUA 1NT2B 1WPBA 2RDCA 3AK1A 3HB3B 1YJNV 4LFCB 2Y0IA 3A0BZ 5H6QA 1L8DA 2PUSA 3OEEG 4YJ2B 2QEXV 4GKJO 1S5JA 5B1OA 2IBZH 1M90W 1YEWA 2R9RB 1LUVA 3BVOA 1Q90D 4X64B 2K1EA 2GTSA 3BCCH 3MHHC 2XASA 4BIOA 5ITZB 3QVNA 3AG1B 3OR7C 5EIBC 3ZHVA 3KCYA 3K9AA 4O4IB 3K5OA 1BQZA 1IDSA 3JD2A 1XNRO 1SF9A 3DSQA 2Z3YA 2OCHA 1KUQA 4QE9A 4X88A 2ZR2A 4JYBA 4FLUA 5EC1C 1Y6XA 4WCEV 3P32A 5B1BC 2VWKA 3ZRSA 2GV9A 4XDLA 2RJZA 3FB5C 4DK1A 4DV7O 4DV2B 4D6TH 2ZDIA 2IJIA 2DQ3A 4C7UA 4K3AA 3F7VC 1VEWA 2Q7GA 2EILB 2ZKOA 4JAVA 1V54C 4CS2A 2X7RB 4X65O 2P06A 3W7WA 3ZX6A 1THZA 3FB7C 2OT5A 3JSNA 5L3FA 1YJWV 2WA4A 4CH3A 3STZC 1HNZB 4UVBA 4X1KA 4LNUB 5LHIA 1R6KA 3E22B 2YIDA 2PF4E 1D2DA 3G6EV 2WAMA 3X2QB 2N05A 3JD4A 2A06H 3HKBB 3PN1A 4L87A 5KUMA 3M7MX 3K06A 3HPLC 4X1YA 5KMGB 5LOVB 4FLXA 5JJNB 2X6AA 2AW9A 4MVQA 3CCMV 4LF7O 3ICXA 4UUJC 3CCJV 4NXMB 1CPYA 2Q6AA 5DN6G 2QE7G 1H8HG 5A2QN 4LP8A 4YXWG 3RW0A 1GO3F 1BMFG 2EIMC 4LF9O 4JTDB 1FXKC 4X20A 4QPJA 4DUYO 1KD1W 2JVDA 4R50A 4FLYA 5CMUA 1TAEA 2GHYA 4OPAA 1QVGU 4UCRA 4GKKB 3DXRB 5C93A 1Y74A 5JVDA 2ZE6A 4O2BB 4X64O 3QO8A 4CZZA 1JJ2U 2HKOA 1W0KG 1ORQC 2VQFB 4QPKA 1ROPA 2OIGA 2BCCH 4DV5B 2FKXA 4HZ3A 4LBEC 4UCOA 2QWQB 3E83A 2YEVB 4NXNB 4JI5O 4RQFA 4NTXA 5F2VO 4MTXA 1AJQA 2GUZA 4BW5A 1W0JG 4DW1A 2NLJC 2L35A 4FIPC 4LCUC 3W7SA 4ZOLB 3TXSA 2R70A 4U3JA 2JDIG 3BEHA 1SQQH 3QTCA 3HKCA 2ZQMA 3SPIA 1OCZB 5L3DA 4ZHQA 4PA3A 1TVKA 4U3FH 3J80N 4JI6O 5IWAB 4LF5B 2IJKA 1SERA 1SA0B 4AHCA 3OUSA 5H6RA 4DRXB 3D3QA 1K4DC 4FLVA 2UUAO 1B6QA 4NKGB 4PI0A 5GW7A 4BIUA 2YSUB 1XILA 5KAIZ 1WP8A 2A7WA 1SKVA 3CCRV 5FLXN 3BY6A 3RBZA 2QSAA 1QU7A 3ABKC 5JJEB 1G1XB 4DR3O 3VQXA 3T1YO 2UXCB 1UJWB 5GONA 4OX9O 1YIJV 1VQ8V 3A2FA 1AI5A 3OTOB 4YHHO 2YI8A 4KUMA 4B7KA 4JGSA 1WN7A 4JTCB 3SR2C 1E1RG 3T4ZA 1R3KC 2QKCA 4X66B 1Q7YW 1US6A 2ZXWB 2HHHB 2N04A 4JZGA 2JJ2G 1FS0G 4LWSB 3BA9A 4H33A 5CN0A 4KL1A 4OPHA 4FVMA 2ZM6O 5GTHZ 1F4NA 3WFVA 1WJZA 1CP9A 1NTKH 4I4TB 1P84F 3JARA 2HVJC 1M5IA 3OT7A 2JEXA 1NKDA 1Q3EA 1TUBA 3F7YC 4H37A 5LYJA 4W4KA 4AI8A 1NZ6A 4J80A 2WPDG 2OIEA 1WNSA 3B8NA 1SQGA 3K5LA 5BXZA 2QDOA 4JASA 5JJJB 4GX1A 4P9OA 2H3OA 4UXNA 5LXTA 2EULA 3CCQV 5EZYB 1KKDA 3UT5A 1JFFB 4IIJA 4RAIA 2V7QG 4RWUA 5J2UB 3G71V 2F23A 4IHJA 1EN6A 2CTRA 4X89A 1MOFA 3W7UA 3UM7A 5J9PC 4X62O 3ZHUA 3N2GA 1KECA 4DR1B 3QO5A 5D5QA 2W0FC 2DE0X 5JCOC 2QWPB 4JI4O 1Q86W 1PNLA 4DR6B 4F6EA 1QR8A 2IW5A 5FNVB 2YXLA 4OXSA 1LNQA 1GK9A 2EINB 3T4DA 2Q0AA 1D5NA 5J2TB 1NU1H 1VF5B 5H2FZ 1K5SA 1JA8A 2BTQA 3UQ8A 5LP6C 3J7AU 4MT8A 4IYHA 1FJGB 4GZRB 2JRIA 5KX5B 1IXMA 2YS8A 1K7DA 4K0KO 2Q5ZA 4DK0A 1J5EO 1BHAA 1QQCA 1WA8B 3CEIA 3RGBA 2X0LA 4YY3O 5D5PA 2V1DA 1MSDA 4GX2A 1W2BU 1OV9A 3HKDA 4ZBMA 5KHJA 3Q4HA 4LR3A 4LF8B 4JI8O 4CBCA 1TA8A 3OTOO 5IJ9B 5B3SB 4R7CA 4I50B 2YI9A 2B1GA 1F51A 3DGEA 2QM4A 3UCSC 4JI1B 1K4CC 1S5LZ 1VQLV 1VQPV 3OEHG 3I56V 3CCVV 1SETA 3B4SA 3RT3C 3B09A 1FXHA 4CS4A 1IX9A 3A8TA 3H1IH 3ZJZA 