2NR5A

Crystal structure of protein of unknown function so2669 from shewanella oneidensis mr-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
64
structure length
60
Chain Sequence
MMTKKERIAIQRSMAEEALGKLKAIRQLCGAEDSDMQEVEIWTNRIKELEDWLWGESPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein SO2669
publication title Structure of SO2669 protein from Shewanella onedensis Mr-1, a singleton of unknown functions.
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 24
structure length 60
sequence length 64
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2nr5A00
2ODMA 2NR5A 2GBOA
chains in the Genus database with same CATH superfamily
3RYCA 2VQFO 1ZTEA 2ZIMA 4WCEV 4F6RA 5IY5B 3OD4A 1AJQA 4PI2A 1VIBA 3IJ4A 3I56V 4I5SA 4UCUA 4LWSA 1D2DA 4JI5O 4DV2B 2XT9A 3SYOA 1YXBA 3AK2A 4MVMA 4X62O 4R7CA 3E2EA 3OTFA 4K0KB 4LBEC 4B3MO 3FKSG 1I08A 4UCSA 1KC8W 2UUAO 4JTDB 5B1BC 1B06A 5EC1C 1H38A 2B1GA 1M56B 5CB4B 3AK1A 4X66B 4K35A 1EN4A 4MTOA 3CC2V 2ZNJA 5BR8O 2DQ0A 1B3QA 2ZD9A 2YIBD 4O4LB 2IJIA 4X1KA 4JI0B 1K4DC 3K5NA 4PDMA 3SYAA 3ZRWA 2V4DA 1DTOA 3H1JH 4FFBA 2EIJC 3WG7B 1ZX3A 2VWJA 2UXNA 1PKXA 4IYHA 4J7KA 3RYFB 4X8AA 4NVPA 1KMIZ 1R3JC 4RUFA 4DV3B 1NI8A 4D7TA 3BPZA 4FLZA 2W0XA 1FJGO 3STLC 2IJHA 2KG7A 3ZHRA 5FNVB 3AG3C 1VF6A 2E75B 1HNXB 4D7SA 4UB8Z 2AHZA 1LUVA 3JSLA 1N4CA 1VQKV 2ADQB 4OPHA 5L3EA 2R9IA 3B8NA 1GH6A 2YIAA 3W7XA 3KCXA 4QE9A 4GKJO 4JASA 2KB1A 1J5EO 4MVZA 3ZS8C 2OCHA 3CCVV 2UUCB 2UXCB 4XDLA 2CAZC 4DV1O 2AZ2A 1HW7A 2LW1A 1K5QA 1XBLA 4NB5A 2W0FC 3NR7A 2XAQA 4NTXA 5EYPB 2HJDA 2F4VB 1OCOC 4HNAB 1XQ8A 3W7WA 4WFEA 2LQTA 1K9MW 1GAXA 1K5SA 1Y6XA 5BMVB 3SPIA 1E1RG 4DR6O 1AB3A 2UXXA 1I7FA 1BMFG 1E1QG 2RMKB 4FZ1A 4LNUA 4QIWF 4DUYO 1NQTA 2YUAA 4PA9A 5LP6C 3CC7V 2ZCEA 1DF4A 2Q7GA 4KL1A 5GW7A 1JMKC 4DYLA 5DEDA 3DXRA 2AW9A 1OCZB 2KKWA 5B66Z 3P3PA 1AI7A 2ARHA 3BCCH 3OR6C 3JD2A 1M90W 4EB6A 3W7TA 1GMGA 2V7QG 5KAFZ 1N32O 5KX5A 1RM1B 4I0XA 5B1OA 2Y69C 3DC5A 5DM6V 4UVAA 4JI8O 1M57B 3GVMA 2PTMA 2Y0IA 2ZDIC 4DV7O 1JJOA 1GN6A 1CEZA 1W0JG 3K04A 4PDRA 1PD3A 4I9QA 1K92A 2DW4A 4UV8A 1XHXA 1OCCB 4LF5O 5KHJA 3JCZA 4JI7B 2GDSA 5EBWC 4DV5O 2HJFC 3J81N 4KP4A 3GWKC 1TA8A 2EIMB 2XOKG 2OIEA 4OPAA 3FAVB 4PA7A 1R1BA 2XAJA 4FJCC 4IYIA 3SGIA 5LBQA 3BEHA 3W7SA 4L87A 1N0JA 1PL0A 1PNLA 3A8TA 5JQGB 1XMOB 5GONB 3LNNA 3SPJA 4LR3A 3HKDB 1VF7A 4O4JA 5H2FZ 1Y74B 4DR4B 1HR0B 2AHYA 1AR1B 3EHBB 4N23A 2WLMA 3STZC 1VQ5V 3RGBA 1FXKC 2VQFB 3CCQV 2MK3A 1Q6UA 4NR1A 1I0HA 3RYFA 4NTWA 2PUSA 2QDOA 1PM9A 3E35A 3SR2C 3EXAA 3JD1A 2XHBA 2DYSB 2YI8A 3EVKA 1IVSA 5E79Z 3L71H 1AJPA 4TV9B 4JI5B 3KCYA 4CH3A 2QWQB 3OMNB 1JJ2U 5EBMC 1HP8A 3JATA 1Y66A 4MVUA 4CC6A 4JAVA 5AG2A 4B3MB 3D36A 2UUAB 1Q86W 4MW8A 4MVRA 2OTJV 2ITDC 3ETEA 4IHJB 4ZOLA 5BXZA 3JAWB 5B1AB 2PI5A 2OIGA 2QGNA 1GM9A 1RFYA 3FX7A 3ZJZA 1L0LH 2CTRA 5BR8B 3FB7C 1KKCA 2F1MA 3E8HA 2IJKA 3CWBH 1SQPH 4LCUC 3QNEA 1BL8A 2PZSA 5BMVA 4GCZA 1SZXA 2KSDA 3R65A 2HKOA 1OCRC 4UCOA 2BCCH 4FLXA 4X89A 1RSOB 1FJGB 3FYIB 2XAGA 2CUGA 4TQDA 1VQMV 1NH2D 4FM2A 2P7TC 2JGUA 2HR3A 1VQ4V 2Q73A 3BAAA 3OTOO 3C3TA 3JARB 2EULA 4DV2O 1AVMA 1YJ9V 1P4RA 2XTAA 4O2BB 4BIZA 2B9ZA 2QKSA 3ABLB 1NTZH 2RJZA 2P06A 2WA4A 2BSKB 3OUSA 1MABG 3K57A 1IBKO 5GTHZ 5KA6A 1XREA 2XNDG 4AI8A 3HKEB 2WLNA 1YTFD 2JGDB 5EIBD 4FVMA 5IDJA 1XL4A 5IWAB 2K9PA 1BT8A 4C7UA 3JD4A 2EINB 3HKCB 4YJ3B 4JI3B 3ZX6A 4MVOA 4JI0O 1V54C 2HG5C 4TQFA 1WPXA 3Q4HA 2H8PC 4J9YB 5HFMA 2QJ1A 2BOBC 4YIPA 4DUYB 2HEPA 2CE4A 3FB8C 4N21A 2BOCC 1V9PA 3E22B 4MVSA 4DW1A 5JQGA 2EILB 1SETA 5GONA 2UU9B 1YIJV 3RN4A 1IDSA 1HNXO 4Z1MG 4TV8B 1VEWA 1QHTA 4DR7B 3ML0A 1PP9H 4JI6B 3SYCA 3G4SV 5LMUB 1SQVH 3BFRA 1T5EA 3FFQA 4P9OA 3I55V 4DK0A 3H01A 5LMNO 4DV7B 4CH5A 2QWRB 1OHHG 3AEIA 4QGPA 2RN9A 2WLHA 3K5OA 3ZHSA 2UXCO 4TV9A 