2NRAC

Crystal structure of pi initiator protein in complex with iteron dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
260
structure length
252
Chain Sequence
VNKKTKIRHRNELNHTLAQLPLPAKRVMYMALALIDSKEPLERGRVFKIRAEDLAALAKITPSLAYRQLKEGGKLLGASKISLRGDDIIALAKELNSEELDLNIIEWIAYSPDEGYLSLKFTRTIEPYISSLIGKKNKFTTQLLTASLRLSSQYSSSLYQLIRKHYSNFKKKNYFIISVDELKEELIAYTFDKDGNIEYKYPDFPIFKRDVLNKAIAEIKKKTEISFVGFTVHEKEGRKISKLKFEFVVDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pi initiator protein-iteron complex of plasmid R6K: implications for initiation of plasmid DNA replication.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
molecule keywords 5'-D(*GP*AP*AP*CP*AP*TP*GP*AP*GP*AP*GP*CP*TP*TP*AP*GP*TP*AP*
total genus 71
structure length 252
sequence length 260
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01051 Rep_3 Initiator Replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nraC02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nraC01
1FYMA 5ILSA 3K1NA 2H6BA 5LRSA 5BPIA 5E18F 4OIPF 1R7JA 1D8JA 1LB2A 4KIGA 3W6KB 2OU2A 4OINF 5D4SA 2ZFWA 5HS9A 3LAPA 2V1XA 1EH7A 3J81Z 2MA3A 2Y75A 1W7PD 4I01A 2R7DA 3RTRA 3EYIA 2P5KA 1WWXA 3JTHA 2VE8A 2VXZA 4AIKA 2XAGA 4I98B 4CDGA 1XMKA 1OR7A 2GIVA 1QZYA 2QENA 2LF8A 2OQGA 5FD5A 5ED4A 2VBYA 2JTVA 1LDJA 2M1BA 5L3GA 1IN8A 1B1BA 5FFZA 2FRHA 1ZARA 4HV5A 2EJRA 4KIFA 4KMFA 4G94A 1UHWA 1P92A 1CF7A 2Z3YA 3K9TA 3FMRA 3ZMTA 3WGIA 4A0XA 4M6YA 4L9TA 3I59A 2FBHA 3N4MA 5CVVA 2HOEA 3RKWA 1QGPA 2IJLA 2VT3A 5TJJA 1F9NA 2P4WA 5ILVA 3KLOA 1R1UA 4AIJA 4EJWA 2ZO4A 4EJTA 1B6AA 5HDNA 3GZ6A 5D5WB 4PGHA 2E7WA 4U7DA 3RPUA 2PLYA 2PN6A 3WTTC 3I5UA 4U0YA 1XSDA 4Y13A 3C18A 1P4WA 3VB2A 2ESNA 1XSVA 2P8TA 1BIBA 2BV6A 4G6DA 2E7XA 4A5MA 1TQPA 1T38A 1YQAA 1FBQA 4N9IA 4EV0A 4EGYA 3T1BA 1G6NA 4M6XA 5EEHA 2KJBA 3TDUC 1W7PA 4CXFA 4JBAA 4FT8A 5H6RA 1DPRA 3K1MA 1O3TA 3H92A 2QVOA 3FM5A 1F5TA 3HIFA 1XMAA 1TLHB 2KIUA 4GYIA 3BOQA 5LBQA 1R5GA 4AVPA 1FNNA 2W57A 4LMYA 1TTYA 3W6JB 3GLXA 2PBIA 3REOA 1EV7A 3ROUA 4YFXF 3TO9A 2P7VB 3JAMZ 1O3RA 1IN5A 4NB5A 1S7OA 2Z33A 3QAHA 3FXUA 1V3FA 4MTEA 3BY6A 2ELHA 2F5FA 1YW7A 3K0LA 4KICA 1J75A 2E1NA 3WGHA 2GA2A 1KYZA 1U5TA 2P6SA 1BI1A 3ULQB 3MZYA 5HLIA 5HOOA 5A2QK 3FMSA 1ODDA 4XSXF 2UZKA 2OZUA 4GO1A 1R1TA 1XSXA 3GXOA 3SXYA 4EM2A 4A5NA 4M74A 1P4XA 1V4RA 2CSOA 3FXRA 2MBFA 4DQ2A 2L01A 2NNNA 2QYOA 1FPQA 3WTUC 2FSWA 4MTDA 1IN6A 3ZP5A 4WXCA 4GYGA 3RKYA 4KYWA 2GA1A 3IKVA 4L0YB 2QBYA 2O61A 2QQ9A 1ZG3A 4L9JA 5CVRA 2ZMEA 3AAFA 2X4HA 2Q0OA 1ULYA 5ICEA 4WX9A 1IXRC 2A3SA 2OBPA 5A2QZ 2RC4A 4UV8A 2L3DA 4A0YA 1Y0UA 4ESBA 3KETA 4ZYGA 3F72A 4LB5A 2WTEA 3FX3A 3G73A 2L02A 3ECHA 4BHBA 4P5OA 3T5XA 5ICFA 4MHGA 4M9XA 1KYWA 2NRAC 5BMZA 4RGUA 5K5QA 2FOKA 3HSFA 3LSTA 1ZN2A 2H94A 3E5QA 5DCFA 2VT2A 4LLNA 5IT3A 4O3MA 3I54A 1G3SA 1Z7UA 3DQVC 4LG0A 3S2WA 2WC2A 5JFRA 1MDMA 2NYXA 3E6BA 1R36A 3LA7A 3J80Z 2AS5F 2QUFA 3U1DA 3VEPA 1FZPB 3T8RA 1IN4A 3IHUA 1HQCA 2F5DA 4LLGF 2VC0A 2DBBA 2HFHA 3IWZA 1BC7C 2PMUA 3LQRA 1BOAA 1DPUA 3L00A 2A69F 3H3ZA 2Y0MA 5HS8A 5HLGA 1P2FA 2D2WA 3E5UA 2Z5UA 4OOIA 1QNTA 3KP7A 4HDVA 5H20A 2MLKA 3MWMA 1H0MA 1ZLKA 5FLXK 3HOSA 2RGVA 2EFNA 4BAYA 1QQIA 2OAZA 1FOKA 5D4RA 1ZAOA 3LA2A 1BI2A 4WF2A 4HDUA 3I64A 4RS8A 1FBUA 2G9WA 2IW5A 4UXNA 2Q8KA 3DV8A 2YX4A 3QU6A 3F8CA 4LK1F 2BEOA 3GFMA 3L9FA 1YLFA 3DKWA 5CVIA 2UXNA 3CO6C 3L7WA 3M8FA 2HYGD 4P96A 1SFUA 2QZ8A 3QPTA 4XBFA 2GQQA 2G7HA 5CJ9A 5CYVA 1UFMA 4Y15A 2VOPA 2O0YA 2ZBKA 1EH6A 1J59A 2PG4A 2BYVE 1SFEA 4M72A 3SFZA 2DI3A 4HLXA 3EYYA 4CYDA 4QWQA 2CYYA 1R00A 2QBYB 3E6DA 5DD8A 1XDSA 1K7AA 5E8GA 3C3WA 3F8NA 1GXQA 5JI6A 3GO5A 3FF5A 1JXSA 4OIQF 4HQMA 2K27A 3FHZA 2E1CA 3HHHA 3P9IA 3MCZA 2XROA 2DFIA 1MJAA 2VBZA 3F6VA 1TNSA 1WQ2A 2HZTA 4MQVA 4CZZA 2HTJA 2J5OA 4A0ZA 2D45A 2QLZA 3IRRA 1O3QA 1Z6RA 4Z2YA 1DP7P 2IVMA 1O3SA 1YTYA 1Q1HA 5TRDA 2KKOA 1U6GA 1TBXA 3DF8A 4WXHA 1ZLJA 1FSHA 2RQPA 2EK5A 3I58A 2BE5F 1BI0A 4G7ZF 2O03A 1X3UA 1Z91A 2W85A 3KZYA 1Z9CA 1RIOH 1TW3A 3P9KA 1BJAA 2DT5A 4HX7A 3TOAA 1SD6A 3PFIA 1USSA 3R6SA 2VOOA 3K2ZA 4P9UA 1KU3A 1T39A 2BBYA 1U3EM 4RGXA 3VFZA 1FY7A 3ZQ7A 4XRFA 3CJNA 4RB2C 5F1RA 1U5TB 4CICA 4IF4A 4ESFA 1K78B 3ZMDA 3RJPA 3CTAA 2L4MA 5LGUA 4KMUX 5L3EA 1J9IA 4HYEA 4UVBA 4A6DA 2OQRA 3HRTA 3ZPLA 3HHGA 2RDPA 2PI0A 3BWGA 4GCVA 4PZJA 5HDKA 2ZNYA 2Q2EA 3D5LA 3V8JA 2EA4A 3H3UA 5J6XA 2PQ8A 1IZ1A 3HRUA 1ZGAA 3MAJA 1XGOA 4ENKA 1W7PB 3RPQA 2XKOA 1U78A 4N0BA 2FBIA 3N97A 1FWZA 3WE2A 2XAQA 3KEOA 5E1XA 1MD0A 2JPBA 4WK8F 1MGTA 2XHKA 3HRSA 5ICGA 1ZRDA 4HA8A 1HW1A 2ZCWA 1YW9A 5LLQA 2EFQA 1B59A 2GXGA 5EEGA 1P4AA 2YU3A 1ON1A 3EETA 1OYYA 2PFBA 4BHCA 4IXAA 3CDHA 2FMLA 3I71A 3ISPA 4U7BA 4H0EA 4CHUA 4IRHA 1IXSB 3KP3A 1D3YA 2A68F 3LWFA 4Y17A 3TDZC 4A2UA 4IRIA 1RUNA 4RGSA 1J7KA 3SHFA 2BGCA 4O5VA 5D6FA 2FQ3A 3IC7A 2PJPA 2HQRA 3SZTA 4HBLA 1K79A 3IRQA 1XD7A 3TKYA 3BJOA 4HX4A 4BH9A 2D1VA 1W5SA 4ETSA 4MEXF 2TDXA 2QQBA 1IRGA 1OYWA 1B4AA 2LSOA 2CQKA 3F3XA 5AIPA 3B73A 2EV0A 2IP2A 3GWZA 3OOPA 3R4KA 3JTGA 1E2XA 5D8KB 2ZMEB 4IVNA 3E5XA 5CVUA 3F8BA 3HTSB 1KU2A 1F4KA 1S6LA 1G3YA 4XSZF 3PQKA 1Z6TA 2ESHA 4EVIA 4KN4X 5L3DA 5K1YA 5JHUA 4ON0A 1T98A 4OIOF 3NRVA 2FE3A 1AOYA 3BPXA 3WGGA 1BM9A 3IWFA 2V1UA 4AIHA 3IKTA 5D5UB 2EV6A 2EWNA 2NS0A 2XIGA 1TNTA 3WTVC 1S8NA 1L3LA 2PEXA 1DDNA 4LGWA 1K6OA 3V4GA 3WG9A 2KIMA 4HF1A 4HF0A 2IRFG 1O7FA 5D8LB 3BZ6A 3F8MA 3ABTA 2K4BA 2JT1A 4HF2A 3RI4A 3R0AA 1GVJA 2DAOA 2FBKA 2K02A 5F64A 5D5VB 2XVCA 5FLXZ 4HAMA 4L9VA 4AD9A 1I6XA 1YW8A 3KP4A 2ADUA 5JVTA 4Q48A 1U5TC 3ML6A 3CUQC 2Y48A 1TQMA 3TOBA 3HOTA 4N9HA 2VBXA 1JGSA 4ZH4F 1K78A 4U88A 2XRNA 1JE8A 1J0RA 4O6JA 3U2RA 2VN2A 2NAZA 4EMSA 2L4AA 2M30A 2CFXA 4G8XA 2OA4A 4BQAA 3QU3A 5DCMA 4HLYA 5HLHA 3MFKA 3JSPA 1B9MA 4Q4ZF 3R61A 3DP7A 3J81K 3F22A 2HYFA 2FMYA 4LG0B 4UUVA 1XGSA 3K1PA 4L5IA 1ZYRF 3E6MA 1H9GA 2W24A 3LAJA 4M9ZA 4P55A 5L3FA 3SQNA 4HX8A 1ZGJA 2A61A 4KA4A 1OYIA 5DUIA 3HRMA 3WTWC 2KIFA 1YS6A 2K86A 2P5LC 2FF4A 4IHSA 3SZPA 3M8EA 2M5WA 5E8IA 3BROA 1HKTA 1J5YA 2HS5A 1R23A 3R60A 3NEUA 2NNYA 4D0PA 3HTUA 4S04A 2P6TA 3D0SA 3RIRA 3TGNA 3V8KA 2HKXA 1XCVA 1HW5A 2M45A 3CO7C 1JHHA 4JK1X 1HXDA 2MH9A 2ZJ2A 4I09A 5D5XB 1BC8C 1LEBA 3Q5FA 3R0JA 2JSCA 3V7CA 5LEJA 1L0OC 1WI9A 2LNBA 1OMIA 3CLOA 2WWYA 2MH2A 1Z05A 1LVAA 1ZH5A 1XN7A 3T0YA 2EFOA 4RAYA 4RB0A 4GGGA 4YIIA 1T0FA 2CO5A 3T8TA 2ISYA 5ILUA 2QQAA 2FXAA 2RKHA 2HEOA 1XGMA 1SMTA 4CGZA 5AIQA 4KUMA 2AXLA 3JAMK 4A12A 2F2EA 5J8FA 3BJAA 2F5CA 4I0AA 5FGMA 5LHHA 1LNWA 4LFUA 1R22A 1KGSA 3COAC 2JRTA 1RI7A 1QZZA 2MD5A 4HZFA 5FO5A 1D8KA 3QP6A 3FXQA 1HBXG 3M7GA 3RKXA 2EB7A 1ZRFA 4I2OA 3WU1B 4S05A 3MEXA 3WODF 4IHTA 2GAUA 1TW2A 3P7NA 3GW2A 2YX7A 3FZVA 2FU4A 4M73A 1A04A 2DQRA 1HSTA 4YIFA 2KRFA 4PCQA 2CWEA 1QPMA 2UWMA 3VODA 4KN7X 3OV8A 4CO8A 1MKMA 1STZA 3E6CC 3MZHA 3KP5A 1YYVA 2VE9A 1I1GA 3KZZA 5LGTA 1Z1DA 2W84A 5L3BA 1DUXC 3F21A 4MNUA 3K69A 1O7LA 5BPDA 3KP6A 5D6EA 3HUGA 3I4PA 1JHFA 1G3TA 1OKRA 1OPCA 3ZMSA 2ZKZA 3M9AA 2H09A 5DD4A 1ZRCA 3EUHA 1BIAA 3LFKA 1ZHFA 3V8LA 1UCRA 1YFHA 3BDDA 4E70A 2M8EA 4EM0B 2DO7A 2STWA 1MZBA 2DK5A 5DCMB 2A6EF 1IAWA 4KDPA 1IRFA 4LJZF 4G7OF 2RV8A 1YS7A 5FB2A 3E3VA 5KK1A 2RN7A 3GX4X 2XUBA 5CVJA 1XGNA 5ERIA 3V7SA 3BJ6A 2IA2A 4WWCA 2LDUA 4HV6A 4I0BA 4EM1A 1SD7A 2W25A 5AONA 5F6FA 4EJUA 3J7AO 1R1VA 4EJOA 4ENJA 2JZYA 1VTNC 4IPAA 1GXPA 1J2XA 5DV5A 3E97A 2CW0F 3F6OA 4ZZLA 1REPC 2YPRA 1RZ4A 3DEUA 4M71A 2YSRA 4RB3C 2XASA 4PDKA 4ZYHA 2OZ6A 4BHPA 3HYIA 2ZNZA 4HQEA 3JSOA 2COMA 2G7UA 4UHTA 3I0TA 4RB1A 1IW7F 2VODA 2ETHA 4RGRA 2B0LA 3M1EA 3HSEA 2XV4S 1SD5A 1R58A 2EFWA 3WTXC 5LRRA 1IUYA 3QRFF 2J5PA 1PDNC 2P5VA 3QPHA 2OD5A 4XLPF 4LK0F 1G3WA 2DU9A 3GFJA 2IA0A 5IT9Z 2VBWA 3C1DA 2EA2A 2XAFA 1O57A 2XKPA 4TV7A 1IXCA 1YIOA 1ONVA 3KCCA 3KLNA 4KT5C 1MJ9A 4QLCU 2Z99A 4L5JA 2KJCA 5BS6A 2A07F 3PQJA 6PAXA 3BPVA 3TQNA 5JR3A 4WXDA 2MC3A 2HWVA 2D1HA 1FP1D 3ZN1A 1HSJA 3ECOA 4OIRF 2DK8A 3MQ0A 4U0VA 1KU7A 3DPTA 1SMYF 2RNJA 2XGXA 2QWWA 2FEZA 4OMYA 3LQQA 4LD5A 3NQOA 4DNCA 2CGPA 1FYKA 4B8XA 2GXBA 1I1SA 1KQ8A 1D5VA 3WTZA 2HDCA 1I5ZA 2GZWA 3JW4A 1FC3A 3HSRA 1MJBA 2XAJA 3TO7A 3ZMUA 5J8CA 2MLGA 5E1ZB 5ICCA 4A6EA 2LF7A 1RNLA 3DXJF 4YFNF 2V79A 1FP2A 4LB6B 5HDGA 1NHAA 5HS7A 1ZG5A 4MGRA 1T6SA 4G9YA 3O6BB 2DW4A 2FNAA 3LA3A 1C0WA 4K2EA 3WTSC 1KA8A 1TQIA 4EQQA 3ZN0A 2R3SA 2M87A 4GXOA 3WTYC 2A6HF 3RYPA 2K4JA 2ACJA 4NHJA 3RDIA 3L2CA 1XDUA 1T2KA 3CUQB 3DFGA 4ASNA 3DPLC 4R8HA 5E1WA 1U2WA 4LLLA 1KQ0A 1USTA 4AWXB 4UVCA 4WCGA 4UV9A 1BN5A 2YR2A 1QO0D 5BQTA 3BP8A 3VOEA 5IT9K 1WRJA 4UNOA 2VC1A 1S3JA 5HVQC 2L54A 3RYRA 4P9FA 1GHCA 4HOBA 1AWCA 1PUEE 4R79A 1PP7U 4G7HF 1ZG1A 1LJ9A 1B9NA 3I59B 1LDKB 1XCBA 1E17A 2DQLA 1UHMA 4I7HA 2HQNA 4U0WA 1SD4A 5FD6A 4YG2F 2V6CA 1CF7B 1LEAA 4KNYA 3B02A 1HKQA 3O2PE 5L3CA 3GUDA 1BBYA 3C7JA 4OMZA 4MQ9F 1BI3A 4RAZA 2FA5A 3FM3A 3GEZA 4ZZDA 5BOXA 4ZYEA 2IA1A 4NQWA 4EGZA 4R1HA 1LDDA 4B09A 2UXXA 2QM3A 1SFXA 4JQFA 1LQ1A 2WV0A 4ZYDA 3Q9SA 1G4DA 4XLNF 5H6QA 3GFIA 2CG4A 3V7RA 3P9CA 1HKSA 3F23A 4BXUA 1IF1A 4ENNA 1IN7A 2STTA 1XB4A 1CGPA 2EFPA 1R5HA 3I53A 4L9NA 2DTRA 3QOPA 3FWEA 2H27A 5DEQA 3CUOA 1FX7A 5DUKA 3QP5A 2LKPA 2O6GE 3CUQA 2JPCA 1FBSA 1WSUA 1YG2A 3ABUA 3O3KA 3FMQA 3EDPA 1H9TA 2HGCA 3GYHX 5LHGA 2XAHA 5FFXA 1P6RA 3KP2A 1FYLA 1ZREA 2O3FA 4ESJA 4L0ZB 3Q9VA 5DYMA 1FLIA 4PGGA 3J80K 2X0LA 1UB9A 2FNPA 4FX4A 4M9SA 3GFLA 2A5YB 1F1ZA 2PMHA 1KQ9A 4FHTA 2K7LA 5E20A 1ON2A 4ENMA 2DPUA 4KFCA 1FT9A 4IRGA 1EH8A 4G6QA 1U8RA 3WE3A 3L09A 1I27A 1KU9A 4OU0A 3ELKA 3GF2A 4BYYA 1QBJA 3U9GA 2ISZA 2Z9OA 3IL2A 2F5EA 1SAXA 4EJVA 2H6CA 5DDGA 2VONA 3WU0A 5LEKA 3GVAA 2EV5A 3EQLF 2P7CB 1W4MA 2V9VA 2V1DA 4Q47A 4L18B 2HKOA 3TO6A 5K5RA 1W5TA 2HR3A 5K5OA 3KE2A 5LHIA 1PP8F 3G3ZA 1HW2A 3KEQA 2O8XA 4HW0A 4KIBA 2IPQX 1YO5C 3ZMVA 2HTSA 3ZMZA 3F8FA 4UVAA 4BNCA 1S29A 5LGNA 5KVRA 3GZ5A 1FSEA 2IT0A 2RVCA 2ZXJA 4FX0A 2C6YA 4I02A 1WKMA 1RUOA 4IJAA 4Q5SF 3ERED 4MEYF 5CLSA 5E17F 1MDMB 2R7FA 4F7ZA 1S7AA 2GWRA 2DPDA 4YFKF 3KFWX 2DLLA