1Z5WA 3JALA 3T2MA 4LFBB 2H8PC 3W7XA 1XEQA 1P49A 5CA0B 2CH7B 1QLEB 2A79B 1HP8A 2R9IA 4K35A 3AG1C 1N0NA 3BRCA 3JYCA 1IBLB 3K59A 4DV4O 4I0XB 4I9WA 5LHHA 4WFHA 3IAYA 1AILA 4FM1A 3ETGA 1SQXH 4FLZA 4YJ3B 2XTAA 2GTAA 2N74A 5BR8B 2UUCB 1MNGA 2XAQA 1IBMO 1N8RW 4XDJA 2ZCEA 3VBBA 3K04A 5B1AB 1DGSA 4LH7A 2IH3C 1VF6C 2P5OA 3MD0A 2FMLA 5BMVB 1JJOA 1VP7A 4KHPO 2EILC 1PD3A 4YIOA 1XNQB 3CP1A 4DW0A 1XMOB 5GTIZ 2RNBA 3CS5A 1VQOV 2Q7HA 1COWG 4E2LA 4B3SB 2IU0A 4ZI7A 5CB4A 2QA4V 1XHXA 4JI7O 1XMQB 4HNAA 1BS3A 1I94O 4GCZA 5FPRA 3CD6V 3X2QC 1XHZA 3UO3A 2IM9A 1IVSA 4ASUG 2ATKC 1EZVH 3D36A 1QBZA 1QNMA 1AI7A 1SRYA 1ZLZA 2LFSA 4J7ZA 4FFBA 3E8FA 3I55V 1M1KW 2EIJB 4DV3O 2XAJA 1R3JC 1X4TA 4NYKA 1N36B 2UXDB 3FKSG 1A32A 4Z1MG 4O4HB 1OCCB 4JAUA 2LQTA 3GWKC 5FL7G 5JCOA 4MTGA 3EHBB 1BQ0A 4TWKA 3HKEA 4XBFA 1PL0A 2WLMA 5HFMA 4RUEA 3FFQA 2DWEC 3JASB 5L3BA 1AR4A 3B2EE 4XDKA 4I7ZB 5LP6A 4J10A 1BCCH 3G67A 2UXBO 2WLLB 3CJHA 5TISZ 3NR7A 2DWDC 1YCIA 4X1IB 3R65A 2LFRA 3ZRVA 1GMGA 4PDLA 5L3CA 4FLTA 2HFEC 3LDDA 2Q4PA 3ZHRA 4LFAB 2QGNA 3K3WA 3B8MA 1MG1A 4PI2A 1Z5VA 5CA3A 1Y66A 2QWNB 1M4UA 1H8EG 1OCOB 1Q5OA 3SPJA 5EYPA 1S77D 1VQNV 1FKAO 5IYCO 1EN5A 4D7SA 4GT1A 3IFXA 1FYJA 4DR7O 4MW8A 1SZXA 2Z0AA 5BY1A 2ZIMA 4YJ2A 4TT3G 3JD1A 1N34B 4D7TA 2OCCB 3SJAC 4UVCA 3OGCC 2OYQA 4PA7A 1HR0B 3RYHB 2AZ2A 1RM1C 2Y48A 1QLNA 2EBOA 5JH7B 5ITZA 3T1HB 1FFXB 1PNMA 3H1KH 4O4IA 2ZINA 2YXHA 4DR2O 1WPXA 1XMQO 2PYLA 1EFRG 1AP6A 2Y69B 2BSKB 4PDMA 3CSXA 2Q7EA 1GN3A 1PPJH 5LL6Y 2QM7A 4AQYO 3ABTA 5IDJA 3WG7B 3ZRXA 4B3RO 1ZAUA 2OWOA 2ZNIA 5IYBO 4DV1B 5DM6V 4F4LA 5LMUO 1S76D 1VF6A 1K9MW 3K08A 3JSLA 2KB1A 4JI0O 1VQ7V 2HJFC 1VIBA 1ZWIC 2AHZA 4I55A 5LA6B 3ZBHA 1HDJA 4NTYA 3OE7G 1NTZH 4H13B 4F6RB 4PD4F 1ZL8B 3K58A 3CHXA 1FD9A 1N33O 5IE9A 1XBLA 2QM8A 2B5UA 4DUZB 1T5EA 3L72H 4LNUA 2JEUA 4LF4B 3E22A 4X9QA 1N32B 1HNXO 1OHHG 1QHTA 1HWYA 4UB8Z 1L0LH 3PJSK 2Y4TA 1FXVA 3HKBA 3A0HZ 1RSOA 4W4LA 2EZPA 4B3MB 1IXBA 3CCUV 5KMGA 3ZCCA 5LOVA 1H2KA 4I9QA 1ZSPA 4LFCO 1AB3A 4U7OA 1LUWA 4KFMA 5DECA 2P67A 3TK1A 4UCSA 2JGDB 4ZIBA 1WB7A 1YVWA 4N21A 4RQEA 2FYUH 1F7YA 5EBLC 2PTMA 2HEPA 4JPRA 5LGUA 2JIZG 3ABLB 1H2LA 3ZN1A 1DTOA 1NVPD 1F4MA 2JK5C 1DF5A 1NR7A 1Q82W 2PZSA 1Q43A 3DXRA 4JTAB 4P2ZA 1MMMA 1QCEA 1N0JA 2EIKB 4PDVA 4O2BA 3E89A 1GN2A 2QJ1A 3CRCA 2Q67A 2ZT9B 2VQEB 3AG3B 4I5SA 3THOA 2WLNA 5JQGB 4MVOA 3JAKB 4DV2O 2KSDA 3LUTB 2ZE7A 2EINC 1Y67A 3TETA 4TV8B 2YEVA 1R3LC 3F5WC 2ZNJA 2Q8VA 1TVKB 4O2AB 4WBNB 5LMNB 4MTOA 1R3IC 3H9VA 5EIBD 5C8YA 1KP3A 3G6BA 4B3TB 4O4JA 2JJ1G 2F93B 4ZOLA 4EFEA 1L0NH 1HNZO 1M93A
chains in the Genus database with same CATH topology
2GBOA 2ODMA 2NR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBO A;  2ODM A;  2NR5 A; 
#chains in the Genus database with same CATH topology