2X6CA 1S77D 2HHHB 5B1BB 3CXCU 2RQ6A 4PI0A 4R8CA 4DV5B 1WAZA 1B04A 3EFFK 4A5UB 3CEIA 3LDCA 1AILA 3H1IH 5TISZ 5IJ0A 1XUQA 1H2KA 3N27A 1MMMA 2ZIOA 1W59A 2P90A 2ZE8A 4X1IB 1TUBB 4FLYA 5D5PA 4MS2A 3B2EE 3FB5C 1VQLV 2EIJB 2RNBA 4LF4B 2OCCC 1YJNV 1THZA 5LHGA 1FAFA 3B4SA 3AG4C 4L8JA 4OXSA 3BVOA 3CRMA 1KD1W 1N33O 1M93A 3RYIA 1PNMA 2IW5A 2NN4A 3AG3B 3TK1A 3K06A 4B3RB 3OE7G 2L6LA 4I55A 2Q0AA 4I4TB 3OW2U 2Q5ZA 2Y48A 4WFFA 4CH4A 3F5TA 1NH2B 2IJJA 2M7WA 4LP8A 3O9OA 4ZI7B 2QWNB 2ZQMA 4JV5O 4JAUA 4RWUA 2YEVA 3JARA 4WBNB 3ABTA 4O2BA 4HAMA 5CA0B 4JI7O 2IH3C 2BSKA 3E83A 2QA4V 2JRIA 2LGWA 3CCUV 1YTFB 1EN5A 4HYOA 2YI9A 1OCOB 3CPWU 1ORQC 3SYQA 4GX2A 1FS0G 1UPGA 3UCSC 3ZRXA 2WWWA 1SERA 4JTAB 3HKCA 1WP8A 2QKAA 5LP6B 2YDEA 4O4HB 4JI2O 1YF2A 4DR4O 3ABMC 4X1YB 2B5UA 3C90A 1Q3EA 4GYCB 1TUEB 3E22A 1NR1A 3TJTA 1DGSA 4FLWA 2Y69B 4IGGA 1JFFA 5EZYA 2Q67A 4IIJB 4UVBA 3OTOB 5IYZB 4JAAA 5JJNB 4J41A 3TGUH 2D3OW 2BTQB 1MNGA 4I50A 4GKKB 3LUTB 2CH7B 4FPPA 4CS2A 3CP1A 3G67A 1IBKB 1IBMO 4GLXA 3PJSK 1IXMA 3HPLC 1Y76B 5LA6B 1NU1H 3JAKB 4YJ2B 1CP9A 5JH7B 4LH7A 5H5NA 3JASB 5IT9N 4OX9O 2X0LA 2F43G 1VP7A 3DC6A 3SDLA 3U10A 5DN6G 1K4CC 2L35A 4NXNB 5H6RA 3PN1A 1IZ3A 2ZE7A 4ZHQB 4FZ0A 4KHPB 3R66A 4X1IA 1S5JA 5JCOA 1COWG 1F4MA 1SQFA 2E3CA 1DF5A 3QO8A 4MW3A 4LF6B 2PYLA 3VOUA 1FXKB 2LJ2A 4QE7A 2CGOA 5KHIA 5KMGB 5IYDO 1GKFA 4RO2A 2LP7A 3UO2A 1V55B 5FPOA 2AZ0A 3CX5F 1VF6C 2YXLA 3DGEA 3H1HH 4QNHB 2A9HA 3BA8A 2C2AA 5LMNB 4D6TH 1PNKA 5J2UB 1W0KG 2JEXA 2OTLV 4DUZO 1VQNV 1Z5WA 3BRCA 2B1IA 3TXQA 1BQ0A 2XAHA 3ZN0A 1SA0B 2DJVA 3ZHVA 5L3CA 2ATKC 3HR0A 4MVQA 3JALA 1VQ8V 5CA0A 5L3BA 3LNMB 5EIBC 3N2KA 5IWAO 3X2QB 4JI3O 1VQPV 1BS3A 1KQSU 4Z1VA 5LOVB 4G2KA 3ASNC 4ZIBA 1K7DA 1TVKA 4KXRA 1L0NH 4FLUA 5K1PA 4U3FH 1A32A 1JOYA 3ZIAG 3K03A 1OCRB 1W2BU 4GUNA 1I94B 4R50A 3G71V 1YITV 1N33B 4WFHA 3WU2Z 2UU9O 4JGSA 1EZVH 1PPJH 4DR7O 2A0LA 2Q9LA 1D5AA 4X1YA 3CE2A 4JI6O 4OGQB 5B3SB 1WB8A 1H2LA 5LMUO 2ETNA 2E5LB 5EBLC 4BW5A 1MSWD 3E86A 4HZ3A 1CXZB 4JI1O 3NXSA 4JV5B 2QM4A 1NTKH 5IYZA 2VS0A 4O4IB 4LF7B 2BE3A 2VQEO 3OMAB 1QCEA 2HHHO 4DR3B 2ZINA 1BSMA 3BABA 1BGYH 1ROPA 1AP5A 1JCHA 3MAQA 1Y76A 1K97A 5LA6A 5KHHA 5KAIZ 5CB4A 5LYJB 1AI5A 1V54B 3QG5A 5H9CA 1H8EG 2AGAA 3FB6C 3T4DA 5LXTB 4LF4O 2GTSA 1NT2B 1GO3F 3KG2A 4O4LA 1HNWO 3AG2C 2CDYA 4BR6A 5KA5A 1S72V 3OEEG 1KECA 2GUZB 3H1KH 4B7EA 4JI2B 4CBCA 1I5XA 4ZHQA 4AQYO 4MTFA 4LFCB 4QPKA 1FKAO 1XMQO 4B3RO 4CS3A 1WNSA 4LF8O 4UCTA 5FNVA 4NTYA 4J9ZB 4PELA 3QF7A 2P67A 5KMGA 3S3WA 1KYOF 1Z5VA 1R3LC 2EIKC 2EZPA 1BHBA 2UUBO 2UXBB 1BZKA 3ASOC 2GHYA 1IBMB 5J2UA 4Z2WA 1TAEA 2MW2B 4JZGA 4TSFG 3D36C 2AXTZ 3CRAA 4B3TO 3IAYA 4DXWA 2QR4A 4OX9B 1AJNA 1PL4A 3U11A 3JAMN 1PV0A 1SA0A 5CA1B 2IM9A 2Q6AA 3RT3C 3QTCA 2WAMA 1S5HC 5EYPA 1JR9A 1HWYA 3OMIB 1L1FA 1KP3A 2X6AA 4HNAA 2OCCB 4J80A 1LUWA 4TT3G 4X9QA 1Q81W 2CGNA 4AILC 2GTAA 4JPRA 4UFZA 3ABUA 2V1DA 3UKMA 4FLTA 3B77A 3AG4B 4H0LB 2WLIB 4GZRB 1HNZO 3AK3A 3D8CA 3CB2A 1UFIA 5C93A 5BY1A 2RCVA 1OCZC 2CTPA 5IYBO 1N36B 1SC5B 1R3IC 1OJHA 4DUZB 4GKKO 2Q0OC 4GX0A 2Z3YA 4H37A 1M57C 1YVWA 3P3NA 3BHPA 3WB2A 3F5WC 1K3EA 5CBGA 3CS5A 3MD0A 3CXHF 1KP2A 1XHZA 1VARA 1F51A 4DW0A 5CBFA 2Y0PA 1OZ0A 4F4LA 1IBLB 3A2FA 3DTUB 4NXNO 2P4KA 1GRJA 2PF4E 3K0GA 3FAVA 4JZ2A 2YICA 4J7JA 3SJQC 2Q69A 5LGNA 2EZOA 4KHPO 1Q8IA 2P22C 3MHSC 3CCMV 1WA8B 2YIBA 1FFXB 1BQZA 4I7ZB 2ODMA 3ABMB 4LF6O 4RQFA 1ZL8B 1NZ6A 3CCLV 3HKDA 3QVNA 1R3KC 1S3JA 1Y74A 4DV0B 2WLKA 3RYCB 1YCIA 1K73W 4PD4F 1NVPD 1R6TA 2D2CB 1SKVA 2UXDB 4FK5C 4F6RB 2W6IG 2HP8A 3IC7A 3RW0A 5A2QN 1EN6A 3H1LH 4JI1B 1ZAUA 2PYJA 3THOA 2HFEC 4J7ZA 1SQQH 4LWSB 2Q8VA 2QTOA 4J10A 4PA6A 2VQEB 5C8YB 1X59A 1F7YA 4PA4A 1XNQB 1P84F 3ABKC 1KUQA 1TGOA 2Z0AA 4IHJA 3UQ8A 3JAWA 5ITZB 4K8XA 1FD9A 2H3OA 1Q7YW 2YIDA 2O57A 