2NR5A

Crystal structure of protein of unknown function so2669 from shewanella oneidensis mr-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
64
structure length
60
Chain Sequence
MMTKKERIAIQRSMAEEALGKLKAIRQLCGAEDSDMQEVEIWTNRIKELEDWLWGESPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of SO2669 protein from Shewanella onedensis Mr-1, a singleton of unknown functions.
rcsb
molecule keywords Hypothetical protein SO2669
molecule tags Structural genomics, unknown function
source organism Shewanella oneidensis
total genus 24
structure length 60
sequence length 64
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.750 Mainly Alpha Orthogonal Bundle Helix Hairpins SO2669-like 2nr5A00
2ODMA 2GBOA 2NR5A
chains in the Genus database with same CATH superfamily
4OXSA 3G6BA 3P3PA 4R7CA 4YJ3B 2ZDIC 1I94B 5JCOC 1OCCB 3LSSA 3RYCA 1S3JA 1TGOA 5EZYB 1QVGU 1VQ5V 1AR4A 4L87A 2WLHA 1THZA 3TXSA 2QGNA 3M7MX 1L1FA 3JYCA 3X2QB 1NQTA 1BT8A 5GONA 2MW2B 2ZKOA 4DV6O 2E5LB 1M57C 3MAQA 2CTWA 2XAHA 4BIOA 4LBEC 4R50A 2W6IG 2EINB 3MDSA 5LL6Y 1CPYA 4I5SA 4TV9A 5B1BC 1PM9A 3U11A 4BIUA 1PL0A 5A2QN 2QA4V 3RYIB 1SESA 5EBLC 5IJ9B 1AVMA 2ZR3A 4ASUG 1MZEA 1GN6A 4DR4B 3ZRSA 4EEQA 1RP3B 3SGIA 3RFRA 1YXBA 2KKWA 4FVMA 3RYFB 4QGPA 4TWKA 3BCCH 4WCEV 2DQ0A 4DYLA 1NH2D 3AG3B 4RQFA 3CCQV 3SYQA 1TA8A 4I7ZB 4MVZA 2RN9A 4MW8A 1V54C 1Y76B 3CRCA 1MSWD 4GX2A 3JARA 3MHHC 4WBNB 1WNSA 4JI5B 3CJHB 4O2BB 4KL1A 3QO7A 5DEDA 1YIJV 2F4VO 1XL4A 4O2AA 1TUBB 2IH1C 4NB5A 3J7AU 4FLUA 1PNLA 4U3FH 1ZUQA 2HKOA 4MTXA 1OV9A 2QDOA 4CBCA 5CBHA 1YHQV 1XL6A 3RVZA 2A0LA 3ZBHA 2VQEB 2ITCC 2OCHA 4JYAB 1AI6A 1Y74B 4WFFA 3D3QA 2X0LA 5B66Z 3ETEA 3FD9A 4JYCA 1M90W 3K0DA 4HBNA 3HKDA 4J42A 1QVFU 5IYZA 4DV2B 2YUAA 4IT5A 1NT2B 3ZMZA 5LGNA 4X64O 5CA1B 2EX3A 1BE3H 4NTXA 2V1DA 3ETQA 4O4JA 1QLEB 5KUKA 4GX0A 3CCLV 4ABMA 3ETGA 2QKCA 3M99B 2CGNA 4ZHQB 1S72V 1V55C 3D36A 2PYLA 5H5NA 2Q68A 4LF9B 3CSXA 4JZGA 3TETA 4R6ZA 1KP2A 1XEQA 1M9NA 2Q0OC 1NR7A 3SPGA 3RYCB 5CBGA 3OEEG 1OCZB 1Z2GA 2GTSA 1S5LZ 2JRIA 3CXHF 2YICA 3L70H 1QNMA 5CB4B 4I4TA 4NXNB 5GONB 1NZ6A 3LNNA 4GT1A 4DRXA 1KC8W 1R3JC 2PI4A 1WAZA 5LBQA 2VQEO 3D36C 2UUCB 5JH7A 2QWPB 3KG2A 1NVPB 2UU9B 2HJFC 5B3SB 1PNMA 4TV9B 4DV2O 4U3JA 4CH3A 4DR5B 3UO3A 3K5LA 1H2SB 1A32A 5KLVH 1VQKV 2DYRC 2ODMA 2CK3G 3R66A 3ZHVA 2JEUA 2IU3A 2EIMC 1I0HA 4UCRA 5IY5B 2V7QG 1J5EO 3FAVA 2IJIA 2DWDC 2P5OA 4AI8A 1YDXA 2ZE7A 3JARB 2XAGA 4OPHA 1JJOA 1AR5A 1IURA 4LF4B 4KXRA 1X59A 5D5QA 4UV8A 3F5TA 3L71H 1XMOO 3H1LH 2IJJA 1YZBA 1H38A 1BSMA 1ZAUA 1PP9H 5JJJB 3K58A 4UXNA 3TK1A 4NXNO 4K0KB 3DGEA 2AZ2A 4PELA 4JI4O 2N74A 2GBOA 3HKDB 1YJWV 3K0GA 1DTOA 2FKXA 5IYZB 3OR6C 3W7XA 3QTCA 1VF5B 2E3CA 2OCCB 4X88A 2UU9O 5KA5A 2Z0AA 3NR7A 1SQXH 1XMQB 3HKCA 2DOSA 3WB1A 2UUAO 1E79G 2B1IA 3WU2Z 2EZPA 3RBZA 3T1HO 3OR7C 3ABKB 4LF5O 2HG5C 4JI6B 4JI1B 5LHGA 4DV4B 3JD0A 1XNRB 2DJVA 2A9HA 1K8AW 2LGQA 1UPGA 2B1GA 5CA3A 1K4DC 2ATKC 1FJGB 1AI7A 4JTDB 2JS5A 4GKJB 1VQNV 1M1KW 4LWSA 5C93A 4EB6A 3ASNB 4X1YA 1Q86W 4FLZA 2WLIA 5HFMA 1RSOA 1AROP 4I4TB 1D2DA 4DRXB 3E8BA 4MVSA 1BGYH 5EC2C 3F5WC 1EZVH 3CWBH 1FS0G 4FZ1A 5JH7B 3IAYA 3OMAB 5B1AC 3E86A 2N05A 2RMKB 1JOYA 2DWEC 3OTOB 3HR0A 1L8DA 4U3JB 3LDEA 2UXDB 1VF7A 4PA6A 1D5AA 4CC5A 1XMQO 1SERA 4GYCB 1VQ9V 2ZXWC 1FAFA 2H94A 1FXKA 2LP7A 1N4CA 2WSSG 3ML0A 4JI1O 4DV4O 2QE7G 3FAVB 1VEWA 5B1NA 1FFTB 1XNRO 4B3RB 5K1PA 4QJFB 4DO2A 3K06A 4WFGA 1GMGA 4LFCB 2FL4A 2QWNB 5JJEB 1FJGO 3O9OA 1I5YA 4J11A 1IBLO 4UUJC 2QM4A 5F2VO 3UCSC 4IHJA 4CZZA 4LF8O 4GKJO 2EBOA 1YTFB 4DK0A 3H1IH 1N0JA 3E8FA 5LYJA 1JMKC 2B5UA 3B2EE 1ROPA 3ABTA 3CCSV 5LMNB 2QJ1A 1G6UA 3ZMVA 1IBMO 2UXCO 1US6A 1KU9A 1BHBA 1ZWIC 4XDLA 4FLTA 4I9WA 3G71V 4UV9A 1AP5A 5DN6G 3CC2V 2Y0IA 3B40A 2WLMA 3HKCB 1HNXB 1PV0A 4XBFA 4G27B 3KCXA 