chains in the Genus database with same CATH superfamily
1FYMA 5ILSA 4ZYAA 2FJ1A 1WPKA 3K1NA 5M5WJ 3TL4X 2H6BA 2ZXWH 5LRSA 5BPIA 4XRSA 5E18F 3GTGJ 3BCAA 4OIPF 1R7JA 4IHWA 1LKXA 1D8JA 3HOXJ 1LB2A 1Z3XA 4KIGA 3W6KB 1Z21A 1UZCA 2OU2A 4OINF 5EEAA 5D4SA 2QA4I 1TC3C 5CPRB 2ZFWA 5HS9A 3LAPA 2V1XA 1EH7A 3J81Z 4YELA 2MA3A 2Y75A 1W7PD 4I01A 2R7DA 3RTRA 3EYIA 2P5KA 3U21A 2XF7A 1WWXA 3JTHA 3K6GA 4X1EA 2VE8A 3KZIC 1TL8A 1XS9A 2VXZA 3H5RA 1MMDA 2KLOA 3OYLA 4AIKA 1MBJA 2XAGA 4I98B 4CDGA 1B72A 2X85A 4FE4A 1XMKA 1OR7A 3K10A 1R49A 2GIVA 2XRLA 1QZYA 2QENA 4FETA 2LF8A 2OQGA 4QSHA 2NS7A 5FD5A 4Y33A 5ED4A 2VBYA 2ZSIB 2JTVA 4UUTA 2BY0A 1LDJA 2M1BA 4FTHA 5IYBJ 5L3GA 3OY9A 1IN8A 1Y8QB 1B1BA 5FFZA 2FRHA 2XF6A 3OYCA 1ZARA 3IV5A 4A93J 2HPMA 4HV5A 3LSPA 3BR1A 2EJRA 3W2VA 3OYBA 4BXFA 4KIFA 1OCOH 4UB6C 1PUFB 1ACIA 4KMFA 4G94A 1UHWA 1P92A 1CF7A 2WV1A 2Z3YA 3K9TA 5GTHC 3FMRA 4JX6A 3ZMTA 3WGIA 4A0XA 3C2BA 4M6YA 1FEXA 4L9TA 3I59A 1VQMI 2HOTA 1LUJB 2FBHA 3N4MA 5CVVA 1V54H 2HOEA 3LSJA 3RKWA 2XB0X 1QGPA 3WHCA 4BACA 2IJLA 2Z16A 5J47A 2VT3A 2V7FA 3ZQFA 5TJJA 3C2HA 1F9NA 5FKNA 2P4WA 5ILVA 3KLOA 4CCJA 1R1UA 3CJQB 4AIJA 4EJWA 4CH7A 2E1OA 2ZO4A 3M1CA 4EJTA 1B6AA 5HDNA 3GZ6A 5D5WB 2KRCA 4PGHA 4A3JJ 1QHGA 1ZGWA 2XGDA 2E7WA 1X1CA 4U7DA 3RPUA 2QQ8A 2PLYA 4MO7A 2D5VA 1JUMA 2KIQA 2PN6A 3WTTC 3I5UA 3OR1C 3GTKJ 4U0YA 1XSDA 4Y13A 3C18A 1P4WA 4XMYA 2LMDA 2JJ7A 3D1NI 3VB2A 3J7AY 2IS2A 2ESNA 1XSVA 1R4MB 2R4GA 1I50J 4JX5A 2AO9A 4IHVA 1KZHA 3ESWB 2P8TA 1BIBA 2XSJC 2BV6A 4G6DA 2E7XA 2V6EA 2VKVA 2IBDA 1V55H 4A5MA 3SJMA 3CJTB 2PJRA 1TQPA 1T38A 1YQAA 1FBQA 4N9IA 4EV0A 4J00A 4EGYA 3T1BA 1G6NA 4M6XA 5EEHA 5J1RA 1IO2A 1YE9A 4A3EJ 1Q1VA 2MSYA 2KJBA 3TDUC 1W7PA 4CXFA 4JBAA 3S3MA 1POGA 4FT8A 5H6RA 1DPRA 3K1MA 1MNMC 1O3TA 3H92A 1Y39A 2QVOA 3FM5A 2CUEA 1FJLA 2WB1N 2K9QA 3OYMA 1F5TA 2DA7A 3HIFA 1PYVA 4UUSA 3AL0B 1XMAA 1TLHB 2KIUA 3LSGA 2GIZA 4GYIA 3EPZA 3VSKA 3BOQA 5IP7J 1ZR4A 2NVTJ 1VQ6I 5LBQA 1R5GA 1XC5A 5EG0B 4AVPA 1PUFA 1FNNA 1SVOA 2W57A 2Q1ZB 1ETQA 1TTYA 4LMYA 3W6JB 3GLXA 1R9TJ 2PBIA 3REOA 4BUPA 1EV7A 3ROUA 3PIOF 2OJED 1YX5A 2WAQA 3S8PA 2DMUA 4YFXF 4C9YA 2JRMA 2EQRA 3DU6A 3TO9A 2P7VB 1F43A 3JAMZ 2W7NA 3GTMJ 1O3RA 3DLAA 1IN5A 4NB5A 1S7OA 3G1OA 2Z33A 3QAHA 3S1QJ 3FXUA 1RRJA 1V3FA 4MTEA 1FOXA 3JRBA 2Y9ZA 2ZXHA 3BY6A 2ELHA 2F5FA 1YW7A 3K0LA 4KICA 1J75A 1WJAA 3IH2A 2E1NA 3WGHA 4B1RA 2GA2A 1OCTC 2L9NA 4E6KG 5HLTA 4FASD 1KYZA 1U5TA 2CQXA 1BI1A 2P6SA 3A0HC 3ULQB 3MZYA 1AA7A 5HLIA 3BTCA 2GOMA 5HOOA 5A2QK 3FMSA 1ODDA 1X4PA 4LIVA 4BE0A 2MG4A 3CCQI 4XSXF 2UZKA 2OZUA 4GO1A 1R1TA 2XGCA 1XSXA 3GXOA 3HDDA 2HPIA 1Y56A 4E7LA 4IOAF 3SXYA 2VKHA 4EM2A 3JRGA 4A5NA 2FX0A 4M74A 1X1AA 1P4XA 1HDPA 3E7LA 1V4RA 2CSOA 2IGMA 2MBFA 3E1SA 3FXRA 1A35A 4DQ2A 2VJ4A 2H1LA 2L01A 2JA7J 5FROA 2JVGA 5DTDA 2NNNA 3PSFA 2IGNA 5CQEA 4DYRA 2QYOA 3PO2J 1FPQA 1TP4A 3WTUC 2FSWA 4MTDA 1RETA 2DCEA 1QHHD 2L0KA 1MW7A 1IN6A 4BGDA 5K7FA 2F48A 3ZP5A 4WXCA 3TW6A 4GYGA 3RKYA 4KYWA 2GA1A 2LYCA 3IKVA 4L0YB 2QBYA 2L7ZA 2O61A 2QQ9A 4UY8I 1ZG3A 4L9JA 4FCYA 5CVRA 2ZMEA 4XICA 4XLAA 3AAFA 2DYRH 4BE2A 2X4HA 4CCLA 2Q0OA 1JKPC 1ULYA 5ICEA 4WX9A 2DMTA 3K4MA 4AUXA 3AL0C 1JUPA 3OR2C 1IXRC 5EYRA 2A3SA 5FRNA 5B5EC 2OBPA 3FXKA 2ZXIA 1OJLA 5A2QZ 2X6OA 2RC4A 4UV8A 2L3DA 1WVRA 3PNTA 4A0YA 2R7RA 1Y0UA 4ESBA 1MMAA 4CZCA 3DWLE 5BNGA 4ZYGA 3KETA 3F72A 4LB5A 2WTEA 3FX3A 2X48A 3HOYJ 1TWHJ 3S93A 4B44A 3G73A 3UNGC 3H35A 2L02A 1WGXA 4RBOA 3ECHA 4BHBA 4P5OA 3FXOA 3T5XA 1ETXA 5ICFA 4NC7A 4MHGA 4M9XA 1KYWA 2NRAC 3OYGA 5BMZA 2BW3B 4RGUA 5K5QA 3JR9A 4AM3A 1YJNI 3MN2A 3OS0A 2FOKA 2BY1A 4CCNA 3HSFA 5DM7F 3ZQQA 4A3FJ 3LSTA 5M5YJ 2XAUA 1ZN2A 2H94A 4A3BJ 2R7OA 4RLQA 3E5QA 4ANJA 5DCFA 2VT2A 1IGNA 4LLNA 5IT3A 4O3MA 2DOEA 3S14J 3I54A 1G3SA 1YITI 1Z7UA 3DQVC 4LG0A 3S2WA 5J1YA 2WC2A 2DA3A 3M8JA 5JFRA 1MDMA 2NYXA 3G1LA 4DIQA 3E6BA 1R36A 3LA7A 3J80Z 4YRVA 2AS5F 2AQEA 2QUFA 1LFPA 3U1DA 3LFUA 3VEPA 1BR1A 3DTEA 3QYEA 3H0GJ 1FZPB 2R7ZJ 3X2QH 3T8RA 3I4MJ 3CF5F 1IN4A 1XTAA 2ECCA 3IHUA 1VQ7I 1HQCA 2XC7A 2F5DA 2L2OA 4LLGF 2VC0A 3FKIJ 2DBBA 2VPLA 2XGEA 2DOAA 2HFHA 3IWZA 2BXZA 1A36A 3L2UA 1P9QC 1BC7C 1MBEA 1X3ZB 1IV8A 3KPHA 3QQAA 1A31A 1Z67A 2PMUA 3LQRA 2FQ4A 1E0EA 1BOAA 4KITB 1DPUA 3HUGB 3L00A 2A69F 5CKTA 3ASOH 1V5EA 3H3ZA 3MKWB 3RQ4A 2X6XA 2RNGA 1JKOC 2Y0MA 5HS8A 1JJ8C 4ZTFA 3RCOA 1GT0C 3W6VA 5HLGA 1P2FA 2D2WA 3E5UA 2Z5UA 5IOYA 2ZJRF 4OOIA 1QNTA 3KP7A 2DT6A 5J4YA 2L5QA 3ABKH 2HOAA 2EIKH 2Y0SN 4HDVA 1MBHA 5H20A 5E79C 1X1BA 2MLKA 2WAFA 4XK4A 3PO3J 2DA4A 4BBRJ 3MWMA 4PFOA 1H0MA 1ZLKA 5FLXK 3FXLA 3HOSA 2RGVA 2RAEA 2EFNA 4BAYA 1QQIA 1JT0A 2OAZA 2Y31A 1FOKA 2WY7Q 5D4RA 1ZAOA 3LA2A 3VDXA 1BI2A 2VASA 3G6EI 4BY1J 4WF2A 4HDUA 3I64A 4RS8A 1FBUA 2G9WA 2IW5A 4UXNA 2NVXJ 2Q8KA 1UHSA 2ZC2A 3DV8A 2YX4A 3QU6A 2YU9J 3F8CA 4LK1F 3G1MA 2BEOA 3GFMA 1T8IA 1WJ5A 3L9FA 1YLFA 5M5XJ 3DKWA 1NH3A 1LE8B 1ZELA 2M4GA 5CVIA 1MH4A 1YRNB 2UXNA 3CO6C 1H89C 3L7WA 3M8FA 2HYGD 4P96A 4HNVA 1SFUA 2QZ8A 2LVSA 3QPTA 2VQGA 2QSGX 4XBFA 4E7IA 2KPMA 2GQQA 2KRHA 2JVHA 2G7HA 2Y2ZA 5CJ9A 1UFMA 5CYVA 3BCBA 2WAEA 3H9JA 2PMZN 2R7WA 4Y15A 1VZ0A 2VOPA 4G12A 4BBSJ 2O0YA 3ZR8X 2ZBKA 5C44J 3DKYA 1EH6A 5LFAA 1J59A 2PG4A 4MLOA 2BYVE 4IOCF 2CV2A 2QCOA 3TEDA 2JMWA 3JRDA 2HVSA 5E3MA 3HOVJ 1MSFC 3P5JA 1SFEA 4E4HA 2DOFA 2JSPA 2WBMA 2V9KA 1X1DA 4M72A 4BJ6C 3SFZA 4RLFA 4E7JA 1R4NB 5HNFA 2W82A 3FBNB 1DP3A 1ZKGA 2DI3A 3EYYA 4HLXA 4CYDA 1LPQA 3OYHA 2AQFA 2W00A 2EIJH 4QWQA 4AYBA 3B6AA 2CYYA 1R00A 4I76A 2QBYB 1JI8A 1ETOA 2ID6A 5EGOA 3E6DA 3ZQGA 5DD8A 3H9GA 1XDSA 1K7AA 5E8GA 1OCPA 3OS2A 3G2BA 2PMZA 4E7SA 1H8AC 2Z2SB 2HOSA 4F92B 3C3WA 3K2AA 3F8NA 1BR4A 1GXQA 5JI6A 3GO5A 3FF5A 2EILH 1JXSA 2R7XA 1GUUA 4OIQF 4HQMA 2K27A 2JUCA 2CQQA 3FHZA 2E2IJ 1X2MA 1MH3A 2E1CA 4HNUA 2BW3A 1TZLA 3HHHA 2E34A 5FKOA 3AG2H 3P9IA 3MCZA 2XROA 2DFIA 3ABMH 3S1NJ 1MJAA 1VQ4I 2VBZA 3F6VA 1TNSA 1WQ2A 2HZTA 4ITVA 4MQVA 3FKJA 4CZZA 2HTJA 3MD2A 2J5OA 4A0ZA 1AHDP 3CMMA 3GTJJ 2D45A 5JHFA 2QLZA 3IRRA 2HI3A 1O3QA 1Z6RA 2F4OB 4Z2YA 1DP7P 2IVMA 2QGUA 1O3SA 4ZDOA 1YTYA 2NVQJ 1Q1HA 5TRDA 2KKOA 1U6GA 1TBXA 3S16J 3DF8A 4F55A 4WXHA 1QU3A 2WADA 1ZLJA 2YS9A 1FSHA 4L5EA 2RQPA 4DJAA 3K4JA 3RQIA 1IRXA 1DU0A 1IUFA 3CDIA 4XNFA 3MKLA 3HZJA 2EK5A 3I58A 2BE5F 3TMOA 1BI0A 4B4CA 4G7ZF 1FOWA 4KT6A 2EBIA 2O03A 2X1EA 1X3UA 1Z91A 2I8DA 1D0ZA 2W85A 3KZYA 5F04A 3OYIA 1Z9CA 1RIOH 2M4KA 2VJ5A 2E1MB 1TW3A 3P9KA 2L9SA 2CJJA 4I99C 1BJAA 3FISA 2DT5A 1B8IB 4A69C 3F0CA 4HX7A 3OYNA 2ZMEC 5JLWA 3TOAA 1SD6A 3PFIA 3RZDJ 1USSA 2BVLA 3H5NA 3PM1A 3K4NA 3R6SA 2VOOA 3K2ZA 4P9UA 2XPUA 1OFCX 1KU3A 1T39A 2BBYA 2HZDA 1U3EM 4RGXA 3TP3A 3VFZA 1FY7A 4S0HB 5HNHA 3ZQ7A 4XRFA 1MSEC 4B48A 3CJNA 3OWTA 4BQQA 4RB2C 5F1RA 1U5TB 1RESA 1XPXA 4D1QA 1R71A 1JGGA 1U9NA 3JRFA 2E19A 3N05A 4CICA 4IF4A 1NK2P 4ESFA 1K78B 1MBGA 1GV2A 5KAIC 1T0FC 3ZMDA 2XPWA 4A3KJ 3VYUB 1WH5A 3RJPA 3CTAA 1OQYA 4C2MJ 2L4MA 3FIWA 5LGUA 2LREA 4IL6C 2KMUA 4KMUX 4A3GJ 5L3EA 1J9IA 3SYTA 5M3MJ 4HYEA 4OAZA 4UVBA 4C30A 3RSNA 4A6DA 1WZ2A 2LOOA 2CQ7A 2OQRA 1N25A 3HRTA 3ZPLA 4II2A 3HHGA 1UMQA 2CH0A 4UB8C 2RDPA 3QPLA 2PI0A 2V4JC 5EG0A 3BWGA 3GTPJ 5FKLA 3PFYA 3OL4A 1MNDA 1LFUP 4GCVA 2RQQA 4PZJA 2QKMB 4CA0A 2LY1A 2ZNYA 5HDKA 2Q2EA 3HPGA 2BHZA 3D5LA 3V8JA 1U0JA 4UUSB 1WJFA 2EA4A 2L7MP 4FQGA 3H3UA 5J6XA 2PQ8A 1IZ1A 3HRUA 1ZGAA 3MAJA 4XM3A 3JRIA 4ZJZA 2L7FP 1Z3YA 1XGOA 4ENKA 1D1CA 4DYCA 1BW6A 1W7PB 3G4SI 2JA8J 3RPQA 3S17J 2XKOA 1U78A 3K70C 4N0BA 2FBIA 3N97A 1FWZA 2DJNA 3WE2A 2XAQA 3KEOA 2IGOA 5E1XA 1MD0A 2JPBA 1S7EA 1ETWA 4WK8F 1MGTA 4PSWA 1WH7A 2XHKA 3HRSA 5ICGA 1ZRDA 1UELB 4HA8A 1HW1A 5DS9A 3I56I 3ZQHA 2ZCWA 2E2HJ 2N8GA 4IEJA 1KONA 1YW9A 3BR0A 4F52A 3BG9A 5LLQA 1XX5A 2EFQA 1B59A 1OCCH 2GXGA 5EEGA 2LK2A 1P4AA 2YU3A 4XORA 1ON1A 3NAUA 2F6CA 1S72I 1AKHA 3EETA 1OYYA 3S15J 4PK4A 2O9LA 3HOUJ 2PFBA 4BHCA 5DM6F 4IXAA 3J7YJ 3CDHA 2FMLA 3OYJA 3I71A 3ISPA 4U7BA 1F36A 2LC2A 3GTOJ 4H0EA 4CHUA 4IRHA 4BDYA 1IXSB 5EJCA 3KP3A 2BZTA 2P0WA 1D3YA 2M7BA 5F0HA 1YX3A 4Y7NJ 2A68F 3LWFA 4Y17A 2OTLI 3TDZC 3DPUA 4A2UA 4XIDA 3EUKL 4IRIA 1RUNA 4RGSA 1J7KA 3SHFA 3L2QA 2BGCA 3A0BC 3I9V2 3WHBA 4PJJA 2F4IA 1HC8A 2DTZA 4O5VA 5D6FA 4LOCA 2FQ3A 