2NR6C

Crystal structure of the complex of antibody and the allergen bla g 2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQIVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYNSPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartic protease Bla g 2
publication title Crystal structure of a dimerized cockroach allergen Bla g 2 complexed with a monoclonal antibody.
pubmed doi rcsb
source organism Blattella germanica
molecule tags Hydrolase/immune system
total genus 44
structure length 211
sequence length 211
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nr6C01
2VXTH 1CDJA 3DX9B 2VISB 2W0KA 3DETC 1NGZB 5HYJD 3T2NL 4LFHG 2QKIA 3HR6A 3B43A 1EPFA 1RY7B 1CU4H 1G6RH 1G9ML 2E8YA 1BGXH 3B2UD 1E4XH 1MCLA 5EOTB 4JO4H 4TSCL 1X5IA 2DWDA 1LO5A 4ZFFB 5J4MA 4WHYH 5DQDL 3T0BA 1GH7A 1G0YR 4MSWA 2NYYC 3HNSH 3MJ9H 4MGXA 5KSAB 1HSBA 2WUCH 3QEQD 3MRLB 5FYKH 3ARGA 1UT9A 4HK0A 5I8EB 4S1QL 2IH3A 4LAJH 4YK4B 1N8ZA 1OPGL 4ZMAT 4ZSOA 3WFHA 1MUJB 1R3JA 2X70B 1F4WL 4X9HA 4ZS6C 2CDGA 3GB7A 3QCUL 4TTDD 2P47B 2C3HA 3QIUD 1PG7W 5DFWH 4HH9A 1INEH 4FP8L 2ADFH 2P4AB 3B5TA 5HYJB 1A9BA 5E94B 1PSKH 3BEVB 3HG1E 3CFEB 4MD5A 5DJ8A 4TUKL 5EULV 4W81A 4QNPE 5D1ZC 3D9AH 5HI5C 1U92A 4Y2DD 1M7IA 4ZD3L 1UA6H 1KLGB 1Y6NR 1KJMB 5CMAA 2VR4A 3M8OH 3MV01 4JFHD 4YHMH 2ZG3A 1YQ2A 1SVCP 2OZ4A 3VA2C 3LQAC 3FFDB 5H37H 2F8VA 4ISVA 1J05B 4AK1A 1OSPH 2Y7QB 3D3VD 3SY0A 1EIBA 5DUBA 5T3ZH 3S36H 4MXWH 4J12A 4H25B 4G8EA 2VISA 5MERB 4DGIH 1I1FA 3QEQB 1KPUA 1OAQH 4Z7VF 2J4WL 3ULUD 3EW3B 4WI3A 1YY8A 3RVXD 2FLRT 4RAVA 2R9HC 3GKZA 3UPRB 2W1NA 3QIUB 2DTML 4NO3B 4PB9L 4PJBE 1J88A 1I85C 4GLRI 3JBG7 3JWDH 4WI4A 1NLDH 4PJIE 3QIBC 1FZOB 2DM7A 2FYYB 5ADOH 1RZJH 4TSBL 1A1OB 4DGYH 4KQ4L 4P4KA 2EZ0D 4Y19A 3SO3B 4MQXD 4NJ9L 1W72L 2WBJD 3OJ2C 4LKXB 4Y2DB 5DK2A 3QQNA 4ZUTA 2JJWA 1R24B 2Y06H 4JZNA 5BV7L 1U58B 1FO0H 4HUNB 4X4ZA 1XF3B 3PWVB 2C26A 1MUJA 3PGFL 3D3VB 4J2XA 5DHYA 4K7FB 3V7AE 1ZANH 3T1FB 2CR3A 3MGOB 4DFHA 4ZTPL 3G6JE 3TIEB 3SCMA 1AHWB 4LCCA 1FVDB 2IPKB 1NFKA 4AMKH 3KPSE 3QIWC 3LKSA 5F3HB 1CXLA 1ZWIA 2OSLA 2GTWB 4ONFH 4P59H 3TH4T 3U2SB 3CFEA 5KG9A 4R90H 3BP6B 4MB4A 3TYFB 1I1AC 1MH5B 2EDNA 1T5XA 5IJKC 3PUCA 5AZEH 5CKAA 1MCQA 4G8FA 4XWGH 1OP3H 3P0YL 5SWSE 3V6ZA 1Q1JH 1XF1A 1JPTL 4Z7UA 4DKEH 1KACB 2YPLE 3U7YH 3OKNA 1J05A 2D9QB 4L8CB 3SE4A 2Y7QA 1ZT1B 2DDQH 5CJXC 4XTRD 2WBJB 4OLXL 4BK4A 5C6TH 5KSUB 2R0LH 4LLUB 1XGQA 2A6JA 1ZHBB 1UH4A 3TT1L 3TNNB 4GG8B 2BHUA 4DJMA 2HKFH 1IGTB 3T08A 3P40A 3VXTB 1CL7L 3MC0A 4NN6C 1RULL 1SJVA 4KDVA 4WHDA 1A6AA 1N5YH 1KC5L 3K4AA 1NGXB 4HGMA 5CEZD 2GFBA 5DS8B 5D72L 2LU3A 3B2VH 1A1OA 1P9MA 2ICWB 5EC1B 4TYUA 4OFVA 3OAUH 2Y36H 1CGSL 3PHOA 3GSUB 1MCEA 1R24A 4MCZA 5D96B 1U58A 5D5MB 3OPZL 2GYSA 2W92A 5C0BE 2DL9A 1T6VN 2OTUA 4ODVL 2I9TB 1MSPA 3IDIA 4JE4B 4BQ6A 1EHNA 1R5VB 2F9BT 3T1FA 1MCBA 2BRRH 4WUKH 1EVUA 5E6ZA 5TF0A 3VDAA 3TIEA 1OLZA 4ZUSB 3S9DB 1FVDA 3I6LD 1WEJH 4N0CD 1WZKA 4JKMA 4HUWA 4JN2B 2VZUA 3ARDD 3DSNA 4J3SA 3SJVA 3QEGH 1OB1A 2RQ8A 4LLQA 4PJGB 1BD2D 4XP9H 4P9MH 4Y5VA 4LU5L 2HVJB 3T09A 3QI9C 1BQLL 5F72S 1I8LA 1B6DA 4KK6D 2GSIB 1QHOA 3AB0C 4JFPA 4NQEE 3LY6A 1RUML 2WBJA 4U7KA 1RI8A 4FQIH 4OLUL 2DQTL 2F19L 3N1QC 3ZE2F 5KANG 1NCAL 1S7UB 2B5IB 4GG8A 5CINH 3TNNA 5JNYB 2C3VB 1ZT4B 2A74B 1WIUA 4NWUH 3GMOB 1FL3B 2FECL 5CD3B 2VDPL 1KCVH 3VXTA 5DXWA 4Z7WB 1DQDL 5K33A 3P3YA 4PGBA 3G5YB 4GSDH 2EDHA 1KENL 5C0RL 1FVCB 3PJSA 1XF5A 2Q7NA 3WNNA 2EIZB 2MPAL 4JY6B 5DS8A 4ZOCA 1ORQA 4U1NB 3FQNB 3TBYB 5EU6B 3ARDB 2ICWA 2DBLH 3MUGA 3REVB 3NFNA 4JHAH 1BD2B 3RL1B 3QUZC 4GKSB 3ZDYF 3GSUA 3LB6D 5DLML 1G9NL 1ZHLB 3EOAB 1MLBB 1I8IB 4X99B 4F57H 3QUKB 1U8HA 3VWJD 3HFML 2D4FA 4P2QD 3Q3GB 2I9TA 4XZUA 3OKEB 3WFEL 1JFQL 3NCYS 1XF2A 4OT1L 4HUVB 2EH7L 2OQJB 2JB5L 4FQ2H 2NZIA 3EYFA 5I1KH 1MPAL 1A6ZA 1MIMH 3R4DA 5AG9A 1Q0YH 5JW5A 1NAML 2R15A 3HUJA 3VG0L 5GSRA 2HT4C 1WFNA 5F88B 4JN2A 4PJCA 1A7BA 4HJ0C 2H2SD 4HXAH 4N1HB 4KK8C 2DQUL 4ALAL 2EE3A 2ZWLT 4PY7B 1Y18B 3OL2A 4YPGB 3IETA 2D0HA 5HHVL 4E41D 2RIKA 5E2WL 5BRZD 5D7LE 4YDLC 3MCLH 4ZS7H 3HAEH 1OLLA 1IGYA 4B7LA 2GSIA 2C3WA 1NFDF 3LHPH 3E6HB 2VLKA 4NC2B 1RZKC 5E56A 1NBQA 4I3GA 4PRNB 4XBGB 3VI3F 2ICES 3BKJL 1LEKB 3IVKA 5FCUL 4BH7B 1GZQB 1IC7H 1OAKH 1ZT4A 2A74A 3PL6B 3GMOA 3VWJB 4P2QB 5CD3A 1JTOA 5J1AA 1VACB 2NW2B 1JMXA 3ZKNC 1A1NA 3NCBB 3DHJA 1VKXB 4I2XA 2ZUTA 3CGTA 2YZ1A 4PREB 5CEYB 5CD5C 1WLHA 1MI5D 1UXSA 2EIZA 1WSST 3MRNB 3BYTA 2EE2A 3CU7A 2YD7A 2BVYA 3B9KA 4P46D 3VGHA 3ARDA 4XC1L 3STLB 4Y5XC 4PG9A 3REVA 1ZHKA 2VQTA 4RFEA 2PETA 1BD2A 3RL1A 4JM2F 5J12C 4GKSA 1QSVA 3ZKXB 4E41B 1R3LA 2YPVH 1ZHLA 2YA1A 2M26A 5LGHL 3WFDL 3QDMA 4X98B 4C56D 2NNAA 3SDDC 4FQQB 1S7RB 4NFCA 1TCMA 3LV3B 1A5FL 1XT5A 2A77H 2IG2H 4Z18A 4L4TD 3UAJD 1E6JL 4MA8H 3NIDF 4FFWD 2OP4L 2UY7A 4G6KL 4K2UL 4LSUL 3RKPA 3HC0B 5JW4N 2PTUA 5GHWH 1EGJA 2J3SA 2ZCHH 5DR5L 3WJLC 3LEVL 4UQ2B 5EZOL 4K94C 4M7LT 2A0LC 4HIHA 4PY8I 2GAZB 1RZ8B 4HIEB 4YX2H 1I7UA 2WIIB 4PY7A 1QBML 2X1WL 2OL3B 1YNTB 2P5WE 4I9WD 3FO0L 1DE4A 5DDHA 3GMQA 2Y23A 4P46B 2F53B 4X6BA 4IJ3C 1RUKL 2R56L 3MRKB 4S1RH 4Y0GA 1KIRB 3O0RH 