 5BZB A;  3IGA C;  1KQS U;  4TUY B;  2C2A A;  2IU3 A;  4DR5 B;  5B3S C;  1V9P A;  2Q9L A;  2HVK C;  1URF A;  2LO1 A;  2RN9 A;  3ZMT A;  1R1B A;  3CRM A;  1P7G A;  1EM1 A;  3JAT B;  4EB6 B;  5HFL A;  2UUB B;  1SA0 A;  4X8A A;  1Y76 B;  2R72 A;  4DRX A;  5KLV H;  4E4E A;  5KHH A;  3ZRW B;  1TUE B;  3EVK A;  4J7K A;  4UCU A;  4DV6 B;  3JAW B;  4NXM O;  3E8B A;  4JI3 B;  3ZS8 C;  2JGU A;  4PHZ A;  4IT5 A;  5IJ0 B;  1QLE C;  3WU2 Z;  2QWR B;  3N2K B;  4O4L B;  2CTW A;  4WFF A;  2KG7 B;  1XL6 A;  4J42 A;  3SYC A;  1KC8 W;  4ABM A;  1IBK B;  1AI4 A;  1Q8I A;  4HAM A;  1VQ5 V;  2RCV A;  4GKK O;  3CCL V;  2YIA A;  5L3E A;  2BOC C;  2XOK G;  4FFK A;  1VQK V;  1Q6U A;  2P7T C;  4QNH B;  1D5A A;  3AK2 A;  4EFB A;  3G4S V;  1NH2 D;  3M8A A;  4LWS A;  2VQF O;  4LF6 B;  1BL8 A;  4DV5 O;  1MZF A;  2FB5 A;  4NXN O;  1Y4M A;  2PGG A;  2ZD9 A;  2F4V B;  3RYC B;  3AG4 B;  2WLI B;  1YF2 A;  1RFY A;  3JCU Z;  3SGI A;  2UU9 B;  2YUA A;  4BW9 A;  3OMN B;  4UV8 A;  1K33 A;  3D36 C;  3UT5 B;  1FXK B;  5H9C A;  4IIJ B;  2CTQ A;  4OGQ B;  2AGA A;  1TGO A;  3IC7 A;  2W0X A;  3JD0 A;  3KKY A;  1XL4 A;  3F5T A;  2WLJ A;  5K1X A;  3FAV B;  2M7W A;  3SPH A;  2GDS A;  1G4Y B;  2QKS A;  2CUG A;  4FM2 A;  3RVZ A;  2F43 G;  2HG5 C;  5IWA O;  4LF5 O;  5IYD O;  1I5Y A;  5EZY A;  5IY5 B;  4JYA B;  3NXS A;  2ETN A;  1JFF A;  1MZE A;  5A9G A;  4TQF A;  4DV0 B;  4EKW A;  5J2U A;  4QE7 A;  1NBM G;  2XAH A;  3FYE B;  2EIJ C;  1HNW B;  1YXB A;  1GM7 A;  4JV5 B;  1OCC C;  3RVY A;  3ZHQ A;  2UXC O;  5FNV A;  3CC7 V;  3OFN G;  4CH6 A;  5J2T A;  1NI8 A;  2LW7 A;  2E5L B;  1ARO P;  1RPR A;  3OR6 C;  5KX5 A;  2L6L A;  1RP3 B;  3SYA A;  1FFT B;  3ABM B;  3RFR A;  1WA8 A;  4X66 O;  1SQF A;  2HHH O;  3CC4 V;  4HBN A;  3A0R A;  3RYI B;  1ENV A;  3S3W A;  1OCO C;  3ZHT A;  1V55 B;  4G28 B;  5IJ9 A;  2UXX A;  2QTO A;  1WAZ A;  2CE4 A;  1AJP A;  4I50 A;  1RPO A;  1DLB A;  1JVM A;  1R73 A;  1OZ0 A;  2P22 C;  2P4V A;  5K1P A;  3DC5 A;  4IYI A;  2ZE8 A;  5CA1 B;  4ICG A;  2DW4 A;  5EBW C;  3RYF B;  2O57 A;  2HP8 A;  2EJR A;  3QG5 A;  4MSW C;  4JI2 B;  4DR4 B;  3CXH F;  5CA0 A;  2CH7 A;  2F1M A;  1P4R A;  2F66 C;  2G38 A;  4KXR A;  3LDC A;  4FZ0 A;  4KP4 A;  1VQ6 V;  4I0X A;  2YIB A;  3ZN0 A;  1YDX A;  2Y69 C;  3E35 A;  1NS1 A;  1AI6 A;  4GKJ B;  5KHG A;  1JX9 A;  3L74 H;  1KMI Z;  4YJ3 A;  4DR1 O;  3WG7 C;  3AK3 A;  3K57 A;  1S3J A;  3H1J H;  4FZ1 A;  3LSQ A;  4DR6 O;  2WWW A;  2M6Y A;  3VQW A;  4WF9 V;  2DYR B;  2XAG A;  5BMV A;  2DOS A;  3UKM A;  4K8X A;  3K03 A;  1FJG O;  4B08 A;  1GN4 A;  4J9Z B;  4WFB V;  1XQ8 A;  3E8G A;  1S0V A;  1M56 B;  5LGN A;  4DV7 B;  1KU9 A;  3ASN B;  4LF8 O;  3RN4 A;  4LC1 A;  2CGO A;  2DN9 A;  3P3N A;  2FTK A;  2DYS B;  4X65 B;  4PV1 B;  5EC2 C;  3C90 A;  4PEL A;  2EZO A;  2WLH A;  4JF3 A;  1B06 A;  1E79 G;  1GRJ A;  3K0G A;  4PA6 A;  4JI1 O;  5KA5 A;  1Q6H A;  4L8J A;  2H94 A;  3OAA G;  2BTO A;  3CRA A;  4TV9 B;  5IYZ B;  2P6J A;  3G80 A;  3C3T A;  4LFB O;  