1AI5A 5JWPA 2PZSA 3O65A 2KG7A 1NKDA 4MS2A 2M6YA 2P4KA 2XHBA 1SQVH 5KAIZ 4PDVA 1K97A 2ZIOA 1NTKH 2W6JG 2YXLA 3SJQC 4B3RO 4I0XA 1B04A 4IIJB 4KFMA 5HFLA 2DN9A 3CCVV 4F6RA 4LFCO 2QTOA 4B3SO 4LWSB 4LNUA 4EB6B 1RFYA 2Q8VA 4X1YB 2WLIB 2EZOA 1KB9F 1RSOB 2CUGA 4X20A 5J2TA 1XI1A 4XDJA 1K9MW 3G6EV 2UXBB 2RJZA 1CXZB 1HNZB 5LP6A 3ZN0A 2ZQMA 2W0FC 2Y4TA 3TGUH 1JVMA 5LGUA 3MD0A 4LR3A 1R6KA 3OTFA 2Q7GA 4J80A 1BL8A 3CHXA 4DK1A 4B3TB 3JATB 3CCEV 4X62B 1OCOC 2D2CB 2WLKA 1KQSU 1EBOA 5JCOA 1NBMG 4UCUA 1FXHA 2EIJB 2WLLB 4GX1A 1Q6IA 1J95A 3PJSK 4NR1A 3STZC 3JD2A 4NKGB 3ABMB 3K08A 3EHBB 3CX5F 4TT3G 2AHZA 3RN4A 1P7BA 1FXKB 5J2UA 2UUBB 3P32A 1GKFA 1TAEA 1IDSA 1GM8A 3P30A 5KA6A 1Q5OA 4X65B 2ZM6O 1PKXA 5BZBA 4X66B 1Y67A 4DW1A 4J7KA 4GKKO 5KHKA 1VQOV 2WA4A 2LJ2A 3CS5A 4GX5A 2XTAA 5CBFA 4MTOA 2JS3A 4IHJB 4BIZA 2AXTZ 2OT5A 5B1OA 5LYJB 2Z5UA 3TCUA 4JI2O 2R9RB 3GWOA 4TOIA 4WF9V 3UO2A 4X89A 3DXRA 1SZTA 1HNZO 2QR4A 3JALA 2GSMB 4Q6GA 1ZL8A 4N21A 4P9PA 5IE9A 4QNHB 4DR6O 4LC1A 4KHPB 2XAQA 1BMFG 4DV7O 3RT3C 4X62O 4BR6A 3B4SA 1R1BA 2RCVA 4PV1B 5B5EZ 3A0BZ 3ZHTA 1DLBA 1F51A 4JAAA 3G4SV 3LDDA 4JI8B 2R9IA 4IYHA 5IYCO 1TVKA 1KD1W 2KG7B 4E2LA 2UUBO 2ZCEA 3K04A 3K5MA 4G2KA 5KAFZ 2WWWA 1GH6A 4NVPA 3AG2B 4AILC 4I0XB 4PDRA 1Q82W 5LMUB 3SYAA 4F6RB 3FB6C 4DW0A 1NTMH 4LNUB 4AQYB 3AG4B 2BOCC 2HJDA 1OZ0A 1WLEA 1VQ4V 4ZOLA 1QU7A 4FLWA 4X20B 1I94O 3AK2A 4EKWA 5J2TB 3VQYA 5BR8B 3A8TA 2AHYA 4X8AA 2QWRB 5LP6B 2PUSA 2ZE6A 4LP8A 3VBBA 4PHZA 3WB0A 3JAWB 1HNWB 1OJHA 5BXZA 2WA3A 2P67A 4RO2A 3WG7C 1AB3A 1XOUA 1Z5WA 2VWKA 1BS3A 3ZIAG 3ZN1A 1IXMA 4X1KA 1SS3A 3N2GA 2YI9A 3LSUA 1ZX3A 4KHPO 4Z2WA 2E5LO 2ZE8A 3K57A 5C8YA 2BTQA 1GO3F 4WFAV 2VQFB 2IM9A 4UCTA 2QKAA 1VARA 5J2UB 2F43G 1WN7A 1H2MA 3JD1A 4DR4O 5K1XA 1M57B 3FX7A 2ILMA 4B3MB 3K9SA 1G4YB 3FFQA 4K3AA 4PI0A 3CE2A 1R3LC 5LMUO 1AILA 2NNUA 3E35A 5B1BB 4AQYO 1VQ8V 3CCJV 4JI5O 1R73A 4FZ0A 4FM0A 2F93B 5BR8O 3DXRB 2BSKA 3JALB 1ZL8B 5LGTA 1PNKA 2GDSA 4YXWG 1VF6C 4MW3A 1GM9A 3M8AA 1VP7A 4FJCC 4JYAO 1V54B 4P30A 1N36B 3EVKA 4LFBB 1FFXA 1B3QA 4O4LA 3S3XA 3IGAC 3L73H 2OIEA 3AG1C 1D5NA 3OEHG 4LF6B 3JSLA 1JCHA 4LFAB 4UB8Z 2P7TC 1TVKB 1K3EA 2YI8A 1H8EG 1JQ0A 4X9QA 2F23A 2Q67A 4O4HA 3JAMN 1WB7A 1YJNV 4MT8A 1GN2A 5IDJA 3B8MA 1SZXA 4YIPA 1EM1A 2EIKC 2JEXA 1HR0B 4H37A 3B77A 3ZHSA 3SJCC 2BTOA 2PGGA 4J9ZB 1E1RG 5JVDA 1HWYA 4PDLA 5L3DA 4LF9O 1QBZA 1QLNA 5E1AC 2EILC 1BZKA 4XDKA 3K79A 1Z5VA 3OGIB 4O2AB 1WP8A 1IBKB 1NR1A 1SC5B 3DC5A 2B9ZA 2GHYA 2FTKA 2WLJA 3BA8A 3VOUA 2ZR2A 1K5SA 3K59A 4X1KB 1V55B 4K8ZA 2IH3C 3N2GB 3THOA 1NTZH 2GV9A 1IX9A 4JI3B 4WFHA 2EJRA 2BTQB 3ZHQA 4FM2A 4BWAA 2Q7EA 2UUCO 5LHIA 3EXAA 2Q73A 1P49A 1WA8A 1K34A 5KMGA 3SR2C 2JDIG 2R72A 4DR3B 4O4JB 5FNVA 3ZHRA 1KUQA 4DR5O 4DV0B 1MMMA 1Y4MA 4QPKA 4BW9A 3RGBA 2HR3A 1F4NA 2CTQA 1JA8A 1QR8A 1HR0O 2OTLV 2YXYA 1YVWA 1BCCH 1B6QA 1IZ3A 4CS3A 4DR2B 1L0NH 3ABLC 4GLXA 1OCRC 4I55A 1K33A 3ZJZA 2KQXA 3K03A 5D5PA 1NI8A 2HVJC 4QE7A 3CC4V 3GWKC 1AI4A 2CH7A 2DYRB 4LF4O 1XQ8A 4NYKA 3SJAC 2BSKB 3SYCA 5EYPA 1YJ9V 1ORQC 1IBKO 3H1JH 2EIMB 3FYIB 2NLJC 5IWAB 1CP9A 5JJNB 4YHHB 2P06A 1O9HA 4BW5A 4RQEA 1NJIW 4H33A 3I5DA 4K0KO 2XAFA 1DK1A 5CA0A 1Y6XA 4DV3B 1AR1B 3HB3B 1R6NA 4JI3O 3DC6A 4O4LB 3DTUB 3TXQA 4JV5B 3STLC 1FPOA 3FB7C 2R70A 1W0KG 4RAIA 1MOFA 2Y69C 2QSAA 4O4HB 4H13B 4YJ2A 1SQGA 3QO5A 3ASOC 1EZJA 5LA6A 2ARHA 1JX9A 1R3IC 5BY1A 2XNDG 2Q9LA 4MTGA 4JI6O 3BEHA 1KP3A 3T1CA 4PDMA 5JVDB 1ENVA 1RM1C 4X1IA 1HW7A 2YDEA 1XREA 3ETDA 5IT9N 3BRCA 2OIGA 3L72H 2BOBC 1EFRG 1KKDA 2KB1A 1MSDA 1Q3EA 2E74B 1N33B 3D3IA 3QVNA 3T1YB 3CRQA 3J81N 3JAKA 3ZMUA 4DV1B 5L3BA 2NN4A 2YC0A 2Q0AA 2OYQA 2QKSA 2N04A 5FPOA 1XDCA 2FMLA 4J7JA 2V4DA 2VS0A 5AG2A 1WA8B 3OTOO 5KMGB 3Q4HA 3BFRA 2A79B 5GTHZ 2UXDO 5FNVB 5KHHA 4MVRA 3RVYA 2XASA 4RUFA 1Q6UA 3K3WA 