3CCSV 2QWPB 1HNWB 1AR5A 3HKBB 3ZRWB 3KKYA 4RAIA 1AI6A 3L70H 2ZXWC 1I94O 4AQYB 4GX1A 4LC1A 2EBOA 1XMQB 1JQ0A 1BE3H 3M99B 4LF8B 1RSOA 2HVKC 2KG7B 2WLIA 1S0VA 2YXHA 4BAYA 5BZBA 1M1KW 3L9DA 2QWOB 1NR7A 2E5LO 4ABMA 1H2MA 3N2GB 3T1YO 3S3XA 3CMAV 3IGAC 1URFA 2G38A 3U0ZA 3F7VC 3OT7A 2UUBB 2FL4A 4LF7O 3K79A 3LSSA 2F66C 4QPJA 4DR3O 2JK5C 4CH6A 4CS4A 1DLBA 4MTGA 3JD3A 4B3TB 4YHHB 2FYUH 1ZSPA 5JWPA 4JYBA 2LFSA 3J80N 3W7UA 3HKEA 3K9SA 2WSSG 4X20B 2JGDA 1WJZA 2QM8A 3T1HO 1XEQA 3F7YC 2WLJA 1E79G 3ASNB 1ZLZA 4YJ3A 1KB9F 1LNQA 3ZMSA 4PJ0Z 1Y67A 4LNUB 4LFCO 2CTWA 4XDJA 1HNZB 1WA8A 2KQXA 3K0DA 3G80A 1EM1A 5KUMA 4DR5O 1QNMA 4WFGA 1Q6HA 2JIZG 1QQCA 1L8DA 4EB6B 4EKWA 1ZL8A 3B40A 5KX5B 4I0XB 1YEWA 1WB7A 2R72A 4GX5A 4DV4O 1NVPB 1VQ7V 1P7BA 5DECA 1IX9A 4TV8A 1UJWB 4B3SB 1N0NA 2IH1C 4JTCB 1D5NA 4RQEA 2F95B 1F4NA 2Q7HA 3D3IA 2A06H 3E89A 2UXBO 1EZJA 1ZWIC 2XAFA 2Q4PA 1YHQV 2JJ1G 1QBZA 3A0HZ 2DOSA 1R6NA 1LR1A 2X6BA 3LDEA 5IYCO 3K3WA 2P6JA 1NTMH 1B6QA 1NJIW 5C8YA 2Q7EA 1SZTA 1G6UA 3WB1A 3ZBHA 4ASUG 3P32A 1MG1A 3L75H 1EBOA 1GN3A 5B5EZ 1H2SB 2JS3A 5F2VO 5LL6Y 5ITZA 1XI1A 2YS8A 2DYRC 5IJ9B 1J95A 3AG2B 1TUBA 2YXYA 3UM7A 3SJBC 3LDDA 4LFAB 3ZHUA 4NXMB 2A7WA 5L3GA 1HDJA 2H94A 1K33A 5JCOC 3HKBA 2ZM6B 3JD0A 4O4JB 3E8GA 1R73A 4DK1A 4DR1B 2JS5A 5J9PC 3RBZA 3A0BZ 1H8HG 1YZBA 2DWEC 3LSUA 3FYEB 1XL6A 1NS1A 3ZMTA 1QVFU 5IE9A 4TOIA 4O2AB 4JYCA 2P4VA 4I4TA 1N36O 4JYAO 3L73H 2R9AA 2EIKB 1FPOA 4UCRA 4W4KA 1QLEC 3ASOB 3N2GA 2WLLB 1XILA 2ITCC 4UCVA 4ZI7A 2ZNIA 2DN9A 3JATB 3SPHA 2IBZH 4WBNA 4JYYA 4ZOLB 4XBFA 1SQGA 3SYPA 1YSCA 4LF9O 3O65A 3WFVA 3CC4V 3OGIB 3ZRSA 1QU7A 1IBLO 2JJ2G 1O9GA 1VMGA 4BWAA 5LGUA 2QEXV 4G28B 1MSDA 4X20A 2DQ3A 3C3SA 3TXSA 2E76B 3CCRV 3HB3B 1VQ9V 3AG1C 4BW9A 4HBNA 3ETQA 3ZHTA 4UXNA 5CA3A 4FMTA 5LP6A 3K58A 1KKDA 2QKCA 4O4HA 4X64O 2DE0X 4DV0O 4W4LA 1N34B 3ZCCA 2PY5A 4KUMA 2UXDO 4LFBO 3T1YB 1KBHA 2QE7G 2PI4A 4EFBA 2EJ7A 4PA3A 4IIJA 4FM0A 3OUFA 5IY5C 1OV9A 2M6YA 2GBOA 2BTQA 2GV9A 3WB0A 2ZDIA 3OM3B 1R6KA 2VWKA 1CPYA 4PDLA 4WFBV 2YC0A 2CH7A 1M4UA 1IXBA 1XNQO 4AHCA 2CK3G 3MHHC 1SF9A 3CYOA 2A3QA 2BTOA 5JH7A 3JAKA 4YJ2A 3SJAC 4TUYB 3SJCC 3I5DA 1YI2V 3T1HB 3JASA 4CZZA 4JI4B 5A9GA 2LO1A 2PGGA 5J2TB 1GK9A 3K5LA 5KUKA 1M56C 3M8AA 3Q4HB 4BIOA 2X7RB 1SQXH 4UVCA 4FIPC 3VQYA 2LFRA 1Q82W 2VRZA 2FKXA 1Z2GA 2Y4UA 5IJ9A 1GM7A 4PDVA 2QSAA 2ILMA 4H13B 4DR5B 4K3AA 3WG7C 4QJFB 3B8MA 1GTOA 1FXKA 4XDKA 1XNRB 4X65B 4DV4B 2ADPA 3CD6V 3ZMZA 3IC9A 4YY3O 3RVZA 1VF5B 3JSNA 4PHZA 4H33A 3T4ZA 4DR2O 4CC5A 1SQBH 3GWOA 4DRXB 1US6A 1V55C 4O2AA 4WF9V 1X4TA 2YSUB 4MT8A 3UT5B 3RWRD 4P30A 4IT5A 3UO3A 4YHHO 2WLLA 4Q6GA 3ABKB 4DV6O 4ICGA 2JVDA 3T2MA 4X62B 2EJRA 1U96A 4U3JB 2ZE5A 4ZKIA 5IJ0B 3CMEV 1QR8A 3VQXA 5EK0A 2OWOA 2Y4TA 2K1EA 1DK1A 5LOVA 3OAAG 2LGQA 1JA8A 2ZXWB 3X2QC 5HFLA 1S5LZ 2JDIG 2GSMB 3CHXA 3ETGA 2ZR2A 2Q68A 4JF3A 5GTIZ 1Q5OA 5L3DA 2ZE6A 1ENVA 1MOFA 1FYJA 1EFRG 4J11A 4FFKA 1YDXA 3J7AU 3RYIB 2NR5A 3ICXA 3FD9A 1H2GA 4I55B 2QTSA 1JPXA 4B3SO 5B1NA 3ZHQA 4E2LA 4JYAB 5L3FA 4R6ZA 3VQVA 3CCJV 3CSXA 5JVDB 1RM1C 2WA3A 2HVJC 3OEHG 3TETA 3QO5A 4WFAV 2W6JG 3ZEDA 4UV9A 5B3SC 2JEUA 3CJHB 2LW7A 4TWKA 2YEVB 2Z5UA 1FXVA 5K1XA 4O4IA 4H44B 5E1AC 4GKJB 1RP3B 1J5EB 4LF9B 4FM1A 3K08A 4KFMA 5CMUA 4K0KO 3JCUZ 1H2NA 1O9HA 4DV1B 1OCCC 3L74H 1BHAA 2N05A 2WPDG 3KZIZ 5JJEB 3ZMVA 3OR7C 1QR9A 4TUYA 4B7KA 2EIMC 4Q20A 4E4EA 4X66O 3RYHB 2OYQA 5LYJA 3OFNG 3G6EV 1P7GA 1AROP 5J2TA 2IU0A 2ZR3A 4LFAO 5LXTA 4YIOA 4NXMO 1JVMA 2OT5A 4DR6B 3T1CA 2ZM6O 2ZKOA 3JYCA 2GUZA 2FMLA 4DR1O 4X64B 1S76D 1WP7A 1GN2A 2E74B 1N8RW 4DV3O 4LFBB 2A79B 4K8ZA 1U97A 1JFFB 5EZYB 3ETDA 4B08A 5CN0A 1WLEA 3GB7C 1KU9A 1N32B 3MDSA 4GT1A 1SESA 1SRYA 3APOA 3P30A 5FLXN 4J42A 1BCCH 4JI8B 2DYSC 4I50B 5LHIA 5CBHA 1WPBA 3CRQA 3LSQA 4DRXA 1MZFA 