1OJH A;  3J81 N;  1PKX A;  1M9N A;  4FMT A;  2VWJ A;  1PV0 A;  2IH1 C;  1BT8 A;  1YTF D;  5B1N A;  3ABL C;  1IBL O;  1GKF A;  3JAS A;  1F23 A;  4GLX A;  3T1C A;  5KA6 A;  4BIZ A;  1AR5 A;  4LF7 B;  3TJT A;  3WB0 A;  4IGG A;  2YDE A;  3BAB A;  4BR6 A;  4MVS A;  2WLL A;  3OD4 A;  4UVA A;  2EIK C;  3HR0 A;  4YIP A;  2D2C B;  3WB2 A;  2A0L A;  4X1I A;  2WLK A;  5BR8 O;  2UUC O;  3AG3 C;  5KUK A;  2RQ6 A;  1MA1 A;  2VRZ A;  2Y0P A;  1KBH A;  4MTF A;  4LF9 B;  4DYL A;  4DUY B;  4QGP A;  4WFG A;  3FX7 A;  1YSC A;  1S5H C;  1SQP H;  2Q73 A;  1EBO A;  1GAX A;  1OCZ C;  2PYJ A;  1VF7 A;  1XNQ O;  5E1A C;  1K5Q A;  2LJ2 A;  1I7F A;  1XMO O;  3E8H A;  3O65 A;  4H0L B;  4UFZ A;  4PDR A;  4B3S O;  1PM9 A;  3ZMV A;  2E76 B;  1NJI W;  3K79 A;  3JCZ A;  2XT9 A;  4MS2 A;  4JI5 B;  4CC5 A;  3CE2 A;  2XND G;  2NN4 A;  3RYH A;  2B1I A;  1SZT A;  1SC5 B;  3SJB C;  1E1Q G;  3D3I A;  5JH7 A;  1J95 A;  5DED A;  1FFX A;  1ZUQ A;  1O9H A;  3KG2 A;  4X1K B;  3CB2 A;  2PI5 A;  2BSK A;  1YIT V;  4I55 B;  4UCT A;  3AG2 B;  1NR1 A;  1PP9 H;  4TSF G;  2LW1 A;  3ETD A;  2A9H A;  1N36 O;  2UXD O;  3ZMU A;  1I0H A;  1VMG A;  1K92 A;  1VQ9 V;  2E75 B;  4JI6 B;  4K8Z A;  2ZXW C;  1YHQ V;  1CEZ A;  3E86 A;  3MHS C;  4X1Y B;  4MVM A;  1K97 A;  3R66 A;  4UCV A;  1LR1 A;  2P90 A;  2UUA B;  3ABU A;  5LA6 A;  2Z5U A;  2CK3 G;  1I08 A;  3ETE A;  1W59 A;  2B9Z A;  4F6R A;  1H2G A;  1OCR B;  1RSO B;  3GB7 C;  1ZL8 A;  4HYO A;  5FPO A;  3LNM B;  4MVZ A;  4DR3 B;  4JYY A;  1M57 B;  3T1Y B;  1BE3 H;  4X20 B;  4LFA O;  3CPW U;  4OX9 B;  1FAF A;  1UPG A;  3H01 A;  3ZHS A;  1O9G A;  3H1H H;  4YHH B;  5L3G A;  1Y74 B;  2ARH A;  5JVD B;  3CRQ A;  3AG4 C;  3ZED A;  3ASO B;  1U96 A;  3APO A;  1JCH A;  1AVM A;  1DF4 A;  2CAZ C;  3IJ4 A;  3BFR A;  3U10 A;  1PL4 A;  1XUQ A;  2ZM6 B;  1I5X A;  2ZIO A;  1KP2 A;  3B40 A;  2ZR3 A;  1JR9 A;  1NVP B;  4J41 A;  1N34 O;  3JD3 A;  2HR3 A;  1AP5 A;  2JGD A;  2V4D A;  4JYC A;  2GUZ B;  3VQV A;  1HR0 O;  3T1H O;  5IY5 C;  4CS3 A;  2Q0O C;  3GVM A;  1K8A W;  4U3J B;  4WFA V;  2EJ7 A;  3HKC B;  3CC2 V;  3OW2 U;  4NB5 A;  3VQY A;  4ZHQ B;  4U7N A;  1DK1 A;  5LBQ A;  5C8Y B;  3OUF A;  4O4J B;  3ETQ A;  2VS0 A;  5JQG A;  4DV1 O;  3JAK A;  4QIW F;  1SS3 A;  1MSW D;  3I5D A;  4CC6 A;  5KHK A;  1WP7 A;  3K5N A;  4TV8 A;  1GM8 A;  5EK0 A;  4P30 A;  1K3E A;  3AEI A;  1UFI A;  1BGY H;  2IJJ A;  3OGI B;  4O2A A;  4X62 B;  4H44 B;  1JOY A;  3N27 A;  4WBN A;  1NQT A;  3ABM C;  3QNE A;  5B1B B;  1RM1 B;  3IC9 A;  4FLW A;  3LNN A;  4JI4 B;  4DUZ O;  3CWB H;  1VAR A;  1KYO F;  1S72 V;  1QVF U;  5GON B;  4LF4 O;  3P3P A;  1N32 O;  3SPC A;  3TCU A;  2DQ0 A;  1GN6 A;  3L70 H;  4TUY A;  2JS3 A;  3APQ A;  1V55 C;  3LSU A;  4BAY A;  5KHI A;  1V54 B;  2XAF A;  4IL6 Z;  4K0K B;  4Z1V A;  3EFF K;  1J5E B;  4B3M O;  3L9D A;  4YY3 B;  2OTJ V;  3JAT A;  2KKW