3TPUB 4OV6F 1JPFB 4PJDF 1YA5A 3RBGA 2FGWH 1UM5L 5JMOC 1A64A 2D9CA 3OKOB 3JTTB 4L4TB 3O45B 3QCTL 2NW2A 2FHCA 4MJ6B 3MNZA 2WBKA 2DOCA 4Z7QE 1KJ2L 2EIEA 4FTVE 1QBLH 1BEYL 3EZ8A 1PEZA 5C86A 5CEYA 2EDQA 3LKRB 2HRPH 3MRNA 4QHNA 2VLME 3BGMA 2WK2A 3N1GC 3HAEG 2DJUA 4BA8A 3DURA 3RWCB 3STLA 1OP5K 4EDWH 5B3JF 4GBXD 4JG0H 2ZP0T 5T3XE 5BRZA 4X98A 5DJ6B 1S7RA 3MRBA 4XNZB 1AGFA 4M5ZH 1KN4H 4LLVB 1OVZA 4G9FA 4WU7B 4Q58C 4LLAA 1UWGH 3VMPA 4M1CC 3FZUD 4XVTL 2AJVL 3HC0A 4KAQH 4Q97A 4PGEB 2EDRA 4JJ5B 3BQUC 4JDZB 1X44A 1GPOL 2UYLA 4LDEB 5DHVH 4BZ2H 1EO8H 3TC9A 2VXUL 3BPNB 5E9DE 3P4OA 3P30H 4LVOB 2WIIA 4YNYB 1JPSL 5J3HD 3LEXA 1MNUL 4JHBA 4KY1L 1K3ZA 3A6CH 4KJPD 4LMQE 1MI5A 1G7MA 3IYLW 1PX4A 4XXCC 4DTGH 1DBJH 5FUZH 2V5SA 1D5BB 4PRBA 4U1KA 5LG1A 4GBXB 4OLYH 3SGKC 1AI1L 1JRHL 2ZOLA 3TPUA 2GJ6E 5F1NA 5FV1L 1JPFA 2H32H 3A6OA 4NUGH 4C56A 1KG0A 2QHRL 2QQLL 2X4SA 2YD8A 3BFOA 1I9EA 5HI3D 1E28A 4CRPA 1MFAH 3QEUA 1YPZB 2FD6H 5IM7B 5FB8A 1PAMA 1G7PB 4YBLB 5EBLB 1JGLH 1GIGH 3SE8L 3LKRA 1AR2A 4OLZH 4UB0L 4OQTA 3PGDB 2VDRH 3RWCA 1AD9A 3KJ6H 5IKCB 2CUHA 3HE6D 5CBAA 1VEOA 4WO4D 4ZAKB 1OM3H 1DL7H 3RIFF 2OX5A 3RWHB 3VD4A 5ETUB 2BHZA 4YO0B 3KYOA 3H9ZA 1N7ML 2DLGA 4LLVA 5F1KC 2N1KA 5IVXF 2P45B 4NBXB 1SBSH 4P3CH 3RP1A 4TRPH 1KCUH 2AERT 1X4XA 3LN5A 4PLJD 2J8UE 2ICCA 3LKOB 5F7LB 4UTAL 1BAFL 4JPIA 4PGEA 2R4RH 2AK1L 4JJ5A 4S1DD 4YUEH 4A6YH 4DEPB 4YXKL 5C07E 4R26H 3GJFH 3EHBC 3L5HA 3HC3H 2OR9L 1Y0LB 5C9JB 1OAZH 1DBMH 3S37H 5KSVB 4GW1B 5IHZB 5IIEB 9CGTA 1J8HE 2NY6D 2XZAH 4GLRH 1FNEA 3OJVC 3QZWA 2QJDA 3RGHA 3RBSA 3PG2A 4M9OA 3MRCB 3Q2CA 35C8H 1UCBL 3OAZK 4GBXA 1CN4A 1RJYB 3HE6B 3ZL4H 3WXVL 2LU4A 3D5OF 3RL2A 1K9TA 3MLVL 1WBZB 5L6YH 4APQD 4TUJB 3O2WL 1A7PL 4ZXBC 4AJ0A 2A73B 2DB8A 3DIFB 1YPZA 2V9TA 4P48A 5IM7A 2JELL 4JFDA 3RPKA 3C9NA 2NY5H 2Z8SA 2V5RA 1MWAA 5FYJU 3FQUB 4X5WB 3V2AR 4I0PB 4LNRB 4CMMB 4HEME 1VB9A 2VXSL 4K7PH 3BN9C 5E2VH 3JTSB 1TCRB 3WYRA 5GGQH 4R2GD 1KB5B 5EU7C 2XN9E 2NY6B 2H6PB 3RWHA 3MRGA 1W0WA 3OZ9H 5CZXC 3NPSC 2NTFA 4ZFOA 5D70L 2IAMD 4C58B 1S7QB 3LKOA 3V4UH 5I1JL 3WSQL 4KRPD 1RU9H 3UBXI 3OKKB 5E5UB 2QQNL 2N7BA 3UTQB 4APQB 2JJTA 1RZIA 1IEBB 4PG2A 1VSCA 5L2KE 4IS6A 1Y0LA 3IKKA 5DJYB 4RWYL 5C9JA 1YEKH 1MCFA 5KSVA 1H5BA 3V5HA 1M6OB 5LGJB 1CF8H 3SKOB 4OTXH 2W9DL 5D1XC 1UZ8B 3O4OC 3D6GA 2LABA 3BKYL 5JXED 4R2GB 1IC5L 5I8KL 3F6LA 4WO4A 3TO4A 5F9JA 2WWMC 2CRMA 1ZSDB 4PLKC 3STZB 1ZA3A 1LO4L 3O6KH 4H88H 3WKNA 4NNPH 4RAHA 1YY9C 5GJSL 3CSYB 1KTDB 2IAMB 2YXFA 4D8PB 2GJJA 1CLZL 3P9LA 4KRPB 2FHBA 3GM0A 4FQ1L 3S88L 5EBMA 3MREB 4K9EL 3FQUA 1G7QB 4HF5H 1EX0A 4L3EE 4LNRA 5D71L 3WNMA 4CMMA 2QSCL 2D7OA 1WBXB 5CJOL 1ZLWH 5GRUL 1YN7A 2P5EE 4NRXA 4NUJA 5ESAB 4O2EA 5F89B 2NTSP 3VCLB 5JO5B 1O5DT 1BF2A 3MBEC 5FYKU 2Z0BA 2OZ4H 3MV7D 3TT3H 4P5TC 1T21B 2O5XL 1YJDC 1S5IH 4ELME 3O2VH 3OAYK 2NY1D 5J9PA 5GSVB 4GRMA 5DTFA 1NDGB 3OMZA 1JZ5A 2EICA 2UWEA 1P1ZB 1TJIH 4AIXA 1JWSA 1RUPL 1QNZL 1VEMA 3UMTA 5I8CB 5MHSD 4AG4H 5I1HL 5FYJL 1BJ8A 3R1GH 4L8SB 1D9KA 1FZKB 3L3JA 3INUL 4TOYH 2DM2A 3QQ3A 1FL5A 3TN0A 5IG7A 5FGBC 2BERA 2X89A 1CLCA 4KI5F 3IJHB 5HHNB 3SKOA 1KFAH 3E8UH 4RGMB 1T7VA 2ZG1A 4TUOB 1VFAA 3CLEH 1YNKL 5DMJB 3BX7C 4CJ0A 1UZ8A 1QRKA 3GMRB 1WGOA 4JO1L 1IZJA 2CXGA 1XCQB 5SV4A 1NEZG 4G7YL 2PXYB 4P4RB 5TGBA 4KZDL 3GSVA 1MF2H 3T3PF 5FKAB 3MV7B 1A3RL 2W9LA 2BY1A 1WT5A 4MVBC 4U0RB 4XWOD 1JMZA 4PJ9A 2NY1B 4K8RL 1DSFH 1DDHB 3HZKB 2EDDA 5DC4B 5IQ9B 2EO9A 1PBYA 3MRIA 4KK5D 1AIFB 3LVEA 1G1CA 3PP3K 1OF2B 5BW7A 3RJDA 4PJHB 1MREH 4XPBL 3QPQC 1WBXA 2ZUQC 3FTGA 5CKGA 4QF1A 2Z93B 3QXTA 5D7LA 2VXTL 5HDQH 3ARBA 1WTLA 1HEZB 4YDVB 4NQUA 4N1CA 4FQCH 3OG6B 1DQQA 5A2KH 4UIMB 1BFOB 3LQMA 1U3HD 4B0MM 3ZKMD 5JXEA 3BP7B 3L7EB 4H0HB 4M7ZB 3PDGA 1CU4L 1G6RL 2C4FU 5JTWA 1BGXL 2X4RB 2ARJA 1FFQA 1B0GB 2OMBA 1VGEH 5F93C 1U91B 1E4XL 3Q5TA 1FZKA 3HB3C 2ATPA 3EO9H 4JO4L 5HGDA 5CEXB 1YEDA 2YPKB 3D85A 3HNSL 3MJ9L 1AGBB 3CJJA 2WUCL 5FYKL 1RZ7H 3LDBB 3NIDE 1PX3A 4JRYD 5FA4A 1JWUA 3UTSE 2MKWA 2OJZH 5CJ8A 4BKLA 1NANI 2PKDA 3M1BA 1DLHB 2BSSA 1INEL 2ADFL 2DMKA 4KJQC 5FKAA 3PNWB 1WAAA 4I3SH 1PSKL 2DM4A 1U3HB 3SDAD 4WW2A 5A2IH 5JIKA 4WEUD 1RUQH 5ID0B 5LWYH 2OTWB 3D9AL 3SDCC 1BOGA 1UA6L 2FEEL 4NKDA 3M8OL 4YHML 3ULVE 1JF1A 2LFGA 4AENB 4CUCA 1OSPL 3G6AB 3VW3H 5T3ZL 3S36L 3MOBH 3DECA 4MXWL 3KLHC 1IZKA 4PV8B 4DGIL 1Z9MA 1HEZA 1OAQL 3OHXB 4Y7MA 1LO0H 1CE1H 1A2YA 5ISZE 3E6FA 3QSKB 4Q9BA 4JRYB 4OZIE 5T1LB 1JYNA 4MQ7B 3IAQA 1SJHA 1BFOA 3CDGB 5I2IA 4DW2H 4GRWE 4QGTA 3EYVA 3BRDA 3PWPD 1RZGA 4FXKA 2B2XH 2X4RA 2ZUSA 3JWDL 4NN5B 1B0GA 1NLDL 3GMNA 1T22B 5MENE 3AY4A 1WCBB 4BFIA 5ADOL 3WFZA 1RZJL 2NZ9C 6FABH 3SDAB 4DGYL 3P73B 4WEMB 4HPYH 4L29A 4ESKA 5J7CC 4V1DD 2Y06L 1FO0L 2ZCLH 2CGRH 1U93B 3ARSA 1EH9A 3VI4F 5GS1B 4XPGH 1R0AH 3BISA 3KYKH 2EXWC 3KWWA 1ZANL 3MCKB 1UEMA 2Y1VA 3MJGX 5C0GB 1DLHA 3WCYA 3DNKA 4AEEA 3PNWA 4AMKL 2F15A 3QDHA 2R1YA 4BSWB 4ONFL 5DZOA 4J6RH 4P59L 1PD6A 4MMZC 1U3HA 4R90L 3O3DB 4XNMA 1BBDH 3X3GH 2FWOB 4RGNE 5AZEL 1PEWA 4HMEA 3UO1H 3GFUA 4XWGL 3PWPB 3MOAH 4HIJB 5IMOB 1Q1JL 3FO2B 4EI5C 5E9DA 2A2QT 3RPIB 4DKEL 4JFQA 5H8DA 3U7YL 1H3TA 3MFFA 3MXWH 