3IC7A 3SEZA 4CCOA 2PJPA 4A3MJ 2HQRA 2CW7A 4QIWN 2DODA 4PUSA 3SZTA 4HBLA 1K79A 2MC4A 2VKEA 3IRQA 3CC2I 3BG3A 1XD7A 4B47A 1W1WE 2OV7A 3TKYA 1IV6A 3BJOA 2MYSA 4HX4A 1X19A 2UUZA 4BH9A 2D1VA 1W5SA 3M07A 3BTLA 4ETSA 5F0CA 4MEXF 2TDXA 4RM3A 2KZGA 2QQBA 3HEFA 1IRGA 1OYWA 2CV0A 2CQNA 4M3GA 1B4AA 3BR5A 2VPRA 1K6YA 1A5JA 4NUBA 1ZK8A 2LSOA 2CQKA 3F3XA 2IS1A 4DBRA 2DDAA 3Q3SA 2AXTC 5AIPA 3KYLA 3B73A 1D1AA 2R7UA 4PSXA 2EV0A 2E1MC 1RR8C 3OS1A 2IP2A 4BL0B 3CCSI 3GWZA 3S3NA 3OOPA 1B72B 3R4KA 4HNTA 4C3JJ 3JTGA 1E2XA 5D8KB 1DU6A 2ZMEB 4YIRX 2MGQA 4IVNA 2DDBA 3E5XA 5CVUA 4A3IJ 2KDZA 3F8BA 2BOLA 2DMNA 1IJWC 2HDWA 3HTSB 3HG9A 1KU2A 1F4KA 1ERDA 4N4OB 5KCMA 2LD5A 1S6LA 1G3YA 4XSZF 3PQKA 1APLC 1HA8A 1Z6TA 2ESHA 1X2NA 3U1KA 4EVIA 4KN4X 5L3DA 3HJEA 1RR7A 4JP0A 3KYDB 5K1YA 3ZOBA 5JHUA 4ON0A 2E60A 1T98A 2V9PA 2WB1A 2FE3A 3NRVA 4OIOF 5FLVA 1AOYA 3BPXA 3WGGA 1SC7A 1BM9A 2DYSH 3IWFA 3K70D 2HYJA 4M3BA 1WJBA 3LSHA 2V1UA 1D0YA 4AIHA 4W97A 3IKTA 5D5UB 2EV6A 2EWNA 2NS0A 2XIGA 1TNTA 5GTIC 2CV1A 2VL8A 3WTVC 9ANTA 1S8NA 5IY5H 1L3LA 3ERMA 1VQ9I 1VQNI 5F08A 3OYDA 3M4OJ 5IYCJ 2PEXA 2RREA 1DDNA 4LGWA 3K4CA 1K6OA 3V4GA 1E3PA 3CJRB 3WG9A 2KIMA 3OL3A 4HF0A 4HF1A 1ITYA 2IRFG 4D5CA 4PJNA 1O7FA 3VPRA 4E7HA 1N75A 5D8LB 2Q2EB 3BZ6A 4GFBA 2FOWA 3F8MA 4XLHA 3ABTA 2K4BA 3MZ8A 4KISA 2JT1A 4HF2A 4MFEA 3RI4A 3R0AA 1GVJA 2DAOA 2FBKA 2K02A 5F64A 2LR8A 1VF9A 5D5VB 2IAIA 3CCVI 1MMGA 4DGWB 2XVCA 5FLXZ 2M0CA 4HAMA 3H1CA 4CYCA 4L9VA 4NBQA 4AD9A 4X6AJ 1UAAA 1I6XA 1YW8A 3KP4A 2ADUA 5JVTA 2JWTA 3KIOA 4Q48A 2ID3A 3SFIA 1U5TC 3ML6A 4E7ZA 3CUQC 2Y48A 1TQMA 3TOBA 1ZTRA 3HOTA 4N9HA 3OYKA 5IYDJ 1RC9A 2VBXA 2B7EA 1JGSA 4ZH4F 3G71I 1K78A 4U88A 3ZRGA 2XRNA 1JE8A 1J0RA 4O6JA 3U2RA 3S3OA 2VN2A 2NAZA 1T56A 1WJEA 3MMYB 4EMSA 2L4AA 1K61A 2M30A 2CFXA 3A03A 4G8XA 2OA4A 2EIMH 4IHYA 4BQAA 3QU3A 2K40A 4RM2A 5DCMA 4HLYA 2K3PA 5HLHA 1P7IA 3BG5A 1NG6A 3B6CA 3MFKA 3JRCA 5GAGJ 4PFPA 4D7MA 3LSKA 3Q0WA 3BZKA 3DEWA 3JSPA 2IEKA 4XOPA 1VQ5I 1XMXA 1B9MA 3S2DJ 4Q4ZF 3HKZA 3R61A 3DP7A 1B8IA 2MABA 3J81K 2HNHA 3F22A 2HYFA 2FMYA 4LG0B 4UUVA 1XGSA 1SFKA 1T08B 1Y1VJ 2A05A 3CCRI 3K1PA 1G8XA 4L5IA 1ZYRF 3E6MA 5J40A 1H9GA 2CU7A 2W24A 3LAJA 4JX4A 4M9ZA 4RAGA 2R92J 4XRSG 2KFDA 1WI3A 4P55A 1FIAA 1JT6A 5L3FA 3SEQA 2GOXB 3VWBA 3SQNA 4HX8A 3CMYA 3GTQJ 1ZGJA 2LKSA 2A61A 5J1UA 1OYIA 4KA4A 3A4CA 3BR3A 2E71A 5DUIA 3OYAA 3HRMA 3WTWC 1YJWI 2KIFA 1YS6A 2GBYA 2K86A 2FF4A 4HSRA 4DBQA 2P5LC 4IHSA 3I4NJ 3SZPA 1ENHA 3M8EA 2M5WA 5E8IA 4J19A 3BROA 4D5FA 1E3OC 1HKTA 3E0JB 2JA6J 2OF7A 4OAYA 4Y4RA 3GLLA 3ONQA 5TISC 1J5YA 2HS5A 1VNDA 1R23A 3R60A 1I3AA 1H88C 3NEUA 3NWSA 2NNYA 4D0PA 3HTUA 4S04A 2P6TA 4GDFA 3D0SA 2KQRA 3RIRA 3CC4I 3A02A 4ZC3A 1A6QA 3TGNA 3V8KA 3CCJI 3O8HA 2HKXA 1XCVA 1I6HJ 1HW5A 1YOVB 2M45A 2H8WA 3CO7C 1JHHA 4JK1X 4NNJA 2R5YA 1HXDA 2MH9A 2COBA 2CMPA 2YUSA 2ZJ2A 4P1WA 3FXJA 4I09A 5D5XB 4BEHB 5H2FC 1BC8C 1LEBA 3Q5FA 1I39A 3R0JA 2JSCA 4RAFA 3ZQIA 3CDLA 3V7CA 5KHDA 3L2WA 1W36D 1S9HA 2K9SA 4W1UA 3OIOA 5LEJA 4A3CJ 3PJRA 1L0OC 3GCMA 4CUGA 4BE1A 1WI9A 2LNBA 2AHQA 1OMIA 1TWCJ 3CLOA 2WWYA 2MH2A 1Z05A 3KX2A 1LVAA 1RKTA 1YJ9I 1ZH5A 1XN7A 2E2JJ 1QA6A 4M6VA 3OMYA 3T0YA 2EFOA 4RAYA 4RB0A 4GGGA 5FLMJ 4A3DJ 3PUFA 4YIIA 4CCKA 1T0FA 2CO5A 4MFDA 1X4OA 3HM5A 3T8TA 4XN0A 2ISYA 3PUBA 1VQPI 5ILUA 2ME0A 5IPAA 1ORKA 1VI0A 2QQAA 2ZB9A 5FJ8J 3DEEA 2FXAA 2RKHA 2F5VA 2ECBA 1M1EB 2LTPA 3DTKA 4DZJA 3LMMA 2HEOA 1S5LC 1XGMA 1SMTA 4CGZA 2E5ZA 5IP9J 5AIQA 4KUMA 1R6RA 2AXLA 2VJJA 3W2AA 1I3QJ 3JAMK 2LLKA 4A12A 2F2EA 4AVZA 5J8FA 2ZJQF 1ZR2A 1SFOJ 1GVDA 4AC0A 2R7QA 2KT0A 3ZQCA 3BJAA 3D5SC 2F5CA 3QYFA 4I0AA 5FGMA 5LHHA 1YI2I 3H3VK 2XB5A 1LNWA 2LRDA 2EH3A 4LFUA 1R22A 5E3LA 1KGSA 3COAC 2JRTA 2LFBA 2O7OA 1NK3P 1RI7A 3Q0VA 2CUJA 1QZZA 2MD5A 4HZFA 5FO5A 2CS3A 2B9SA 3BG7A 4HPQA 1D8KA 3QP6A 1FOYA 3FXQA 1HBXG 5E3NA 2L9VA 3M7GA 3RKXA 2EB7A 3ABLH 1ZRFA 1P7JA 4I2OA 4BXXJ 4JYKA 3WU1B 4S05A 3MEXA 4BS9A 2A5WA 3WODF 1X3WB 4PJ0C 4IHTA 1TW2A 2GAUA 2LH9A 3GW2A 3P7NA 2YX7A 2DJIA 1OR7C 2FU4A 3FZVA 1W5CC 1YHQI 4M73A 1A04A 2DQRA 3LOCA 3QWLA 1HSTA 2CUFA 2LY9A 4YIFA 2KRFA 4PCQA 2CWEA 1U8BA 1QPMA 4V2FA 4F3QA 2UWMA 3VODA 4EEFG 4KN7X 3OV8A 4CO8A 1BL0A 1MKMA 1STZA 3KEYA 3E6CC 4C3IJ 3OIQA 3MZHA 3KP5A 1BR2A 3L2VA 1MBFA 1FIPA 1YYVA 2VE9A 2DMPA 3H0DA 1I1GA 2I10A 3KZZA 5EZHA 1Z1DA 5LGTA 2W84A 5L3BA 2VIXA 1DUXC 2R93J 1QPIA 3F21A 4MNUA 2E5NA 3K69A 1O7LA 2K5CA 5BPDA 2DT7B 3KP6A 1VQ8I 1IC8A 5D6EA 4EATA 3F9KA 3BT9A 3HUGA 3I4PA 1JHFA 1G3TA 1V5FA 3OSGA 1HDDC 1OKRA 1OPCA 3DBRB 5B3SH 3ZMSA 2ZKZA 1JTYA 2H09A 3M9AA 5DD4A 1YIJI 1YRNA 1ZRCA 3EUHA 5F27A 3Q0UA 1SVMA 1AU7A 1BIAA 2X9DA 4PJMA 4RDUA 4IKFA 3LFKA 1ZHFA 3V8LA 1UCRA 1YFHA 3BDDA 4E70A 2BY3A 4LIUA 2M8EA 4N4NB 4EM0B 1MBKA 2DO7A 2STWA 4H4KC 2UV1A 3CQZJ 1MZBA 2DK5A 5DCMB 2L9RA 3BTIA 2A6EF 1IAWA 4KDPA 1IRFA 4LJZF 3DBLB 5GADJ 4G7OF 2RV8A 1YS7A 5FB2A 3WU2C 1VQLI 3E3VA 3KYCB 5KK1A 2LG4A 2RN7A 2KL4A 4BJ5C 3GX4X 4HSTA 3HB9A 3CP8A 2XUBA 5CVJA 4B3XA 1LFBA 1W36C 2X1DA 1XGNA 5ERIA 3UR3C 2VLAA 2F4MB 4HEA2 2FUG2 3D5RC 3V7SA 3BJ6A 2IA2A 5KAFC 4WWCA 2ELJA 3S2HJ 2LDUA 4HV6A 4I0BA 5GAHJ 4EM1A 1SD7A 2W25A 2WY8Q 4OWRB 5AONA 5F6FA 4EJUA 1QRYA 3MKZA 3J7AO 1R1VA 4NDLA 4II3A 4EJOA 4ENJA 3LSIA 4FE7A 4DOZA 2GLOA 2JZYA 5GPCA 1VTNC 3CCEI 4IPAA 2R5ZA 2Z1DA 1GXPA 2HVRA 1J2XA 5DV5A 3E97A 2M7AA 2CW0F 3F6OA 2VQCA 4ZZLA 1REPC 2YPRA 2NOGA 1RZ4A 3DEUA 4M71A 3VYRB 2YSRA 4RB3C 2XASA 4BU2A 4F91B 4PDKA 4ZYHA 2OZ6A 4BHPA 2VKDA 3HYIA 1JJ6C 2HQ5A 1XG1A 2ZNZA 4HQEA 3DLLF 3BZCA 4JOMA 3JSOA 1O4XA 3LL7A 2COMA 2G7UA 4UHTA 2DA6A 3I0TA 4RB1A 1IW7F 2VODA 1N78A 5TGTA 3LSMA 1J09A 1Y8RB 2ETHA 4RGRA 5C3EJ 5B1AH 2NVYJ 2B0LA 3M1EA 3HSEA 4XLFA 3RZOJ 2XV4S 3HOWJ 1SD5A 5GP9A 3PSIA 1R58A 2VB6A 3OYFA 2L7KA 3JREA 2XDVA 3CLQA 1EJ9A 1NG7A 2EFWA 3WTXC 1Z77A 5EDNA 5LRRA 1IUYA 2CUZA 2O8KA 3ZCOA 3QRFF 2J5PA 3L1PA 1PDNC 2OUMA 2P5VA 4DYQA 3QPHA 2OD5A 4XLPF 4LK0F 2W4SA 1G3WA 1BJZA 2DU9A 1T33A 3GFJA 2IA0A 2Y69H 5IT9Z 2VBWA 3C1DA 2EA2A 3S1RJ 1JTXA 2XAFA 1O57A 3EUAA 2R5ZB 3JCUC 2MW8A 2XKPA 4TV7A 4NQWB 4ZTJA 4XRMA 3HXLA 1IXCA 1YIOA 4XKWA 1ONVA 2LBFA 3KCCA 2VXDA 3KLNA 4KT5C 3A2KA 1MJ9A 4QLCU 5K7HA 2W1OA 2Z99A 4L5JA 3FBIB 2KJCA 4XONA 2JK3A 3K4BA 5BS6A 1TT0A 2XF5A 1WJCA 2A07F 2HQAA 3PQJA 4YEJA 1GV5A 2OTJI 6PAXA 3BPVA 3BTJA 3TQNA 5JR3A 4WXDA 2DN0A 2MC3A 2HWVA 2D1HA 3IP4B 1FP1D 3ZN1A 1HSJA 3ECOA 2DMQA 3L2RA 4OIRF 2DK8A 3MQ0A 4U0VA 1KU7A 3W3CA 3DPTA 4Y3OA 1SMYF 2M8GX 2RNJA 4IQJA 3QOEA 2XGXA 2QWWA 3SDBA 3ZGKA 1IDZA 5LD2C 2FEZA 4M3DA 3OSFA 4OMYA 3LQQA 5IOZA 2XPVA 4LD5A 3NQOA 4IHXA 2W48A 3HGGA 5C4XJ 3I55I 1Z0XA 1FMWA 4BQOA 3MKYB 4DNCA 4C3HJ 2PJRB 2DFHA 2CGPA 1K83J 1FYKA 4AU7A 1PJRA 4B8XA 2GXBA 1I1SA 1KQ8A 1D5VA 2V1NA 3WTZA 2HDCA 1I5ZA 2GZWA 2OCEA 1FC3A 3JW4A 3HSRA 1IRZA 1MJBA 5F0FA 2XAJA 3TO7A 2QSHX 4DW6A 5GAEJ 3ZMUA 5J8CA 2QF7A 2MLGA 4BDZA 4HRIA 1ETVA 1AKHB 5E1ZB 2GM4A 3CC7I 1UG2A 3FK6A 5ICCA 4IX7A 4A6EA 1HOMA 2LF7A 1RNLA 2JQ7A 2ICWG 1SVLA 3DXJF 4ZDLA 3BQZA 4YFNF 2A6TA 2V79A 1FP2A 4LB6B 5HDGA 1NHAA 5HS7A 1QVUA 1ZG5A 1ZQ3P 2K3FA 4MGRA 1T6SA 1QVTA 4G9YA 3O6BB 3BR2A 4RMNA 4F93B 2VUMJ 2DW4A 1G2HA 2FNAA 4XOTA 2ZFUA 2X6WA 3LA3A 3TBIA 1C0WA 4K2EA 2M2EA 4NC6A 3WTSC 2M34A 3AG4H 4X0GA 1KA8A 1TQIA 2NS8A 3WG7H 4EQQA 3ZN0A 2R3SA 3HOZJ 3GBGA 3PIPF 3K4KA 2JUGA 2QKLB 2TCTA 4D7NA 1LVKA 2M87A 3CP2A 4GXOA 3ZXSA 3HL2A 3AKZA 3WTYC 4XLEA 2A6HF 2IGKA 3HKZN 2EZLA 1D0XA 5EZGA 3RYPA 2K4JA 2ACJA 1Z7LA 5K7ZA 4ABZA 1HF0A 2TRTA 4G6TB 4NHJA 2EZIA 3I3LA 2EZHA 3RDIA 1G59A 5IP6A 1WFXA 3L2CA 1XDUA 1T2KA 3CUQB 3DFGA 4ASNA 3DPLC 4R8HA 5E1WA 3BR6A 5FRMA 1U2WA 4LLLA 1KQ0A 2QSFX 1USTA 2DXIA 4C2UA 4AWXB 3K7AJ 3EUHC 1W0UA 4UVCA 4WCGA 4UV9A 3HGYA 3UKGA 3VYTB 1BN5A 3H5AA 2YR2A 4QTRA 3CCUI 1QO0D 5BQTA 3BP8A 3VOEA 5IT9K 1WRJA 4J01A 4UNOA 2EZKA 2LP0A 2VC1A 1S3JA 5HVQC 1DGRM 2L54A 3RYRA 4P9FA 4XLCA 3RKQA 1GHCA 3LNQA 3A01A 4HOBA 1AWCA 2BY2A 1PUEE 4R79A 1NTCA 1PP7U 2HXOA 3BC8A 4AIDA 4G7HF 1ZG1A 1N77A 2K9NA 1OCRH 1RKWA 4IO9F 2JN6A 1LJ9A 5EF6A 2P81A 1JKQC 1B9NA 3I59B 2XSDC 1LDKB 1XCBA 1E17A 2DQLA 1UHMA 3AFHA 4I7HA 1WHUA 3BQYA 2HQNA 4U0WA 1VFCA 3FDYA 4U87A 1SD4A 2CRGA 5FD6A 4YG2F 2V6CA 5C4JJ 1CF7B 1LEAA 4KNYA 3B02A 1HKQA 3O2PE 1UJ8A 5L3CA 2NXNB 5FKMA 3GUDA 1BBYA 1JKRC 3C7JA 1PVEA 4OMZA 2KZVA 4MQ9F 4AYBN 1T95A 3ASNH 2Y30A 1BI3A 4RAZA 4NC8A 2LBFB 2I5UA 5J4VA 5KNLA 4CSWA 2R5YB 2R7VA 2BVMA 2FA5A 3FM3A 2R7TA 3GEZA 4ZZDA 5BOXA 4RA2A 1E3HA 4ZYEA 2IA1A 4NQWA 2HXIA 2WA0A 1BA5A 1BW5A 3FHNA 4EGZA 2E36A 4R1HA 3H36A 2DA5A 2DFFA 1LDDA 4B09A 2DA1A 2UXXA 2QM3A 2VI6A 1Y0NA 2VJIA 2Y0SA 4CCMA 4XQFA 2H8RA 2G0EA 2M0MA 1MMNA 1MNEA 2PX9A 1SFXA 5GPAA 4JQFA 3AG3H 3SDGA 3DU5A 4LG3A 3HBLA 3O8GA 1LQ1A 1IG7A 2WV0A 4PJLA 3Q9SA 4ZYDA 5M3FJ 1G4DA 1X1PA 4XLNF 3A01B 5H6QA 3GFIA 1GLNA 1CQTA 3DCFA 3OYEA 2CG4A 2KP6A 2K9MA 1TT5B 2HU9A 4A3LJ 2K85A 2CW8A 2JA5J 3CD6I 3V7RA 3P9CA 1HKSA 3F23A 4BXUA 1IF1A 1FTZA 1EKEA 4ENNA 1IN7A 2STTA 3ZQLA 2NOJB 2HVQA 4GRIA 2O5RA 1XB4A 1CGPA 2EFPA 1R5HA 3LSRA 3V42A 3I53A 4Y52J 4XKVA 5E3OA 4E7KA 1DQUA 1QZEA 2DTRA 3QOPA 2BXYA 4L9NA 2FD5A 