A;  3CX5 F;  1XOU A;  4EB6 A;  1Q81 W;  1Y76 A;  2GSM B;  5H5N A;  2D3O W;  2XUM A;  4GX0 A;  3L75 H;  3ZRW A;  4Q6G A;  1L1F A;  1ZTE A;  2A3Q A;  4JI8 B;  2Y4U A;  2JS5 A;  3JAW A;  5B5E Z;  3JAR B;  2W6J G;  1N4C A;  2UXN A;  2Q69 A;  1FPO A;  1IZ3 A;  5IJ0 A;  4NR1 A;  3N2K A;  4O4L A;  4CH5 A;  1TUB B;  2KG7 A;  1WLE A;  3BPZ A;  4GUN A;  4G2K A;  1XRE A;  5LYJ B;  1NH2 B;  3O9O A;  5B1A C;  4MW3 A;  3MDS A;  2X6B A;  4PA4 A;  2ADP A;  4I4T A;  3OMI B;  4P9P A;  4EEQ A;  5LHG A;  4G27 B;  1GM9 A;  2LP7 A;  3E2E A;  2X6C A;  4PA9 A;  3DC6 A;  2CGN A;  2VQE O;  4QJF B;  4FK5 C;  2MW2 B;  5LXT B;  2EIM B;  2ITC C;  3FB8 C;  2ILM A;  4LH6 A;  2YC0 A;  3H1L H;  4DV4 B;  5CBH A;  2ITD C;  2DYR C;  4IHJ B;  1GTO A;  3RYC A;  4FPP A;  5LMN O;  2CDY A;  2WLI A;  1B04 A;  1JQ0 A;  3N2G B;  3U11 A;  3EXA A;  1B3Q A;  4B3T O;  5IT9 N;  1IBM B;  1M56 C;  5CBF A;  1FXK A;  3WB1 A;  3SDL A;  3STL C;  3ASN C;  4BWA A;  1YZB A;  3JAM N;  2BTQ B;  3FAV A;  4KHP B;  2WA3 A;  3QF7 A;  2LGW A;  4DR5 O;  2DYS C;  2DJV A;  2AXT Z;  2HJD A;  4NTW A;  2K9P A;  5EBM C;  2XHB A;  1GH6 A;  3BAA A;  2EX3 A;  4GYC B;  2UUB O;  3OMA B;  3HKD B;  3VOU A;  3Q4H B;  3BHP A;  3OTF A;  4JI7 B;  2MK3 A;  4TQD A;  1H2S B;  4FJC C;  4DV6 O;  3GWO A;  1I94 B;  5JWP A;  1H2M A;  4JI3 O;  3K0D A;  5AG2 A;  2KQX A;  4DO2 A;  5B66 Z;  2ODM A;  3BA8 A;  1SQV H;  1SES A;  2YIC A;  4A5U B;  4FM0 A;  4J9Y B;  2E3C A;  3CMA V;  3B77 A;  4J7J A;  3DTU B;  3U0Z A;  3SYQ A;  1QR9 A;  2QWO B;  1IBK O;  3UO2 A;  3ZMS A;  1EN4 A;  2BOB C;  2QR4 A;  4DXW A;  4DV3 B;  3JAL B;  1VQ4 V;  4UB6 Z;  1PNK A;  3RWR D;  1G6U A;  4R6Z A;  4NVP A;  1U97 A;  3ABK B;  3FB6 C;  5KAF Z;  1AJN A;  1P7B A;  4LF6 O;  1H2N A;  1XI1 A;  3RYI A;  2ADQ B;  5LGT A;  2AZ0 A;  1BSM A;  4ZKI A;  2ZE5 A;  1ZX3 A;  2OCC C;  2F4V O;  2UXB B;  1G8M A;  3MAQ A;  1KB9 F;  3SYP A;  3FYI B;  2UU9 O;  2BE3 A;  3AG7 A;  4RUF A;  1JMK C;  3ML0 A;  3QO7 A;  3CXC U;  2YIB D;  1SQB H;  5CA1 A;  2NR5 A;  2ZDI C;  4CH4 A;  3W7T A;  1MAB G;  3S3X A;  3M99 B;  3RYF A;  1H38 A;  3TXQ A;  1VQM V;  1HW7 A;  2OTL V;  1JPX A;  4J11 A;  2RMK B;  1YJ9 V;  4JZ2 A;  4JYA O;  4DR7 B;  2YXY A;  1Z2G A;  4ZI7 B;  5CB4 B;  3D8C A;  4DV0 O;  1XNR B;  3TGU H;  4N23 A;  4HNA B;  1HNW O;  1X59 A;  3AG2 C;  4UV9 A;  3K5M A;  4Q20 A;  4B7E A;  2DMX A;  3SJC C;  4JV5 O;  2Q68 A;  3SYO A;  2QKA A;  3CCE V;  4DR2 B;  4MVU A;  2GBO A;  1YI2 V;  2PY5 A;  4R8C A;  2E5L O;  4FFB B;  1XDC A;  1R6T A;  2HLD G;  4AQY B;  1KKC A;  4WFE A;  5E79 Z;  4Z2W A;  1OCR C;  3KCX A;  4PJ0 Z;  3OM3 B;  1WB8 A;  4B3R B;  3ZMZ A;  1R6N A;  1M57 C;  2QTS A;  1IUR A;  3HKE B;  2WSS G;  5LMU B;  3C3S A;  2CTP A;  4RO2 A;  4JI0 B;  1NTM H;  2LGQ A;  4GX5 A;  4TOI A;  5LP6 B;  3CCS V;  3FD9 A;  3L73 H;  3CJH B;  3SJQ C;  4AIL C;  3CYO A;  3ASO C;  