4F6EA 1MNGA 3OUSA 5L3EA 1K73W 2DYSC 2ZT9B 2K1EA 1K4CC 3RWRD 5B1AB 2XT9A 2NR5A 3NXSA 4JF3A 2OTJV 4EFBA 1SF9A 4PJ0Z 4FMTA 1OCCC 2JK5C 4I9QA 5EBWC 3BABA 4JTAB 5IJ9A 1JR9A 3BHPA 3GVMA 2ZXWB 4WFBV 3ZEDA 4NTYA 1I08A 3X2QC 1N33O 4E4EA 3WB2A 2RDCA 2LW1A 3RYFA 2Y48A 3K5OA 3E83A 2AW9A 3VQWA 2RQ6A 1URFA 3ZRVA 3K5NA 4LCUC 2YIBD 1P7GA 3BVOA 1K7DA 4TQDA 2JVDA 1I5XA 5LMNO 2QM7A 4FK5C 2EINC 4JTCB 1GRJA 4O2BA 1P4RA 4YY3B 3AK3A 3OMNB 1I7FA 4QE9A 3P3NA 4LH6A 4DV6B 1WJZA 3TJTA 1HNXO 1U97A 3BPZA 5EC1C 2P4VA 2L6LA 3A0HZ 3SPJA 2LO1A 3IJ4A 4IGGA 3HKEA 3AG3C 1TUEB 4MVMA 2HFEC 4X1IB 2WPDG 3K9AA 1G1XB 1GM7A 4J7ZA 5DECA 4OX9B 1VQ6V 1LNQA 3ZRWA 4TV8A 1FD9A 1MA1A 1S76D 2HP8A 2ETNA 4UCSA 3SJBC 2Y4UA 4JGSA 1WPXA 4DXWA 1VQMV 3ABUA 5DM6V 4O4IA 4U7NA 3JAKB 3CRMA 1SQPH 3E22A 4JAVA 3I55V 3SYPA 2UXBO 3CRAA 1Q81W 2VWJA 2AGAA 3H9VA 3CMEV 1XILA 1E1QG 3BY6A 3CEIA 1O9GA 4B7EA 2W0XA 3QF7A 4RWUA 1BHAA 2YS8A 4GZRB 4JYYA 2F4VB 5EK0A 2Q69A 3OAAG 2DE0X 3OGCC 3FYEB 2KSDA 4B3TO 2UXNA 4J41A 2CTPA 2ITDC 2K9PA 3CMAV 2P6JA 3Q4HB 4J10A 3OD4A 1UJWB 4YY3O 4A5UB 2L35A 2BE3A 5CB4A 1QLEC 4P2ZA 2CAZC 2X7RB 2Q4PA 1YITV 2QTSA 5H6QA 2ZE5A 1NU1H 1IVSA 5KHIA 1FKAO 3KCYA 1LUWA 3KZIZ 1Q8IA 3R65A 3U10A 4X64B 3ZS8C 4PA3A 4DUZB 3H1HH 1G8MA 4CS2A 1NH2B 1OCOB 1MABG 4L8JA 2EULA 4X65O 2IBZH 5FLXN 1LUVA 2YEVA 1S5HC 4ZKIA 1OCZC 3A0RA 4X66O 4HZ3A 4OX9O 1XHXA 3CC7V 4PA4A 4DV5B 3F7VC 1S0VA 3CCUV 1N34B 4U7OA 5GW7A 1L0LH 1DGSA 3QG5A 3W7TA 3HPLC 2F1MA 5EBMC 4NTWA 5EIBC 4D6TH 3MHSC 3U0ZA 4ICGA 4LF7B 4OGQB 1YCIA 5CMUA 3RW0A 3SPCA 4DR7B 1AJNA 4MTFA 5KHGA 4JAUA 3L9DA 3UQ8A 2Z3YA 1Q90D 5B3SC 1SRYA 4JZ2A 3F7YC 1KECA 3ZX6A 2HHHB 1KBHA 4FFBA 4G28B 5H9CA 1MG1A 1HDJA 4KP4A 2DW4A 1VQPV 3UM7A 4JI8O 4Q20A 5KX5A 5IY5C 3CD6V 3HKEB 1GAXA 2LQTA 1VF6A 2CDYA 1QQCA 1F7YA 3LDCA 1LR1A 1FYJA 1KKCA 2A3QA 3E8GA 4KUMA 2H8PC 5L3CA 2JGUA 3ZRWB 4DUZO 2F66C 4TV8B 4UB6Z 1T5EA 2CE4A 5ITZA 3HKBA 4TUYA 2PF4E 4DV5O 1SQFA 1J5EB 1OHHG 1M56C 1N34O 3IFXA 3CCRV 4O4IB 2AZ0A 3AG7A 1SQQH 4PI2A 2A06H 1Q6HA 2YIDA 1IXBA 3E22B 1BQZA 4WFEA 2M7WA 2YSUB 4Z1VA 3JD4A 4LF7O 1N0NA 4W4LA 1HNWO 5KUMA 2IU0A 2WAMA 3H1KH 2VRZA 3FKSG 4FLVA 4DR7O 1SA0A 2OCCC 1HP8A 2DQ3A 2IW5A 1N32B 1H2LA 1XMOB 1YF2A 3J80N 4QPJA 3T2MA 3BA9A 5H2FZ 1EN5A 1H2GA 3W7WA 4MVUA 2IJKA 4K35A 2P22C 1WP7A 3ABKC 2HHHO 4JI4B 2VQFO 2PI5A 3OW2U 5EIBD 5LOVA 2QEXV 3CRRA 4ZIBA 3JCZA 4FIPC 3WG7B 1VMGA 1PD3A 4ZI7A 1DF4A 4BAYA 4UCVA 4PD4F 4HYOA 1NVPD 3JCUZ 3CYOA 1AP6A 2YEVB 2UUAB 1M93A 4TSFG 2YXHA 3B8NA 3T1HB 4B3MO 1CEZA 1H2NA 4LF5B 2X6AA 4LH7A 4B7KA 4ZOLB 3ASNC 4H0LB 2X6BA 1F4MA 5J9PC 4UVAA 2XOKG 3ZCCA 2BCCH 4DR1B 3WFVA 1ZLZA 4JI7B 4F4LA 2G38A 2Q7HA 3EFFK 1JFFA 5FL7G 2HEPA 3APQA 4GCZA 2P90A 4JPRA 1Q7YW 4OPAA 4D7SA 3C3SA 1DF5A 5C8YB 2PTMA 3QO8A 4FPPA 1GTOA 4JASA 1N32O 2WLNA 1M56B 4FFBB 1ZTEA 1N36O 4IYIA 4LFBO 3PN1A 3SYOA 4P9OA 3SDLA 4LF6O 4LFAO 5KX5B 3FB5C 1QCEA 3UT5A 5BMVA 5JQGA 3BAAA 3N27A 2LFSA 1Q43A 2CGOA 3W7SA 1PL4A 2XAJA 3C90A 2JGDA 4GUNA 4DUYB 5KHJA 3OMIB 5ITZB 5LXTA 3HKBB 3AG1B 4TUYB 3CXCU 4CH5A 3IC9A 2ZINA 2XUMA 3OFNG 3CPWU 4DR1O 3UKMA 2EIKB 3KKYA 4JI7O 3AK1A 4PA9A 2O57A 4J9YB 3E8HA 4FFKA 2ZNIA 4C7UA 4CH6A 4MSWC 1IBLB 4IIJA 1XBLA 2GUZA 2YIBA 1PPJH 4LF8B 1VQ7V 1WB8A 5IYBO 1SA0B 1XNQB 1S5JA 3OE7G 2HLDG 4JYBA 4FLYA 2EILB 5GTIZ 1FFXB 2LW7A 1H2KA 4PA7A 1IBMB 2UXCB 4NXMB 4R8CA 4HNAA 3OM3B 5IJ0A 1W2BU 4IL6Z 2F95B 3LNMB 5LOVB 1H8HG 3W7UA 3CCMV 3SPHA 4EFEA 3D8CA 4DR3O 1QHTA 2EJ7A 3RYHA 4AHCA 4ZI7B 1JJ2U 3N2KA 4D7TA 3JATA 2X6CA 3ZMTA 5IYDO 4N23A 4DV0O 2Q5ZA 3JASA 4H44B 1K5QA 2WLLA 3OUFA 2C2AA 2R9AA 1R3KC 3C3TA 3IC7A 4DUYO 3G67A 3SPIA 1WPBA 5FPRA 5CN0A 3GB7C 4DR2O 4CH4A 4UVBA 3T4ZA 1QR9A 1AJQA 2Q6AA 4I50A 4JI0B 1JFFB 2LGWA 1U96A 3OT7A 4B3SB 1SETA 3L75H 2UXXA 1FXVA 4FM1A 4Z1MG 5IWAO 5E79Z 5L3FA 4UFZA 