3V0AC 3RY5A 3JVGC 5DFVC 2DDQL 2MCPH 2HTKC 3QEHA 1T1ZA 3AGVA 5C6TL 5HVGB 2G2RA 5D5MF 4V1DB 2R0LL 2X1QA 2ZUXA 5CEZH 3ARFD 1T1WA 4L4VD 3DXAB 4Y4FA 3TO2A 1BBJA 5IEHB 3QDJB 5F1SA 4OGZA 5CLTA 4MQ7A 2HKFL 3PABA 4PIRF 3VWKD 1O7SA 4OZ4B 2YBRB 2VDQH 1ZT7A 4G8GD 4KV5E 3NCEB 1N5YL 4KTEH 4K23H 2Y5EA 5D2NB 5SV3A 4HH8A 4NT6B 4G80A 2ICWJ 5KVDH 4JDTH 2EDEA 4LSQH 1BIIB 3C5ZC 1CZ8H 1WCBA 3B2VL 3EFFB 1KTKE 3OAUL 3A6BH 2AV7B 2Y36L 1S9WB 2XG5A 1UM4H 1LDSA 3BZFB 5DA4A 3DUUA 3RWEA 1BVKB 4M8QB 3AXLA 1G7IB 4ZO9A 3DLQR 3DX8A 5GS1A 2JB6A 1YN6A 3SDXF 1I3RB 3T4AB 5HD8C 1WIOA 1FNHA 2BRRL 4WUKL 3QXWA 4N8VG 4ZQKB 5EN2B 3ARFB 4L4VB 3V9FA 5JPMB 5IBUG 2NQCA 1WEJL 4GW5B 4Z7WF 3AMKA 2EH8H 3VWKB 1FFOA 5FM5O 4JM2C 4D0BB 2NY0D 4NYLA 2VQUA 2ZSWA 3QEGL 4G8GB 4XMPH 5CP7B 4XP9L 1KEMH 4P9ML 1EGJH 3QB7C 3PWPA 1NBZA 2H9GA 4ONHB 4HIJA 1BZ7B 4FQXA 2B1AH 3RPIA 4MZ3A 5J11C 1AD0B 4GS7C 2C3GA 4PGJA 1I7ZA 3QWOA 3AU1A 4PB0H 1G7HB 5GGVH 5IHLB 5ANMB 4URTB 4H8WH 5CGYD 5JIHA 1ZHNA 4HGWB 4V1DA 4FQIL 1OTUD 4JFZH 1T04B 4JEGB 3QH3A 1FZMB 1SMAA 1XZ0A 4J23A 5CINL 4GXVH 1A1MB 5IF0A 5E1AB 4NWUL 1NGWB 1G7LA 1I9JH 2PW2A 1BWWA 1KCVL 3OKDB 1HSAA 2Z35B 5LJYH 4KJYB 3RVWC 2YOCA 5I1GH 3RTQC 2J88H 4GSDL 4BFGA 3BOVA 4YQXH 4QCIB 2BFVH 5DI8B 3EFFA 2NY0B 5E8EB 4NQDD 1QSED 2DBLL 5AUMA 4JHAL 4PJEF 1MELA 3BXNB 5DVOA 4ZPTB 3TFKC 4F57L 1MCRA 3CH1B 4PGZA 3G9VA 3RVVD 3UTTE 5T1DH 3KPOA 4XVJH 2XWBB 3BESR 2XN9A 1I3RA 3SE3C 4FQ2L 2JLLA 2H26A 5I1KL 2YUZA 4P99A 1MIML 1N64H 1QPPA 1Q0YL 4O2CA 2VZVA 2FO1A 3VWKA 1HNGA 2PW1B 3UPCA 4OZHE 1W0YT 3PP4H 4KVCH 2O61A 5IHUH 1KNOB 4HXAL 1LD9B 4G8GA 4XCNB 5E7BA 5CP7A 5KSBA 5AAMA 5IBTH 3ZYZA 4ONHA 1NGPH 2WW8A 4P0DA 4NQXA 1QFPA 3MCLL 5C0AD 4ZS7L 3MBXH 4UIKH 1X7QB 4UILH 2CMRH 3LN4A 1K2DB 3DBXA 3K2UH 3VGFA 4U1IA 4RWHA 4NQDB 1QSEB 3LHPL 4D9LH 2PF6A 4LMQI 2X4NB 5ANMA 2NXYD 5C08D 1F4HA 1NGYB 2I24N 5D2LE 1AQDA 5IW1A 1IC7L 1OAKL 1A1MA 3OKMA 1XIWC 1VESA 1J0JA 2ITDB 2NY3B 1F4YH 3EO0A 3QQ9D 2NX5D 3RQ3A 4QHMB 3WXWH 4PJAB 4UMGA 4YXHH 1KXQE 3UPAA 2YWYA 4ENEC 4F7EB 3WL9B 5BQ7A 4J3WA 3AROA 2VR5A 5B3NA 1OAYH 3DETD 1FSKB 4BK5A 3BXNA 4OLEA 2C1PA 2AQ1A 2YPVL 3EDKA 5EIQA 2UUDH 3Q1SH 1FVEA 3MR9B 5HY9A 5C0AB 3MLPA 3RZCC 1BMGA 5HYQB 4IMLB 2A77L 2JJUA 2IG2L 5L7XH 1TVHA 1QEWB 3B9VA 2XWBA 1FC2D 4MA8L 3QDGE 2EYTB 3FB5B 2OCFD 1OD7A 1BZQK 4LVHC 5GHWL 4FMFA 2ZCHL 1FGVH 3HZVA 4ZODA 4WWKC 1JZ7A 4DK3A 2NX5B 1VENA 2NYYD 3DYMA 4FG6C 4YX2L 2F8XC 2OYPA 4N8VB 3RVTC 4W4NA 2VTFA 5IBUB 5F7UA 5C3TA 1K2DA 5FOBB 4FQJH 4NQDA 1QSEA 4ZS6D 3DTXB 2ESVD 1EEQA 1A6WH 4S1RL 3IXAB 5JHLH 3O0RL 2MQ3A 1CFBA 4M6MH 1NFIA 1PG7H 2LTQC 2GW5A 4O02H 1NBVH 2FGWL 4Q9QH 4NOBA 2NLJA 2GIYA 2VLJD 4HWEH 4HKBB 4UV7H 4I5BA 5BMFH 2Z9TA 1BJMA 3L7FB 2NR6C 3MRMA 1QBLL 3JV6B 5DUPH 3X11B 4HIIA 2HRPL 4EQ3A 2Q6WA 3P4NB 3QCVH 2Z4QB 2PCPB 5MEQA 4M48H 3VE0B 1I9IH 5J6HA 2VN7A 1J0YA 5GRXG 4EDWL 4XAKD 4JG0L 1FL6B 3T3ME 3MR9A 4YDKH 1FRGH 3DRQB 1CK0H 3WUZA 4M5ZL 1KN4L 3FAWA 4C83A 2GT9B 5HYQA 2R9HD 1T80A 2FCBA 3DX6A 1TZHB 2EKSA 3H0TA 1UWGL 1BFVH 2E27H 3BAEH 3K74B 3O41A 5C08A 1RFDH 3IAGC 4HUUB 1T1XA 4KAQL 4U1LB 4MCYB 4BZ2L 1BX2B 1EO8L 1EEUA 4FA8A 2X09A 1FIGH 4RBPK 4N9GA 3P30L 3OF6D 3TA3B 5L9DH 1XR8B 3RVUC 4N8VA 5J89A 3A6CL 3ZDXF 4IMKA 4DTGL 2EIDA 1DBJL 4HSQA 5FUZL 4GUPA 4QO1A 5GGRY 4YR6A 3BH8B 3ZSTA 1JZ8A 4OLYL 3LKPB 4F80A 2GUOB 1EMTH 3QIWD 1FN4B 4LVEA 3BPLC 4NUGL 4BJLA 2XFXA 3EDEA 4AH2B 4JR9H 1ZLUK 2ADGB 1MFAL 2W9EH 2FD6L 1NANH 3L7FA 4OD1H 4LPUA 4GQPH 4DUXA 2Z8VC 4KROC 1JGLL 1AO7E 1GIGL 5SX4I 2VITA 1N3NB 4CJ1A 4OLZL 1GGYA 4MJIA 2VDRL 2DN7A 2M2DA 3BDXA 1NCWH 1HH6A 3KJ6L 1JNJA 3GSWA 2QADC 1OM3L 1DL7L 1X4YA 5B38A 3KXFD 3DI2B 3DRQA 2ATKB 2HFEB 1BPVA 2GT9A 4OI7A 2COQA 4RISH 1SBSL 5DK0B 4P3CL 4TRPL 2J8OA 4JFOA 1KCUL 2ESVA 2YA0A 5CJBA 3H3PH 4HUUA 3QIWB 3DPBA 4JGMA 2R4RL 4U1LA 4YUEL 4A6YL 5HVWA 1BX2A 1MCDA 5DRWA 4C57C 5C0EA 4YHNB 3QR2A 3BZ4A 2VLJA 4R26L 3V7AG 2F74A 3HC3L 5D1ZA 3QXVA 1OAZL 3L5JA 1DBML 3S37L 1LE5B 2PUQT 3NZHH 1XR8A 1T7YA 4K3EH 3VI4E 2XZAL 1V8HA 5L88H 2WANA 2D0FA 3SOBH 1REIA 1WFOA 5DVKA 3VXSD 3MV11 35C8L 4OI8A 2FB4H 4PFEA 4ONGH 3LKPA 3TLRA 1UG9A 5D7IE 1SEQH 3ZL4L 1AXSB 3KXFB 3VFGH 1JI2A 2R0KH 5L6YL 4GRLC 4P23C 3BZDA 1JGDA 2Z91B 4X6DE 5K9KB 2YD9A 5KS9A 1UXWB 5HHOE 2AAVA 4KI5C 1I85A 1S7VB 4O51B 3V4PH 4WFEE 3QIBA 2VKXA 2NY5L 4Q6IB 4YZFF 1N3NA 4GW4A 3QO0A 4MNHA 3QNYA 3JWNC 2ZZUT 3D87B 4Y4HC 5ITFB 12E8H 1JE6A 4K7PL 5E2VL 3MLTB 3OF6A 3NIFE 5CHNB 4L9DA 5GGQL 3MLSH 1MJJB 4XRCA 2AJUH 1FE8H 3ARED 1MCCA 3OZ9L 2CUIA 4OUOA 2ATKA 3HG1D 5DMGC 5GQBA 2CSPA 4X7CC 3VXSB 1XGYH 1A7OH 5DK0A 2CIIA 3RKDC 3OXSA 3MA7A 5J13B 4P2YA 3V4UL 2NW3A 4QRRE 3GHBH 1RU9L 3K7UA 2ED8A 1KCKA 1Z3GH 3PV6A 3L9RA 1I1AA 4R96B 3O2DH 5KSAC 4WWID 3PHQB 5IJKA 3LAFA 3RX8A 2WMPA 5CSZB 3FHAA 2CDFA 1YEKL 2BOBA 4L3AA 1PY9A 1N5AB 3SO5A 1CF8L 3RWJB 3UZVB 1ZV5A 4OTXL 4XGZB 3H9SD 5CJXA 4BSVA 2AJXH 3BRFA 1X6NA 3GMPB 4UAOC 1PYWB 2IBZY 1AXSA 1MCIA 5E6IB 3KXFA 3AREB 3LZFH 4F7PB 3HG1B 1T2QH 3W81A 5F70A 3O6KL 4H88L 4NNPL 5H94A 2Z91A 4HJ0D 3C5JB 2C1OA 4KK8D 1UXWA 1UKQA 3NOIA 3WKMH 4OGAD 2DQDH 5DC0A 1FLRH 4QT5B 3VRLF 1F45A 1S7VA 5JHDA 