3FWEA 2NVUB 4B43A 4B3AA 2H27A 5DEQA 3CUOA 4BEHA 1FX7A 2R0QC 5DUKA 2Y9YA 3QP5A 2LKPA 3MVPA 3CF2A 5EGOB 3DKXA 3GMEA 2O6GE 3CUQA 2JPCA 4XN3A 2ZSHB 3TP0A 1FBSA 4M3FA 1WSUA 1JUSA 3DTIA 4BKXA 1YG2A 3ABUA 1WJDA 3FMQA 2VQLA 3EDPA 2M3AA 3O3KA 2HGCA 3OOUA 2EINH 4LITA 1H9TA 3GYHX 3CESA 5LHGA 1VQKI 4V19K 2XAHA 5F1JA 5FFXA 1P6RA 4XKCA 2R7SA 4V2GA 3KP2A 5JVGF 3PNYA 2ZJPF 1FYLA 1MMSA 2KISA 3AG1H 1ZREA 1OISA 2O3FA 2BHYA 4ESJA 2JA2A 4L0ZB 3H9QA 3Q9VA 3NWTA 5DYMA 3HPHA 5B66C 1FLIA 4PGGA 1GDTA 5J3LA 3J80K 4IQ4A 2X0LA 1MIJA 1V5GA 4XKBA 3CCYA 3S32A 2LY2A 1SAUA 2B63J 1UB9A 1Y6IA 2FNPA 4XR6A 3DBHB 4M9SA 4FX4A 2K9LA 3GFLA 2A5YB 4MIMA 1F1ZA 2PMHA 3VSLA 1HLVA 1KQ9A 4FHTA 1W0TA 1HCRA 3IH3A 3IUOA 3BG6A 4KJZA 4IZZA 2IS4A 1TWAJ 2K7LA 5E20A 1ON2A 3JRAA 4ENMA 2GXAA 1OLTA 2DPUA 4KFCA 1FT9A 4IRGA 3TW7A 2CFOA 1EH8A 4G6QA 2E35A 3W2WA 2ELKA 3QYBA 3M3YJ 2MD0A 1U8RA 3WE3A 3C2GA 1FMVA 3L09A 1I27A 2IXSA 4C2TA 2X1CA 1KU9A 4OU0A 4CYCB 3ELKA 3GF2A 1U9OA 4BYYA 4DZPA 1QBJA 3U9GA 2ISZA 2Z9OA 3IL2A 1BOBA 3J7ZI 1SANA 2OC6A 1LE8A 3IAS2 3SZGA 2F5EA 4BJTA 3RPUD 1SEUA 1SAXA 2HDDA 1ETKA 4EJVA 2H6CA 1VQOI 3FK7A 5DDGA 4I6ZA 2VONA 3WU0A 5LEKA 3QPSA 2V26A 3GVAA 3QODA 2LKXA 2EV5A 1FTTA 3EQLF 2DA2A 2P7CB 1R5ID 1W4MA 5B1BH 3CCMI 4XL9A 2V9VA 2MFZA 1D1BA 2OPTA 2V1DA 3GTLJ 1WCMJ 4Q47A 4L18B 1TWGJ 2HKOA 4ZDPA 3IH4A 3TO6A 5K5RA 1W5TA 2HR3A 3NARA 3CMAI 4FISA 5K5OA 3KE2A 1TWFJ 5LHIA 2H1KA 3BLYA 5FKKA 1PP8F 5HODA 1A6IA 1Y1WJ 3G3ZA 1HW2A 3KEQA 4HG2A 2O8XA 4HW0A 4KIBA 3CZ6A 2IPQX 1X58A 1YO5C 3ZMVA 2HTSA 1DGWY 3ZMZA 3F8FA 4UVAA 4BNCA 1S29A 5LGNA 5KVRA 3GZ5A 3IAM2 4M3EA 1FSEA 1EF4A 2ME6A 2DFEA 4D9JA 2KHMA 3JRHA 1K4SA 1EA3A 1K4TA 4QPOA 3VYSB 2IT0A 2RVCA 2ZXJA 3HC7A 3CMEI 3CCLI 4FX0A 5JLXA 4QPQA 2WAQN 2OCCH 3FXMA 2VQHA 2C6YA 4I02A 3OIPA 3GZNB 1WKMA 4BQNA 1RUOA 4IJAA 2KDOA 3K4LA 2X6YA 4Q5SF 1UG0A 3ERED 4MEYF 5CLSA 1ETYA 3PL8A 5CQGA 5E17F 3S1MJ 2M9HA 1MDMB 2R7FA 4Z6YA 1OCZH 4F7ZA 1S7AA 2GWRA 4BY7J 2QEXI 2DPDA 2EPFA 1IDYA 2X51A 1D5YA 1RPWA 3A1YA 4YFKF 2IS6A 3PNVA 3KFWX 2DLLA
chains in the Genus database with same CATH topology
1FYMA 5ILSA 3K1NA 2H6BA 5LRSA 5BPIA 5E18F 4OIPF 1R7JA 1D8JA 1LB2A 4KIGA 3W6KB 2OU2A 4OINF 5D4SA 2ZFWA 5HS9A 3LAPA 2V1XA 1EH7A 3J81Z 2MA3A 2Y75A 1W7PD 4I01A 2R7DA 3RTRA 3EYIA 2P5KA 1WWXA 3JTHA 2VE8A 2VXZA 4AIKA 2XAGA 4I98B 4CDGA 1XMKA 1OR7A 2GIVA 1QZYA 2QENA 2LF8A 2OQGA 5FD5A 5ED4A 2VBYA 2JTVA 1LDJA 2M1BA 5L3GA 1IN8A 1B1BA 5FFZA 2FRHA 1ZARA 4HV5A 2EJRA 4KIFA 4KMFA 4G94A 1UHWA 1P92A 1CF7A 2Z3YA 3K9TA 3FMRA 3ZMTA 3WGIA 4A0XA 4M6YA 4L9TA 3I59A 2FBHA 3N4MA 5CVVA 2HOEA 3RKWA 1QGPA 2IJLA 2VT3A 5TJJA 1F9NA 2P4WA 5ILVA 3KLOA 1R1UA 4AIJA 4EJWA 2ZO4A 4EJTA 1B6AA 5HDNA 3GZ6A 5D5WB 4PGHA 2E7WA 4U7DA 3RPUA 2PLYA 2PN6A 3WTTC 3I5UA 4U0YA 1XSDA 4Y13A 3C18A 1P4WA 3VB2A 2ESNA 1XSVA 2P8TA 1BIBA 2BV6A 4G6DA 2E7XA 4A5MA 1TQPA 1T38A 1YQAA 1FBQA 4N9IA 4EV0A 4EGYA 3T1BA 1G6NA 4M6XA 5EEHA 2KJBA 3TDUC 1W7PA 4CXFA 4JBAA 4FT8A 5H6RA 1DPRA 3K1MA 1O3TA 3H92A 2QVOA 3FM5A 1F5TA 3HIFA 1XMAA 1TLHB 2KIUA 4GYIA 3BOQA 5LBQA 1R5GA 4AVPA 1FNNA 2W57A 4LMYA 1TTYA 3W6JB 3GLXA 2PBIA 3REOA 1EV7A 3ROUA 4YFXF 3TO9A 2P7VB 3JAMZ 1O3RA 1IN5A 4NB5A 1S7OA 2Z33A 3QAHA 3FXUA 1V3FA 4MTEA 3BY6A 2ELHA 2F5FA 1YW7A 3K0LA 4KICA 1J75A 2E1NA 3WGHA 2GA2A 1KYZA 1U5TA 2P6SA 1BI1A 3ULQB 3MZYA 5HLIA 5HOOA 5A2QK 3FMSA 1ODDA 4XSXF 2UZKA 2OZUA 4GO1A 1R1TA 1XSXA 3GXOA 3SXYA 4EM2A 4A5NA 4M74A 1P4XA 1V4RA 2CSOA 3FXRA 2MBFA 4DQ2A 2L01A 2NNNA 2QYOA 1FPQA 3WTUC 2FSWA 4MTDA 1IN6A 3ZP5A 4WXCA 4GYGA 3RKYA 4KYWA 2GA1A 3IKVA 4L0YB 2QBYA 2O61A 2QQ9A 1ZG3A 4L9JA 5CVRA 2ZMEA 3AAFA 2X4HA 2Q0OA 1ULYA 5ICEA 4WX9A 1IXRC 2A3SA 2OBPA 5A2QZ 2RC4A 4UV8A 2L3DA 4A0YA 1Y0UA 4ESBA 3KETA 4ZYGA 3F72A 4LB5A 2WTEA 3FX3A 3G73A 2L02A 3ECHA 4BHBA 4P5OA 3T5XA 5ICFA 4MHGA 4M9XA 1KYWA 2NRAC 5BMZA 4RGUA 5K5QA 2FOKA 3HSFA 3LSTA 1ZN2A 2H94A 3E5QA 5DCFA 2VT2A 4LLNA 5IT3A 4O3MA 3I54A 1G3SA 1Z7UA 3DQVC 4LG0A 3S2WA 2WC2A 5JFRA 1MDMA 2NYXA 3E6BA 1R36A 3LA7A 3J80Z 2AS5F 2QUFA 3U1DA 3VEPA 1FZPB 3T8RA 1IN4A 3IHUA 1HQCA 2F5DA 4LLGF 2VC0A 2DBBA 2HFHA 3IWZA 1BC7C 2PMUA 3LQRA 1BOAA 1DPUA 3L00A 2A69F 3H3ZA 2Y0MA 5HS8A 5HLGA 1P2FA 2D2WA 3E5UA 2Z5UA 4OOIA 1QNTA 3KP7A 4HDVA 5H20A 2MLKA 3MWMA 1H0MA 1ZLKA 5FLXK 3HOSA 2RGVA 2EFNA 4BAYA 1QQIA 2OAZA 1FOKA 5D4RA 1ZAOA 3LA2A 1BI2A 4WF2A 4HDUA 3I64A 4RS8A 1FBUA 2G9WA 2IW5A 4UXNA 2Q8KA 3DV8A 2YX4A 3QU6A 3F8CA 4LK1F 2BEOA 3GFMA 3L9FA 1YLFA 3DKWA 5CVIA 2UXNA 3CO6C 3L7WA 3M8FA 2HYGD 4P96A 1SFUA 2QZ8A 3QPTA 4XBFA 2GQQA 2G7HA 5CJ9A 5CYVA 1UFMA 4Y15A 2VOPA 2O0YA 2ZBKA 1EH6A 1J59A 2PG4A 2BYVE 1SFEA 4M72A 3SFZA 2DI3A 4HLXA 3EYYA 4CYDA 4QWQA 2CYYA 1R00A 2QBYB 3E6DA 5DD8A 1XDSA 1K7AA 5E8GA 3C3WA 3F8NA 1GXQA 5JI6A 3GO5A 3FF5A 1JXSA 4OIQF 4HQMA 2K27A 3FHZA 2E1CA 3HHHA 3P9IA 3MCZA 2XROA 2DFIA 1MJAA 2VBZA 3F6VA 1TNSA 1WQ2A 2HZTA 4MQVA 4CZZA 2HTJA 2J5OA 4A0ZA 2D45A 2QLZA 3IRRA 1O3QA 1Z6RA 4Z2YA 1DP7P 2IVMA 1O3SA 1YTYA 1Q1HA 5TRDA 2KKOA 1U6GA 1TBXA 3DF8A 4WXHA 1ZLJA 1FSHA 2RQPA 2EK5A 3I58A 2BE5F 1BI0A 4G7ZF 2O03A 1X3UA 1Z91A 2W85A 3KZYA 1Z9CA 1RIOH 1TW3A 3P9KA 1BJAA 2DT5A 4HX7A 3TOAA 1SD6A 3PFIA 1USSA 3R6SA 2VOOA 3K2ZA 4P9UA 1KU3A 1T39A 2BBYA 1U3EM 4RGXA 3VFZA 1FY7A 3ZQ7A 4XRFA 3CJNA 4RB2C 5F1RA 1U5TB 4CICA 4IF4A 4ESFA 1K78B 3ZMDA 3RJPA 3CTAA 2L4MA 5LGUA 4KMUX 5L3EA 1J9IA 4HYEA 4UVBA 4A6DA 2OQRA 3HRTA 3ZPLA 3HHGA 2RDPA 2PI0A 3BWGA 4GCVA 4PZJA 5HDKA 2ZNYA 2Q2EA 3D5LA 3V8JA 2EA4A 3H3UA 5J6XA 2PQ8A 1IZ1A 3HRUA 1ZGAA 3MAJA 1XGOA 4ENKA 1W7PB 3RPQA 2XKOA 1U78A 4N0BA 2FBIA 3N97A 1FWZA 3WE2A 2XAQA 3KEOA 5E1XA 1MD0A 2JPBA 4WK8F 1MGTA 2XHKA 3HRSA 5ICGA 1ZRDA 4HA8A 1HW1A 2ZCWA 1YW9A 5LLQA 2EFQA 1B59A 2GXGA 5EEGA 1P4AA 2YU3A 1ON1A 3EETA 1OYYA 2PFBA 4BHCA 4IXAA 3CDHA 2FMLA 3I71A 3ISPA 4U7BA 4H0EA 4CHUA 4IRHA 1IXSB 3KP3A 1D3YA 2A68F 3LWFA 4Y17A 3TDZC 4A2UA 4IRIA 1RUNA 4RGSA 1J7KA 3SHFA 2BGCA 4O5VA 5D6FA 2FQ3A 3IC7A 2PJPA 2HQRA 3SZTA 4HBLA 1K79A 3IRQA 1XD7A 3TKYA 3BJOA 4HX4A 4BH9A 2D1VA 1W5SA 4ETSA 4MEXF 2TDXA 2QQBA 1IRGA 1OYWA 1B4AA 2LSOA 2CQKA 3F3XA 5AIPA 3B73A 2EV0A 2IP2A 3GWZA 3OOPA 3R4KA 3JTGA 1E2XA 5D8KB 2ZMEB 4IVNA 3E5XA 5CVUA 3F8BA 3HTSB 1KU2A 1F4KA 1S6LA 1G3YA 4XSZF 3PQKA 1Z6TA 2ESHA 4EVIA 4KN4X 5L3DA 5K1YA 5JHUA 4ON0A 1T98A 4OIOF 3NRVA 2FE3A 1AOYA 3BPXA 3WGGA 1BM9A 3IWFA 2V1UA 4AIHA 3IKTA 5D5UB 2EV6A 2EWNA 2NS0A 2XIGA 1TNTA 3WTVC 1S8NA 1L3LA 2PEXA 1DDNA 4LGWA 1K6OA 3V4GA 3WG9A 2KIMA 4HF1A 4HF0A 2IRFG 1O7FA 5D8LB 3BZ6A 3F8MA 3ABTA 2K4BA 2JT1A 4HF2A 3RI4A 3R0AA 1GVJA 2DAOA 2FBKA 2K02A 5F64A 5D5VB 2XVCA 5FLXZ 4HAMA 4L9VA 4AD9A 1I6XA 1YW8A 3KP4A 2ADUA 5JVTA 4Q48A 1U5TC 3ML6A 3CUQC 2Y48A 1TQMA 3TOBA 3HOTA 4N9HA 2VBXA 1JGSA 4ZH4F 1K78A 4U88A 2XRNA 1JE8A 1J0RA 4O6JA 3U2RA 2VN2A 2NAZA 4EMSA 2L4AA 2M30A 2CFXA 4G8XA 2OA4A 4BQAA 3QU3A 5DCMA 4HLYA 5HLHA 3MFKA 3JSPA 1B9MA 4Q4ZF 3R61A 3DP7A 3J81K 3F22A 2HYFA 2FMYA 4LG0B 4UUVA 1XGSA 3K1PA 4L5IA 1ZYRF 3E6MA 1H9GA 2W24A 3LAJA 4M9ZA 4P55A 5L3FA 3SQNA 4HX8A 1ZGJA 2A61A 4KA4A 1OYIA 5DUIA 3HRMA 3WTWC 2KIFA 1YS6A 2K86A 2P5LC 2FF4A 4IHSA 3SZPA 3M8EA 2M5WA 5E8IA 3BROA 1HKTA 1J5YA 2HS5A 1R23A 3R60A 3NEUA 2NNYA 4D0PA 3HTUA 4S04A 2P6TA 3D0SA 3RIRA 3TGNA 3V8KA 2HKXA 1XCVA 1HW5A 2M45A 3CO7C 1JHHA 4JK1X 1HXDA 2MH9A 2ZJ2A 4I09A 5D5XB 1BC8C 1LEBA 3Q5FA 3R0JA 2JSCA 3V7CA 5LEJA 1L0OC 1WI9A 2LNBA 1OMIA 3CLOA 2WWYA 2MH2A 1Z05A 1LVAA 1ZH5A 1XN7A 3T0YA 2EFOA 4RAYA 4RB0A 4GGGA 4YIIA 1T0FA 2CO5A 3T8TA 2ISYA 5ILUA 2QQAA 2FXAA 2RKHA 2HEOA 1XGMA 1SMTA 4CGZA 5AIQA 4KUMA 2AXLA 3JAMK 4A12A 2F2EA 5J8FA 3BJAA 2F5CA 4I0AA 5FGMA 5LHHA 1LNWA 4LFUA 1R22A 1KGSA 3COAC 2JRTA 1RI7A 1QZZA 2MD5A 4HZFA 5FO5A 1D8KA 3QP6A 3FXQA 1HBXG 3M7GA 3RKXA 2EB7A 1ZRFA 4I2OA 3WU1B 4S05A 3MEXA 3WODF 4IHTA 2GAUA 1TW2A 3P7NA 3GW2A 2YX7A 3FZVA 2FU4A 4M73A 1A04A 2DQRA 1HSTA 4YIFA 2KRFA 4PCQA 2CWEA 1QPMA 2UWMA 3VODA 4KN7X 3OV8A 4CO8A 1MKMA 1STZA 3E6CC 3MZHA 3KP5A 1YYVA 2VE9A 1I1GA 3KZZA 5LGTA 1Z1DA 2W84A 5L3BA 1DUXC 3F21A 4MNUA 3K69A 1O7LA 5BPDA 3KP6A 5D6EA 3HUGA 3I4PA 1JHFA 1G3TA 1OKRA 1OPCA 3ZMSA 2ZKZA 3M9AA 2H09A 5DD4A 1ZRCA 3EUHA 1BIAA 3LFKA 1ZHFA 3V8LA 1UCRA 1YFHA 3BDDA 4E70A 2M8EA 4EM0B 2DO7A 2STWA 1MZBA 2DK5A 5DCMB 2A6EF 1IAWA 4KDPA 1IRFA 4LJZF 4G7OF 2RV8A 1YS7A 5FB2A 3E3VA 5KK1A 2RN7A 3GX4X 2XUBA 5CVJA 1XGNA 5ERIA 3V7SA 3BJ6A 2IA2A 4WWCA 2LDUA 4HV6A 4I0BA 4EM1A 1SD7A 2W25A 5AONA 5F6FA 4EJUA 3J7AO 1R1VA 4EJOA 4ENJA 2JZYA 1VTNC 4IPAA 1GXPA 1J2XA 5DV5A 3E97A 2CW0F 3F6OA 4ZZLA 1REPC 2YPRA 1RZ4A 3DEUA 4M71A 2YSRA 4RB3C 2XASA 4PDKA 4ZYHA 2OZ6A 4BHPA 3HYIA 2ZNZA 4HQEA 3JSOA 2COMA 2G7UA 4UHTA 3I0TA 4RB1A 1IW7F 2VODA 2ETHA 4RGRA 2B0LA 3M1EA 3HSEA 2XV4S 1SD5A 1R58A 2EFWA 3WTXC 5LRRA 1IUYA 3QRFF 2J5PA 1PDNC 2P5VA 3QPHA 2OD5A 4XLPF 4LK0F 1G3WA 2DU9A 3GFJA 2IA0A 5IT9Z 2VBWA 3C1DA 2EA2A 2XAFA 1O57A 2XKPA 4TV7A 1IXCA 1YIOA 1ONVA 3KCCA 3KLNA 4KT5C 1MJ9A 4QLCU 2Z99A 4L5JA 2KJCA 5BS6A 2A07F 3PQJA 6PAXA 3BPVA 3TQNA 5JR3A 4WXDA 2MC3A 2HWVA 2D1HA 1FP1D 3ZN1A 1HSJA 3ECOA 4OIRF 2DK8A 3MQ0A 4U0VA 1KU7A 3DPTA 1SMYF 2RNJA 2XGXA 2QWWA 2FEZA 4OMYA 3LQQA 