4DO2A 1RPOA 3E8BA 5FL7G 4P9PA 2P5OA 3K5MA 1M5IA 1MZEA 1Y4MA 2F23A 2UUCO 3UT5A 1XOUA 4NKGB 1K8AW 4LF5B 3VQWA 1XDCA 1Q43A 4P2ZA 5B1AC 3K9AA 4FLVA 4U3JA 1F23A 3RVYA 4YXWG 5CA1A 4X1KB 4RUEA 3B09A 3ZRVA 2DYRB 3BY6A 2QM7A 5KLVH 3IFXA 1AP6A 3OGCC 2F4VO 4FFBB 2FTKA 1QVGU 1ZUQA 3AG7A 5KHGA 1IURA 1Q6IA 5JJJB 3APQA 2DMXA 4UB6Z 3ZN1A 1N34O 5H6QA 3VBBA 5LGTA 1NKDA 4U7NA 4X88A 3BA9A 1AI4A 4YY3B 2NLJC 1G8MA 4DR2B 4U7OA 1VQOV 3L72H 3H9VA 4MSWC 3E8FA 3ZMUA 4UUJC 2DWDC 5KHKA 1QLEB 3QO7A 4EEQA 5FPRA 3DSQA 2XASA 1JX9A 2XUMA 1FXHA 1GN4A 5JVDA 2N74A 1K34A 2FB5A 2R70A 4PV1B 5D5QA 3CRRA 1VQ6V 3ABLC 4DV6B 2R9RB 1GM8A 2RDCA 3CJHA 3SPCA 4BIUA 2CTQA 1G4YB 1WN7A 3M7MX 1MA1A 3JALB 2F93B 4JI4O 3G6BA 3N2KB 3D3QA 4ZBMA 1I5YA 2EX3A 4EFEA 2IU3A 4NYKA 4G27B 1YJWV 1TVKB 5LHHA 1QLNA 3AG1B 2EINC 2ZT9B 2N04A 1RPRA 1G1XB 3RYHA 5EC2C 4LH6A 3DXRB 3K59A 4IL6Z 4MTXA 1FFTB 4F6EA 1P49A 1FFXA 4I9WA 3TCUA 1AR4A 3CCEV 3CRCA 1XMOO 2NNUA 1NBMG 3RFRA 1XNRO 1SS3A 2HLDG 4X65O 3SPGA 3A0RA 1M9NA 1HR0O 2EILC 1Q90D
chains in the Genus database with same CATH topology
2ODMA 2NR5A 2GBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODM A;  2NR5 A;  2GBO A; 
#chains in the Genus database with same CATH topology
 3RYC A;  2VQF O;  1ZTE A;  2ZIM A;  4WCE V;  4F6R A;  5IY5 B;  3OD4 A;  1AJQ A;  4PI2 A;  1VIB A;  3IJ4 A;  3I56 V;  4I5S A;  4UCU A;  4LWS A;  1D2D A;  4JI5 O;  4DV2 B;  2XT9 A;  3SYO A;  1YXB A;  3AK2 A;  4MVM A;  4X62 O;  4R7C A;  3E2E A;  3OTF A;  4K0K B;  4LBE C;  4B3M O;  3FKS G;  1I08 A;  4UCS A;  1KC8 W;  2UUA O;  4JTD B;  5B1B C;  1B06 A;  5EC1 C;  1H38 A;  2B1G A;  1M56 B;  5CB4 B;  3AK1 A;  4X66 B;  4K35 A;  1EN4 A;  4MTO A;  3CC2 V;  2ZNJ A;  5BR8 O;  2DQ0 A;  1B3Q A;  2ZD9 A;  2YIB D;  4O4L B;  2IJI A;  4X1K A;  4JI0 B;  1K4D C;  3K5N A;  4PDM A;  3SYA A;  3ZRW A;  2V4D A;  1DTO A;  3H1J H;  4FFB A;  2EIJ C;  3WG7 B;  1ZX3 A;  2VWJ A;  2UXN A;  1PKX A;  4IYH A;  4J7K A;  3RYF B;  4X8A A;  4NVP A;  1KMI Z;  1R3J C;  4RUF A;  4DV3 B;  1NI8 A;  4D7T A;  3BPZ A;  4FLZ A;  2W0X A;  1FJG O;  3STL C;  2IJH A;  2KG7 A;  3ZHR A;  5FNV B;  3AG3 C;  1VF6 A;  2E75 B;  1HNX B;  4D7S A;  4UB8 Z;  2AHZ A;  1LUV A;  3JSL A;  1N4C A;  1VQK V;  2ADQ B;  4OPH A;  5L3E A;  2R9I A;  3B8N A;  1GH6 A;  2YIA A;  3W7X A;  3KCX A;  4QE9 A;  4GKJ O;  4JAS A;  2KB1 A;  1J5E O;  4MVZ A;  3ZS8 C;  2OCH A;  3CCV V;  2UUC B;  2UXC B;  4XDL A;  2CAZ C;  4DV1 O;  2AZ2 A;  1HW7 A;  2LW1 A;  1K5Q A;  1XBL A;  4NB5 A;  2W0F C;  3NR7 A;  2XAQ A;  4NTX A;  5EYP B;  2HJD A;  2F4V B;  1OCO C;  4HNA B;  1XQ8 A;  3W7W A;  4WFE A;  2LQT A;  1K9M W;  1GAX A;  1K5S A;  1Y6X A;  5BMV B;  3SPI A;  1E1R G;  4DR6 O;  1AB3 A;  2UXX A;  1I7F A;  1BMF G;  1E1Q G;  2RMK B;  4FZ1 A;  4LNU A;  4QIW F;  4DUY O;  1NQT A;  2YUA A;  4PA9 A;  5LP6 C;  3CC7 V;  2ZCE A;  1DF4 A;  2Q7G A;  4KL1 A;  5GW7 A;  1JMK C;  4DYL A;  5DED A;  3DXR A;  2AW9 A;  1OCZ B;  2KKW A;  5B66 Z;  3P3P A;  1AI7 A;  2ARH A;  3BCC H;  3OR6 C;  3JD2 A;  1M90 W;  4EB6 A;  3W7T A;  1GMG A;  2V7Q G;  5KAF Z;  1N32 O;  5KX5 A;  1RM1 B;  4I0X A;  5B1O A;  2Y69 C;  3DC5 A;  5DM6 V;  4UVA A;  4JI8 O;  1M57 B;  3GVM A;  2PTM A;  2Y0I A;  2ZDI C;  4DV7 O;  1JJO A;  1GN6 A;  1CEZ A;  1W0J G;  3K04 A;  4PDR A;  1PD3 A;  4I9Q A;  1K92 A;  2DW4 A;  4UV8 A;  1XHX A;  1OCC B;  4LF5 O;  5KHJ A;  3JCZ A;  4JI7 B;  2GDS A;  5EBW C;  4DV5 O;  2HJF C;  3J81 N;  4KP4 A;  3GWK C;  1TA8 A;  2EIM B;  2XOK G;  2OIE A;  4OPA A;  3FAV B;  4PA7 A;  1R1B A;  2XAJ A;  4FJC C;  4IYI A;  3SGI A;  5LBQ A;  3BEH A;  3W7S A;  4L87 A;  1N0J A;  1PL0 A;  1PNL A;  3A8T A;  5JQG B;  1XMO B;  5GON B;  3LNN A;  3SPJ A;  4LR3 A;  3HKD B;  1VF7 A;  4O4J A;  5H2F Z;  1Y74 