4MVR A;  3LSS A;  3ZIA G;  3CRR A;  3LDE A;  4O4H A;  2PI4 A;  1K73 W;  2FL4 A;  1AR1 B;  1N33 B;  3SPG A;  1EZJ A;  1YTF B;  3P30 A;  3K9S A;  1K34 A;  1CXZ B;  3L71 H;  4TV9 A;  1BHB A;  5IYZ A;  2E74 B;  1HNX B;  4JAA A;  2IJH A;  1BZK A;  4JI2 O;  5CBG A;  5EYP B;  4DR4 O;  2F95 B;  2AHY A;  1Q6I A;  2W6I G;  3CME V;  3KZI Z;  2P4K A;  2R9A A;  2NNU A;  1NT2 B;  1WPB A;  2RDC A;  3AK1 A;  3HB3 B;  1YJN V;  4LFC B;  2Y0I A;  3A0B Z;  5H6Q A;  1L8D A;  2PUS A;  3OEE G;  4YJ2 B;  2QEX V;  4GKJ O;  1S5J A;  5B1O A;  2IBZ H;  1M90 W;  1YEW A;  2R9R B;  1LUV A;  3BVO A;  1Q90 D;  4X64 B;  2K1E A;  2GTS A;  3BCC H;  3MHH C;  2XAS A;  4BIO A;  5ITZ B;  3QVN A;  3AG1 B;  3OR7 C;  5EIB C;  3ZHV A;  3KCY A;  3K9A A;  4O4I B;  3K5O A;  1BQZ A;  1IDS A;  3JD2 A;  1XNR O;  1SF9 A;  3DSQ A;  2Z3Y A;  2OCH A;  1KUQ A;  4QE9 A;  4X88 A;  2ZR2 A;  4JYB A;  4FLU A;  5EC1 C;  1Y6X A;  4WCE V;  3P32 A;  5B1B C;  2VWK A;  3ZRS A;  2GV9 A;  4XDL A;  2RJZ A;  3FB5 C;  4DK1 A;  4DV7 O;  4DV2 B;  4D6T H;  2ZDI A;  2IJI A;  2DQ3 A;  4C7U A;  4K3A A;  3F7V C;  1VEW A;  2Q7G A;  2EIL B;  2ZKO A;  4JAV A;  1V54 C;  4CS2 A;  2X7R B;  4X65 O;  2P06 A;  3W7W A;  3ZX6 A;  1THZ A;  3FB7 C;  2OT5 A;  3JSN A;  5L3F A;  1YJW V;  2WA4 A;  4CH3 A;  3STZ C;  1HNZ B;  4UVB A;  4X1K A;  4LNU B;  5LHI A;  1R6K A;  3E22 B;  2YID A;  2PF4 E;  1D2D A;  3G6E V;  2WAM A;  3X2Q B;  2N05 A;  3JD4 A;  2A06 H;  3HKB B;  3PN1 A;  4L87 A;  5KUM A;  3M7M X;  3K06 A;  3HPL C;  4X1Y A;  5KMG B;  5LOV B;  4FLX A;  5JJN B;  2X6A A;  2AW9 A;  4MVQ A;  3CCM V;  4LF7 O;  3ICX A;  4UUJ C;  3CCJ V;  4NXM B;  1CPY A;  2Q6A A;  5DN6 G;  2QE7 G;  1H8H G;  5A2Q N;  4LP8 A;  4YXW G;  3RW0 A;  1GO3 F;  1BMF G;  2EIM C;  4LF9 O;  4JTD B;  1FXK C;  4X20 A;  4QPJ A;  4DUY O;  1KD1 W;  2JVD A;  4R50 A;  4FLY A;  5CMU A;  1TAE A;  2GHY A;  4OPA A;  1QVG U;  4UCR A;  4GKK B;  3DXR B;  5C93 A;  1Y74 A;  5JVD A;  2ZE6 A;  4O2B B;  4X64 O;  3QO8 A;  4CZZ A;  1JJ2 U;  2HKO A;  1W0K G;  1ORQ C;  2VQF B;  4QPK A;  1ROP A;  2OIG A;  2BCC H;  4DV5 B;  2FKX A;  4HZ3 A;  4LBE C;  4UCO A;  2QWQ B;  3E83 A;  2YEV B;  4NXN B;  4JI5 O;  4RQF A;  4NTX A;  5F2V O;  4MTX A;  1AJQ A;  2GUZ A;  4BW5 A;  1W0J G;  4DW1 A;  2NLJ C;  2L35 A;  4FIP C;  4LCU C;  3W7S A;  4ZOL B;  3TXS A;  2R70 A;  4U3J A;  2JDI G;  3BEH A;  1SQQ H;  3QTC A;  3HKC A;  2ZQM A;  3SPI A;  1OCZ B;  5L3D A;  4ZHQ A;  4PA3 A;  1TVK A;  4U3F H;  3J80 N;  4JI6 O;  5IWA B;  4LF5 B;  2IJK A;  1SER A;  1SA0 B;  4AHC A;  3OUS A;  5H6R A;  4DRX B;  3D3Q A;  1K4D C;  4FLV A;  2UUA O;  1B6Q A;  4NKG B;  4PI0 A;  5GW7 A;  4BIU A;  2YSU B;  1XIL A;  5KAI Z;  1WP8 A;  2A7W A;  1SKV A;  3CCR V;  5FLX N;  3BY6 A;  3RBZ A;  2QSA A;  1QU7 A;  3ABK C;  5JJE B;  1G1X B;  4DR3 O;  3VQX A;  3T1Y O;  2UXC B;  1UJW B;  5GON A;  4OX9 O;  1YIJ V;  1VQ8 