4YJ3A 4YHHO 1MZFA 5L3GA 2EIJC 4RUEA 1XNQO 2QWOB 5EZYA 1YTFD 1GN3A 3ABLB 2LFRA 3ABMC 1OCRB 4DV3O 1GK9A 4MVQA 4UCOA 1V9PA 1FXKC 2E76B 4JV5O 1RPRA 1VQLV 2OWOA 4NXMO 3A2FA 3L74H 3UT5B 5BMVB 2RNBA 5H6RA 3ZMSA 2IJHA 5JQGB 4HAMA 2GTAA 2D3OW 1RPOA 4CC6A 1BQ0A 1VIBA 3ZRXA 1YEWA 1W0JG 1M5IA 2JGDB 3I56V 1M4UA 1YI2V 5LXTB 2E75B 5A9GA 2ZNJA 1JPXA 4TQFA 1EN6A 2Y69B 4I55B 3RYIA 4CS4A 1GN4A 2JJ1G 2ZM6B 1SQBH 3E89A 1AJPA 2CH7B 3ASOB 1B06A 3S3WA 3T4DA 1ZSPA 1KMIZ 5EYPB 4GKKB 3T1YO 3APOA 1SKVA 2A7WA 1P84F 2GUZB 1R6TA 4JI0O 1RM1B 4DV1O 2HVKC 2H3OA 3CP1A 3VQXA 1Y76A 4ZBMA 5CA0B 2Y0PA 4W4KA 4WBNA 4JI2B 4MVOA 3CJHA 3FB8C 1NS1A 3CB2A 1TUBA 2CTRA 2ZIMA 4HNAB 1XHZA 2ADPA 5IJ0B 3JAWA 2YIAA 1K92A 4DR6B 4YJ2B 1Y66A 3LSQA 3JD3A 3E2EA 4DV7B 1UFIA 3RYHB 5LA6B 2MK3A 3N2KB 1S77D 3DSQA 1Y74A 3AG2C 2JIZG 3LUTB 1F23A 2ZDIA 3VQVA 3JASB 3H01A 3JSNA 2ADQB 4B08A 3G80A 3AG4C 2QM8A 2ZD9A 3QNEA 5LHHA 4YIOA 5CA1A 2DMXA 2FYUH 5TISZ 2PYJA 2FB5A 2JJ2G 2QWQB 1N8RW 1YSCA 2PY5A 5LP6C 1X4TA 1XUQA 1W59A 4I50B 4UVCA 3B09A 1COWG 3AEIA 4FLXA 2DYSB 1EN4A 4ZHQA 1KYOF 4QIWF 3ICXA 3ZHUA 4K8XA
chains in the Genus database with same CATH topology
2ODMA 2GBOA 2NR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODM A;  2GBO A;  2NR5 A; 
#chains in the Genus database with same CATH topology
 4OXS A;  3G6B A;  3P3P A;  4R7C A;  4YJ3 B;  2ZDI C;  1I94 B;  5JCO C;  1OCC B;  3LSS A;  3RYC A;  1S3J A;  1TGO A;  5EZY B;  1QVG U;  1VQ5 V;  1AR4 A;  4L87 A;  2WLH A;  1THZ A;  3TXS A;  2QGN A;  3M7M X;  1L1F A;  3JYC A;  3X2Q B;  1NQT A;  1BT8 A;  5GON A;  2MW2 B;  2ZKO A;  4DV6 O;  2E5L B;  1M57 C;  3MAQ A;  2CTW A;  2XAH A;  4BIO A;  4LBE C;  4R50 A;  2W6I G;  2EIN B;  3MDS A;  5LL6 Y;  1CPY A;  4I5S A;  4TV9 A;  5B1B C;  1PM9 A;  3U11 A;  4BIU A;  1PL0 A;  5A2Q N;  2QA4 V;  3RYI B;  1SES A;  5EBL C;  5IJ9 B;  1AVM A;  2ZR3 A;  4ASU G;  1MZE A;  1GN6 A;  4DR4 B;  3ZRS A;  4EEQ A;  1RP3 B;  3SGI A;  3RFR A;  1YXB A;  2KKW A;  4FVM A;  3RYF B;  4QGP A;  4TWK A;  3BCC H;  4WCE V;  2DQ0 A;  4DYL A;  1NH2 D;  3AG3 B;  4RQF A;  3CCQ V;  3SYQ A;  1TA8 A;  4I7Z B;  4MVZ A;  2RN9 A;  4MW8 A;  1V54 C;  1Y76 B;  3CRC A;  1MSW D;  4GX2 A;  3JAR A;  3MHH C;  4WBN B;  1WNS A;  4JI5 B;  3CJH B;  4O2B B;  4KL1 A;  3QO7 A;  5DED A;  1YIJ V;  2F4V O;  1XL4 A;  4O2A A;  1TUB B;  2IH1 C;  4NB5 A;  3J7A U;  4FLU A;  1PNL A;  4U3F H;  1ZUQ A;  2HKO A;  4MTX A;  1OV9 A;  2QDO A;  4CBC A;  5CBH A;  1YHQ V;  1XL6 A;  3RVZ A;  2A0L A;  3ZBH A;  2VQE B;  2ITC C;  2OCH A;  4JYA B;  1AI6 A;  1Y74 B;  4WFF A;  3D3Q A;  2X0L A;  5B66 Z;  3ETE A;  3FD9 A;  4JYC A;  1M90 W;  3K0D A;  4HBN A;  3HKD A;  4J42 A;  1QVF U;  5IYZ A;  4DV2 B;  2YUA A;  4IT5 A;  1NT2 B;  3ZMZ A;  5LGN A;  4X64 O;  5CA1 B;  2EX3 A;  1BE3 H;  4NTX A;  2V1D A;  3ETQ A;  4O4J A;  1QLE B;  5KUK A;  4GX0 A;  3CCL V;  4ABM A;  3ETG A;  2QKC A;  3M99 B;  2CGN A;  4ZHQ B;  1S72 V;  1V55 C;  3D36 A;  2PYL A;  5H5N A;  2Q68 A;  4LF9 B;  3CSX A;  4JZG A;  3TET A;  4R6Z A;  1KP2 A;  1XEQ A;  1M9N A;  2Q0O C;  1NR7 A;  3SPG A;  3RYC B;  5CBG A;  3OEE G;  1OCZ B;  1Z2G A;  2GTS A;  1S5L Z;  2JRI A;  3CXH F;  2YIC A;  3L70 H;  1QNM A;  5CB4 B;  4I4T A;  4NXN B;  5GON B;  1NZ6 A;  3LNN A;  4GT1 A;  4DRX A;  1KC8 W;  1R3J C;  2PI4 A;  1WAZ A;  5LBQ A;  2VQE O;  3D36 C;  2UUC B;  5JH7 A;  2QWP B;  3KG2 A;  1NVP B;  2UU9 B;  2HJF C;  5B3S B;  1PNM A;  4TV9 B;  4DV2 O;  4U3J A;  4CH3 A;  4DR5 B;  3UO3 A;  3K5L A;  1H2S B;  1A32 A;  5KLV H;  1VQK V;  2DYR C;  2ODM A;  2CK3 G;  3R66 A;  3ZHV A;  2JEU A;  2IU3 A;  2EIM C;  1I0H A;  4UCR A;  5IY5 B;  2V7Q G;  1J5E O;  3FAV A;  2IJI A;  2DWD C;  2P5O A;  4AI8 A;  1YDX A;  2ZE7 A;  3JAR B;  2XAG A;  4OPH A;  1JJO A;  1AR5 