4LD5A 3NQOA 4DNCA 2CGPA 1FYKA 4B8XA 2GXBA 1I1SA 1KQ8A 1D5VA 3WTZA 2HDCA 1I5ZA 2GZWA 3JW4A 1FC3A 3HSRA 1MJBA 2XAJA 3TO7A 3ZMUA 5J8CA 2MLGA 5E1ZB 5ICCA 4A6EA 2LF7A 1RNLA 3DXJF 4YFNF 2V79A 1FP2A 4LB6B 5HDGA 1NHAA 5HS7A 1ZG5A 4MGRA 1T6SA 4G9YA 3O6BB 2DW4A 2FNAA 3LA3A 1C0WA 4K2EA 3WTSC 1KA8A 1TQIA 4EQQA 3ZN0A 2R3SA 2M87A 4GXOA 3WTYC 2A6HF 3RYPA 2K4JA 2ACJA 4NHJA 3RDIA 3L2CA 1XDUA 1T2KA 3CUQB 3DFGA 4ASNA 3DPLC 4R8HA 5E1WA 1U2WA 4LLLA 1KQ0A 1USTA 4AWXB 4UVCA 4WCGA 4UV9A 1BN5A 2YR2A 1QO0D 5BQTA 3BP8A 3VOEA 5IT9K 1WRJA 4UNOA 2VC1A 1S3JA 5HVQC 2L54A 3RYRA 4P9FA 1GHCA 4HOBA 1AWCA 1PUEE 4R79A 1PP7U 4G7HF 1ZG1A 1LJ9A 1B9NA 3I59B 1LDKB 1XCBA 1E17A 2DQLA 1UHMA 4I7HA 2HQNA 4U0WA 1SD4A 5FD6A 4YG2F 2V6CA 1CF7B 1LEAA 4KNYA 3B02A 1HKQA 3O2PE 5L3CA 3GUDA 1BBYA 3C7JA 4OMZA 4MQ9F 1BI3A 4RAZA 2FA5A 3FM3A 3GEZA 4ZZDA 5BOXA 4ZYEA 2IA1A 4NQWA 4EGZA 4R1HA 1LDDA 4B09A 2UXXA 2QM3A 1SFXA 4JQFA 1LQ1A 2WV0A 4ZYDA 3Q9SA 1G4DA 4XLNF 5H6QA 3GFIA 2CG4A 3V7RA 3P9CA 1HKSA 3F23A 4BXUA 1IF1A 4ENNA 1IN7A 2STTA 1XB4A 1CGPA 2EFPA 1R5HA 3I53A 4L9NA 2DTRA 3QOPA 3FWEA 2H27A 5DEQA 3CUOA 1FX7A 5DUKA 3QP5A 2LKPA 2O6GE 3CUQA 2JPCA 1FBSA 1WSUA 1YG2A 3ABUA 3O3KA 3FMQA 3EDPA 1H9TA 2HGCA 3GYHX 5LHGA 2XAHA 5FFXA 1P6RA 3KP2A 1FYLA 1ZREA 2O3FA 4ESJA 4L0ZB 3Q9VA 5DYMA 1FLIA 4PGGA 3J80K 2X0LA 1UB9A 2FNPA 4FX4A 4M9SA 3GFLA 2A5YB 1F1ZA 2PMHA 1KQ9A 4FHTA 2K7LA 5E20A 1ON2A 4ENMA 2DPUA 4KFCA 1FT9A 4IRGA 1EH8A 4G6QA 1U8RA 3WE3A 3L09A 1I27A 1KU9A 4OU0A 3ELKA 3GF2A 4BYYA 1QBJA 3U9GA 2ISZA 2Z9OA 3IL2A 2F5EA 1SAXA 4EJVA 2H6CA 5DDGA 2VONA 3WU0A 5LEKA 3GVAA 2EV5A 3EQLF 2P7CB 1W4MA 2V9VA 2V1DA 4Q47A 4L18B 2HKOA 3TO6A 5K5RA 1W5TA 2HR3A 5K5OA 3KE2A 5LHIA 1PP8F 3G3ZA 1HW2A 3KEQA 2O8XA 4HW0A 4KIBA 2IPQX 1YO5C 3ZMVA 2HTSA 3ZMZA 3F8FA 4UVAA 4BNCA 1S29A 5LGNA 5KVRA 3GZ5A 1FSEA 2IT0A 2RVCA 2ZXJA 4FX0A 2C6YA 4I02A 1WKMA 1RUOA 4IJAA 4Q5SF 3ERED 4MEYF 5CLSA 5E17F 1MDMB 2R7FA 4F7ZA 1S7AA 2GWRA 2DPDA 4YFKF 3KFWX 2DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYM A;  5ILS A;  3K1N A;  2H6B A;  5LRS A;  5BPI A;  5E18 F;  4OIP F;  1R7J A;  1D8J A;  1LB2 A;  4KIG A;  3W6K B;  2OU2 A;  4OIN F;  5D4S A;  2ZFW A;  5HS9 A;  3LAP A;  2V1X A;  1EH7 A;  3J81 Z;  2MA3 A;  2Y75 A;  1W7P D;  4I01 A;  2R7D A;  3RTR A;  3EYI A;  2P5K A;  1WWX A;  3JTH A;  2VE8 A;  2VXZ A;  4AIK A;  2XAG A;  4I98 B;  4CDG A;  1XMK A;  1OR7 A;  2GIV A;  1QZY A;  2QEN A;  2LF8 A;  2OQG A;  5FD5 A;  5ED4 A;  2VBY A;  2JTV A;  1LDJ A;  2M1B A;  5L3G A;  1IN8 A;  1B1B A;  5FFZ A;  2FRH A;  1ZAR A;  4HV5 A;  2EJR A;  4KIF A;  4KMF A;  4G94 A;  1UHW A;  1P92 A;  1CF7 A;  2Z3Y A;  3K9T A;  3FMR A;  3ZMT A;  3WGI A;  4A0X A;  4M6Y A;  4L9T A;  3I59 A;  2FBH A;  3N4M A;  5CVV A;  2HOE A;  3RKW A;  1QGP A;  2IJL A;  2VT3 A;  5TJJ A;  1F9N A;  2P4W A;  5ILV A;  3KLO A;  1R1U A;  4AIJ A;  4EJW A;  2ZO4 A;  4EJT A;  1B6A A;  5HDN A;  3GZ6 A;  5D5W B;  4PGH A;  2E7W A;  4U7D A;  3RPU A;  2PLY A;  2PN6 A;  3WTT C;  3I5U A;  4U0Y A;  1XSD A;  4Y13 A;  3C18 A;  1P4W A;  3VB2 A;  2ESN A;  1XSV A;  2P8T A;  1BIB A;  2BV6 A;  4G6D A;  2E7X A;  4A5M A;  1TQP A;  1T38 A;  1YQA A;  1FBQ A;  4N9I A;  4EV0 A;  4EGY A;  3T1B A;  1G6N A;  4M6X A;  5EEH A;  2KJB A;  3TDU C;  1W7P A;  4CXF A;  4JBA A;  4FT8 A;  5H6R A;  1DPR A;  3K1M A;  1O3T A;  3H92 A;  2QVO A;  3FM5 A;  1F5T A;  3HIF A;  1XMA A;  1TLH B;  2KIU A;  4GYI A;  3BOQ A;  5LBQ A;  1R5G A;  4AVP A;  1FNN A;  2W57 A;  4LMY A;  1TTY A;  3W6J B;  3GLX A;  2PBI A;  3REO A;  1EV7 A;  3ROU A;  4YFX F;  3TO9 A;  2P7V B;  3JAM Z;  1O3R A;  1IN5 A;  4NB5 A;  1S7O A;  2Z33 A;  3QAH A;  3FXU A;  1V3F A;  4MTE A;  3BY6 A;  2ELH A;  2F5F A;  1YW7 A;  3K0L A;  4KIC A;  1J75 A;  2E1N A;  3WGH A;  2GA2 A;  1KYZ A;  1U5T A;  2P6S A;  1BI1 A;  3ULQ B;  3MZY A;  5HLI A;  5HOO A;  5A2Q K;  3FMS A;  1ODD A;  4XSX F;  2UZK A;  2OZU A;  4GO1 A;  1R1T A;  1XSX A;  3GXO A;  3SXY A;  4EM2 A;  4A5N A;  4M74 A;  1P4X A;  1V4R A;  2CSO A;  3FXR A;  2MBF A;  4DQ2 A;  2L01 A;  2NNN A;  2QYO A;  1FPQ A;  3WTU C;  2FSW A;  4MTD A;  1IN6 A;  3ZP5 A;  4WXC A;  4GYG A;  3RKY A;  4KYW A;  2GA1 A;  3IKV A;  4L0Y B;  2QBY A;  2O61 A;  2QQ9 A;  1ZG3 A;  4L9J A;  5CVR A;  2ZME A;  3AAF A;  2X4H A;  2Q0O A;  1ULY A;  5ICE A;  4WX9 A;  1IXR C;  2A3S A;  2OBP A;  5A2Q Z;  2RC4 A;  4UV8 A;  2L3D A;  4A0Y A;  1Y0U A;  4ESB A;  3KET A;  4ZYG A;  3F72 A;  4LB5 A;  2WTE A;  3FX3 A;  3G73 A;  2L02 A;  3ECH A;  4BHB A;  4P5O A;  3T5X A;  5ICF A;  4MHG A;  4M9X A;  1KYW A;  2NRA C;  5BMZ A;  4RGU A;  5K5Q A;  2FOK A;  3HSF A;  3LST A;  1ZN2 A;  2H94 A;  3E5Q A;  5DCF A;  2VT2 A;  4LLN A;  5IT3 A;  4O3M A;  3I54 A;  1G3S A;  1Z7U A;  3DQV C;  4LG0 A;  3S2W A;  2WC2 A;  5JFR A;  1MDM A;  2NYX A;  3E6B A;  1R36 A;  3LA7 A;  3J80 Z;  2AS5 F;  2QUF A;  3U1D A;  3VEP A;  1FZP B;  3T8R A;  1IN4 A;  3IHU A;  1HQC A;  2F5D A;  4LLG F;  2VC0 A;  2DBB A;  2HFH A;  3IWZ A;  1BC7 C;  2PMU A;  3LQR A;  1BOA A;  1DPU A;  3L00 A;  2A69 F;  3H3Z A;  2Y0M A;  5HS8 A;  5HLG A;  1P2F A;  2D2W A;  3E5U A;  2Z5U A;  4OOI A;  1QNT A;  3KP7 A;  4HDV A;  5H20 A;  2MLK A;  3MWM A;  1H0M A;  1ZLK A;  5FLX K;  3HOS A;  2RGV A;  2EFN A;  4BAY A;  1QQI A;  2OAZ A;  1FOK A;  5D4R A;  1ZAO A;  3LA2 A;  1BI2 A;  4WF2 A;  4HDU A;  3I64 A;  4RS8 A;  1FBU A;  2G9W A;  2IW5 A;  4UXN A;  2Q8K A;  3DV8 A;  2YX4 A;  3QU6 A;  3F8C A;  4LK1 F;  2BEO A;  3GFM A;  3L9F A;  1YLF A;  3DKW A;  5CVI A;  2UXN A;  3CO6 C;  3L7W A;  3M8F A;  2HYG D;  4P96 A;  1SFU A;  2QZ8 A;  3QPT A;  4XBF A;  2GQQ A;  2G7H A;  5CJ9 A;  5CYV A;  1UFM A;  4Y15 A;  2VOP A;  2O0Y A;  2ZBK A;  1EH6 A;  1J59 A;  2PG4 A;  2BYV E;  1SFE A;  4M72 A;  3SFZ A;  2DI3 A;  4HLX A;  3EYY A;  4CYD A;  4QWQ A;  2CYY A;  1R00 A;  2QBY B;  3E6D A;  5DD8 A;  1XDS A;  1K7A A;  5E8G A;  3C3W A;  3F8N A;  1GXQ A;  5JI6 A;  3GO5 A;  3FF5 A;  1JXS A;  4OIQ F;  4HQM A;  2K27 A;  3FHZ A;  2E1C A;  3HHH A;  3P9I A;  3MCZ A;  2XRO A;  2DFI A;  1MJA A;  2VBZ A;  3F6V A;  1TNS A;  1WQ2 A;  2HZT A;  4MQV A;  4CZZ A;  2HTJ A;  2J5O A;  4A0Z A;  2D45 A;  2QLZ A;  3IRR A;  1O3Q A;  1Z6R A;  4Z2Y A;  1DP7 P;  2IVM A;  1O3S A;  1YTY A;  1Q1H A;  5TRD A;  2KKO A;  1U6G A;  1TBX A;  3DF8 A;  4WXH A;  1ZLJ A;  1FSH A;  2RQP A;  2EK5 A;  3I58 A;  2BE5 F;  1BI0 A;  4G7Z F;  2O03 A;  1X3U A;  1Z91 A;  2W85 A;  3KZY A;  1Z9C A;  1RIO H;  1TW3 A;  3P9K A;  1BJA A;  2DT5 A;  4HX7 A;  3TOA A;  1SD6 A;  3PFI A;  1USS A;  3R6S A;  2VOO A;  3K2Z A;  4P9U A;  1KU3 A;  1T39 A;  2BBY A;  1U3E M;  4RGX A;  3VFZ A;  1FY7 A;  3ZQ7 A;  4XRF A;  3CJN A;  4RB2 C;  5F1R A;  1U5T B;  4CIC A;  4IF4 A;  4ESF A;  1K78 B;  3ZMD A;  3RJP A;  3CTA A;  2L4M A;  5LGU A;  4KMU X;  5L3E A;  1J9I A;  4HYE A;  4UVB A;  4A6D A;  2OQR A;  3HRT A;  3ZPL A;  3HHG A;  2RDP A;  2PI0 A;  3BWG A;  4GCV A;  4PZJ A;  5HDK A;  2ZNY A;  2Q2E A;  3D5L A;  3V8J A;  2EA4 A;  3H3U A;  5J6X A;  2PQ8 A;  1IZ1 A;  3HRU A;  1ZGA A;  3MAJ A;  1XGO A;  4ENK A;  1W7P B;  3RPQ A;  2XKO A;  1U78 A;  4N0B A;  2FBI A;  3N97 A;  1FWZ A;  3WE2 A;  2XAQ A;  3KEO A;  5E1X A;  1MD0 A;  2JPB A;  4WK8 F;  1MGT A;  2XHK A;  3HRS A;  5ICG A;  1ZRD A;  4HA8 A;  1HW1 A;  2ZCW A;  1YW9 A;  5LLQ A;  2EFQ A;  1B59 A;  2GXG A;  5EEG A;  1P4A A;  2YU3 A;  1ON1 A;  3EET A;  1OYY A;  2PFB A;  4BHC A;  4IXA A;  3CDH A;  2FML A;  3I71 A;  3ISP A;  4U7B A;  4H0E A;  4CHU A;  4IRH A;  1IXS B;  3KP3 A;  1D3Y A;  2A68 F;  3LWF A;  4Y17 A;  3TDZ C;  4A2U A;  4IRI A;  1RUN A;  4RGS A;  1J7K A;  3SHF A;  2BGC A;  4O5V A;  5D6F A;  2FQ3 A;  3IC7 A;  2PJP A;  2HQR A;  3SZT A;  4HBL A;  1K79 A;  3IRQ A;  1XD7 A;  3TKY A;  3BJO A;  4HX4 A;  4BH9 A;  2D1V A;  1W5S A;  4ETS A;  4MEX F;  2TDX A;  2QQB A;  1IRG A;  1OYW A;  1B4A A;  2LSO A;  2CQK A;  3F3X A;  5AIP A;  3B73 A;  2EV0 A;  2IP2 A;  3GWZ A;  3OOP A;  3R4K A;  3JTG A;  1E2X A;  5D8K B;  2ZME B;  4IVN A;  3E5X A;  5CVU A;  3F8B A;  3HTS B;  1KU2 A;  1F4K A;  1S6L A;  1G3Y A;  4XSZ F;  3PQK A;  1Z6T A;  2ESH A;  4EVI A;  4KN4 X;  5L3D A;  5K1Y A;  5JHU A;  4ON0 A;  1T98 A;  4OIO F;  3NRV A;  2FE3 A;  1AOY A;  3BPX A;  3WGG A;  1BM9 A;  3IWF A;  2V1U A;  4AIH A;  3IKT A;  5D5U B;  2EV6 A;  2EWN A;  2NS0 A;  2XIG A;  1TNT A;  3WTV C;  1S8N A;  1L3L A;  2PEX A;  1DDN A;  4LGW A;  1K6O A;  3V4G A;  3WG9 A;  2KIM A;  4HF1 A;  4HF0 A;  2IRF G;  1O7F A;  5D8L B;  3BZ6 A;  3F8M A;  3ABT A;  2K4B A;  2JT1 A;  4HF2 A;  3RI4 A;  3R0A A;  1GVJ A;  2DAO A;  2FBK A;  2K02 A;  5F64 A;  5D5V B;  2XVC A;  5FLX Z;  4HAM A;  4L9V A;  4AD9 A;  1I6X A;  1YW8 A;  3KP4 A;  2ADU A;  5JVT A;  4Q48 A;  1U5T C;  3ML6 A;  3CUQ C;  2Y48 A;  1TQM A;  3TOB A;  3HOT A;  4N9H A;  2VBX A;  1JGS A;  4ZH4 F;  1K78 A;  4U88 A;  2XRN A;  1JE8 A;  1J0R A;  4O6J A;  3U2R A;  2VN2 A;  2NAZ A;  4EMS A;  2L4A A;  2M30 A;  2CFX A;  4G8X A;  2OA4 A;  4BQA A;  3QU3 