2CH8A 3GIVA 2IH1B 2QLVB 4UT7H 4HF5L 4DKAA 5ITFA 3MRFA 1CGUA 5C2BH 2W0FB 1J8KA 4W70A 4Q2ZA 2DAVA 3TWCH 1OWRM 4I77H 2OZ4L 2HJKA 3TT3L 3WDJA 4TTDC 3UZEA 3CFKA 3OGCB 3QIUC 5DEZA 1LK2B 2VABB 1S5IL 4HFUH 3ZKND 3O2VL 4HK3N 3RX7A 1QVOA 4S11A 3EYQC 2ZUUA 3UTPD 4PJBB 3OG4B 3GM8A 1TJIL 5SWSD 5DSCB 1IAIM 4XVSH 2YS4A 4YBHA 5CD5D 1JZ2A 4PJIB 4AG4L 2YPLD 2VE6B 1MRFH 3R1GL 5CP3H 5JORB 3QXAA 5E70A 4PRHE 3WNPA 4TOYL 3M17B 5D7SH 5EUOB 1CL7I 3TF7C 1CVRA 5DMIH 5CGMA 1UJ3A 3MX0A 3QI9A 3RWJA 4ORGB 2H3NB 1JJUA 4LCWD 1KFAL 2CK0H 3E8UL 4HS8H 3VRJA 2VNCA 3CLEL 4OM0H 4P5KA 4PJHF 1NH6A 3SEPA 1F3DH 1AHWC 5E2UH 1ND0A 4LSVH 4B7IA 3G6JB 3R8BB 1NMBH 1N4XH 1MF2L 3KPSB 4ETYA 4L1HA 4KKBD 5DYOA 1CDUA 1CGXA 3MSPA 2A0LD 3C5JA 1P53A 1DSFL 5T3XH 1BZ9B 1I7RA 2RFXB 5C09D 3FRUA 4OB5H 5GRVK 4LCYA 3TBSA 5SWSB 3F7PC 3U9UB 2EZ0C 2YPLB 4MQXC 4YDJB 1A6VH 2X4QA 1SYVA 3WS3B 1HWGB 1MREL 4NZDA 3QUZA 2MJWA 4X6EB 4EBQH 5J12B 1J11A 2DJSA 5BZDA 1BLNA 2E9WA 1NC4D 2BJMH 5FUCC 1MIEH 5HDQL 4Z7NF 4CW1B 4FQCL 2Q76B 2K9UA 1QKZH 1TTFA 3H9SA 4PTTB 2IFGA 4JFED 4GAYB 4ZUVA 1YEFH 3K3QA 4CADB 4JPKH 3NACL 3BPCB 1MFEH 1DN0A 1EERB 3ARQA 4FXGA 3IJSB 3IFLH 4XCEB 2ERJC 3EIFA 4PV9B 3HNTH 4RMQA 1OGAD 1VGEL 1DTUA 5GISH 3T0EE 2QQKH 3EO9L 1O7VA 5CSGA 2FL5A 3EO1B 2Q1EA 5DFTA 1DUYB 5EUOA 1S8DA 3D0VB 3CH8A 4K9EC 2AEIT 1L7TH 5FHAH 5BS0D 1RZ7L 4MXQC 4MB5A 4LHUD 2R1XA 3IDYC 3F12B 4M1CD 1T5WB 4I4WB 2OJZL 3I6GA 3BHBA 1HOCB 4AIZB 3BQUD 1NC4B 2XTJE 4KKLD 2IMNA 4JQIH 1NKOA 5DMKA 1KGCE 4I3SL 2FIRT 1MEXH 3T65B 3FN3A 5TE6H 2HJFB 5GRWA 1X5KA 1Q9LA 2RFXA 1WWAX 1RUQL 5LWYL 3OR6B 5FYLD 1A9EB 1G0DA 3RHWK 2P24B 3U9UA 1F11B 2OR8A 4PTUB 4CMHB 2IAND 4M1GH 5SWZE 5DEFB 1C16B 4OF3A 5KVMC 4Y5XA 3P0GB 3WS3A 4XCCH 2BC4A 2CLRB 4PJFE 3VW3L 3MOBL 4JANA 3LKNA 2AQ3A 4NRYA 3IDGA 4RMWA 4GG6F 3SDDA 5BS0B 5F7DA 4LCWA 1LO0L 2HWZH 1CE1L 2JF1A 2ZKHH 4CDHA 4PTTA 1PZUB 4XNXH 1IILE 4DW2L 1C1EH 4OZGF 5E4IA 4CADA 3BPCA 2FIKA 3TBVB 4DCQA 4CU7A 3BQUB 1VADB 1T4KA 5GRYA 1KIUA 5E2JA 4XCEA 3G08A 3R06B 5F8QC 2B2XL 4OFYA 1C5DB 3WJLA 1A7RH 4XAWH 3MA9H 2HLFC 1P5UA 6FABL 4PJ5A 2G75B 4HPYL 2IF7A 4J1UA 2DICA 5C09A 3D0VA 1E6OH 5ESQB 1HXYA 3MQIA 2ZCLL 2CGRL 5IR1A 1AXTH 1WQVT 4Y1AE 1S7TB 4O9HH 5ALBH 2V7NB 3F12A 4XPGL 1R0AL 3GRWA 3KYKL 2GSGB 4MA3A 4AL8H 4WENB 3T77A 4PJ7B 5CAYB 2EYRA 5DJZB 4HG4K 2BY0A 2A9NH 2XKNA 1N2RB 3EHBD 4JFEA 1F97A 3S3JA 4J6RL 4LVNB 4KKCC 2Z92B 4X7TB 2HJFA 3VFVB 1BBDL 1FNFA 4MQSB 3X3GL 3DV4B 1UWXH 5D93B 4LDLB 2GI7A 3UO1L 1FBIH 4NN7C 3MOAL 1S7SA 5E6YA 2I60H 1OGAA 2FJGB 5DEFA 1UACH 5TDOA 4NC0B 5IB1B 2P49B 1V3LA 5DUMH 3MXWL 1HHKA 5J6GA 2MCPL 3GSNH 3BE1H 3KPNB 1UFUA 1BVLB 3PL6C 3VWJC 5IVNA 2XI9A 2PYEE 5TPWH 5A43C 5FA3A 5BS0A 5CEZL 3WNKA 3EOBB 1U8MB 1EZVX 4ZXBD 3MZGB 4ELKB 4LHUA 4DZ8B 5A2JH 4UINH 5EO0B 2JCCA 1J0ZA 2VDQL 5E2TH 3BQUA 1H0DB 4KTEL 1R6VA 4N0UA 5LKNA 1S9XB 1BFSA 4D9RD 2DYPB 4JDTL 5KVDL 4LSQL 3MROA 1CZ8L 3BN9D 2WP3T 2G75A 1EUUA 5ESVB 3HI1A 3A6BL 4ODBD 4CVWA 1UM4L 4XXCA 5EIIB 1GC1C 3BVNA 3VXUE 3CCHA 5SX4H 2IANA 1RK0B 5CZXD 2GCYA 3K46A 3WIIH 5LVEA 2VZTA 1S9KC 4FQLH 2DWEB 2CK2A 4ODSH 3SGKA 4OKVA 5GGUB 1BQSA 4NQSB 1BFTA 1H3WM 1WZ1H 5E8OA 4I48B 2VLMD 1II4E 4OIIH 2EH8L 4YFLI 4JY4B 2VDLH 2WSKA 4FQHB 4IIQB 4D0CA 5KAQG 3ES6B 4XMPL 5C0FB 3DUSB 1NUFA 3JWDC 1KEML 1S9VB 2P5WB 1EGJL 4P46C 4YWGH 2B1AL 5D1XD 3KPRE 3I9GH 4PB0L 5JOFA 5GGVL 1N6QH 4H8WL 2DQFA 4IRJB 3KLDA 1ZGLB 3F65A 4K3JH 2D3VA 4JFZL 2W0PA 1NQBA 2OMNA 1ADQA 4PLKD 3ZT7A 2R1WA 3VFMA 4GXVL 4DKDC 2P8PA 2YRLA 2W59A 4RIRB 1I9JL 3VXRA 15C8H 2BNQD 1ONQB 1XGUB 4FTVB 4IEFB 5I1GL 2J88L 1DBBH 1BHGA 4UOJA 4YQXL 5F9WC 3HKFA 3MZTA 4X6DA 2BFVL 4Z7UF 1S9XA 2ARJQ 3ALXA 5HPMB 1HYSC 4JVPA 1CFQB 1UM6H 3TM6A 5EZLA 3B4NA 3MRJB 3MRDA 4NJAH 5SX5K 2IQAA 2H8PA 1JK8B 4XNZC 3BZEB 5IW6A 3MBED 7CGTA 3C2AH 3MXVH 1DUZA 1VERA 3MYJA 3NPZB 1MHCA 3QG6B 4P5TD 4GKNA 3T0XA 3O8XC 1TNNA 1RK0A 1CVSC 1CIUA 4JQVC 4OIBA 4U1JB 5D1XB 3RWFB 4IDJH 1A4KB 5ADPH 1CD1B 5T1DL 4XVJL 3K8LA 4NNXB 5DRNA 3BI9X 3X14B 1HCFX 5GGUA 1XGTB 2YC1A 3BPNC 1N64L 3PWNB 1U6AH 4I48A 4ZXBA 5KZCD 4LVOC 1ZA6A 3VDCA 1KCSH 1T89C 4PJAF 2BNQB 3PP4L 4KVCL 2CLVB 4QRRA 5IHUL 3S37X 3ES6A 1INQB 2ADJA 3DUSA 4PYGA 5IBTL 1H8NA 2EEDA 5HDBF 1NGPL 2BVUA 1AC6A 2AI0H 1BQHG 5CJQH 3MBXL 2B39A 3FQXB 4UIKL 1CXIA 4UILL 2CMRL 1KYOK 5F6HI 3K2UL 2BNRE 4WGWB 4D9LL 3REWA 2VXQH 4J8RA 2GJ6B 3MCG1 3C09B 1HDMB 5C2UB 3BGAA 1EK3A 1LP9E 1T0NA 2XACC 4P5TB 1QR1B 4MLSA 4A2MA 4MVBD 3RA7H 5C07D 3FZUC 4WIQA 5IEKA 4YBLC 3VRLE 1F4YL 3VJ6A 4RDQF 4LHQB 3CVHH 4HKJB 3ULSA 2YK1H 3IJYA 4CVXB 1XGUA 5J0BA 3WXWL 5DJCA 4G8IB 5IB5B 4OF6A 4LEOB 1K4DB 4YXHL 1RURH 4M61A 2EO1A 5KZCB 2E7BA 1YC7A 3QHTC 5TDNA 4PD4J 3QPQD 5GGRB 3EUUA 4HFWA 4ZAKC 4WW1B 2XV6B 2V5TA 1QLEH 4Z7VB 2ZUWA 4Z0XA 3SE9H 4WDIA 5CBEB 1OAYL 2CO7B 1JK8A 1TDQA 5KN5B 3VG9B 2XICA 1AR1C 1AGEB 3QG6A 4LGPB 3Q1SL 3TBWB 4OGXH 5JOPE 3HNVH 3WS6C 5L7XL 3TZVA 4YPJA 5F1IA 2V2WA 3S96B 4NNXA 2J8UB 4LBEA 4DEPC 4MAYA 3ULVH 1XGTA 4JAMB 3JWOH 3MJ7B 5BO1H 3PWNA 2OR7A 1KT2B 1KCRH 3U1SH 5C07B 3HB3D 5FO8B 1OQOA 4XB8A 1FGVL 4F7MA 1FJ1B 4LF3B 4LQFH 2BNQA 4XT1C 4M03A 2A6IB 4IOIA 1GYAA 1J8HB 