A;  1IUR A;  4LF4 B;  4KXR A;  1X59 A;  5D5Q A;  4UV8 A;  3F5T A;  3L71 H;  1XMO O;  3H1L H;  2IJJ A;  1YZB A;  1H38 A;  1BSM A;  1ZAU A;  1PP9 H;  5JJJ B;  3K58 A;  4UXN A;  3TK1 A;  4NXN O;  4K0K B;  3DGE A;  2AZ2 A;  4PEL A;  4JI4 O;  2N74 A;  2GBO A;  3HKD B;  1YJW V;  3K0G A;  1DTO A;  2FKX A;  5IYZ B;  3OR6 C;  3W7X A;  3QTC A;  1VF5 B;  2E3C A;  2OCC B;  4X88 A;  2UU9 O;  5KA5 A;  2Z0A A;  3NR7 A;  1SQX H;  1XMQ B;  3HKC A;  2DOS A;  3WB1 A;  2UUA O;  1E79 G;  2B1I A;  3WU2 Z;  2EZP A;  3RBZ A;  3T1H O;  3OR7 C;  3ABK B;  4LF5 O;  2HG5 C;  4JI6 B;  4JI1 B;  5LHG A;  4DV4 B;  3JD0 A;  1XNR B;  2DJV A;  2A9H A;  1K8A W;  2LGQ A;  1UPG A;  2B1G A;  5CA3 A;  1K4D C;  2ATK C;  1FJG B;  1AI7 A;  4JTD B;  2JS5 A;  4GKJ B;  1VQN V;  1M1K W;  4LWS A;  5C93 A;  4EB6 A;  3ASN B;  4X1Y A;  1Q86 W;  4FLZ A;  2WLI A;  5HFM A;  1RSO A;  1ARO P;  4I4T B;  1D2D A;  4DRX B;  3E8B A;  4MVS A;  1BGY H;  5EC2 C;  3F5W C;  1EZV H;  3CWB H;  1FS0 G;  4FZ1 A;  5JH7 B;  3IAY A;  3OMA B;  5B1A C;  3E86 A;  2N05 A;  2RMK B;  1JOY A;  2DWE C;  3OTO B;  3HR0 A;  1L8D A;  4U3J B;  3LDE A;  2UXD B;  1VF7 A;  4PA6 A;  1D5A A;  4CC5 A;  1XMQ O;  1SER A;  4GYC B;  1VQ9 V;  2ZXW C;  1FAF A;  2H94 A;  1FXK A;  2LP7 A;  1N4C A;  2WSS G;  3ML0 A;  4JI1 O;  4DV4 O;  2QE7 G;  3FAV B;  1VEW A;  5B1N A;  1FFT B;  1XNR O;  4B3R B;  5K1P A;  4QJF B;  4DO2 A;  3K06 A;  4WFG A;  1GMG A;  4LFC B;  2FL4 A;  2QWN B;  5JJE B;  1FJG O;  3O9O A;  1I5Y A;  4J11 A;  1IBL O;  4UUJ C;  2QM4 A;  5F2V O;  3UCS C;  4IHJ A;  4CZZ A;  4LF8 O;  4GKJ O;  2EBO A;  1YTF B;  4DK0 A;  3H1I H;  1N0J A;  3E8F A;  5LYJ A;  1JMK C;  2B5U A;  3B2E E;  1ROP A;  3ABT A;  3CCS V;  5LMN B;  2QJ1 A;  1G6U A;  3ZMV A;  1IBM O;  2UXC O;  1US6 A;  1KU9 A;  1BHB A;  1ZWI C;  4XDL A;  4FLT A;  4I9W A;  3G71 V;  4UV9 A;  1AP5 A;  5DN6 G;  3CC2 V;  2Y0I A;  3B40 A;  2WLM A;  3HKC B;  1HNX B;  1PV0 A;  4XBF A;  4G27 B;  3KCX A;  1AI5 A;  5JWP A;  2PZS A;  3O65 A;  2KG7 A;  1NKD A;  4MS2 A;  2M6Y A;  2P4K A;  2XHB A;  1SQV H;  5KAI Z;  4PDV A;  1K97 A;  2ZIO A;  1NTK H;  2W6J G;  2YXL A;  3SJQ C;  4B3R O;  4I0X A;  1B04 A;  4IIJ B;  4KFM A;  5HFL A;  2DN9 A;  3CCV V;  4F6R A;  4LFC O;  2QTO A;  4B3S O;  4LWS B;  4LNU A;  4EB6 B;  1RFY A;  2Q8V A;  4X1Y B;  2WLI B;  2EZO A;  1KB9 F;  1RSO B;  2CUG A;  4X20 A;  5J2T A;  1XI1 A;  4XDJ A;  1K9M W;  3G6E V;  2UXB B;  2RJZ A;  1CXZ B;  1HNZ B;  5LP6 A;  3ZN0 A;  2ZQM A;  2W0F C;  2Y4T A;  3TGU H;  1JVM A;  5LGU A;  3MD0 A;  4LR3 A;  1R6K A;  3OTF A;  2Q7G A;  4J80 A;  1BL8 A;  3CHX A;  4DK1 A;  4B3T B;  3JAT B;  3CCE V;  4X62 B;  1OCO C;  2D2C B;  2WLK A;  1KQS U;  1EBO A;  5JCO A;  1NBM G;  4UCU A;  1FXH A;  2EIJ B;  2WLL B;  4GX1 A;  1Q6I A;  1J95 A;  3PJS K;  4NR1 A;  3STZ C;  3JD2 A;  4NKG B;  3ABM B;  3K08 A;  3EHB B;  3CX5 F;  4TT3 G;  2AHZ A;  3RN4 A;  1P7B A;  1FXK B;  5J2U A;  2UUB B;  3P32 A;  1GKF A;  1TAE A;  1IDS A;  1GM8 A;  3P30 A;  5KA6 A;  1Q5O A;  4X65 B;  2ZM6 O;  1PKX A;  5BZB A;  4X66 B;  1Y67 A;  4DW1 A;  4J7K A;  4GKK O;  5KHK A;  1VQO V;  2WA4 A;  2LJ2 A;  3CS5 A;  4GX5 A;  2XTA A;  5CBF A;  4MTO A;  2JS3 A;  4IHJ B;  4BIZ A;  2AXT Z;  2OT5 A;  5B1O A;  5LYJ B;  2Z5U A;  3TCU A;  4JI2 O;  2R9R B;  3GWO A;  4TOI A;  4WF9 V;  3UO2 A;  4X89 A;  3DXR A;  1SZT A;  1HNZ O;  2QR4 A;  3JAL A;  2GSM B;  4Q6G A;  1ZL8 A;  4N21 A;  4P9P A;  5IE9 A;  4QNH B;  4DR6 O;  4LC1 A;  4KHP B;  2XAQ A;  1BMF G;  4DV7 O;  3RT3 C;  4X62 O;  4BR6 A;  3B4S A;  1R1B A;  2RCV A;  4PV1 B;  5B5E Z;  3A0B Z;  3ZHT A;  1DLB A;  1F51 A;  4JAA A;  3G4S V;  3LDD A;  4JI8 B;  2R9I A;  4IYH A;  5IYC O;  1TVK A;  1KD1 W;  2KG7 B;  4E2L A;  2UUB O;  2ZCE A;  3K04 A;  