A;  5DCM A;  4HLY A;  5HLH A;  3MFK A;  3JSP A;  1B9M A;  4Q4Z F;  3R61 A;  3DP7 A;  3J81 K;  3F22 A;  2HYF A;  2FMY A;  4LG0 B;  4UUV A;  1XGS A;  3K1P A;  4L5I A;  1ZYR F;  3E6M A;  1H9G A;  2W24 A;  3LAJ A;  4M9Z A;  4P55 A;  5L3F A;  3SQN A;  4HX8 A;  1ZGJ A;  2A61 A;  4KA4 A;  1OYI A;  5DUI A;  3HRM A;  3WTW C;  2KIF A;  1YS6 A;  2K86 A;  2P5L C;  2FF4 A;  4IHS A;  3SZP A;  3M8E A;  2M5W A;  5E8I A;  3BRO A;  1HKT A;  1J5Y A;  2HS5 A;  1R23 A;  3R60 A;  3NEU A;  2NNY A;  4D0P A;  3HTU A;  4S04 A;  2P6T A;  3D0S A;  3RIR A;  3TGN A;  3V8K A;  2HKX A;  1XCV A;  1HW5 A;  2M45 A;  3CO7 C;  1JHH A;  4JK1 X;  1HXD A;  2MH9 A;  2ZJ2 A;  4I09 A;  5D5X B;  1BC8 C;  1LEB A;  3Q5F A;  3R0J A;  2JSC A;  3V7C A;  5LEJ A;  1L0O C;  1WI9 A;  2LNB A;  1OMI A;  3CLO A;  2WWY A;  2MH2 A;  1Z05 A;  1LVA A;  1ZH5 A;  1XN7 A;  3T0Y A;  2EFO A;  4RAY A;  4RB0 A;  4GGG A;  4YII A;  1T0F A;  2CO5 A;  3T8T A;  2ISY A;  5ILU A;  2QQA A;  2FXA A;  2RKH A;  2HEO A;  1XGM A;  1SMT A;  4CGZ A;  5AIQ A;  4KUM A;  2AXL A;  3JAM K;  4A12 A;  2F2E A;  5J8F A;  3BJA A;  2F5C A;  4I0A A;  5FGM A;  5LHH A;  1LNW A;  4LFU A;  1R22 A;  1KGS A;  3COA C;  2JRT A;  1RI7 A;  1QZZ A;  2MD5 A;  4HZF A;  5FO5 A;  1D8K A;  3QP6 A;  3FXQ A;  1HBX G;  3M7G A;  3RKX A;  2EB7 A;  1ZRF A;  4I2O A;  3WU1 B;  4S05 A;  3MEX A;  3WOD F;  4IHT A;  2GAU A;  1TW2 A;  3P7N A;  3GW2 A;  2YX7 A;  3FZV A;  2FU4 A;  4M73 A;  1A04 A;  2DQR A;  1HST A;  4YIF A;  2KRF A;  4PCQ A;  2CWE A;  1QPM A;  2UWM A;  3VOD A;  4KN7 X;  3OV8 A;  4CO8 A;  1MKM A;  1STZ A;  3E6C C;  3MZH A;  3KP5 A;  1YYV A;  2VE9 A;  1I1G A;  3KZZ A;  5LGT A;  1Z1D A;  2W84 A;  5L3B A;  1DUX C;  3F21 A;  4MNU A;  3K69 A;  1O7L A;  5BPD A;  3KP6 A;  5D6E A;  3HUG A;  3I4P A;  1JHF A;  1G3T A;  1OKR A;  1OPC A;  3ZMS A;  2ZKZ A;  3M9A A;  2H09 A;  5DD4 A;  1ZRC A;  3EUH A;  1BIA A;  3LFK A;  1ZHF A;  3V8L A;  1UCR A;  1YFH A;  3BDD A;  4E70 A;  2M8E A;  4EM0 B;  2DO7 A;  2STW A;  1MZB A;  2DK5 A;  5DCM B;  2A6E F;  1IAW A;  4KDP A;  1IRF A;  4LJZ F;  4G7O F;  2RV8 A;  1YS7 A;  5FB2 A;  3E3V A;  5KK1 A;  2RN7 A;  3GX4 X;  2XUB A;  5CVJ A;  1XGN A;  5ERI A;  3V7S A;  3BJ6 A;  2IA2 A;  4WWC A;  2LDU A;  4HV6 A;  4I0B A;  4EM1 A;  1SD7 A;  2W25 A;  5AON A;  5F6F A;  4EJU A;  3J7A O;  1R1V A;  4EJO A;  4ENJ A;  2JZY A;  1VTN C;  4IPA A;  1GXP A;  1J2X A;  5DV5 A;  3E97 A;  2CW0 F;  3F6O A;  4ZZL A;  1REP C;  2YPR A;  1RZ4 A;  3DEU A;  4M71 A;  2YSR A;  4RB3 C;  2XAS A;  4PDK A;  4ZYH A;  2OZ6 A;  4BHP A;  3HYI A;  2ZNZ A;  4HQE A;  3JSO A;  2COM A;  2G7U A;  4UHT A;  3I0T A;  4RB1 A;  1IW7 F;  2VOD A;  2ETH A;  4RGR A;  2B0L A;  3M1E A;  3HSE A;  2XV4 S;  1SD5 A;  1R58 A;  2EFW A;  3WTX C;  5LRR A;  1IUY A;  3QRF F;  2J5P A;  1PDN C;  2P5V A;  3QPH A;  2OD5 A;  4XLP F;  4LK0 F;  1G3W A;  2DU9 A;  3GFJ A;  2IA0 A;  5IT9 Z;  2VBW A;  3C1D A;  2EA2 A;  2XAF A;  1O57 A;  2XKP A;  4TV7 A;  1IXC A;  1YIO A;  1ONV A;  3KCC A;  3KLN A;  4KT5 C;  1MJ9 A;  4QLC U;  2Z99 A;  4L5J A;  2KJC A;  5BS6 A;  2A07 F;  3PQJ A;  6PAX A;  3BPV A;  3TQN A;  5JR3 A;  4WXD A;  2MC3 A;  2HWV A;  2D1H A;  1FP1 D;  3ZN1 A;  1HSJ A;  3ECO A;  4OIR F;  2DK8 A;  3MQ0 A;  4U0V A;  1KU7 A;  3DPT A;  1SMY F;  2RNJ A;  2XGX A;  2QWW A;  2FEZ A;  4OMY A;  3LQQ A;  4LD5 A;  3NQO A;  4DNC A;  2CGP A;  1FYK A;  4B8X A;  2GXB A;  1I1S A;  1KQ8 A;  1D5V A;  3WTZ A;  2HDC A;  1I5Z A;  2GZW A;  3JW4 A;  1FC3 A;  3HSR A;  1MJB A;  2XAJ A;  3TO7 A;  3ZMU A;  5J8C A;  2MLG A;  5E1Z B;  5ICC A;  4A6E A;  2LF7 A;  1RNL A;  3DXJ F;  4YFN F;  2V79 A;  1FP2 A;  4LB6 B;  5HDG A;  1NHA A;  5HS7 A;  1ZG5 A;  4MGR A;  1T6S A;  4G9Y A;  3O6B B;  2DW4 A;  2FNA A;  3LA3 A;  1C0W A;  4K2E A;  3WTS C;  1KA8 A;  1TQI A;  4EQQ A;  3ZN0 A;  2R3S A;  2M87 A;  4GXO A;  3WTY C;  2A6H F;  3RYP A;  2K4J A;  2ACJ A;  4NHJ A;  3RDI A;  3L2C A;  1XDU A;  1T2K A;  3CUQ B;  3DFG A;  4ASN A;  3DPL C;  4R8H A;  5E1W A;  1U2W A;  4LLL A;  1KQ0 A;  1UST A;  4AWX B;  4UVC A;  4WCG A;  4UV9 A;  1BN5 A;  2YR2 A;  1QO0 D;  5BQT A;  3BP8 A;  3VOE A;  5IT9 K;  1WRJ A;  4UNO A;  2VC1 A;  1S3J A;  5HVQ C;  2L54 A;  3RYR A;  4P9F A;  1GHC A;  4HOB A;  1AWC A;  1PUE E;  4R79 A;  1PP7 U;  4G7H F;  1ZG1 A;  1LJ9 A;  1B9N A;  3I59 B;  1LDK B;  1XCB A;  1E17 A;  2DQL A;  1UHM A;  4I7H A;  2HQN A;  4U0W A;  1SD4 A;  5FD6 A;  4YG2 F;  2V6C A;  1CF7 B;  1LEA A;  4KNY A;  3B02 A;  1HKQ A;  3O2P E;  5L3C A;  3GUD A;  1BBY A;  3C7J A;  4OMZ A;  4MQ9 F;  1BI3 A;  4RAZ A;  2FA5 A;  3FM3 A;  3GEZ A;  4ZZD A;  5BOX A;  4ZYE A;  2IA1 A;  4NQW A;  4EGZ A;  4R1H A;  1LDD A;  4B09 A;  2UXX A;  2QM3 A;  1SFX A;  4JQF A;  1LQ1 A;  2WV0 A;  4ZYD A;  3Q9S A;  1G4D A;  4XLN F;  5H6Q A;  3GFI A;  2CG4 A;  3V7R A;  3P9C A;  1HKS A;  3F23 A;  4BXU A;  1IF1 A;  4ENN A;  1IN7 A;  2STT A;  1XB4 A;  1CGP A;  2EFP A;  1R5H A;  3I53 A;  4L9N A;  2DTR A;  3QOP A;  3FWE A;  2H27 A;  5DEQ A;  3CUO A;  1FX7 A;  5DUK A;  3QP5 A;  2LKP A;  2O6G E;  3CUQ A;  2JPC A;  1FBS A;  1WSU A;  1YG2 A;  3ABU A;  3O3K A;  3FMQ A;  3EDP A;  1H9T A;  2HGC A;  3GYH X;  5LHG A;  2XAH A;  5FFX A;  1P6R A;  3KP2 A;  1FYL A;  1ZRE A;  2O3F A;  4ESJ A;  4L0Z B;  3Q9V A;  5DYM A;  1FLI A;  4PGG A;  3J80 K;  2X0L A;  1UB9 A;  2FNP A;  4FX4 A;  4M9S A;  3GFL A;  2A5Y B;  1F1Z A;  2PMH A;  1KQ9 A;  4FHT A;  2K7L A;  5E20 A;  1ON2 A;  4ENM A;  2DPU A;  4KFC A;  1FT9 A;  4IRG A;  1EH8 A;  4G6Q A;  1U8R A;  3WE3 A;  3L09 A;  1I27 A;  1KU9 A;  4OU0 A;  3ELK A;  3GF2 A;  4BYY A;  1QBJ A;  3U9G A;  2ISZ A;  2Z9O A;  3IL2 A;  2F5E A;  1SAX A;  4EJV A;  2H6C A;  5DDG A;  2VON A;  3WU0 A;  5LEK A;  3GVA A;  2EV5 A;  3EQL F;  2P7C B;  1W4M A;  2V9V A;  2V1D A;  4Q47 A;  4L18 B;  2HKO A;  3TO6 A;  5K5R A;  1W5T A;  2HR3 A;  5K5O A;  3KE2 A;  5LHI A;  1PP8 F;  3G3Z A;  1HW2 A;  3KEQ A;  2O8X A;  4HW0 A;  4KIB A;  2IPQ X;  1YO5 C;  3ZMV A;  2HTS A;  3ZMZ A;  3F8F A;  4UVA A;  4BNC A;  1S29 A;  5LGN A;  5KVR A;  3GZ5 A;  1FSE A;  2IT0 A;  2RVC A;  2ZXJ A;  4FX0 A;  2C6Y A;  4I02 A;  1WKM A;  1RUO A;  4IJA A;  4Q5S F;  3ERE D;  4MEY F;  5CLS A;  5E17 F;  1MDM B;  2R7F A;  4F7Z A;  1S7A A;  2GWR A;  2DPD A;  4YFK F;  3KFW X;  2DLL A; 
#chains in the Genus database with same CATH topology
 1FYM A;  5ILS A;  4ZYA A;  2FJ1 A;  1WPK A;  3K1N A;  5M5W J;  3TL4 X;  2H6B A;  2ZXW H;  5LRS A;  5BPI A;  4XRS A;  5E18 F;  3GTG J;  3BCA A;  4OIP F;  1R7J A;  4IHW A;  1LKX A;  1D8J A;  3HOX J;  1LB2 A;  1Z3X A;  4KIG A;  3W6K B;  1Z21 A;  1UZC A;  2OU2 A;  4OIN F;  5EEA A;  5D4S A;  2QA4 I;  1TC3 C;  5CPR B;  2ZFW A;  5HS9 A;  3LAP A;  2V1X A;  1EH7 A;  3J81 Z;  4YEL A;  2MA3 A;  2Y75 A;  1W7P D;  4I01 A;  2R7D A;  3RTR A;  3EYI A;  2P5K A;  3U21 A;  2XF7 A;  1WWX A;  3JTH A;  3K6G A;  4X1E A;  2VE8 A;  3KZI C;  1TL8 A;  1XS9 A;  2VXZ A;  3H5R A;  1MMD A;  2KLO A;  3OYL A;  4AIK A;  1MBJ A;  2XAG A;  4I98 B;  4CDG A;  1B72 A;  2X85 A;  4FE4 A;  1XMK A;  1OR7 A;  3K10 A;  1R49 A;  2GIV A;  2XRL A;  1QZY A;  2QEN A;  4FET A;  2LF8 A;  2OQG A;  4QSH A;  2NS7 A;  5FD5 A;  4Y33 A;  5ED4 A;  2VBY A;  2ZSI B;  2JTV A;  4UUT A;  2BY0 A;  1LDJ A;  2M1B A;  4FTH A;  5IYB J;  5L3G A;  3OY9 A;  1IN8 A;  1Y8Q B;  1B1B A;  5FFZ A;  2FRH A;  2XF6 A;  3OYC A;  1ZAR A;  3IV5 A;  4A93 J;  2HPM A;  4HV5 A;  3LSP A;  3BR1 A;  2EJR A;  3W2V A;  3OYB A;  4BXF A;  4KIF A;  1OCO H;  4UB6 C;  1PUF B;  1ACI A;  4KMF A;  4G94 A;  1UHW A;  1P92 A;  1CF7 A;  2WV1 A;  2Z3Y A;  3K9T A;  5GTH C;  3FMR A;  4JX6 A;  3ZMT A;  3WGI A;  4A0X A;  3C2B A;  4M6Y A;  1FEX A;  4L9T A;  3I59 A;  1VQM I;  2HOT A;  1LUJ B;  2FBH A;  3N4M A;  5CVV A;  1V54 H;  2HOE A;  3LSJ A;  3RKW A;  2XB0 X;  1QGP A;  3WHC A;  4BAC A;  2IJL A;  2Z16 A;  5J47 A;  2VT3 A;  2V7F A;  3ZQF A;  5TJJ A;  3C2H A;  1F9N A;  5FKN A;  2P4W A;  5ILV A;  3KLO A;  4CCJ A;  1R1U A;  3CJQ B;  4AIJ A;  4EJW A;  4CH7 A;  2E1O A;  2ZO4 A;  3M1C A;  4EJT A;  1B6A A;  5HDN A;  3GZ6 A;  5D5W B;  2KRC A;  4PGH A;  4A3J J;  1QHG A;  1ZGW A;  2XGD A;  2E7W A;  1X1C A;  4U7D A;  3RPU A;  2QQ8 A;  2PLY A;  4MO7 A;  2D5V A;  1JUM A;  2KIQ A;  2PN6 A;  3WTT C;  3I5U A;  3OR1 C;  3GTK J;  4U0Y A;  1XSD A;  4Y13 A;  3C18 A;  1P4W A;  4XMY A;  2LMD A;  2JJ7 A;  3D1N I;  3VB2 A;  3J7A Y;  2IS2 A;  2ESN A;  1XSV A;  1R4M B;  2R4G A;  1I50 J;  4JX5 A;  2AO9 A;  4IHV A;  1KZH A;  3ESW B;  2P8T A;  1BIB A;  2XSJ C;  2BV6 A;  4G6D A;  2E7X A;  2V6E A;  2VKV A;  2IBD A;  1V55 H;  4A5M A;  3SJM A;  3CJT B;  2PJR A;  1TQP A;  1T38 A;  1YQA A;  1FBQ A;  4N9I A;  4EV0 A;  4J00 A;  4EGY A;  3T1B A;  1G6N A;  4M6X A;  5EEH A;  5J1R A;  1IO2 A;  1YE9 A;  4A3E J;  1Q1V A;  2MSY A;  2KJB A;  3TDU C;  1W7P A;  4CXF A;  4JBA A;  3S3M A;  1POG A;  4FT8 A;  5H6R A;  1DPR A;  3K1M A;  1MNM C;  1O3T A;  3H92 A;  1Y39 A;  2QVO A;  3FM5 