B;  4DR4 B;  1HR0 B;  2AHY A;  1AR1 B;  3EHB B;  4N23 A;  2WLM A;  3STZ C;  1VQ5 V;  3RGB A;  1FXK C;  2VQF B;  3CCQ V;  2MK3 A;  1Q6U A;  4NR1 A;  1I0H A;  3RYF A;  4NTW A;  2PUS A;  2QDO A;  1PM9 A;  3E35 A;  3SR2 C;  3EXA A;  3JD1 A;  2XHB A;  2DYS B;  2YI8 A;  3EVK A;  1IVS A;  5E79 Z;  3L71 H;  1AJP A;  4TV9 B;  4JI5 B;  3KCY A;  4CH3 A;  2QWQ B;  3OMN B;  1JJ2 U;  5EBM C;  1HP8 A;  3JAT A;  1Y66 A;  4MVU A;  4CC6 A;  4JAV A;  5AG2 A;  4B3M B;  3D36 A;  2UUA B;  1Q86 W;  4MW8 A;  4MVR A;  2OTJ V;  2ITD C;  3ETE A;  4IHJ B;  4ZOL A;  5BXZ A;  3JAW B;  5B1A B;  2PI5 A;  2OIG A;  2QGN A;  1GM9 A;  1RFY A;  3FX7 A;  3ZJZ A;  1L0L H;  2CTR A;  5BR8 B;  3FB7 C;  1KKC A;  2F1M A;  3E8H A;  2IJK A;  3CWB H;  1SQP H;  4LCU C;  3QNE A;  1BL8 A;  2PZS A;  5BMV A;  4GCZ A;  1SZX A;  2KSD A;  3R65 A;  2HKO A;  1OCR C;  4UCO A;  2BCC H;  4FLX A;  4X89 A;  1RSO B;  1FJG B;  3FYI B;  2XAG A;  2CUG A;  4TQD A;  1VQM V;  1NH2 D;  4FM2 A;  2P7T C;  2JGU A;  2HR3 A;  1VQ4 V;  2Q73 A;  3BAA A;  3OTO O;  3C3T A;  3JAR B;  2EUL A;  4DV2 O;  1AVM A;  1YJ9 V;  1P4R A;  2XTA A;  4O2B B;  4BIZ A;  2B9Z A;  2QKS A;  3ABL B;  1NTZ H;  2RJZ A;  2P06 A;  2WA4 A;  2BSK B;  3OUS A;  1MAB G;  3K57 A;  1IBK O;  5GTH Z;  5KA6 A;  1XRE A;  2XND G;  4AI8 A;  3HKE B;  2WLN A;  1YTF D;  2JGD B;  5EIB D;  4FVM A;  5IDJ A;  1XL4 A;  5IWA B;  2K9P A;  1BT8 A;  4C7U A;  3JD4 A;  2EIN B;  3HKC B;  4YJ3 B;  4JI3 B;  3ZX6 A;  4MVO A;  4JI0 O;  1V54 C;  2HG5 C;  4TQF A;  1WPX A;  3Q4H A;  2H8P C;  4J9Y B;  5HFM A;  2QJ1 A;  2BOB C;  4YIP A;  4DUY B;  2HEP A;  2CE4 A;  3FB8 C;  4N21 A;  2BOC C;  1V9P A;  3E22 B;  4MVS A;  4DW1 A;  5JQG A;  2EIL B;  1SET A;  5GON A;  2UU9 B;  1YIJ V;  3RN4 A;  1IDS A;  1HNX O;  4Z1M G;  4TV8 B;  1VEW A;  1QHT A;  4DR7 B;  3ML0 A;  1PP9 H;  4JI6 B;  3SYC A;  3G4S V;  5LMU B;  1SQV H;  3BFR A;  1T5E A;  3FFQ A;  4P9O A;  3I55 V;  4DK0 A;  3H01 A;  5LMN O;  4DV7 B;  4CH5 A;  2QWR B;  1OHH G;  3AEI A;  4QGP A;  2RN9 A;  2WLH A;  3K5O A;  3ZHS A;  2UXC O;  4TV9 A;  2X6C A;  1S77 D;  2HHH B;  5B1B B;  3CXC U;  2RQ6 A;  4PI0 A;  4R8C A;  4DV5 B;  1WAZ A;  1B04 A;  3EFF K;  4A5U B;  3CEI A;  3LDC A;  1AIL A;  3H1I H;  5TIS Z;  5IJ0 A;  1XUQ A;  1H2K A;  3N27 A;  1MMM A;  2ZIO A;  1W59 A;  2P90 A;  2ZE8 A;  4X1I B;  1TUB B;  4FLY A;  5D5P A;  4MS2 A;  3B2E E;  3FB5 C;  1VQL V;  2EIJ B;  2RNB A;  4LF4 B;  2OCC C;  1YJN V;  1THZ A;  5LHG A;  1FAF A;  3B4S A;  3AG4 C;  4L8J A;  4OXS A;  3BVO A;  3CRM A;  1KD1 W;  1N33 O;  1M93 A;  3RYI A;  1PNM A;  2IW5 A;  2NN4 A;  3AG3 B;  3TK1 A;  3K06 A;  4B3R B;  3OE7 G;  2L6L A;  4I55 A;  2Q0A A;  4I4T B;  3OW2 U;  2Q5Z A;  2Y48 A;  4WFF A;  4CH4 A;  3F5T A;  1NH2 B;  2IJJ A;  2M7W A;  4LP8 A;  3O9O A;  4ZI7 B;  2QWN B;  2ZQM A;  4JV5 O;  4JAU A;  4RWU A;  2YEV A;  3JAR A;  4WBN B;  3ABT A;  4O2B A;  4HAM A;  5CA0 B;  4JI7 O;  2IH3 C;  2BSK A;  3E83 A;  2QA4 V;  2JRI A;  2LGW A;  3CCU V;  1YTF B;  1EN5 A;  4HYO A;  2YI9 A;  1OCO B;  3CPW U;  1ORQ C;  3SYQ A;  4GX2 A;  1FS0 G;  1UPG A;  3UCS C;  3ZRX A;  2WWW A;  1SER A;  4JTA B;  3HKC A;  1WP8 A;  2QKA A;  5LP6 B;  2YDE A;  4O4H B;  4JI2 O;  1YF2 A;  4DR4 O;  3ABM C;  4X1Y B;  2B5U A;  3C90 A;  1Q3E A;  4GYC B;  1TUE B;  3E22 A;  1NR1 A;  3TJT A;  1DGS A;  4FLW A;  2Y69 B;  4IGG A;  1JFF A;  5EZY A;  2Q67 A;  4IIJ B;  4UVB A;  3OTO B;  5IYZ B;  4JAA A;  5JJN B;  4J41 A;  3TGU H;  2D3O W;  2BTQ B;  1MNG A;  4I50 A;  4GKK B;  3LUT B;  2CH7 B;  4FPP A;  4CS2 A;  3CP1 A;  3G67 A;  1IBK B;  1IBM O;  4GLX A;  3PJS K;  1IXM A;  3HPL C;  1Y76 B;  5LA6 B;  1NU1 H;  3JAK B;  4YJ2 B;  1CP9 A;  5JH7 B;  4LH7 A;  5H5N A;  3JAS B;  5IT9 N;  4OX9 O;  