3K5M A;  4G2K A;  5KAF Z;  2WWW A;  1GH6 A;  4NVP A;  3AG2 B;  4AIL C;  4I0X B;  4PDR A;  1Q82 W;  5LMU B;  3SYA A;  4F6R B;  3FB6 C;  4DW0 A;  1NTM H;  4LNU B;  4AQY B;  3AG4 B;  2BOC C;  2HJD A;  1OZ0 A;  1WLE A;  1VQ4 V;  4ZOL A;  1QU7 A;  4FLW A;  4X20 B;  1I94 O;  3AK2 A;  4EKW A;  5J2T B;  3VQY A;  5BR8 B;  3A8T A;  2AHY A;  4X8A A;  2QWR B;  5LP6 B;  2PUS A;  2ZE6 A;  4LP8 A;  3VBB A;  4PHZ A;  3WB0 A;  3JAW B;  1HNW B;  1OJH A;  5BXZ A;  2WA3 A;  2P67 A;  4RO2 A;  3WG7 C;  1AB3 A;  1XOU A;  1Z5W A;  2VWK A;  1BS3 A;  3ZIA G;  3ZN1 A;  1IXM A;  4X1K A;  1SS3 A;  3N2G A;  2YI9 A;  3LSU A;  1ZX3 A;  4KHP O;  4Z2W A;  2E5L O;  2ZE8 A;  3K57 A;  5C8Y A;  2BTQ A;  1GO3 F;  4WFA V;  2VQF B;  2IM9 A;  4UCT A;  2QKA A;  1VAR A;  5J2U B;  2F43 G;  1WN7 A;  1H2M A;  3JD1 A;  4DR4 O;  5K1X A;  1M57 B;  3FX7 A;  2ILM A;  4B3M B;  3K9S A;  1G4Y B;  3FFQ A;  4K3A A;  4PI0 A;  3CE2 A;  1R3L C;  5LMU O;  1AIL A;  2NNU A;  3E35 A;  5B1B B;  4AQY O;  1VQ8 V;  3CCJ V;  4JI5 O;  1R73 A;  4FZ0 A;  4FM0 A;  2F93 B;  5BR8 O;  3DXR B;  2BSK A;  3JAL B;  1ZL8 B;  5LGT A;  1PNK A;  2GDS A;  4YXW G;  1VF6 C;  4MW3 A;  1GM9 A;  3M8A A;  1VP7 A;  4FJC C;  4JYA O;  1V54 B;  4P30 A;  1N36 B;  3EVK A;  4LFB B;  1FFX A;  1B3Q A;  4O4L A;  3S3X A;  3IGA C;  3L73 H;  2OIE A;  3AG1 C;  1D5N A;  3OEH G;  4LF6 B;  3JSL A;  1JCH A;  4LFA B;  4UB8 Z;  2P7T C;  1TVK B;  1K3E A;  2YI8 A;  1H8E G;  1JQ0 A;  4X9Q A;  2F23 A;  2Q67 A;  4O4H A;  3JAM N;  1WB7 A;  1YJN V;  4MT8 A;  1GN2 A;  5IDJ A;  3B8M A;  1SZX A;  4YIP A;  1EM1 A;  2EIK C;  2JEX A;  1HR0 B;  4H37 A;  3B77 A;  3ZHS A;  3SJC C;  2BTO A;  2PGG A;  4J9Z B;  1E1R G;  5JVD A;  1HWY A;  4PDL A;  5L3D A;  4LF9 O;  1QBZ A;  1QLN A;  5E1A C;  2EIL C;  1BZK A;  4XDK A;  3K79 A;  1Z5V A;  3OGI B;  4O2A B;  1WP8 A;  1IBK B;  1NR1 A;  1SC5 B;  3DC5 A;  2B9Z A;  2GHY A;  2FTK A;  2WLJ A;  3BA8 A;  3VOU A;  2ZR2 A;  1K5S A;  3K59 A;  4X1K B;  1V55 B;  4K8Z A;  2IH3 C;  3N2G B;  3THO A;  1NTZ H;  2GV9 A;  1IX9 A;  4JI3 B;  4WFH A;  2EJR A;  2BTQ B;  3ZHQ A;  4FM2 A;  4BWA A;  2Q7E A;  2UUC O;  5LHI A;  3EXA A;  2Q73 A;  1P49 A;  1WA8 A;  1K34 A;  5KMG A;  3SR2 C;  2JDI G;  2R72 A;  4DR3 B;  4O4J B;  5FNV A;  3ZHR A;  1KUQ A;  4DR5 O;  4DV0 B;  1MMM A;  1Y4M A;  4QPK A;  4BW9 A;  3RGB A;  2HR3 A;  1F4N A;  2CTQ A;  1JA8 A;  1QR8 A;  1HR0 O;  2OTL V;  2YXY A;  1YVW A;  1BCC H;  1B6Q A;  1IZ3 A;  4CS3 A;  4DR2 B;  1L0N H;  3ABL C;  4GLX A;  1OCR C;  4I55 A;  1K33 A;  3ZJZ A;  2KQX A;  3K03 A;  5D5P A;  1NI8 A;  2HVJ C;  4QE7 A;  3CC4 V;  3GWK C;  1AI4 A;  2CH7 A;  2DYR B;  4LF4 O;  1XQ8 A;  4NYK A;  3SJA C;  2BSK B;  3SYC A;  5EYP A;  1YJ9 V;  1ORQ C;  1IBK O;  3H1J H;  2EIM B;  3FYI B;  2NLJ C;  5IWA B;  1CP9 A;  5JJN B;  4YHH B;  2P06 A;  1O9H A;  4BW5 A;  4RQE A;  1NJI W;  4H33 A;  3I5D A;  4K0K O;  2XAF A;  1DK1 A;  5CA0 A;  1Y6X A;  4DV3 B;  1AR1 B;  3HB3 B;  1R6N A;  4JI3 O;  3DC6 A;  4O4L B;  3DTU B;  3TXQ A;  4JV5 B;  3STL C;  1FPO A;  3FB7 C;  2R70 A;  1W0K G;  4RAI A;  1MOF A;  2Y69 C;  2QSA A;  4O4H B;  4H13 B;  4YJ2 A;  1SQG A;  3QO5 A;  3ASO C;  1EZJ A;  5LA6 A;  2ARH A;  1JX9 A;  1R3I C;  5BY1 A;  2XND G;  2Q9L A;  4MTG A;  4JI6 O;  3BEH A;  1KP3 A;  3T1C A;  4PDM A;  5JVD B;  1ENV A;  1RM1 C;  4X1I A;  1HW7 A;  2YDE A;  1XRE A;  3ETD A;  5IT9 N;  3BRC A;  2OIG A;  3L72 H;  2BOB C;  1EFR G;  1KKD A;  2KB1 A;  1MSD A;  1Q3E A;  2E74 B;  1N33 B;  3D3I A;  3QVN A;  3T1Y B;  3CRQ A;  3J81 N;  3JAK A;  3ZMU A;  4DV1 B;  5L3B A;  2NN4 A;  2YC0 A;  2Q0A A;  2OYQ A;  2QKS A;  2N04 A;  5FPO A;  1XDC A;  2FML A;  4J7J A;  2V4D A;  2VS0 A;  5AG2 A;  1WA8 B;  3OTO O;  5KMG B;  3Q4H A;  3BFR A;  2A79 B;  