4NOFA 4I0KA 3G5XB 4X6CE 3OB8A 5I6XC 4NPYA 4GRWH 2BSTB 3FQXA 2BK8A 2ZUQB 5INCB 2XRAH 3D39E 4FQJL 3VA6A 1TETH 3HC4H 1A6WL 5JHLL 3MBEA 4KJQD 3IF1A 4M6ML 1PG7L 1A02N 4U6HA 2R2EB 5DD3H 4OSUH 4O02L 1NBVL 4KMQA 4XCYA 4UT6H 5IQ7H 4Q9QL 4P2OC 1B6UA 2J1KA 4PJXE 25C8H 5I17A 3I3EA 4PJCF 5D6DC 4HWEL 3WLBA 3N1MC 4HKJA 4UV7L 4KTDH 3W9DB 3SDCD 5BMFL 4G8IA 4LQ1A 4I0PC 2AJ3A 1VA9A 1K4DA 5J57B 1KLUA 5DQ9A 4MA7H 2X4PB 4X7SH 5DUPL 2W91A 1R5WB 4X4XA 3DGGA 1NCNA 5GGRA 3QCVL 3RX5A 3WEXB 3MNWA 3KLHD 4M48L 2V17H 1I9IL 1S78C 5FGBA 4Z7VA 2EEAA 5CBEA 1D5MA 43CAB 1UB6B 4KJWC 3OXRB 3ARYA 4JREC 3BJ91 4MD0B 3S4SG 3W2DH 1M7DB 4YDKL 1FRGL 1P7QA 1LO3H 1CK0L 3GHEH 2DI8A 3ZE0E 1U3JA 3ZE1F 4EDXA 5GZOC 1BFVL 2E27L 3BAEL 1H3GA 1RFDL 3MJ7A 1L0YA 1YMMD 4HCRA 3NFPA 3ZTJH 4U33A 1F02I 2NZ9D 1MFBH 5FGCE 1BQUA 4LF3A 5FKPA 1FIGL 3QNZB 2A6IA 4EN3D 2HVKA 5L9DL 4OIAA 4P5MB 3FQTB 3BUYB 3OJDA 2IFFH 4QHUB 4Z6AT 4HIXH 5I1LB 5ENWB 4R2GC 4HAFA 4UDTB 3QDAA 1QTYT 2EXWD 3PQYE 1M1SA 4WV1B 2KL6A 4P2RD 4MNQD 4OZFA 3G5VB 1EMTL 2DIJA 1H8SA 3PDOB 4Z0BH 2XT1B 3KHOA 5MEOA 1BQHB 3WHXA 1JYWA 5D7JD 4WVRA 3F7RA 4JR9L 3U30B 2AXHA 4WU5A 1P4LA 3W9DA 2W9EL 2JK5A 4OD1L 5BVJA 5FM5M 1OSZA 4S2SB 4EI5D 3VFRA 3KPMB 3WUWG 5DFVD 1H3PH 3MGTB 2HTKD 3BDBA 4MNGE 4EN3B 4X0KA 1MOEA 1X5AA 43CAA 1NCWL 1KTLB 4U1MA 5SWZA 4AQOA 2DD8H 4RQQB 3WBDA 5JW3H 3E2HC 5F9AC 1IE5A 1VGKB 4ELMB 2CRZA 5T33H 1RHHB 5JLZA 4RISL 5EBWA 3ZZ1A 4LLMB 3H3PL 1P6FA 4L8SC 3RUGE 4JKKA 2W60B 4DUVA 3C5ZD 1U8OB 4HKXA 3TH2T 4F7TB 1VFBB 5D7JB 1UQSB 3AUVA 4O2FA 4BZ1H 4RGMC 3SDCA 4QRPD 5DURD 4KQ3H 4MJ5B 3O6MH 3NZHL 4EI5B 1Z9SA 4K3EL 4UU9A 5L88L 1U8QB 1KSRA 5HPOA 1FYTA 1HIMH 3QQ4B 4IRSC 3SOBL 2PXYC 2R2HB 4UDTA 5D6CA 4RCAA 3ZDZF 4NDMA 1P4BH 4Z7OE 2FB4L 2P7TB 4ONGL 4OCSH 4ZUWB 4X9FA 3S5LG 3MRRA 1SEQL 2YD3A 4U0RC 3BEWB 5IWLC 2VLRD 3VFGL 3HE7C 3PDOA 1ZLSH 2R0KL 4D2NA 5EU4B 3D18B 4JM2D 3BP4A 4KFZC 2QBWA 4JFFD 2OJEB 4S1SH 5F7FA 1FNLA 1T6WA 4TSAH 4NRZA 1CCZA 3V4PL 4ZSOE 1CD0A 1YMMA 1SM3H 1EFXB 3RWGB 1U8LB 2WUBH 4LRNH 1XMWA 2ITCA 3B8YA 4JRWA 12E8L 5HHPA 1MCOH 2X4TA 1CQYA 4QRPB 5DURB 3U6RA 4PGDA 3MV9E 3MLSL 3NAAH 1AE6H 3JV0A 4PRDB 2AJUL 1FE8L 4RQQA 1JZ4A 1N59B 2VAAB 4RRPG 1PKQB 3WIFB 1JPGB 4L1DA 4H1LG 1XGYL 1A7OL 3KYAA 3RVWD 4P2RA 4MNQA 2VDOH 3QO1B 3RTQD 4EI6B 4LLMA 4ZOEA 2HJLA 5CIPB 3GHBL 2VLRB 4OFKA 5T1KD 2IGFH 3C5SB 1Q9KB 4I3RH 3THMH 2PYFA 1Z3GL 2IALA 3L3OA 4QNPF 4JM2B 1UYWH 1VFBA 3O2DL 1UQSA 1YDPB 4JFFB 1NMAH 1LMKA 5I74B 3LDBC 4MJ5A 3WHE0 1CQKA 1SY6H 4EI5A 2YSSA 5EZIH 4PP2B 5ISZD 5J11B 1TNMA 1Z6JT 3QQ4A 1W72B 2EC8A 3IXTA 3UDWC 2AGJH 2AJXL 3KYNA 2EDYA 3QFJD 1UGNA 5BV7B 3UYOD 1P5VA 4FZ8H 4ZUWA 3LD8C 5CLWA 1VFUA 3S6CA 2A83B 4JDVA 1OY3B 3I84A 4GKZA 5DQJB 2AQ2A 4NO2B 3LZFL 1T2QL 3QXUA 1CT8B 4QXUH 3P77B 3CFDB 2AKRA 4PJBF 3GO1H 2QSVA 2X44D 3WKML 2DQDL 1FLRL 4NC1E 4PJIF 3WE6B 1NFDA 4D9QE 2X4UA 3QNXA 4E42B 5T1KB 3RWGA 4UT7L 1U8LA 3C5ZA 3L1OH 5IOPB 3U4BH 3GGWB 5KW9H 1F3JB 1SEBA 4PJDB 4O4YH 5C2BL 1EXUA 5DJAB 4QRPA 1JPST 3TWCL 2V9QA 2FH8A 5ISZB 4I77L 1UCTA 4OZIB 5FGSA 4RMSA 3VGDA 2GJZA 3WIFA 5E08H 3U7WH 3WUWB 4HFUL 5L0QC 3QFJB 5A16B 1GOGA 2FDBP 4NN5C 2XIDA 5B4MC 2I07B 5CIPA 4XVSL 3SDAC 5CWSA 3C5SA 1C08B 4K3HA 4ENED 1CFTA 4M4PA 3SKJH 1MRFL 1PKOA 2DLFH 3IT8D 4JM2A 1FDLH 4QEGA 4HHAB 4IRZH 1YDPA 1IQWH 3MRQB 2BNUB 4H26B 4YAQA 4JFFA 4QTHA 3UTZB 4Q9CA 1QPXA 2YEZB 4PBXA 5D7SL 5DMIL 2NY5C 3ET9F 1KPVB 3NH7H 3RZCD 2CK0L 4HS8L 4OM0L 2P43B 3T2QA 2BRQA 3W5MA 3RGVD 5E2UL 4JB9H 4LSVL 1LE9B 3K8KA 2A83A 1NMBL 1N4XL 3H42H 4FFVC 5EC2A 3HS0A 5IJVA 1NCCH 3V6FB 5KJRH 4WWKD 3GBLA 2MKLC 2VUOA 3P77A 4LLWB 1F6LL 5IUSA 5EB9A 4FG6D 5T3XL 3RTQA 1JCKA 4RGNB 2E9IA 4OB5L 1IEHA 3RVTD 2X7LB 5DF0A 2OS7A 2HG5A 5JPNA 1MHHB 1A6VL 1ZEAH 1J1OH 4PJDA 4YHZH 3KPTA 4EBQL 5ID1A 3LRSA 3FONB 3ULUE 2W0LA 5HJ3B 3RNKB 2BJML 1MIEL 3UYRH 3GSXB 2AK4D 3RZCB 2WQRA 2KPNA 3PWLB 1QKZL 1L7IH 4LPTA 4Y16C 1R5IB 4G42A 4C54A 4M7JH 3RGVB 2R2BA 1YEFL 3QFJA 5D2NC 3SE3A 3KNBB 1LP9A 2ENSA 2CPCA 3TBTB 1PZ5B 2NR6D 4JPKL 2I07A 1MFEL 3NCFB 4D94A 4ODWB 3FOMB 1CFSB 1JHKH 2CDEA 3IFLL 4LP5A 3HCVB 1M05A 1CE6B 4K3DH 3HNTL 4WWKB 1FQ9C 1HI6B 5IMKB 2L0DA 5GISL 1JHTB 2QQKL 3L3DB 3GI9H 1EFQA 4ZUUB 3MRQA 5D1QB 3L3IB 4H1LB 2B7DT 3UTZA 1OGTB 3EDFA 4U1HB 1XGRB 3UZQA 1I7TB 1U3YA 4CN6A 1QBBA 5IVXB 3QUXA 1L7TL 5T5FH 1MHEB 5FHAL 3MFGB 4MX7B 4WTZG 4PP1C 1DR9A 3FAXA 2HH0H 2ED7A 3ARFC 4JKLA 5FYLH 1LE9A 1L6XA 4L9LC 2VMFA 5BXFB 2AK4B 3FT3A 1XIWA 4NKMB 2Q7YA 2DI7A 4JQIL 2X9XA 3W39B 1MEXL 3O3EA 3DVNB 5TE6L 3FQRA 3SKNA 1AGDA 2VL5A 3L5WA 1TLKA 2G5BA 4QRTA 1NAMB 2X7LA 1TQCC 1IGJB 2GKIA 5F6HJ 1MHHA 4M1GL 1KPRB 2P8MB 1D5IH 3ALWA 4XCCL 3HPLA 3NCJH 5F7MC 2A6KA 1TVDA 4R97C 5HJ3A 3HI5H 3RNKA 3HUJE 3V6BR 4NFBA 3GSXA 4EUPH 4BZYA 3RZCA 2HWZL 4PJCE 2ZKHL 5ITBH 1LEIA 4JPWH 3PWLA 1R5IA 5DD0H 4PJGE 4XNXL 1IM9A 3HZMA 3KNBA 5E5MA 1C1EL 4R4BB 4MXVE 1PZ5A 5DJ2B 3LOWA 5CEZE 4KROD 4ODWA 3FOMA 3V0VB 1XEDA 3HCVA 4MJ4A 4XPHH 4WWKA 3O11A 2VLKE 1A7RL 1KIPA 4XAWL 3MA9L 5HGBB 5IMKA 5IW3A 3L3DA 4ZUUA 3DHMA 4G6MH 3LN9A 1H15B 3G04A 4G6FB 5ECJE 1XGRA 3UP1A 3BIKB 2QADD 1I7TA 1YUHB 3TNMA 1IT9H 1E6OL 5DD6B 3V5DB 