V;  3A2F A;  1AI5 A;  3OTO B;  4YHH O;  2YI8 A;  4KUM A;  4B7K A;  4JGS A;  1WN7 A;  4JTC B;  3SR2 C;  1E1R G;  3T4Z A;  1R3K C;  2QKC A;  4X66 B;  1Q7Y W;  1US6 A;  2ZXW B;  2HHH B;  2N04 A;  4JZG A;  2JJ2 G;  1FS0 G;  4LWS B;  3BA9 A;  4H33 A;  5CN0 A;  4KL1 A;  4OPH A;  4FVM A;  2ZM6 O;  5GTH Z;  1F4N A;  3WFV A;  1WJZ A;  1CP9 A;  1NTK H;  4I4T B;  1P84 F;  3JAR A;  2HVJ C;  1M5I A;  3OT7 A;  2JEX A;  1NKD A;  1Q3E A;  1TUB A;  3F7Y C;  4H37 A;  5LYJ A;  4W4K A;  4AI8 A;  1NZ6 A;  4J80 A;  2WPD G;  2OIE A;  1WNS A;  3B8N A;  1SQG A;  3K5L A;  5BXZ A;  2QDO A;  4JAS A;  5JJJ B;  4GX1 A;  4P9O A;  2H3O A;  4UXN A;  5LXT A;  2EUL A;  3CCQ V;  5EZY B;  1KKD A;  3UT5 A;  1JFF B;  4IIJ A;  4RAI A;  2V7Q G;  4RWU A;  5J2U B;  3G71 V;  2F23 A;  4IHJ A;  1EN6 A;  2CTR A;  4X89 A;  1MOF A;  3W7U A;  3UM7 A;  5J9P C;  4X62 O;  3ZHU A;  3N2G A;  1KEC A;  4DR1 B;  3QO5 A;  5D5Q A;  2W0F C;  2DE0 X;  5JCO C;  2QWP B;  4JI4 O;  1Q86 W;  1PNL A;  4DR6 B;  4F6E A;  1QR8 A;  2IW5 A;  5FNV B;  2YXL A;  4OXS A;  1LNQ A;  1GK9 A;  2EIN B;  3T4D A;  2Q0A A;  1D5N A;  5J2T B;  1NU1 H;  1VF5 B;  5H2F Z;  1K5S A;  1JA8 A;  2BTQ A;  3UQ8 A;  5LP6 C;  3J7A U;  4MT8 A;  4IYH A;  1FJG B;  4GZR B;  2JRI A;  5KX5 B;  1IXM A;  2YS8 A;  1K7D A;  4K0K O;  2Q5Z A;  4DK0 A;  1J5E O;  1BHA A;  1QQC A;  1WA8 B;  3CEI A;  3RGB A;  2X0L A;  4YY3 O;  5D5P A;  2V1D A;  1MSD A;  4GX2 A;  1W2B U;  1OV9 A;  3HKD A;  4ZBM A;  5KHJ A;  3Q4H A;  4LR3 A;  4LF8 B;  4JI8 O;  4CBC A;  1TA8 A;  3OTO O;  5IJ9 B;  5B3S B;  4R7C A;  4I50 B;  2YI9 A;  2B1G A;  1F51 A;  3DGE A;  2QM4 A;  3UCS C;  4JI1 B;  1K4C C;  1S5L Z;  1VQL V;  1VQP V;  3OEH G;  3I56 V;  3CCV V;  1SET A;  3B4S A;  3RT3 C;  3B09 A;  1FXH A;  4CS4 A;  1IX9 A;  3A8T A;  3H1I H;  3ZJZ A;  1Z5W A;  3JAL A;  3T2M A;  4LFB B;  2H8P C;  3W7X A;  1XEQ A;  1P49 A;  5CA0 B;  2CH7 B;  1QLE B;  2A79 B;  1HP8 A;  2R9I A;  4K35 A;  3AG1 C;  1N0N A;  3BRC A;  3JYC A;  1IBL B;  3K59 A;  4DV4 O;  4I0X B;  4I9W A;  5LHH A;  4WFH A;  3IAY A;  1AIL A;  4FM1 A;  3ETG A;  1SQX H;  4FLZ A;  4YJ3 B;  2XTA A;  2GTA A;  2N74 A;  5BR8 B;  2UUC B;  1MNG A;  2XAQ A;  1IBM O;  1N8R W;  4XDJ A;  2ZCE A;  3VBB A;  3K04 A;  5B1A B;  1DGS A;  4LH7 A;  2IH3 C;  1VF6 C;  2P5O A;  3MD0 A;  2FML A;  5BMV B;  1JJO A;  1VP7 A;  4KHP O;  2EIL C;  1PD3 A;  4YIO A;  1XNQ B;  3CP1 A;  4DW0 A;  1XMO B;  5GTI Z;  2RNB A;  3CS5 A;  1VQO V;  2Q7H A;  1COW G;  4E2L A;  4B3S B;  2IU0 A;  4ZI7 A;  5CB4 A;  2QA4 V;  1XHX A;  4JI7 O;  1XMQ B;  4HNA A;  1BS3 A;  1I94 O;  4GCZ A;  5FPR A;  3CD6 V;  3X2Q C;  1XHZ A;  3UO3 A;  2IM9 A;  1IVS A;  4ASU G;  2ATK C;  1EZV H;  3D36 A;  1QBZ A;  1QNM A;  1AI7 A;  1SRY A;  1ZLZ A;  2LFS A;  4J7Z A;  4FFB A;  3E8F A;  3I55 V;  1M1K W;  2EIJ B;  4DV3 O;  2XAJ A;  1R3J C;  1X4T A;  4NYK A;  1N36 B;  2UXD B;  