5GTH Z;  2UXD O;  5FNV B;  5KHH A;  4MVR A;  3RVY A;  2XAS A;  4RUF A;  1Q6U A;  3K3W A;  4F6E A;  1MNG A;  3OUS A;  5L3E A;  1K73 W;  2DYS C;  2ZT9 B;  2K1E A;  1K4C C;  3RWR D;  5B1A B;  2XT9 A;  2NR5 A;  3NXS A;  4JF3 A;  2OTJ V;  4EFB A;  1SF9 A;  4PJ0 Z;  4FMT A;  1OCC C;  2JK5 C;  4I9Q A;  5EBW C;  3BAB A;  4JTA B;  5IJ9 A;  1JR9 A;  3BHP A;  3GVM A;  2ZXW B;  4WFB V;  3ZED A;  4NTY A;  1I08 A;  3X2Q C;  1N33 O;  4E4E A;  3WB2 A;  2RDC A;  2LW1 A;  3RYF A;  2Y48 A;  3K5O A;  3E83 A;  2AW9 A;  3VQW A;  2RQ6 A;  1URF A;  3ZRV A;  3K5N A;  4LCU C;  2YIB D;  1P7G A;  3BVO A;  1K7D A;  4TQD A;  2JVD A;  1I5X A;  5LMN O;  2QM7 A;  4FK5 C;  2EIN C;  4JTC B;  1GRJ A;  4O2B A;  1P4R A;  4YY3 B;  3AK3 A;  3OMN B;  1I7F A;  4QE9 A;  3P3N A;  4LH6 A;  4DV6 B;  1WJZ A;  3TJT A;  1HNX O;  1U97 A;  3BPZ A;  5EC1 C;  2P4V A;  2L6L A;  3A0H Z;  3SPJ A;  2LO1 A;  3IJ4 A;  4IGG A;  3HKE A;  3AG3 C;  1TUE B;  4MVM A;  2HFE C;  4X1I B;  2WPD G;  3K9A A;  1G1X B;  1GM7 A;  4J7Z A;  5DEC A;  4OX9 B;  1VQ6 V;  1LNQ A;  3ZRW A;  4TV8 A;  1FD9 A;  1MA1 A;  1S76 D;  2HP8 A;  2ETN A;  4UCS A;  3SJB C;  2Y4U A;  4JGS A;  1WPX A;  4DXW A;  1VQM V;  3ABU A;  5DM6 V;  4O4I A;  4U7N A;  3JAK B;  3CRM A;  1SQP H;  3E22 A;  4JAV A;  3I55 V;  3SYP A;  2UXB O;  3CRA A;  1Q81 W;  2VWJ A;  2AGA A;  3H9V A;  3CME V;  1XIL A;  1E1Q G;  3BY6 A;  3CEI A;  1O9G A;  4B7E A;  2W0X A;  3QF7 A;  4RWU A;  1BHA A;  2YS8 A;  4GZR B;  4JYY A;  2F4V B;  5EK0 A;  2Q69 A;  3OAA G;  2DE0 X;  3OGC C;  3FYE B;  2KSD A;  4B3T O;  2UXN A;  4J41 A;  2CTP A;  2ITD C;  2K9P A;  3CMA V;  2P6J A;  3Q4H B;  4J10 A;  3OD4 A;  1UJW B;  4YY3 O;  4A5U B;  2L35 A;  2BE3 A;  5CB4 A;  1QLE C;  4P2Z A;  2CAZ C;  2X7R B;  2Q4P A;  1YIT V;  2QTS A;  5H6Q A;  2ZE5 A;  1NU1 H;  1IVS A;  5KHI A;  1FKA O;  3KCY A;  1LUW A;  3KZI Z;  1Q8I A;  3R65 A;  3U10 A;  4X64 B;  3ZS8 C;  4PA3 A;  4DUZ B;  3H1H H;  1G8M A;  4CS2 A;  1NH2 B;  1OCO B;  1MAB G;  4L8J A;  2EUL A;  4X65 O;  2IBZ H;  5FLX N;  1LUV A;  2YEV A;  1S5H C;  4ZKI A;  1OCZ C;  3A0R A;  4X66 O;  4HZ3 A;  4OX9 O;  1XHX A;  3CC7 V;  4PA4 A;  4DV5 B;  3F7V C;  1S0V A;  3CCU V;  1N34 B;  4U7O A;  5GW7 A;  1L0L H;  1DGS A;  3QG5 A;  3W7T A;  3HPL C;  2F1M A;  5EBM C;  4NTW A;  5EIB C;  4D6T H;  3MHS C;  3U0Z A;  4ICG A;  4LF7 B;  4OGQ B;  1YCI A;  5CMU A;  3RW0 A;  3SPC A;  4DR7 B;  1AJN A;  4MTF A;  5KHG A;  4JAU A;  3L9D A;  3UQ8 A;  2Z3Y A;  1Q90 D;  5B3S C;  1SRY A;  4JZ2 A;  3F7Y C;  1KEC A;  3ZX6 A;  2HHH B;  1KBH A;  4FFB A;  4G28 B;  5H9C A;  1MG1 A;  1HDJ A;  4KP4 A;  2DW4 A;  1VQP V;  3UM7 A;  4JI8 O;  4Q20 A;  5KX5 A;  5IY5 C;  3CD6 V;  3HKE B;  1GAX A;  2LQT A;  1VF6 A;  2CDY A;  1QQC A;  1F7Y A;  3LDC A;  1LR1 A;  1FYJ A;  1KKC A;  2A3Q A;  3E8G A;  4KUM A;  2H8P C;  5L3C A;  2JGU A;  3ZRW B;  4DUZ O;  2F66 C;  4TV8 B;  4UB6 Z;  1T5E A;  2CE4 A;  5ITZ A;  3HKB A;  4TUY A;  2PF4 E;  4DV5 O;  1SQF A;  1J5E B;  1OHH G;  1M56 C;  1N34 O;  3IFX A;  3CCR V;  4O4I B;  2AZ0 A;  3AG7 A;  1SQQ H;  4PI2 A;  2A06 H;  1Q6H A;  2YID A;  1IXB A;  3E22 B;  1BQZ A;  4WFE A;  2M7W A;  2YSU B;  4Z1V A;  3JD4 A;  4LF7 O;  1N0N A;  4W4L A;  1HNW O;  5KUM A;  2IU0 A;  2WAM A;  3H1K H;  2VRZ A;  3FKS G;  4FLV A;  4DR7 O;  1SA0 A;  2OCC C;  1HP8 A;  2DQ3 A;  2IW5 A;  1N32 B;  1H2L A;  1XMO B;  1YF2 A;  3J80 N;  4QPJ A;  3T2M A;  3BA9 A;  5H2F Z;  1EN5 A;  1H2G A;  3W7W A;  4MVU A;  2IJK A;  4K35 A;  2P22 C;  1WP7 A;  3ABK C;  2HHH O;  4JI4 B;  2VQF O;  2PI5 A;  3OW2 U;  5EIB D;  5LOV A;  2QEX V;  3CRR A;  4ZIB A;  3JCZ A;  4FIP C;  3WG7 B;  1VMG A;  1PD3 A;  4ZI7 A;  1DF4 A;  4BAY A;  4UCV A;  4PD4 F;  4HYO A;  1NVP D;  3JCU Z;  3CYO A;  1AP6 A;  2YEV