4AEFA 3DYPA 5IVXA 4ODUB 2WNGA 1ZKAA 4OCRH 3ZE1E 1AXTL 2XXMB 3UTTB 4O9HL 3QFDA 2IC2A 5ALBL 1OTUC 4LCIH 1T20A 4XPFH 1G9EA 3P4MB 1GJIA 3IKCB 3I6LE 4LARH 1QA9B 3BPLB 4AL8L 5GS0H 2EDTA 2JE8A 5BXFA 2AK4A 2LV4A 2HN7B 3V6OC 4HULB 5EO9A 4GAGH 2A9NL 1BD2E 1TENA 4C4KT 5JMRA 4WHTB 4OZHB 5EU3B 2WP3O 2EDLA 5ICXB 1MQKH 3QDME 4KROB 1WVZA 4GT7A 5HGGS 3KDMB 3D25A 4NWTH 4FOMA 4R3SB 1FBIL 1OCWH 4BYHA 1IGJA 2V2XB 2I60L 3OKYA 1UACL 5K9OA 3WJJA 3ILQC 2Y5TA 5DUML 1DQTA 4GAJH 3GSNL 4XP5H 2QADB 3BE1L 4FHBD 4ZNEE 1EVTC 1G7JB 1F6FB 2NY3C 5TPWL 4LIQH 5ERWB 1P9MC 1WWCA 3FRPG 3BP5A 5INDB 1KV3A 1F90H 4UINL 3X12B 4JN1H 3TVMA 4KI5D 1F2XK 4R4BA 4U2YA 5DJ2A 5B8CB 4JLRA 5E2TL 4XMKH 3CFBA 3O6LH 4JCMA 7FABH 3V0VA 1I8KB 5F96H 3QHZH 1S7WA 3QUYC 2EDXA 4Y5YC 5TH2B 4Y4HD 1IL1A 5EU5A 4I18B 4UOW1 2UZIH 4L5FH 2X4OA 5JDSB 3GDBA 1Q94B 1CGTA 1XFPA 4MQTB 3O3BA 4ODUA 4RAUB 4CVZA 2OBGA 2R69H 3VH8A 4OV5A 5DMGD 3BKMH 4MNGA 4KZDH 3WIIL 2NY2B 4PLNC 1OAUH 2KZWA 2V7HB 3QDGB 4FQLL 5I76B 4FQPA 1TQBC 1MY7A 4ODSL 1OHQA 5DJXA 2WIMA 4ZNCD 1Z5LB 1K8DB 2IPUG 1A6UH 1U8JB 2R0WH 4WI7A 1WZ1L 2WWKO 3NCMA 5DD5H 1I8LC 1H3UA 1KJVB 3C6SA 5KSAD 4RA3A 4OIIL 1R3HB 1JGVH 3QRGH 4O5LH 4Z7QF 4E41E 2VDLL 3CZJA 5BRZE 4LLDB 3CFJA 5AD0A 4PRID 3KDMA 4OUUB 5JQ6H 4YWGL 1M7XA 2HFFB 3PWUA 4G9FE 1JUFB 3DROA 4Y4HB 3RNQB 4LRIC 3I9GL 4N90D 5DHXB 4XBEH 4NIKB 1N6QL 3B6SB 4HZAA 1G7JA 4K3JL 5BJTB 2Q8AH 4UUJB 2CKBH 4OD2A 1KF9B 2QR0A 5INDA 1J0KA 5C0DA 3X12A 15C8L 1AFVH 4P9HH 4JZOB 1MI5E 1DBBL 3F5WB 3MNVA 5C0CD 3MV8D 3U0TB 5EO1B 1JN6A 2VQ1B 1UM6L 1KJ2A 3STBA 4X6FB 5JDJA 1S9YB 2SEBA 2DL2A 1Q9OA 4NJAL 4LLYB 2NY4C 2J2ZA 4C56E 1Q94A 4PRIB 1YNLH 4HJJH 3C2AL 3MXVL 4QRQA 4L4TE 2BVQA 5TDPA 1JBJA 3DUHA 3I3DA 4IDJL 2V7HA 5I76A 3QULB 3VU2A 2YD1A 3H7BB 3MV9A 3EYQD 3N9GH 4UAOB 5ADPL 3FB6A 4PBVC 4XC3H 3IDNB 3MJ8A 3FT4A 1XGPB 1U8JA 1AO7D 5FK9A 3VFTA 1NUNB 2Q87A 5IMMB 4IBLT 4GRLA 3OKLB 4P23A 1U6AL 3BYYA 1NC2B 4O58H 1KJVA 1FGNH 2YHGA 4JGUA 1ORSA 4WTZA 3HN3A 2C7UA 4HS6B 4N5UA 3RWDA 1KCSL 3TA3C 3DO3A 2FJFA 2VIRB 2KZ1B 2ZJSH 3HZYA 3TJEH 5C0JB 1QO3B 1U8IB 4I9WE 4LEXH 3F7YB 5C0CB 3MV8B 2HFFA 1JUFA 5I1DB 3DX9A 4Y4HA 2AI0L 5CJQL 1NGZA 1UKTA 1RV6X 1IEAB 5DJDB 3D2UD 2VXQL 3B6SA 5AG8A 1MCWM 4TNWF 3BSZH 2E7HA 4U6TA 4QLRA 3B9KC 1BOYA 3RA7L 4UOW0 1X5HA 2J8UF 5I1AB 2E6PA 4OZFH 1PLGH 3TGXA 3CVHL 5EOTA 1MCHA 2DLHA 2YK1L 2WLYA 2C4FT 4ZFFA 1AO7B 3F5WA 1FV1B 3I85A 4MMXC 1DCLA 4X5XB 1RURL 5EO1A 3V8CA 5KSAA 4CDGC 3MRLA 4Y4KD 3GSRB 1YYMH 5I8EA 5A2FA 4X6FA 5FIEA 1MFCH 3C60D 1QLEL 1EO5A 4LLYA 4R6UA 3SE9L 2MHAB 2X1PA 2YUVA 2X70A 1CTNA 1W2KT 1I4FB 2D7MA 2FZ3B 5ILTH 2VSCA 4WFFD 1FP5A 4OGXL 1IM3B 1YPZE 2L7UA 4MDJB 4HGKC 3GNMH 3HNVL 5HHXH 5HYJA 5E94A 4JFDE 5IK3B 4HAGA 3BEVA 3D2UB 5KAQF 5H35B 1XGPA 3GSQB 3ULVL 4LFHD 4U3HA 2R4SH 2HTLC 4WFED 1MCSA 2D31B 3JWOL 4JM4H 4WHYG 5F21B 2CKNA 5BO1L 3Q48A 5I0DA 1KCRL 1JHLH 3KPPB 3U1SL 1KLGA 2EKJA 1KJMA 3I2CH 2VIRA 3SN6N 4LQFL 3FFDA 4JQXC 2IQ9H 1QO3A 4ETQB 2E9BA 5I0ZA 5C0CA 2DQGH 4MXQD 2X05A 4H25A 5MERA 3QEQA 1ZS8B 2GITB 4JJHA 4Y4KB 2XRAL 3C60B 2JIXD 2P8LB 2FEDC 1E4JA 1TETL 3HC4L 5DJDA 3VFPB 4X9GA 1G0XA 4U6YB 4F15C 3UPRA 5K9QI 2ZNXA 3QIUA 3MRPB 1J87A 5DD3L 2GHWB 2R39A 4NO3A 4OSUL 5IQ7L 4UT6L 2EC9T 4NSKB 3NTCH 25C8L 4U6XB 5HHOB 3OB0H 3CD4A 1FZOA 3Q6FB 4Q6IC 2FYYA 4KTDL 5FYJD 2ERJB 5H37G 1N0XH 3OTTA 3V5KB 4MA7L 4DWHA 4LKXA 4X7SL 4Y2DA 3GZKA 3F8UB 1P4IH 1XF3A 1U8NB 3PWVA 3O3AB 1JVKA 3V95A 5HVHB 1A6TB 2V17L 5IB4B 1C7TA 2YWZA 3D3VA 3EGSB 4OCXH 4K7FA 2E6QA 3OWEA 5FM4A 4MD4B 3W2DL 3MGOA 3IDYB 1AHWA 1LO3L 5J13C 3GHEL 2IPKA 3HRZB 4KKAC 4PJ8B 4PLOB 4DVRH 4O00A 2JIXB 5F3HA 3ROOB 2GTWA 4J3OC 3D2UA 3U2SA 3SGJC 5H35A 1F42A 4ZOBA 3BP6A 5EU6D 3TYFA 1MH5A 1S3KH 4MAUH 5IFHH 2RHEA 4K8RD 3KPPA 2NMSA 2HLFD 2GTZB 1MFBL 1KCLA 3VXMD 1WUNT 4LK4A 3ORJA 3D1MC 4L8CA 1CD9B 1ZT1A 4NZTH 3RIFK 3SDXB 5KSUA 1WZMA 3V79C 3W9EB 2IFFL 2KBGA 5HYSG 4LLUA 4HIXL 1HH9B 2GITA 1ZHBA 5E00B 4KWUA 4N1EA 2UWEE 1DQMH 5E6IC 3AREC 5HHME 4UDUB 1X5LA 1IGTA 3VFPA 1CDGA 2Q3ZA 1KEGH 1F6AB 1M4KA 4G7VH 4ELMF 1FG2B 1IAII 4K7PY 4Z0BL 4KKCD 1NGXA 3QJHB 1IARB 5EPMB 1CLOH 2J5LB 2VC2H 5EC1A 2BCKB 3V5KA 3AS1A 4XHJC 5ELIA 1GAFH 4WUUD 1ZLVK 5ICYB 5GRZA 1AGCB 5D5MA 2J8HA 5I8OH 1H3PL 1U8NA 3VXMB 1A6TA 4G3YH 4HWUA 3Q0HA 3PL6D 5FYKD 4TN9A 5HHQB 3NBNA 3IRPX 3EGSA 5C7XH 2DQJH 2KDGA 1R5VA 2I9LB 1T03H 3VFOB 4MD4A 5LCVH 2DD8L 2FNBA 5JW3L 5B21A 3CK0H 3H3KA 4ZUSA 5EH1A 2N56A 3CVIH 5T33L 2BMKB 5A3IC 3HLAB 1J7VR 4LSTH 4UV4H 3DWTA 4MB3A 2BOCB 4NHCH 1EBPA 2YRZA 4PJGA 2PO6B 4OGAC 4PJEB 2CKBB 2HVJA 4JRXD 1FHGA 1F4XH 1G6RB 4YIQB 3TYGH 1FYHB 4BZ1L 4RFOH 4KQ3L 4NN7B 3O6ML 4JKWA 3SDXA 3L3GB 4F3FB 3W9EA 4HWZB 3WO4C 4WUUB 1HIML 4NP4H 5T3ZD 1HH9A 5E00A 1S7UA 5JNYA 2C3VA 1P4BL 4H20H 2O5YH 3LMJH 1FL3A 4XBPB 4OCSL 8CGTA 4Z7WA 4KZEH 2VERN 4Z77B 4S0SD 5I1EH 3G5YA 1ZLSL 1EA9C 1FVCA 4OAWB 3WDIA 3OX8B 5GIRB 3WMSA 4X4YB 1YQVH 5FM8A 4JY6A 1ERNA 3U4EB 3P11H 4U1NA 4S1SL 1DEEB 3FQNA 3TBYA 5EU6A 4TSAL 2F53D 1SM3L 1NL0H 1QYGH 2WUBL 5ICYA 3EOAA 2VSDA 4LRNL 4XPAH 4JRXB 1DQJB 1MLBA 4DFIA 5I18H 1I8IA 4PRAB 4X99A 4BELD 3QUKA 4NCDA 1MCOL 3MUY1 5CILH 