2X0L A;  2F43 G;  1VP7 A;  3DC6 A;  3SDL A;  3U10 A;  5DN6 G;  1K4C C;  2L35 A;  4NXN B;  5H6R A;  3PN1 A;  1IZ3 A;  2ZE7 A;  4ZHQ B;  4FZ0 A;  4KHP B;  3R66 A;  4X1I A;  1S5J A;  5JCO A;  1COW G;  1F4M A;  1SQF A;  2E3C A;  1DF5 A;  3QO8 A;  4MW3 A;  4LF6 B;  2PYL A;  3VOU A;  1FXK B;  2LJ2 A;  4QE7 A;  2CGO A;  5KHI A;  5KMG B;  5IYD O;  1GKF A;  4RO2 A;  2LP7 A;  3UO2 A;  1V55 B;  5FPO A;  2AZ0 A;  3CX5 F;  1VF6 C;  2YXL A;  3DGE A;  3H1H H;  4QNH B;  2A9H A;  3BA8 A;  2C2A A;  5LMN B;  4D6T H;  1PNK A;  5J2U B;  1W0K G;  2JEX A;  2OTL V;  4DUZ O;  1VQN V;  1Z5W A;  3BRC A;  2B1I A;  3TXQ A;  1BQ0 A;  2XAH A;  3ZN0 A;  1SA0 B;  2DJV A;  3ZHV A;  5L3C A;  2ATK C;  3HR0 A;  4MVQ A;  3JAL A;  1VQ8 V;  5CA0 A;  5L3B A;  3LNM B;  5EIB C;  3N2K A;  5IWA O;  3X2Q B;  4JI3 O;  1VQP V;  1BS3 A;  1KQS U;  4Z1V A;  5LOV B;  4G2K A;  3ASN C;  4ZIB A;  1K7D A;  1TVK A;  4KXR A;  1L0N H;  4FLU A;  5K1P A;  4U3F H;  1A32 A;  1JOY A;  3ZIA G;  3K03 A;  1OCR B;  1W2B U;  4GUN A;  1I94 B;  4R50 A;  3G71 V;  1YIT V;  1N33 B;  4WFH A;  3WU2 Z;  2UU9 O;  4JGS A;  1EZV H;  1PPJ H;  4DR7 O;  2A0L A;  2Q9L A;  1D5A A;  4X1Y A;  3CE2 A;  4JI6 O;  4OGQ B;  5B3S B;  1WB8 A;  1H2L A;  5LMU O;  2ETN A;  2E5L B;  5EBL C;  4BW5 A;  1MSW D;  3E86 A;  4HZ3 A;  1CXZ B;  4JI1 O;  3NXS A;  4JV5 B;  2QM4 A;  1NTK H;  5IYZ A;  2VS0 A;  4O4I B;  4LF7 B;  2BE3 A;  2VQE O;  3OMA B;  1QCE A;  2HHH O;  4DR3 B;  2ZIN A;  1BSM A;  3BAB A;  1BGY H;  1ROP A;  1AP5 A;  1JCH A;  3MAQ A;  1Y76 A;  1K97 A;  5LA6 A;  5KHH A;  5KAI Z;  5CB4 A;  5LYJ B;  1AI5 A;  1V54 B;  3QG5 A;  5H9C A;  1H8E G;  2AGA A;  3FB6 C;  3T4D A;  5LXT B;  4LF4 O;  2GTS A;  1NT2 B;  1GO3 F;  3KG2 A;  4O4L A;  1HNW O;  3AG2 C;  2CDY A;  4BR6 A;  5KA5 A;  1S72 V;  3OEE G;  1KEC A;  2GUZ B;  3H1K H;  4B7E A;  4JI2 B;  4CBC A;  1I5X A;  4ZHQ A;  4AQY O;  4MTF A;  4LFC B;  4QPK A;  1FKA O;  1XMQ O;  4B3R O;  4CS3 A;  1WNS A;  4LF8 O;  4UCT A;  5FNV A;  4NTY A;  4J9Z B;  4PEL A;  3QF7 A;  2P67 A;  5KMG A;  3S3W A;  1KYO F;  1Z5V A;  1R3L C;  2EIK C;  2EZP A;  1BHB A;  2UUB O;  2UXB B;  1BZK A;  3ASO C;  2GHY A;  1IBM B;  5J2U A;  4Z2W A;  1TAE A;  2MW2 B;  4JZG A;  4TSF G;  3D36 C;  2AXT Z;  3CRA A;  4B3T O;  3IAY A;  4DXW A;  2QR4 A;  4OX9 B;  1AJN A;  1PL4 A;  3U11 A;  3JAM N;  1PV0 A;  1SA0 A;  5CA1 B;  2IM9 A;  2Q6A A;  3RT3 C;  3QTC A;  2WAM A;  1S5H C;  5EYP A;  1JR9 A;  1HWY A;  3OMI B;  1L1F A;  1KP3 A;  2X6A A;  4HNA A;  2OCC B;  4J80 A;  1LUW A;  4TT3 G;  4X9Q A;  1Q81 W;  2CGN A;  4AIL C;  2GTA A;  4JPR A;  4UFZ A;  3ABU A;  2V1D A;  3UKM A;  4FLT A;  3B77 A;  3AG4 B;  4H0L B;  2WLI B;  4GZR B;  1HNZ O;  3AK3 A;  3D8C A;  3CB2 A;  1UFI A;  5C93 A;  5BY1 A;  2RCV A;  1OCZ C;  2CTP A;  5IYB O;  1N36 B;  1SC5 B;  1R3I C;  1OJH A;  4DUZ B;  4GKK O;  2Q0O C;  4GX0 A;  2Z3Y A;  4H37 A;  1M57 C;  1YVW A;  3P3N A;  3BHP A;  3WB2 A;  3F5W C;  1K3E A;  5CBG A;  3CS5 A;  3MD0 A;  3CXH F;  1KP2 A;  1XHZ A;  1VAR A;  1F51 A;  4DW0 A;  5CBF A;  2Y0P A;  1OZ0 A;  4F4L A;  1IBL B;  3A2F A;  3DTU B;  4NXN O;  2P4K A;  1GRJ A;  2PF4 E;  3K0G A;  3FAV A;  4JZ2 A;  2YIC A;  4J7J A;  3SJQ C;  2Q69 A;  5LGN A;  2EZO A;  4KHP O;  1Q8I A;  2P22 C;  3MHS C;  3CCM V;  1WA8 B;  2YIB A;  1FFX B;  1BQZ A;  4I7Z B;  2ODM A;  3ABM B;  4LF6 O;  4RQF A;  1ZL8 B;  1NZ6 A;  3CCL V;  3HKD A;  3QVN A;  1R3K C;  1S3J A;  1Y74 A;  4DV0 B;  2WLK A;  3RYC B;  1YCI A;  1K73 W;  4PD4 F;  1NVP D;  1R6T A;  2D2C B;  1SKV A;  2UXD B;  4FK5 C;  4F6R B;  2W6I G;  2HP8 A;  3IC7 A;  3RW0 A;  5A2Q N;  1EN6 A;  3H1L H;  4JI1 B;  1ZAU A;  2PYJ A;  3THO A;  2HFE C;  4J7Z A;  1SQQ H;  4LWS B;  2Q8V A;  2QTO A;  4J10 A;  4PA6 