B;  2UUA B;  1M93 A;  4TSF G;  2YXH A;  3B8N A;  3T1H B;  4B3M O;  1CEZ A;  1H2N A;  4LF5 B;  2X6A A;  4LH7 A;  4B7K A;  4ZOL B;  3ASN C;  4H0L B;  2X6B A;  1F4M A;  5J9P C;  4UVA A;  2XOK G;  3ZCC A;  2BCC H;  4DR1 B;  3WFV A;  1ZLZ A;  4JI7 B;  4F4L A;  2G38 A;  2Q7H A;  3EFF K;  1JFF A;  5FL7 G;  2HEP A;  3APQ A;  4GCZ A;  2P90 A;  4JPR A;  1Q7Y W;  4OPA A;  4D7S A;  3C3S A;  1DF5 A;  5C8Y B;  2PTM A;  3QO8 A;  4FPP A;  1GTO A;  4JAS A;  1N32 O;  2WLN A;  1M56 B;  4FFB B;  1ZTE A;  1N36 O;  4IYI A;  4LFB O;  3PN1 A;  3SYO A;  4P9O A;  3SDL A;  4LF6 O;  4LFA O;  5KX5 B;  3FB5 C;  1QCE A;  3UT5 A;  5BMV A;  5JQG A;  3BAA A;  3N27 A;  2LFS A;  1Q43 A;  2CGO A;  3W7S A;  1PL4 A;  2XAJ A;  3C90 A;  2JGD A;  4GUN A;  4DUY B;  5KHJ A;  3OMI B;  5ITZ B;  5LXT A;  3HKB B;  3AG1 B;  4TUY B;  3CXC U;  4CH5 A;  3IC9 A;  2ZIN A;  2XUM A;  3OFN G;  3CPW U;  4DR1 O;  3UKM A;  2EIK B;  3KKY A;  4JI7 O;  3AK1 A;  4PA9 A;  2O57 A;  4J9Y B;  3E8H A;  4FFK A;  2ZNI A;  4C7U A;  4CH6 A;  4MSW C;  1IBL B;  4IIJ A;  1XBL A;  2GUZ A;  2YIB A;  1PPJ H;  4LF8 B;  1VQ7 V;  1WB8 A;  5IYB O;  1SA0 B;  1XNQ B;  1S5J A;  3OE7 G;  2HLD G;  4JYB A;  4FLY A;  2EIL B;  5GTI Z;  1FFX B;  2LW7 A;  1H2K A;  4PA7 A;  1IBM B;  2UXC B;  4NXM B;  4R8C A;  4HNA A;  3OM3 B;  5IJ0 A;  1W2B U;  4IL6 Z;  2F95 B;  3LNM B;  5LOV B;  1H8H G;  3W7U A;  3CCM V;  3SPH A;  4EFE A;  3D8C A;  4DR3 O;  1QHT A;  2EJ7 A;  3RYH A;  4AHC A;  4ZI7 B;  1JJ2 U;  3N2K A;  4D7T A;  3JAT A;  2X6C A;  3ZMT A;  5IYD O;  4N23 A;  4DV0 O;  2Q5Z A;  3JAS A;  4H44 B;  1K5Q A;  2WLL A;  3OUF A;  2C2A A;  2R9A A;  1R3K C;  3C3T A;  3IC7 A;  4DUY O;  3G67 A;  3SPI A;  1WPB A;  5FPR A;  5CN0 A;  3GB7 C;  4DR2 O;  4CH4 A;  4UVB A;  3T4Z A;  1QR9 A;  1AJQ A;  2Q6A A;  4I50 A;  4JI0 B;  1JFF B;  2LGW A;  1U96 A;  3OT7 A;  4B3S B;  1SET A;  3L75 H;  2UXX A;  1FXV A;  4FM1 A;  4Z1M G;  5IWA O;  5E79 Z;  5L3F A;  4UFZ A;  4YJ3 A;  4YHH O;  1MZF A;  5L3G A;  2EIJ C;  4RUE A;  1XNQ O;  2QWO B;  5EZY A;  1YTF D;  1GN3 A;  3ABL B;  2LFR A;  3ABM C;  1OCR B;  4DV3 O;  1GK9 A;  4MVQ A;  4UCO A;  1V9P A;  1FXK C;  2E76 B;  4JV5 O;  1RPR A;  1VQL V;  2OWO A;  4NXM O;  3A2F A;  3L74 H;  3UT5 B;  5BMV B;  2RNB A;  5H6R A;  3ZMS A;  2IJH A;  5JQG B;  4HAM A;  2GTA A;  2D3O W;  1RPO A;  4CC6 A;  1BQ0 A;  1VIB A;  3ZRX A;  1YEW A;  1W0J G;  1M5I A;  2JGD B;  3I56 V;  1M4U A;  1YI2 V;  5LXT B;  2E75 B;  5A9G A;  2ZNJ A;  1JPX A;  4TQF A;  1EN6 A;  2Y69 B;  4I55 B;  3RYI A;  4CS4 A;  1GN4 A;  2JJ1 G;  2ZM6 B;  1SQB H;  3E89 A;  1AJP A;  2CH7 B;  3ASO B;  1B06 A;  3S3W A;  3T4D A;  1ZSP A;  1KMI Z;  5EYP B;  4GKK B;  3T1Y O;  3APO A;  1SKV A;  2A7W A;  1P84 F;  2GUZ B;  1R6T A;  4JI0 O;  1RM1 B;  4DV1 O;  2HVK C;  2H3O A;  3CP1 A;  3VQX A;  1Y76 A;  4ZBM A;  5CA0 B;  2Y0P A;  4W4K A;  4WBN A;  4JI2 B;  4MVO A;  3CJH A;  3FB8 C;  1NS1 A;  3CB2 A;  1TUB A;  2CTR A;  2ZIM A;  4HNA B;  1XHZ A;  2ADP A;  5IJ0 B;  3JAW A;  2YIA A;  1K92 A;  4DR6 B;  4YJ2 B;  1Y66 A;  3LSQ A;  3JD3 A;  3E2E A;  4DV7 B;  1UFI A;  3RYH B;  5LA6 B;  2MK3 A;  3N2K B;  1S77 D;  3DSQ A;  1Y74 A;  3AG2 C;  2JIZ G;  3LUT B;  1F23 A;  2ZDI A;  3VQV A;  3JAS B;  3H01 A;  3JSN A;  2ADQ B;  4B08 A;  3G80 A;  3AG4 C;  2QM8 A;  2ZD9 A;  3QNE A;  5LHH A;  4YIO A;  5CA1 A;  2DMX A;  2FYU H;  5TIS Z;  2PYJ A;  2FB5 A;  2JJ2 G;  2QWQ B;  1N8R W;  1YSC A;  2PY5 A;  5LP6 C;  1X4T A;  1XUQ A;  1W59 A;  4I50 B;  4UVC A;  3B09 A;  1COW G;  3AEI A;  4FLX A;  2DYS B;  1EN4 A;  4ZHQ A;  1KYO F;  4QIW F;  3ICX A;  3ZHU A;  4K8X A; 
#chains in the Genus database with same CATH homology
 2ODM A;  2GBO A;  2NR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...