A;  2CUE A;  1FJL A;  2WB1 N;  2K9Q A;  3OYM A;  1F5T A;  2DA7 A;  3HIF A;  1PYV A;  4UUS A;  3AL0 B;  1XMA A;  1TLH B;  2KIU A;  3LSG A;  2GIZ A;  4GYI A;  3EPZ A;  3VSK A;  3BOQ A;  5IP7 J;  1ZR4 A;  2NVT J;  1VQ6 I;  5LBQ A;  1R5G A;  1XC5 A;  5EG0 B;  4AVP A;  1PUF A;  1FNN A;  1SVO A;  2W57 A;  2Q1Z B;  1ETQ A;  1TTY A;  4LMY A;  3W6J B;  3GLX A;  1R9T J;  2PBI A;  3REO A;  4BUP A;  1EV7 A;  3ROU A;  3PIO F;  2OJE D;  1YX5 A;  2WAQ A;  3S8P A;  2DMU A;  4YFX F;  4C9Y A;  2JRM A;  2EQR A;  3DU6 A;  3TO9 A;  2P7V B;  1F43 A;  3JAM Z;  2W7N A;  3GTM J;  1O3R A;  3DLA A;  1IN5 A;  4NB5 A;  1S7O A;  3G1O A;  2Z33 A;  3QAH A;  3S1Q J;  3FXU A;  1RRJ A;  1V3F A;  4MTE A;  1FOX A;  3JRB A;  2Y9Z A;  2ZXH A;  3BY6 A;  2ELH A;  2F5F A;  1YW7 A;  3K0L A;  4KIC A;  1J75 A;  1WJA A;  3IH2 A;  2E1N A;  3WGH A;  4B1R A;  2GA2 A;  1OCT C;  2L9N A;  4E6K G;  5HLT A;  4FAS D;  1KYZ A;  1U5T A;  2CQX A;  1BI1 A;  2P6S A;  3A0H C;  3ULQ B;  3MZY A;  1AA7 A;  5HLI A;  3BTC A;  2GOM A;  5HOO A;  5A2Q K;  3FMS A;  1ODD A;  1X4P A;  4LIV A;  4BE0 A;  2MG4 A;  3CCQ I;  4XSX F;  2UZK A;  2OZU A;  4GO1 A;  1R1T A;  2XGC A;  1XSX A;  3GXO A;  3HDD A;  2HPI A;  1Y56 A;  4E7L A;  4IOA F;  3SXY A;  2VKH A;  4EM2 A;  3JRG A;  4A5N A;  2FX0 A;  4M74 A;  1X1A A;  1P4X A;  1HDP A;  3E7L A;  1V4R A;  2CSO A;  2IGM A;  2MBF A;  3E1S A;  3FXR A;  1A35 A;  4DQ2 A;  2VJ4 A;  2H1L A;  2L01 A;  2JA7 J;  5FRO A;  2JVG A;  5DTD A;  2NNN A;  3PSF A;  2IGN A;  5CQE A;  4DYR A;  2QYO A;  3PO2 J;  1FPQ A;  1TP4 A;  3WTU C;  2FSW A;  4MTD A;  1RET A;  2DCE A;  1QHH D;  2L0K A;  1MW7 A;  1IN6 A;  4BGD A;  5K7F A;  2F48 A;  3ZP5 A;  4WXC A;  3TW6 A;  4GYG A;  3RKY A;  4KYW A;  2GA1 A;  2LYC A;  3IKV A;  4L0Y B;  2QBY A;  2L7Z A;  2O61 A;  2QQ9 A;  4UY8 I;  1ZG3 A;  4L9J A;  4FCY A;  5CVR A;  2ZME A;  4XIC A;  4XLA A;  3AAF A;  2DYR H;  4BE2 A;  2X4H A;  4CCL A;  2Q0O A;  1JKP C;  1ULY A;  5ICE A;  4WX9 A;  2DMT A;  3K4M A;  4AUX A;  3AL0 C;  1JUP A;  3OR2 C;  1IXR C;  5EYR A;  2A3S A;  5FRN A;  5B5E C;  2OBP A;  3FXK A;  2ZXI A;  1OJL A;  5A2Q Z;  2X6O A;  2RC4 A;  4UV8 A;  2L3D A;  1WVR A;  3PNT A;  4A0Y A;  2R7R A;  1Y0U A;  4ESB A;  1MMA A;  4CZC A;  3DWL E;  5BNG A;  4ZYG A;  3KET A;  3F72 A;  4LB5 A;  2WTE A;  3FX3 A;  2X48 A;  3HOY J;  1TWH J;  3S93 A;  4B44 A;  3G73 A;  3UNG C;  3H35 A;  2L02 A;  1WGX A;  4RBO A;  3ECH A;  4BHB A;  4P5O A;  3FXO A;  3T5X A;  1ETX A;  5ICF A;  4NC7 A;  4MHG A;  4M9X A;  1KYW A;  2NRA C;  3OYG A;  5BMZ A;  2BW3 B;  4RGU A;  5K5Q A;  3JR9 A;  4AM3 A;  1YJN I;  3MN2 A;  3OS0 A;  2FOK A;  2BY1 A;  4CCN A;  3HSF A;  5DM7 F;  3ZQQ A;  4A3F J;  3LST A;  5M5Y J;  2XAU A;  1ZN2 A;  2H94 A;  4A3B J;  2R7O A;  4RLQ A;  3E5Q A;  4ANJ A;  5DCF A;  2VT2 A;  1IGN A;  4LLN A;  5IT3 A;  4O3M A;  2DOE A;  3S14 J;  3I54 A;  1G3S A;  1YIT I;  1Z7U A;  3DQV C;  4LG0 A;  3S2W A;  5J1Y A;  2WC2 A;  2DA3 A;  3M8J A;  5JFR A;  1MDM A;  2NYX A;  3G1L A;  4DIQ A;  3E6B A;  1R36 A;  3LA7 A;  3J80 Z;  4YRV A;  2AS5 F;  2AQE A;  2QUF A;  1LFP A;  3U1D A;  3LFU A;  3VEP A;  1BR1 A;  3DTE A;  3QYE A;  3H0G J;  1FZP B;  2R7Z J;  3X2Q H;  3T8R A;  3I4M J;  3CF5 F;  1IN4 A;  1XTA A;  2ECC A;  3IHU A;  1VQ7 I;  1HQC A;  2XC7 A;  2F5D A;  2L2O A;  4LLG F;  2VC0 A;  3FKI J;  2DBB A;  2VPL A;  2XGE A;  2DOA A;  2HFH A;  3IWZ A;  2BXZ A;  1A36 A;  3L2U A;  1P9Q C;  1BC7 C;  1MBE A;  1X3Z B;  1IV8 A;  3KPH A;  3QQA A;  1A31 A;  1Z67 A;  2PMU A;  3LQR A;  2FQ4 A;  1E0E A;  1BOA A;  4KIT B;  1DPU A;  3HUG B;  3L00 A;  2A69 F;  5CKT A;  3ASO H;  1V5E A;  3H3Z A;  3MKW B;  3RQ4 A;  2X6X A;  2RNG A;  1JKO C;  2Y0M A;  5HS8 A;  1JJ8 C;  4ZTF A;  3RCO A;  1GT0 C;  3W6V A;  5HLG A;  1P2F A;  2D2W A;  3E5U A;  2Z5U A;  5IOY A;  2ZJR F;  4OOI A;  1QNT A;  3KP7 A;  2DT6 A;  5J4Y A;  2L5Q A;  3ABK H;  2HOA A;  2EIK H;  2Y0S N;  4HDV A;  1MBH A;  5H20 A;  5E79 C;  1X1B A;  2MLK A;  2WAF A;  4XK4 A;  3PO3 J;  2DA4 A;  4BBR J;  3MWM A;  4PFO A;  1H0M A;  1ZLK A;  5FLX K;  3FXL A;  3HOS A;  2RGV A;  2RAE A;  2EFN A;  4BAY A;  1QQI A;  1JT0 A;  2OAZ A;  2Y31 A;  1FOK A;  2WY7 Q;  5D4R A;  1ZAO A;  3LA2 A;  3VDX A;  1BI2 A;  2VAS A;  3G6E I;  4BY1 J;  4WF2 A;  4HDU A;  3I64 A;  4RS8 A;  1FBU A;  2G9W A;  2IW5 A;  4UXN A;  2NVX J;  2Q8K A;  1UHS A;  2ZC2 A;  3DV8 A;  2YX4 A;  3QU6 A;  2YU9 J;  3F8C A;  4LK1 F;  3G1M A;  2BEO A;  3GFM A;  1T8I A;  1WJ5 A;  3L9F A;  1YLF A;  5M5X J;  3DKW A;  1NH3 A;  1LE8 B;  1ZEL A;  2M4G A;  5CVI A;  1MH4 A;  1YRN B;  2UXN A;  3CO6 C;  1H89 C;  3L7W A;  3M8F A;  2HYG D;  4P96 A;  4HNV A;  1SFU A;  2QZ8 A;  2LVS A;  3QPT A;  2VQG A;  2QSG X;  4XBF A;  4E7I A;  2KPM A;  2GQQ A;  2KRH A;  2JVH A;  2G7H A;  2Y2Z A;  5CJ9 A;  1UFM A;  5CYV A;  3BCB A;  2WAE A;  3H9J A;  2PMZ N;  2R7W A;  4Y15 A;  1VZ0 A;  2VOP A;  4G12 A;  4BBS J;  2O0Y A;  3ZR8 X;  2ZBK A;  5C44 J;  3DKY A;  1EH6 A;  5LFA A;  1J59 A;  2PG4 A;  4MLO A;  2BYV E;  4IOC F;  2CV2 A;  2QCO A;  3TED A;  2JMW A;  3JRD A;  2HVS A;  5E3M A;  3HOV J;  1MSF C;  3P5J A;  1SFE A;  4E4H A;  2DOF A;  2JSP A;  2WBM A;  2V9K A;  1X1D A;  4M72 A;  4BJ6 C;  3SFZ A;  4RLF A;  4E7J A;  1R4N B;  5HNF A;  2W82 A;  3FBN B;  1DP3 A;  1ZKG A;  2DI3 A;  3EYY A;  4HLX A;  4CYD A;  1LPQ A;  3OYH A;  2AQF A;  2W00 A;  2EIJ H;  4QWQ A;  4AYB A;  3B6A A;  2CYY A;  1R00 A;  4I76 A;  2QBY B;  1JI8 A;  1ETO A;  2ID6 A;  5EGO A;  3E6D A;  3ZQG A;  5DD8 A;  3H9G A;  1XDS A;  1K7A A;  5E8G A;  1OCP A;  3OS2 A;  3G2B A;  2PMZ A;  4E7S A;  1H8A C;  2Z2S B;  2HOS A;  4F92 B;  3C3W A;  3K2A A;  3F8N A;  1BR4 A;  1GXQ A;  5JI6 A;  3GO5 A;  3FF5 A;  2EIL H;  1JXS A;  2R7X A;  1GUU A;  4OIQ F;  4HQM A;  2K27 A;  2JUC A;  2CQQ A;  3FHZ A;  2E2I J;  1X2M A;  1MH3 A;  2E1C A;  4HNU A;  2BW3 A;  1TZL A;  3HHH A;  2E34 A;  5FKO A;  3AG2 H;  3P9I A;  3MCZ A;  2XRO A;  2DFI A;  3ABM H;  3S1N J;  1MJA A;  1VQ4 I;  2VBZ A;  3F6V A;  1TNS A;  1WQ2 A;  2HZT A;  4ITV A;  4MQV A;  3FKJ A;  4CZZ A;  2HTJ A;  3MD2 A;  2J5O A;  4A0Z A;  1AHD P;  3CMM A;  3GTJ J;  2D45 A;  5JHF A;  2QLZ A;  3IRR A;  2HI3 A;  1O3Q A;  1Z6R A;  2F4O B;  4Z2Y A;  1DP7 P;  2IVM A;  2QGU A;  1O3S A;  4ZDO A;  1YTY A;  2NVQ J;  1Q1H A;  5TRD A;  2KKO A;  1U6G A;  1TBX A;  3S16 J;  3DF8 A;  4F55 A;  4WXH A;  1QU3 A;  2WAD A;  1ZLJ A;  2YS9 A;  1FSH A;  4L5E A;  2RQP A;  4DJA A;  3K4J A;  3RQI A;  1IRX A;  1DU0 A;  1IUF A;  3CDI A;  4XNF A;  3MKL A;  3HZJ A;  2EK5 A;  3I58 A;  2BE5 F;  3TMO A;  1BI0 A;  4B4C A;  4G7Z F;  1FOW A;  4KT6 A;  2EBI A;  2O03 A;  2X1E A;  1X3U A;  1Z91 A;  2I8D A;  1D0Z A;  2W85 A;  3KZY A;  5F04 A;  3OYI A;  1Z9C A;  1RIO H;  2M4K A;  2VJ5 A;  2E1M B;  1TW3 A;  3P9K A;  2L9S A;  2CJJ A;  4I99 C;  1BJA A;  3FIS A;  2DT5 A;  1B8I B;  4A69 C;  3F0C A;  4HX7 A;  3OYN A;  2ZME C;  5JLW A;  3TOA A;  1SD6 A;  3PFI A;  3RZD J;  1USS A;  2BVL A;  3H5N A;  3PM1 A;  3K4N A;  3R6S A;  2VOO A;  3K2Z A;  4P9U A;  2XPU A;  1OFC X;  1KU3 A;  1T39 A;  2BBY A;  2HZD A;  1U3E M;  4RGX A;  3TP3 A;  3VFZ A;  1FY7 A;  4S0H B;  5HNH A;  3ZQ7 A;  4XRF A;  1MSE C;  4B48 A;  3CJN A;  3OWT A;  4BQQ A;  4RB2 C;  5F1R A;  1U5T B;  1RES A;  1XPX A;  4D1Q A;  1R71 A;  1JGG A;  1U9N A;  3JRF A;  2E19 A;  3N05 A;  4CIC A;  4IF4 A;  1NK2 P;  4ESF A;  1K78 B;  1MBG A;  1GV2 A;  5KAI C;  1T0F C;  3ZMD A;  2XPW A;  4A3K J;  3VYU B;  1WH5 A;  3RJP A;  3CTA A;  1OQY A;  4C2M J;  2L4M A;  3FIW A;  5LGU A;  2LRE A;  4IL6 C;  2KMU A;  4KMU X;  4A3G J;  5L3E A;  1J9I A;  3SYT A;  5M3M J;  4HYE A;  4OAZ A;  4UVB A;  4C30 A;  3RSN A;  4A6D A;  1WZ2 A;  2LOO A;  2CQ7 A;  2OQR A;  1N25 A;  3HRT A;  3ZPL A;  4II2 A;  3HHG A;  1UMQ A;  2CH0 A;  4UB8 C;  2RDP A;  3QPL A;  2PI0 A;  2V4J C;  5EG0 A;  3BWG A;  3GTP J;  5FKL A;  3PFY A;  3OL4 A;  1MND A;  1LFU P;  4GCV A;  2RQQ A;  4PZJ A;  2QKM B;  4CA0 A;  2LY1 A;  2ZNY A;  5HDK A;  2Q2E A;  3HPG A;  2BHZ A;  3D5L A;  3V8J A;  1U0J A;  4UUS B;  1WJF A;  2EA4 A;  2L7M P;  4FQG A;  3H3U A;  5J6X A;  2PQ8 A;  1IZ1 A;  3HRU A;  1ZGA A;  3MAJ A;  4XM3 A;  3JRI A;  4ZJZ A;  2L7F P;  1Z3Y A;  1XGO A;  4ENK A;  1D1C A;  4DYC A;  1BW6 A;  1W7P B;  3G4S I;  2JA8 J;  3RPQ A;  3S17 J;  2XKO A;  1U78 A;  3K70 C;  4N0B A;  2FBI A;  3N97 A;  1FWZ A;  2DJN A;  3WE2 A;  2XAQ A;  3KEO A;  2IGO A;  5E1X A;  1MD0 A;  2JPB A;  1S7E A;  1ETW A;  4WK8 F;  1MGT A;  4PSW A;  1WH7 A;  2XHK A;  3HRS A;  5ICG A;  1ZRD A;  1UEL B;  4HA8 A;  1HW1 A;  5DS9 A;  3I56 I;  3ZQH A;  2ZCW A;  2E2H J;  2N8G A;  4IEJ A;  1KON A;  1YW9 A;  3BR0 A;  4F52 A;  3BG9 A;  5LLQ A;  1XX5 A;  2EFQ A;  1B59 A;  1OCC H;  2GXG A;  5EEG A;  2LK2 A;  1P4A A;  2YU3 A;  4XOR A;  1ON1 A;  3NAU A;  2F6C A;  1S72 I;  1AKH A;  3EET A;  1OYY A;  3S15 J;  4PK4 A;  2O9L A;  3HOU J;  2PFB A;  4BHC A;  5DM6 F;  4IXA A;  3J7Y J;  3CDH A;  