A;  2VQE B;  5C8Y B;  1X59 A;  1F7Y A;  4PA4 A;  1XNQ B;  1P84 F;  3ABK C;  1KUQ A;  1TGO A;  2Z0A A;  4IHJ A;  3UQ8 A;  3JAW A;  5ITZ B;  4K8X A;  1FD9 A;  2H3O A;  1Q7Y W;  2YID A;  2O57 A;  3CCS V;  2QWP B;  1HNW B;  1AR5 A;  3HKB B;  3ZRW B;  3KKY A;  4RAI A;  1AI6 A;  3L70 H;  2ZXW C;  1I94 O;  4AQY B;  4GX1 A;  4LC1 A;  2EBO A;  1XMQ B;  1JQ0 A;  1BE3 H;  3M99 B;  4LF8 B;  1RSO A;  2HVK C;  2KG7 B;  2WLI A;  1S0V A;  2YXH A;  4BAY A;  5BZB A;  1M1K W;  3L9D A;  2QWO B;  1NR7 A;  2E5L O;  4ABM A;  1H2M A;  3N2G B;  3T1Y O;  3S3X A;  3CMA V;  3IGA C;  1URF A;  2G38 A;  3U0Z A;  3F7V C;  3OT7 A;  2UUB B;  2FL4 A;  4LF7 O;  3K79 A;  3LSS A;  2F66 C;  4QPJ A;  4DR3 O;  2JK5 C;  4CH6 A;  4CS4 A;  1DLB A;  4MTG A;  3JD3 A;  4B3T B;  4YHH B;  2FYU H;  1ZSP A;  5JWP A;  4JYB A;  2LFS A;  3J80 N;  3W7U A;  3HKE A;  3K9S A;  2WSS G;  4X20 B;  2JGD A;  1WJZ A;  2QM8 A;  3T1H O;  1XEQ A;  3F7Y C;  2WLJ A;  1E79 G;  3ASN B;  1ZLZ A;  4YJ3 A;  1KB9 F;  1LNQ A;  3ZMS A;  4PJ0 Z;  1Y67 A;  4LNU B;  4LFC O;  2CTW A;  4XDJ A;  1HNZ B;  1WA8 A;  2KQX A;  3K0D A;  3G80 A;  1EM1 A;  5KUM A;  4DR5 O;  1QNM A;  4WFG A;  1Q6H A;  2JIZ G;  1QQC A;  1L8D A;  4EB6 B;  4EKW A;  1ZL8 A;  3B40 A;  5KX5 B;  4I0X B;  1YEW A;  1WB7 A;  2R72 A;  4GX5 A;  4DV4 O;  1NVP B;  1VQ7 V;  1P7B A;  5DEC A;  1IX9 A;  4TV8 A;  1UJW B;  4B3S B;  1N0N A;  2IH1 C;  4JTC B;  1D5N A;  4RQE A;  2F95 B;  1F4N A;  2Q7H A;  3D3I A;  2A06 H;  3E89 A;  2UXB O;  1EZJ A;  1ZWI C;  2XAF A;  2Q4P A;  1YHQ V;  2JJ1 G;  1QBZ A;  3A0H Z;  2DOS A;  1R6N A;  1LR1 A;  2X6B A;  3LDE A;  5IYC O;  3K3W A;  2P6J A;  1NTM H;  1B6Q A;  1NJI W;  5C8Y A;  2Q7E A;  1SZT A;  1G6U A;  3WB1 A;  3ZBH A;  4ASU G;  3P32 A;  1MG1 A;  3L75 H;  1EBO A;  1GN3 A;  5B5E Z;  1H2S B;  2JS3 A;  5F2V O;  5LL6 Y;  5ITZ A;  1XI1 A;  2YS8 A;  2DYR C;  5IJ9 B;  1J95 A;  3AG2 B;  1TUB A;  2YXY A;  3UM7 A;  3SJB C;  3LDD A;  4LFA B;  3ZHU A;  4NXM B;  2A7W A;  5L3G A;  1HDJ A;  2H94 A;  1K33 A;  5JCO C;  3HKB A;  2ZM6 B;  3JD0 A;  4O4J B;  3E8G A;  1R73 A;  4DK1 A;  4DR1 B;  2JS5 A;  5J9P C;  3RBZ A;  3A0B Z;  1H8H G;  1YZB A;  2DWE C;  3LSU A;  3FYE B;  1XL6 A;  1NS1 A;  3ZMT A;  1QVF U;  5IE9 A;  4TOI A;  4O2A B;  4JYC A;  2P4V A;  4I4T A;  1N36 O;  4JYA O;  3L73 H;  2R9A A;  2EIK B;  1FPO A;  4UCR A;  4W4K A;  1QLE C;  3ASO B;  3N2G A;  2WLL B;  1XIL A;  2ITC C;  4UCV A;  4ZI7 A;  2ZNI A;  2DN9 A;  3JAT B;  3SPH A;  2IBZ H;  4WBN A;  4JYY A;  4ZOL B;  4XBF A;  1SQG A;  3SYP A;  1YSC A;  4LF9 O;  3O65 A;  3WFV A;  3CC4 V;  3OGI B;  3ZRS A;  1QU7 A;  1IBL O;  2JJ2 G;  1O9G A;  1VMG A;  4BWA A;  5LGU A;  2QEX V;  4G28 B;  1MSD A;  4X20 A;  2DQ3 A;  3C3S A;  3TXS A;  2E76 B;  3CCR V;  3HB3 B;  1VQ9 V;  3AG1 C;  4BW9 A;  4HBN A;  3ETQ A;  3ZHT A;  4UXN A;  5CA3 A;  4FMT A;  5LP6 A;  3K58 A;  1KKD A;  2QKC A;  4O4H A;  4X64 O;  2DE0 X;  4DV0 O;  4W4L A;  1N34 B;  3ZCC A;  2PY5 A;  4KUM A;  2UXD O;  4LFB O;  3T1Y B;  1KBH A;  2QE7 G;  2PI4 A;  4EFB A;  2EJ7 A;  4PA3 A;  4IIJ A;  4FM0 A;  3OUF A;  5IY5 C;  1OV9 A;  2M6Y A;  2GBO A;  2BTQ A;  2GV9 A;  3WB0 A;  2ZDI A;  3OM3 B;  1R6K A;  2VWK A;  1CPY A;  4PDL A;  4WFB V;  2YC0 A;  2CH7 A;  1M4U A;  1IXB A;  1XNQ O;  4AHC A;  2CK3 G;  3MHH C;  1SF9 A;  3CYO A;  2A3Q A;  2BTO A;  5JH7 A;  3JAK A;  4YJ2 A;  3SJA C;  4TUY B;  3SJC C;  3I5D A;  1YI2 V;  3T1H B;  3JAS A;  4CZZ A;  4JI4 B;  5A9G A;  2LO1 A;  2PGG A;  5J2T B;  1GK9 A;  3K5L A;  5KUK A;  1M56 C;  3M8A A;  3Q4H B;  4BIO A;  2X7R B;  1SQX H;  4UVC A;  4FIP C;  3VQY A;  2LFR A;  1Q82 W;  2VRZ A;  2FKX A;  1Z2G A;  2Y4U A;  5IJ9 A;  1GM7 A;  4PDV A;  2QSA A;  2ILM A;  4H13 B;  4DR5 B;  4K3A A;  