3FKS G;  1A32 A;  4Z1M G;  4O4H B;  1OCC B;  4JAU A;  2LQT A;  3GWK C;  5FL7 G;  5JCO A;  4MTG A;  3EHB B;  1BQ0 A;  4TWK A;  3HKE A;  4XBF A;  1PL0 A;  2WLM A;  5HFM A;  4RUE A;  3FFQ A;  2DWE C;  3JAS B;  5L3B A;  1AR4 A;  3B2E E;  4XDK A;  4I7Z B;  5LP6 A;  4J10 A;  1BCC H;  3G67 A;  2UXB O;  2WLL B;  3CJH A;  5TIS Z;  3NR7 A;  2DWD C;  1YCI A;  4X1I B;  3R65 A;  2LFR A;  3ZRV A;  1GMG A;  4PDL A;  5L3C A;  4FLT A;  2HFE C;  3LDD A;  2Q4P A;  3ZHR A;  4LFA B;  2QGN A;  3K3W A;  3B8M A;  1MG1 A;  4PI2 A;  1Z5V A;  5CA3 A;  1Y66 A;  2QWN B;  1M4U A;  1H8E G;  1OCO B;  1Q5O A;  3SPJ A;  5EYP A;  1S77 D;  1VQN V;  1FKA O;  5IYC O;  1EN5 A;  4D7S A;  4GT1 A;  3IFX A;  1FYJ A;  4DR7 O;  4MW8 A;  1SZX A;  2Z0A A;  5BY1 A;  2ZIM A;  4YJ2 A;  4TT3 G;  3JD1 A;  1N34 B;  4D7T A;  2OCC B;  3SJA C;  4UVC A;  3OGC C;  2OYQ A;  4PA7 A;  1HR0 B;  3RYH B;  2AZ2 A;  1RM1 C;  2Y48 A;  1QLN A;  2EBO A;  5JH7 B;  5ITZ A;  3T1H B;  1FFX B;  1PNM A;  3H1K H;  4O4I A;  2ZIN A;  2YXH A;  4DR2 O;  1WPX A;  1XMQ O;  2PYL A;  1EFR G;  1AP6 A;  2Y69 B;  2BSK B;  4PDM A;  3CSX A;  2Q7E A;  1GN3 A;  1PPJ H;  5LL6 Y;  2QM7 A;  4AQY O;  3ABT A;  5IDJ A;  3WG7 B;  3ZRX A;  4B3R O;  1ZAU A;  2OWO A;  2ZNI A;  5IYB O;  4DV1 B;  5DM6 V;  4F4L A;  5LMU O;  1S76 D;  1VF6 A;  1K9M W;  3K08 A;  3JSL A;  2KB1 A;  4JI0 O;  1VQ7 V;  2HJF C;  1VIB A;  1ZWI C;  2AHZ A;  4I55 A;  5LA6 B;  3ZBH A;  1HDJ A;  4NTY A;  3OE7 G;  1NTZ H;  4H13 B;  4F6R B;  4PD4 F;  1ZL8 B;  3K58 A;  3CHX A;  1FD9 A;  1N33 O;  5IE9 A;  1XBL A;  2QM8 A;  2B5U A;  4DUZ B;  1T5E A;  3L72 H;  4LNU A;  2JEU A;  4LF4 B;  3E22 A;  4X9Q A;  1N32 B;  1HNX O;  1OHH G;  1QHT A;  1HWY A;  4UB8 Z;  1L0L H;  3PJS K;  2Y4T A;  1FXV A;  3HKB A;  3A0H Z;  1RSO A;  4W4L A;  2EZP A;  4B3M B;  1IXB A;  3CCU V;  5KMG A;  3ZCC A;  5LOV A;  1H2K A;  4I9Q A;  1ZSP A;  4LFC O;  1AB3 A;  4U7O A;  1LUW A;  4KFM A;  5DEC A;  2P67 A;  3TK1 A;  4UCS A;  2JGD B;  4ZIB A;  1WB7 A;  1YVW A;  4N21 A;  4RQE A;  2FYU H;  1F7Y A;  5EBL C;  2PTM A;  2HEP A;  4JPR A;  5LGU A;  2JIZ G;  3ABL B;  1H2L A;  3ZN1 A;  1DTO A;  1NVP D;  1F4M A;  2JK5 C;  1DF5 A;  1NR7 A;  1Q82 W;  2PZS A;  1Q43 A;  3DXR A;  4JTA B;  4P2Z A;  1MMM A;  1QCE A;  1N0J A;  2EIK B;  4PDV A;  4O2B A;  3E89 A;  1GN2 A;  2QJ1 A;  3CRC A;  2Q67 A;  2ZT9 B;  2VQE B;  3AG3 B;  4I5S A;  3THO A;  2WLN A;  5JQG B;  4MVO A;  3JAK B;  4DV2 O;  2KSD A;  3LUT B;  2ZE7 A;  2EIN C;  1Y67 A;  3TET A;  4TV8 B;  2YEV A;  1R3L C;  3F5W C;  2ZNJ A;  2Q8V A;  1TVK B;  4O2A B;  4WBN B;  5LMN B;  4MTO A;  1R3I C;  3H9V A;  5EIB D;  5C8Y A;  1KP3 A;  3G6B A;  4B3T B;  4O4J A;  2JJ1 G;  2F93 B;  4ZOL A;  4EFE A;  1L0N H;  1HNZ O;  1M93 A; 
#chains in the Genus database with same CATH homology
 2GBO A;  2ODM A;  2NR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...