3MV7E 5HHQA 3Q3GA 1WAAE 3OKEA 3NAAL 3IGAB 1AE6L 4MS8C 3VFOA 1KGCD 4HUVA 2OQJA 3CX5K 3J8F7 3LKQB 2M1KA 3ARZA 3U36B 1BF8A 3HLAA 3SKMB 4ZNEA 2E9JA 2VDOL 5MHSE 2CR6A 2AV1B 4KKBC 4KXZI 4TVPD 1HHIB 1RK1B 5D7KD 5F88A 1ZVYA 4AM0B 1ES0B 1HYSD 2IGFL 4HJGB 1Y18A 4I3RL 3THML 3T0EB 4YPGA 4ODTH 4PJEA 1UYWL 1NMAL 3MO1B 3NMEA 1A3LH 4QHKJ 3ULVF 3RU8H 5IFJB 1SY6L 3WV0A 3E6HA 4U3CA 4WI5A 2VN4A 3O8XD 2X40A 2FBOJ 5EZIL 3LH2H 3MLXH 4WRLA 1JZ6A 4WUUA 4PRNA 4XBGA 1U8KB 1LEKA 4HS3B 2AGJL 1YEEH 4BH7A 1GZQA 2XWJB 5FHBH 1X5XA 3PL6A 1FO0B 3VWJA 4P2QA 4FZ8L 3RFZC 5DEGB 2XTJB 1VACA 3EDDA 3SGEI 4OZIF 5F71A 1E0OB 1CDHA 4Z77A 1VDGA 2H2PC 4JFXB 1VKXA 2VYRE 4GRWF 4PREA 4QXUL 3EKCA 1U95B 3GO1L 4PR5B 4CMHC 3L5XH 2ICWI 5F9WB 5DZNA 4YGAB 4PRPD 2MCG1 1I8MB 3RAJH 1T7WA 3L1OL 3U4BL 4E41A 3IS1X 5KW9L 4KK9C 4JRXA 2AJZB 4PJFB 4UQ3B 4FQQA 4U1GB 3LV3A 4O4YL 3IDMB 1FAIH 3X13B 4TNVF 2B8OT 3O8XB 3QUMH 4H5SB 4GH7B 5I9QC 3W0WD 3H8NA 3MOQA 5E08L 3U36A 4KKLC 3U7WL 1HQ4B 2AV1A 1NKRA 4UQ2A 4AM0A 1ES0A 1J1XH 1SJEB 1ITBB 3NGBC 2GAZA 1RZ8A 4HIEA 2OL3A 1IKFH 4ZAKD 3SKJL 5HGHB 1YNTA 2DLFL 3ZKQD 1FDLL 4F9PC 4IRZL 1IQWL 4OJFH 4PBWD 3VD7A 1DBAH 1B90A 2YR3A 3O4LD 4F2MB 3DV6B 1TZIB 2C4XA 4P46A 1AR1D 1RIHH 2CQVA 2F53A 4PRPB 5GXBB 3MRKA 4Y1AB 1KIRA 4PJ9C 3NH7L 1U8KA 2RCSH 2HMIC 1TMCB 1D5XB 1R3KB 3CXHK 4JB9L 3OKOA 3JTTA 4L4TA 3O45A 2ZOKB 4MJ6A 3VXOB 4LVNC 2FJHB 3H42L 1QFHA 2YMXH 3W0WB 3QYCA 1NCCL 1PVHA 5KJRL 3SBWC 2APTA 2V6HA 4QWWC 5D93C 1LO2H 3IFNH 4KV5F 4PR5A 3ARBC 1RAMA 1J18A 5EORH 2CIKB 1CYGA 1GGTA 1IBGH 1QFWM 4ODXB 3VD5A 1LHZA 1ZEAL 2AJZA 2NXZD 1J1OL 5DJ6A 5IGXH 4YHZL 3O4LB 5CS7A 4WU7A 5CCKH 4NKIH 3O8XA 4JQVA 3UYRL 4P2OD 5SWQB 4JDZA 1L7IL 1V3KA 4M7JL 3PWPE 4I0PD 5DJ0B 3LS4H 5E8NB 4MJ2A 4KHTH 2HT3C 4M4RA 1JHKL 5LBSH 4YNYA 4K3DL 1S78D 3GI9L 4V1DE 5MP6H 2DTSA 1L0XA 1P84K 3ESUF 4KJWD 1IQDB 1D5BA 2X1XR 4PRPA 5I6XB 1MCKA 5T5FL 3DO7B 4KU1A 1FCCA 2ZCKH 3AVEA 1EHAA 1KB9K 3FB8B 2HH0L 2NXZB 3EYOB 3I75B 1MAJA 4DK6A 1DQLH 5GZOD 1B0RB 4ZO6A 3VGGA 5FYLL 2VLLB 3T8XB 4W6WB 3MLYH 3VXOA 1IAOB 4EOWH 4M62H 5LAXB 4P2OB 4RZCB 3W0WA 4IIQC 1G7PA 2IJ0C 5EBLA 4YGVB 3DVGB 3RDTB 4Y8DC 2UZYB 3PGDA 3K80A 3LPGA 3H9HB 1UB5B 5IB3B 5IKCA 1T7ZA 3CZFB 1U42A 4ZAKA 2IPUK 3KHQA 4IRJC 1D5IL 5ETUA 4YO0A 1T7XA 3DMMC 2VWEE 3NCJL 1DZBA 4L4VE 4JREB 3HI5L 5GGSY 3HAEB 3M45A 1L0QA 4G6AC 4MLIA 1RIVH 5ITBL 5SWQA 4JPWL 3WS6A 4G8GE 2EE9A 5DD0L 5KSBE 1NUDA 2RGSA 4C4KO 1MVUB 1U41A 1GOHA 5DJ0A 4WI8A 2FX9H 4OF7A 3ZYJA 5CSBA 3SGDI 3SPVB 4G9DB 4QYOB 3FO9B 4GW1A 4RMUA 4OZHF 1HHHB 4XPHL 4XXDB 5ANME 5IIEA 5IHZA 2VL4A 1NCDH 3WN5B 4G6ML 3MRCA 3GMMB 1IQDA 4NKOB 2ENYA 1HCVA 1IT9L 2FATH 4F9LC 3DO7A 4L8DB 4EIZC 1RJYA 3GK8H 3HE6A 4OCRL 4LPYA 4U1SB 4U49A 5DT1H 1WBZA 2F54D 4LCIL 2DI9A 4XPFL 4TUJA 5D2LF 3L3KB 2VLLA 3MUJA 4M1DH 2A73A 3MLUH 3BW9B 4LARL 5GS0L 4ZDHB 3DIFA 2F8OA 5LAXA 4P2OA 1QQDB 5D6DA 4GAGL 1OP9A 3B5HA 2FR4B 5GZND 5KANI 4MDIB 4YGVA 3DVGA 1OT1A 4X5WA 4RMTA 5ACZB 4I0PA 2AXGB 1MQKL 1CFNB 1SMOA 1Q9WB 4LL9A 1JF6A 4Y4FC 2XPGB 4NWTL 3ARXA 3F7VB 3H9HA 1UB5A 3JTSA 1TCRA 1OCWL 4IRSD 4NHUB 2PXYD 1A47A 5IMLB 1KB5A 2ID5A 1F13A 3WDHA 2H6PA 3C09C 1FC1A 3F62A 1EV2E 3CX5J 1OP5H 6CGTA 4AZ8A 1E4KC 4GAJL 3C08H 1ZGLM 4XP5L 1T3FB 3K8MA 3HE7D 3HAEA 3E2HB 1S7QA 4LIQL 3VGEA 3FCTB 5JUEH 3L3HB 3OKKA 2F54B 1XH3B 1F90L 1GGIH 4WEBH 4YFLF 1WBYB 4JN1L 3UTQA 4APQA 1IEBA 1RZFH 5T1MB 3GBMH 4NZRH 2WAHA 4XMKL 5DJYA 3O6LL 7FABL 2EDBA 5F96L 1T1YB 3QHZL 4NQDE 1QSEE 4Z76B 1HHHA 1FFPB 1M6OA 5LGJA 1OAXH 1IAIH 4WI2A 3D39D 3ZHLA 3VG9C 2UZIL 1FFNB 4L5FL 5EBGA 4RFNC 4NKOA 5JA8B 1I1RA 4POYA 1C12B 1Z9LA 4IRSB 2R69L 3EAKA 4WJ5B 3BKML 4XH2B 2E7LC 1OAUL 3CXDH 1ZSDA 3STZA 4XNQB 3VFWB 2FX7H 3L3KA 3MUZ1 4FQXC 1A6UL 3S3PA 2R0WL 3CSYA 3HE7B 1KTDA 1MCWW 1ZTXH 2X1OA 2IAMA 5DD5L 4ZYKB 1A8JH 4D8PA 1ETZB 5IT2H 2XYCA 2HFTA 5K9QG 3QRGL 1JGVL 4HKZB 2X9WA 1IKNC 4O5LL 3MREA 5FEBA 1G7QA 5ACZA 4KPHH 5GS2D 1XR9B 2AXGA 5DHVB 1LDPH 1CFNA 4XNUH 1S7XB 3C8DA 1EDQA 4X7DC 5BZWB 1KJ3H 2XPGA 4X6CB 1JWMB 4NHUA 5JQ6L 5ESAA 5IMLA 5F89A 1NDMB 3VCLA 4DZBB 3D39B 4JVWA 5JO5A 4JHWH 5C08E 4D3CH 3BD4A 3CAFA 1K8IB 4XBEL 3P9WB 1T21A 3T3MF 5TQ2H 5H2BB 1T3FA 5GSVA 3NACH 1NDGA 2Q8AL 2CKBL 2NX5E 1P1ZA 3KLSA 4PJXB 4X8JB 3L3HA 4JY5H 1SYSB 5I8CA 1Z2KA 1WBYA 4P9HL 1AFVL 5BOZG 3WLWC 4ODHH 2H32B 4L8SA 3HPJB 1MLCB 2ICEB 3E3QE 4OCNC 1T1YA 4HUMB 3NIGE 2FX8H 1FFPA 4DUWA 3IJHA 5HHNA 3PQYD 1HK6A 3H6JA 4TUOA 2X5PA 1FFNA 2FH6A 3DX7B 3BD3A 3AAZB 5F7WC 5T1LD 3GMRA 1HXMB 2F5AH 3F6IA 1GGUA 1YNLL 4HJJL 1XCQA 4IRSA 3BT2H 2PXYA 4P4RA 4NM4H 4WI6A 4WJ5A 1JYVA 5EA0H 4D0DB 3MV7A 4BQBA 4E5XB 2W65B 3OAZH 2JCCF 5B4MD 3N9GL 4XNQA 3LD8B 5L8LB 3VFWA 3SHSA 4XC3L 1G84A 4KHXH 5IWLA 4U05A 3U7AA 1K5NB 4MJIE 1DDHA 3HZKA 3HE7A 2EYSB 4UI2A 1MFNA 2G9HB 5IQ9A 1ROWA 4OM1H 4XP1H 4DN4H 4O58L 5FGCB 3MACH 1FGNL 3W5NA 1AIFA 4GMSH 3ULUH 3KYMB 3TJEL 2ZJSL 1OF2A 1XR9A 3OR7B 4A6YB 3AM8C 5DHVA 4KXZH 4PJHA 1U2HA 4LEXL 4FS0A 2W38A 1JWMA 3GJFB 2Z93A 4WV1C 1NDMA 1A22B 2ESVE 4UTBH 4YDVA 3PQYB 2DQHH 2FO4B 1KTRL 3FOLB 1TIUA 5FUOH 2EC9U 3KGRA 2QSQA 4UIMA 1M71B 3ILPB 4FFVD 3BSZL 2FSEB 2MQCA 1B88A 3BP7A 