3WG7 C;  4QJF B;  3B8M A;  1GTO A;  1FXK A;  4XDK A;  1XNR B;  4X65 B;  4DV4 B;  2ADP A;  3CD6 V;  3ZMZ A;  3IC9 A;  4YY3 O;  3RVZ A;  1VF5 B;  3JSN A;  4PHZ A;  4H33 A;  3T4Z A;  4DR2 O;  4CC5 A;  1SQB H;  3GWO A;  4DRX B;  1US6 A;  1V55 C;  4O2A A;  4WF9 V;  1X4T A;  2YSU B;  4MT8 A;  3UT5 B;  3RWR D;  4P30 A;  4IT5 A;  3UO3 A;  4YHH O;  2WLL A;  4Q6G A;  3ABK B;  4DV6 O;  4ICG A;  2JVD A;  3T2M A;  4X62 B;  2EJR A;  1U96 A;  4U3J B;  2ZE5 A;  4ZKI A;  5IJ0 B;  3CME V;  1QR8 A;  3VQX A;  5EK0 A;  2OWO A;  2Y4T A;  2K1E A;  1DK1 A;  5LOV A;  3OAA G;  2LGQ A;  1JA8 A;  2ZXW B;  3X2Q C;  5HFL A;  1S5L Z;  2JDI G;  2GSM B;  3CHX A;  3ETG A;  2ZR2 A;  2Q68 A;  4JF3 A;  5GTI Z;  1Q5O A;  5L3D A;  2ZE6 A;  1ENV A;  1MOF A;  1FYJ A;  1EFR G;  4J11 A;  4FFK A;  1YDX A;  3J7A U;  3RYI B;  2NR5 A;  3ICX A;  3FD9 A;  1H2G A;  4I55 B;  2QTS A;  1JPX A;  4B3S O;  5B1N A;  3ZHQ A;  4E2L A;  4JYA B;  5L3F A;  4R6Z A;  3VQV A;  3CCJ V;  3CSX A;  5JVD B;  1RM1 C;  2WA3 A;  2HVJ C;  3OEH G;  3TET A;  3QO5 A;  4WFA V;  2W6J G;  3ZED A;  4UV9 A;  5B3S C;  2JEU A;  3CJH B;  2LW7 A;  4TWK A;  2YEV B;  2Z5U A;  1FXV A;  5K1X A;  4O4I A;  4H44 B;  5E1A C;  4GKJ B;  1RP3 B;  1J5E B;  4LF9 B;  4FM1 A;  3K08 A;  4KFM A;  5CMU A;  4K0K O;  3JCU Z;  1H2N A;  1O9H A;  4DV1 B;  1OCC C;  3L74 H;  1BHA A;  2N05 A;  2WPD G;  3KZI Z;  5JJE B;  3ZMV A;  3OR7 C;  1QR9 A;  4TUY A;  4B7K A;  2EIM C;  4Q20 A;  4E4E A;  4X66 O;  3RYH B;  2OYQ A;  5LYJ A;  3OFN G;  3G6E V;  1P7G A;  1ARO P;  5J2T A;  2IU0 A;  2ZR3 A;  4LFA O;  5LXT A;  4YIO A;  4NXM O;  1JVM A;  2OT5 A;  4DR6 B;  3T1C A;  2ZM6 O;  2ZKO A;  3JYC A;  2GUZ A;  2FML A;  4DR1 O;  4X64 B;  1S76 D;  1WP7 A;  1GN2 A;  2E74 B;  1N8R W;  4DV3 O;  4LFB B;  2A79 B;  4K8Z A;  1U97 A;  1JFF B;  5EZY B;  3ETD A;  4B08 A;  5CN0 A;  1WLE A;  3GB7 C;  1KU9 A;  1N32 B;  3MDS A;  4GT1 A;  1SES A;  1SRY A;  3APO A;  3P30 A;  5FLX N;  4J42 A;  1BCC H;  4JI8 B;  2DYS C;  4I50 B;  5LHI A;  5CBH A;  1WPB A;  3CRQ A;  3LSQ A;  4DRX A;  1MZF A;  4DO2 A;  1RPO A;  3E8B A;  5FL7 G;  4P9P A;  2P5O A;  3K5M A;  1M5I A;  1MZE A;  1Y4M A;  2F23 A;  2UUC O;  3UT5 A;  1XOU A;  4NKG B;  1K8A W;  4LF5 B;  3VQW A;  1XDC A;  1Q43 A;  4P2Z A;  5B1A C;  3K9A A;  4FLV A;  4U3J A;  1F23 A;  3RVY A;  4YXW G;  5CA1 A;  4X1K B;  4RUE A;  3B09 A;  3ZRV A;  2DYR B;  3BY6 A;  2QM7 A;  5KLV H;  3IFX A;  1AP6 A;  3OGC C;  2F4V O;  4FFB B;  2FTK A;  1QVG U;  1ZUQ A;  3AG7 A;  5KHG A;  1IUR A;  1Q6I A;  5JJJ B;  3APQ A;  2DMX A;  4UB6 Z;  3ZN1 A;  1N34 O;  5H6Q A;  3VBB A;  5LGT A;  1NKD A;  4U7N A;  4X88 A;  3BA9 A;  1AI4 A;  4YY3 B;  2NLJ C;  1G8M A;  4DR2 B;  4U7O A;  1VQO V;  3L72 H;  3H9V A;  4MSW C;  3E8F A;  3ZMU A;  4UUJ C;  2DWD C;  5KHK A;  1QLE B;  3QO7 A;  4EEQ A;  5FPR A;  3DSQ A;  2XAS A;  1JX9 A;  2XUM A;  1FXH A;  1GN4 A;  5JVD A;  2N74 A;  1K34 A;  2FB5 A;  2R70 A;  4PV1 B;  5D5Q A;  3CRR A;  1VQ6 V;  3ABL C;  4DV6 B;  2R9R B;  1GM8 A;  2RDC A;  3CJH A;  3SPC A;  4BIU A;  2CTQ A;  1G4Y B;  1WN7 A;  3M7M X;  1MA1 A;  3JAL B;  2F93 B;  4JI4 O;  3G6B A;  3N2K B;  3D3Q A;  4ZBM A;  1I5Y A;  2EX3 A;  4EFE A;  2IU3 A;  4NYK A;  4G27 B;  1YJW V;  1TVK B;  5LHH A;  1QLN A;  3AG1 B;  2EIN C;  2ZT9 B;  2N04 A;  1RPR A;  1G1X B;  3RYH A;  5EC2 C;  4LH6 A;  3DXR B;  3K59 A;  4IL6 Z;  4MTX A;  1FFT B;  4F6E A;  1P49 A;  1FFX A;  4I9W A;  3TCU A;  1AR4 A;  3CCE V;  3CRC A;  1XMO O;  2NNU A;  1NBM G;  3RFR A;  1XNR O;  1SS3 A;  2HLD G;  4X65 O;  3SPG A;  3A0R A;  1M9N A;  1HR0 O;  2EIL C;  1Q90 D; 
#chains in the Genus database with same CATH homology
 2ODM A;  2NR5 A;  2GBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...