1WC7B 2VLJE 4QRSB 2AJSH 3L7EA 2J7LA 3U30C 4RX4D 1DP0A 5L0QB 1SYSA 4KH2A 3HA0A 1DBKH 4Z8FH 1U91A 1PLGL 1MLCA 4M43H 4R7DB 5CEXA 3SGEH 2YPKA 3T0AA 1RJZB 4HC1A 4LCUB 5HGAB 1AGBA 4EN3C 4W4OC 3VD3A 2C9AA 4XAKE 1YYML 3DXAD 4GG6B 1MFCL 1KB9J 3HTLX 3QDJD 2GY5A 3QJFB 4HDIB 4RSVA 2XQBH 1OP3K 3O9WC 5ILTL 3UDWA 3IDJB 4OZGB 4Y16D 5KS9E 2VZ1A 4AT6B 4D0DA 4G43B 1LEGB 4L8BB 3GNML 5D7IF 1GGCH 5HHXL 4QOKD 3GI8H 4WNQB 3RUGB 2CLZB 2R4SL 4ZOAA 5I66B 3GUTB 1G9MC 5D7JC 4JM4L 5D9SB 5ID0A 1C5BH 4X6DF 1CTOA 1NEZB 2OTWA 4HW6A 1JHLL 1RD6A 4M5YH 3I2CL 1IFHH 3O6FC 3CMOH 2FRGP 4LHJB 4AENA 2IQ9L 1EO7A 3G6AA 2DQGL 4PP1D 2XY1A 3QWRD 4PV8A 3T0WA 3MLZH 3OHXA 3NIFF 1A7QH 3ZSSA 4DVBB 3MODH 4JRYA 5T1LA 3GIZH 3CDGA 1Q0XH 2FSEA 4QRSA 2DWDB 1LO5B 5CZVH 2AXJA 4I8DA 4Y16B 5GS3A 4MSWB 3NTCL 3OAYH 1HSBB 1GHFH 1CBVH 4HK0B 1T22A 2IH3B 4QOKB 1N8ZB 1QSFD 3C8KB 3SDAA 3P73A 1NCBH 4JCLA 3WFHB 4WFGE 4ERSH 1R3JB 1TJHH 1N0XL 4RDQG 4YC2B 2FGZA 2B4CH 3GB7B 4YE4H 1TFHA 1P4IL 1TVBB 1WJ3A 4GG6A 1U93A 2E7MA 3DARA 3KXFE 1A9BB 1DANT 2G5RA 2N7AA 5EWIH 4OCXL 4MD5B 5DJ8B 4Y19D 3MCKA 4OZGA 5C0GA 4Y88A 3N1FC 3QRFM 4G43A 1M7IB 4DVRL 5JHDE 4BSWA 5CMAB 1CDCA 4L9LB 5CJ5A 3O3DA 5F9DC 4FFZH 4ISVB 3EJZC 2FWOA 3SY0B 2DMBA 1S3KL 4MAUL 1NEZA 5IFHL 5DUBB 5I74C 4G8EB 5IMOA 3FO2A 1I1FB 1KPUB 3SCMD 2BVEA 3B3IB 2BSED 1QSFB 2LU7A 4POUB 1TQCB 4NZTL 3FFCD 1YY8B 3VXSE 4RAVB 3PP3H 1MJ8H 5BV7C 1KBGH 1UZ6E 3DXAA 4DVBA 5IEHA 4R97B 3QDJA 1DQML 3V0WH 4OZ4A 3S8WA 2YBRA 4NCC2 1KEGL 4P4KB 4Y19B 4G7VL 4Y16A 2QTEA 1DFBH 2V9RA 3KS0H 5DO2C 5D2NA 5DK2B 4ZUTB 3CU1A 4NT6A 5DGRA 1CLOL 4JZNB 1UJTA 3ULVC 4QOKA 1BIIA 3R0NA 2B0SH 3C8KA 5HVFB 4HWBA 3JWOC 1FNSH 1HINH 1ZVSB 2VC2L 5DHYB 2AV7A 1J0HA 1GAFL 1S9WA 2XOTA 2DMCA 3ILQD 4GXUN 3BZFA 5I8OL 1TVBA 3SCMB 1BVKA 4LCCB 4M8QA 4G3YL 1G7IA 5E95B 1NGQH 3LKSB 1ZWIB 2OSLB 3FFCB 2NY3D 4NGHH 4YHKH 5C7XL 5KG9B 1TTGA 2DQJL 3T4AA 1T03L 3QWRA 4ZQKA 5LCVL 1T5XB 4BQCA 1RIUH 3CK0L 5EN2A 3ARFA 3CVIL 4G8FB 4L4VA 3BJLA 5JPMA 3V6ZB 1BVZA 4KI1A 4GW5A 1MY5A 4L9LA 1GC1H 4LSTL 4UV4L 4Z7UB 3EDJA 4NHCL 4D0BA 3OKNB 1JNLH 3DYOA 3QUYD 1D7FA 3JUZA 4M00A 1XGQB 1BZ7A 2A6JB 3QP3A 3FN0H 1F4XL 1T83C 3B3IA 3TYGL 1AD0A 1QSFA 3NVQA 2XTLA 4RFOL 2O5ZH 3LEYH 1G7HA 1DVFC 3SGDH 3H9SE 4W6XB 3KS0J 2OL3H 5JXAH 3SJVD 2HFGH 4HGWA 1T04A 4NP4L 1A6AB 1FZMA 4HT1H 5D4QA 4H20L 1QRND 5E1AA 2O5YL 3LMJL 1NGWA 3WO3B 2GFBB 1LGVA 3OKDA 2NPLX 2Z35A 4KJYA 4KZEL 1JGUH 3K81A 5I1EL 4RGNC 3PHOB 2F58H 1WFTA 4QCIA 5EUOE 2DKSA 4MCZB 1YQVL 3RY6A 1D3CA 1JYXA 3BMWA 1T0MB 3P11L 1MHPH 4MYWB 2K7PA 5DI8A 1ZVSA 5E8EA 1YEJH 3QUYB 2OTUB 4Y5YB 1NL0L 3IDIB 1B4JH 4ZPTA 1QYGL 1CDBA 4XPAL 2EDFA 5I18L 4TVPH 4CN4A 3CH1A 4OQTH 3K1KC 5CILL 5I15H 1J86A 3FFCA 1WIPA 4HUWB 3RGVC 2HA1A 3SJVB 1QR4A 1K6QH 1OB1B 4LLQB 4BQ9A 1TQBB 4OGYH 4Y5VB 3UTPE 4MA1C 3VMNA 1QRNB 1BJ1H 2DLTA 2PW1A 4Q7DA 3H7LA 3V6OA 1KNOA 4XI5C 3BO8B 4GKOA 1LD9A 4JFPB 5D1QC 4XCNA 5E7FA 4ODTL 1QOKA 1H3XA 2NY4D 4R4NC 1X7QA 4LCWE 4NZUH 4PYHA 2WINB 2LAGB 1A3LL 3RU8L 2X4NA 2I5YH 1I3GH 1G9NC 3LH2L 3MLXL 1NGYA 4PJFF 4XCFH 4PGBB 4K3GA 1YEEL 5B39G 3PJSB 1XF5B 5FHBL 2ITDA 1ORQB 1PW3A 1V7NH 4JGJA 4QHMA 2E8ZA 4PJAA 3MUGB 4PJ5E 2VLKD 5FXCH 3NFNB 3TA3D 5C09E 3UBXG 1V3MA 4DKFH 1T0MA 1U8HB 3L5XL 3WL9A 4F7EA 5E4EB 1MAMH 3QUYA 4Y5YA 4XZUB 3RAJL 1W8NA 1XF2B 1BJ1J 1MWAH 2BXZA 4YDIH 2NY4B 3EYFB 5C0AA 1A6ZB 2FBJH 4ONOA 2BP3A 4IMLA 1Q72H 1FAIL 5JW5B 3HUJB 1QEWA 1Z9OA 4G5ZH 5GSRB 4JFEE 4PJCB 2EYTA 3B9KD 2DQEH 3FB5A 3QUML 3QT2A 4JKPH 3IETB 3ESVF 1QRNA 1UJ3C 3QDMD 4NQCD 2F5BH 1OGAE 2NX5A 2E3VA 3MMEB 3MLWH 4YBQC 1IGYB 5C0ND 1J1XL 3BO8A 1JTTA 1URLA 2BDNH 2EE6A 2VLKB 4QTIH 1IKFL 4YXLH 3IVKB 4OJFL 5DVLA 5BS0E 1DBAL 5GGSB 5FOBA 2WINA 1RIHL 5J1AB 3DTXA 1V5JA 3LPWA 3IXAA 1A1NB 1KN2H 2JCCE 4LRIA 2AP2A 5KVGH 4I2XB 1FCGA 1P69B 2A6DB 2RCSL 1H8OA 4Y89A 4N0UE 1KXTB 1UXSB 2HTLD 4HKBA 3B9KB 5F8RC 4EXKA 4PG9B 1ZHKB 2DQIH 2YMXL 4RFEB 2Q3AA 5FYLE 2FLBT 1LO2L 3JV6A 4J3XA 1R3LB 3IFNL 3X11A 3ELAT 3QDMB 3P4NA 2NNAB 4NQCB 4QGYA 2Z4QA 1IGMH 3F7QA 2IANE 2PCPA 5EORL 3VE0A 2Z31C 1J12A 2CO6B 1IBGL 4I13B 3ARVA 1FL6A 5FFLA 2FEDD 3GJFK 2VDNH 3QZWG 5IGXL 1K85A 4EQ2A 4PJ7E 4ZG1A 1UWEH 3NCCB 3RY4A 5CCKL 4NKIL 2ZUYA 1TZHA 5JA9A 2I27N 1KB5H 2D7NA 4HIHB 2UVFA 1I7UB 5B8CC 3BPOC 4MCYA 3MJ6A 4YHYC 5AEAA 3SKUD 3LS4L 1DE4B 5DDHB 3MMEA 3GMQB 4I18C 4KHTL 4G9FD 4X6BB 5LBSL 4Z5RB 3H2WA 3K0WA 1MFDH 4LKCB 3TA3A 5TFSH 4LPWA 5MP6L 3W11C 4N9OB 5GGSA 2LVEA 3BH8A 3WFBH 2GK2A 2NY2C 5EFIB 3VXRE 2ZCKL 3MNZB 1KELH 2GUOA 1WTGT 4KKAD 1FN4A 3BDYH 4N5EC 2A6DA 1DQLL 3CDCA 2YD6A 4QHNB 4F15B 4AH2A 3BGMB 2ADGA 3MLYL 5K59E 4EOWL 4M62L 3DURB 5IHBA 3TCLB 5BRZB 5B39B 4NQCA 1SJXA 3MRBB 1AGFB 3B9EA 4G9FB 2MFNA 4Q6YA 5E6ID 2UYLB 2HFEA 3UBXB 2IMMA 1QP1A 3PIQB 5C3LD 1JV5B 1NLBH 3S35X 3O81A 3P4OB 1RIVL 2XY2A 3QIWA 3BH9B 5KVEH 3LEXB 1A6PA 4JZJC 1MI5B 4YHNA 3LRHA 1G7MB 2FX9L 4OCYH 2APWA 3DVIA 3PV7A 4D9RE 4LIQE 4XHJD 1RUAH 4PRBB 4U1KB 1LE5A 4Z5RA 1B4RA 4LKCA 1WK0A 4UBDC 5EU7E 2ZOLB 5AWNH 4JQXA 4M7LH 2CJUH 5F1NB 3IAPA 1NCDL 3NA4A 4C56B 2DLEA 5IFAH 1KG0B 2E5EA 5EFIA 2FATL 2X4SB 1E28B 3QEUB 1INDH 3GK8L 5A3ID 5FB8B 5DT1L