2FML A;  3OYJ A;  3I71 A;  3ISP A;  4U7B A;  1F36 A;  2LC2 A;  3GTO J;  4H0E A;  4CHU A;  4IRH A;  4BDY A;  1IXS B;  5EJC A;  3KP3 A;  2BZT A;  2P0W A;  1D3Y A;  2M7B A;  5F0H A;  1YX3 A;  4Y7N J;  2A68 F;  3LWF A;  4Y17 A;  2OTL I;  3TDZ C;  3DPU A;  4A2U A;  4XID A;  3EUK L;  4IRI A;  1RUN A;  4RGS A;  1J7K A;  3SHF A;  3L2Q A;  2BGC A;  3A0B C;  3I9V 2;  3WHB A;  4PJJ A;  2F4I A;  1HC8 A;  2DTZ A;  4O5V A;  5D6F A;  4LOC A;  2FQ3 A;  3IC7 A;  3SEZ A;  4CCO A;  2PJP A;  4A3M J;  2HQR A;  2CW7 A;  4QIW N;  2DOD A;  4PUS A;  3SZT A;  4HBL A;  1K79 A;  2MC4 A;  2VKE A;  3IRQ A;  3CC2 I;  3BG3 A;  1XD7 A;  4B47 A;  1W1W E;  2OV7 A;  3TKY A;  1IV6 A;  3BJO A;  2MYS A;  4HX4 A;  1X19 A;  2UUZ A;  4BH9 A;  2D1V A;  1W5S A;  3M07 A;  3BTL A;  4ETS A;  5F0C A;  4MEX F;  2TDX A;  4RM3 A;  2KZG A;  2QQB A;  3HEF A;  1IRG A;  1OYW A;  2CV0 A;  2CQN A;  4M3G A;  1B4A A;  3BR5 A;  2VPR A;  1K6Y A;  1A5J A;  4NUB A;  1ZK8 A;  2LSO A;  2CQK A;  3F3X A;  2IS1 A;  4DBR A;  2DDA A;  3Q3S A;  2AXT C;  5AIP A;  3KYL A;  3B73 A;  1D1A A;  2R7U A;  4PSX A;  2EV0 A;  2E1M C;  1RR8 C;  3OS1 A;  2IP2 A;  4BL0 B;  3CCS I;  3GWZ A;  3S3N A;  3OOP A;  1B72 B;  3R4K A;  4HNT A;  4C3J J;  3JTG A;  1E2X A;  5D8K B;  1DU6 A;  2ZME B;  4YIR X;  2MGQ A;  4IVN A;  2DDB A;  3E5X A;  5CVU A;  4A3I J;  2KDZ A;  3F8B A;  2BOL A;  2DMN A;  1IJW C;  2HDW A;  3HTS B;  3HG9 A;  1KU2 A;  1F4K A;  1ERD A;  4N4O B;  5KCM A;  2LD5 A;  1S6L A;  1G3Y A;  4XSZ F;  3PQK A;  1APL C;  1HA8 A;  1Z6T A;  2ESH A;  1X2N A;  3U1K A;  4EVI A;  4KN4 X;  5L3D A;  3HJE A;  1RR7 A;  4JP0 A;  3KYD B;  5K1Y A;  3ZOB A;  5JHU A;  4ON0 A;  2E60 A;  1T98 A;  2V9P A;  2WB1 A;  2FE3 A;  3NRV A;  4OIO F;  5FLV A;  1AOY A;  3BPX A;  3WGG A;  1SC7 A;  1BM9 A;  2DYS H;  3IWF A;  3K70 D;  2HYJ A;  4M3B A;  1WJB A;  3LSH A;  2V1U A;  1D0Y A;  4AIH A;  4W97 A;  3IKT A;  5D5U B;  2EV6 A;  2EWN A;  2NS0 A;  2XIG A;  1TNT A;  5GTI C;  2CV1 A;  2VL8 A;  3WTV C;  9ANT A;  1S8N A;  5IY5 H;  1L3L A;  3ERM A;  1VQ9 I;  1VQN I;  5F08 A;  3OYD A;  3M4O J;  5IYC J;  2PEX A;  2RRE A;  1DDN A;  4LGW A;  3K4C A;  1K6O A;  3V4G A;  1E3P A;  3CJR B;  3WG9 A;  2KIM A;  3OL3 A;  4HF0 A;  4HF1 A;  1ITY A;  2IRF G;  4D5C A;  4PJN A;  1O7F A;  3VPR A;  4E7H A;  1N75 A;  5D8L B;  2Q2E B;  3BZ6 A;  4GFB A;  2FOW A;  3F8M A;  4XLH A;  3ABT A;  2K4B A;  3MZ8 A;  4KIS A;  2JT1 A;  4HF2 A;  4MFE A;  3RI4 A;  3R0A A;  1GVJ A;  2DAO A;  2FBK A;  2K02 A;  5F64 A;  2LR8 A;  1VF9 A;  5D5V B;  2IAI A;  3CCV I;  1MMG A;  4DGW B;  2XVC A;  5FLX Z;  2M0C A;  4HAM A;  3H1C A;  4CYC A;  4L9V A;  4NBQ A;  4AD9 A;  4X6A J;  1UAA A;  1I6X A;  1YW8 A;  3KP4 A;  2ADU A;  5JVT A;  2JWT A;  3KIO A;  4Q48 A;  2ID3 A;  3SFI A;  1U5T C;  3ML6 A;  4E7Z A;  3CUQ C;  2Y48 A;  1TQM A;  3TOB A;  1ZTR A;  3HOT A;  4N9H A;  3OYK A;  5IYD J;  1RC9 A;  2VBX A;  2B7E A;  1JGS A;  4ZH4 F;  3G71 I;  1K78 A;  4U88 A;  3ZRG A;  2XRN A;  1JE8 A;  1J0R A;  4O6J A;  3U2R A;  3S3O A;  2VN2 A;  2NAZ A;  1T56 A;  1WJE A;  3MMY B;  4EMS A;  2L4A A;  1K61 A;  2M30 A;  2CFX A;  3A03 A;  4G8X A;  2OA4 A;  2EIM H;  4IHY A;  4BQA A;  3QU3 A;  2K40 A;  4RM2 A;  5DCM A;  4HLY A;  2K3P A;  5HLH A;  1P7I A;  3BG5 A;  1NG6 A;  3B6C A;  3MFK A;  3JRC A;  5GAG J;  4PFP A;  4D7M A;  3LSK A;  3Q0W A;  3BZK A;  3DEW A;  3JSP A;  2IEK A;  4XOP A;  1VQ5 I;  1XMX A;  1B9M A;  3S2D J;  4Q4Z F;  3HKZ A;  3R61 A;  3DP7 A;  1B8I A;  2MAB A;  3J81 K;  2HNH A;  3F22 A;  2HYF A;  2FMY A;  4LG0 B;  4UUV A;  1XGS A;  1SFK A;  1T08 B;  1Y1V J;  2A05 A;  3CCR I;  3K1P A;  1G8X A;  4L5I A;  1ZYR F;  3E6M A;  5J40 A;  1H9G A;  2CU7 A;  2W24 A;  3LAJ A;  4JX4 A;  4M9Z A;  4RAG A;  2R92 J;  4XRS G;  2KFD A;  1WI3 A;  4P55 A;  1FIA A;  1JT6 A;  5L3F A;  3SEQ A;  2GOX B;  3VWB A;  3SQN A;  4HX8 A;  3CMY A;  3GTQ J;  1ZGJ A;  2LKS A;  2A61 A;  5J1U A;  1OYI A;  4KA4 A;  3A4C A;  3BR3 A;  2E71 A;  5DUI A;  3OYA A;  3HRM A;  3WTW C;  1YJW I;  2KIF A;  1YS6 A;  2GBY A;  2K86 A;  2FF4 A;  4HSR A;  4DBQ A;  2P5L C;  4IHS A;  3I4N J;  3SZP A;  1ENH A;  3M8E A;  2M5W A;  5E8I A;  4J19 A;  3BRO A;  4D5F A;  1E3O C;  1HKT A;  3E0J B;  2JA6 J;  2OF7 A;  4OAY A;  4Y4R A;  3GLL A;  3ONQ A;  5TIS C;  1J5Y A;  2HS5 A;  1VND A;  1R23 A;  3R60 A;  1I3A A;  1H88 C;  3NEU A;  3NWS A;  2NNY A;  4D0P A;  3HTU A;  4S04 A;  2P6T A;  4GDF A;  3D0S A;  2KQR A;  3RIR A;  3CC4 I;  3A02 A;  4ZC3 A;  1A6Q A;  3TGN A;  3V8K A;  3CCJ I;  3O8H A;  2HKX A;  1XCV A;  1I6H J;  1HW5 A;  1YOV B;  2M45 A;  2H8W A;  3CO7 C;  1JHH A;  4JK1 X;  4NNJ A;  2R5Y A;  1HXD A;  2MH9 A;  2COB A;  2CMP A;  2YUS A;  2ZJ2 A;  4P1W A;  3FXJ A;  4I09 A;  5D5X B;  4BEH B;  5H2F C;  1BC8 C;  1LEB A;  3Q5F A;  1I39 A;  3R0J A;  2JSC A;  4RAF A;  3ZQI A;  3CDL A;  3V7C A;  5KHD A;  3L2W A;  1W36 D;  1S9H A;  2K9S A;  4W1U A;  3OIO A;  5LEJ A;  4A3C J;  3PJR A;  1L0O C;  3GCM A;  4CUG A;  4BE1 A;  1WI9 A;  2LNB A;  2AHQ A;  1OMI A;  1TWC J;  3CLO A;  2WWY A;  2MH2 A;  1Z05 A;  3KX2 A;  1LVA A;  1RKT A;  1YJ9 I;  1ZH5 A;  1XN7 A;  2E2J J;  1QA6 A;  4M6V A;  3OMY A;  3T0Y A;  2EFO A;  4RAY A;  4RB0 A;  4GGG A;  5FLM J;  4A3D J;  3PUF A;  4YII A;  4CCK A;  1T0F A;  2CO5 A;  4MFD A;  1X4O A;  3HM5 A;  3T8T A;  4XN0 A;  2ISY A;  3PUB A;  1VQP I;  5ILU A;  2ME0 A;  5IPA A;  1ORK A;  1VI0 A;  2QQA A;  2ZB9 A;  5FJ8 J;  3DEE A;  2FXA A;  2RKH A;  2F5V A;  2ECB A;  1M1E B;  2LTP A;  3DTK A;  4DZJ A;  3LMM A;  2HEO A;  1S5L C;  1XGM A;  1SMT A;  4CGZ A;  2E5Z A;  5IP9 J;  5AIQ A;  4KUM A;  1R6R A;  2AXL A;  2VJJ A;  3W2A A;  1I3Q J;  3JAM K;  2LLK A;  4A12 A;  2F2E A;  4AVZ A;  5J8F A;  2ZJQ F;  1ZR2 A;  1SFO J;  1GVD A;  4AC0 A;  2R7Q A;  2KT0 A;  3ZQC A;  3BJA A;  3D5S C;  2F5C A;  3QYF A;  4I0A A;  5FGM A;  5LHH A;  1YI2 I;  3H3V K;  2XB5 A;  1LNW A;  2LRD A;  2EH3 A;  4LFU A;  1R22 A;  5E3L A;  1KGS A;  3COA C;  2JRT A;  2LFB A;  2O7O A;  1NK3 P;  1RI7 A;  3Q0V A;  2CUJ A;  1QZZ A;  2MD5 A;  4HZF A;  5FO5 A;  2CS3 A;  2B9S A;  3BG7 A;  4HPQ A;  1D8K A;  3QP6 A;  1FOY A;  3FXQ A;  1HBX G;  5E3N A;  2L9V A;  3M7G A;  3RKX A;  2EB7 A;  3ABL H;  1ZRF A;  1P7J A;  4I2O A;  4BXX J;  4JYK A;  3WU1 B;  4S05 A;  3MEX A;  4BS9 A;  2A5W A;  3WOD F;  1X3W B;  4PJ0 C;  4IHT A;  1TW2 A;  2GAU A;  2LH9 A;  3GW2 A;  3P7N A;  2YX7 A;  2DJI A;  1OR7 C;  2FU4 A;  3FZV A;  1W5C C;  1YHQ I;  4M73 A;  1A04 A;  2DQR A;  3LOC A;  3QWL A;  1HST A;  2CUF A;  2LY9 A;  4YIF A;  2KRF A;  4PCQ A;  2CWE A;  1U8B A;  1QPM A;  4V2F A;  4F3Q A;  2UWM A;  3VOD A;  4EEF G;  4KN7 X;  3OV8 A;  4CO8 A;  1BL0 A;  1MKM A;  1STZ A;  3KEY A;  3E6C C;  4C3I J;  3OIQ A;  3MZH A;  3KP5 A;  1BR2 A;  3L2V A;  1MBF A;  1FIP A;  1YYV A;  2VE9 A;  2DMP A;  3H0D A;  1I1G A;  2I10 A;  3KZZ A;  5EZH A;  1Z1D A;  5LGT A;  2W84 A;  5L3B A;  2VIX A;  1DUX C;  2R93 J;  1QPI A;  3F21 A;  4MNU A;  2E5N A;  3K69 A;  1O7L A;  2K5C A;  5BPD A;  2DT7 B;  3KP6 A;  1VQ8 I;  1IC8 A;  5D6E A;  4EAT A;  3F9K A;  3BT9 A;  3HUG A;  3I4P A;  1JHF A;  1G3T A;  1V5F A;  3OSG A;  1HDD C;  1OKR A;  1OPC A;  3DBR B;  5B3S H;  3ZMS A;  2ZKZ A;  1JTY A;  2H09 A;  3M9A A;  5DD4 A;  1YIJ I;  1YRN A;  1ZRC A;  3EUH A;  5F27 A;  3Q0U A;  1SVM A;  1AU7 A;  1BIA A;  2X9D A;  4PJM A;  4RDU A;  4IKF A;  3LFK A;  1ZHF A;  3V8L A;  1UCR A;  1YFH A;  3BDD A;  4E70 A;  2BY3 A;  4LIU A;  2M8E A;  4N4N B;  4EM0 B;  1MBK A;  2DO7 A;  2STW A;  4H4K C;  2UV1 A;  3CQZ J;  1MZB A;  2DK5 A;  5DCM B;  2L9R A;  3BTI A;  2A6E F;  1IAW A;  4KDP A;  1IRF A;  4LJZ F;  3DBL B;  5GAD J;  4G7O F;  2RV8 A;  1YS7 A;  5FB2 A;  3WU2 C;  1VQL I;  3E3V A;  3KYC B;  5KK1 A;  2LG4 A;  2RN7 A;  2KL4 A;  4BJ5 C;  3GX4 X;  4HST A;  3HB9 A;  3CP8 A;  2XUB A;  5CVJ A;  4B3X A;  1LFB A;  1W36 C;  2X1D A;  1XGN A;  5ERI A;  3UR3 C;  2VLA A;  2F4M B;  4HEA 2;  2FUG 2;  3D5R C;  3V7S A;  3BJ6 A;  2IA2 A;  5KAF C;  4WWC A;  2ELJ A;  3S2H J;  2LDU A;  4HV6 A;  4I0B A;  5GAH J;  4EM1 A;  1SD7 A;  2W25 A;  2WY8 Q;  4OWR B;  5AON A;  5F6F A;  4EJU A;  1QRY A;  3MKZ A;  3J7A O;  1R1V A;  4NDL A;  4II3 A;  4EJO A;  4ENJ A;  3LSI A;  4FE7 A;  4DOZ A;  2GLO A;  2JZY A;  5GPC A;  1VTN C;  3CCE I;  4IPA A;  2R5Z A;  2Z1D A;  1GXP A;  2HVR A;  1J2X A;  5DV5 A;  3E97 A;  2M7A A;  2CW0 F;  3F6O A;  2VQC A;  4ZZL A;  1REP C;  2YPR A;  2NOG A;  1RZ4 A;  3DEU A;  4M71 A;  3VYR B;  2YSR A;  4RB3 C;  2XAS A;  4BU2 A;  4F91 B;  4PDK A;  4ZYH A;  2OZ6 A;  4BHP A;  2VKD A;  3HYI A;  1JJ6 C;  2HQ5 A;  1XG1 A;  2ZNZ A;  4HQE A;  3DLL F;  3BZC A;  4JOM A;  3JSO A;  1O4X A;  3LL7 A;  2COM A;  2G7U A;  4UHT A;  2DA6 A;  3I0T A;  4RB1 A;  1IW7 F;  2VOD A;  1N78 A;  5TGT A;  3LSM A;  1J09 A;  1Y8R B;  2ETH A;  4RGR A;  5C3E J;  5B1A H;  2NVY J;  2B0L A;  3M1E A;  3HSE A;  4XLF A;  3RZO J;  2XV4 S;  3HOW J;  1SD5 A;  5GP9 A;  3PSI A;  1R58 A;  2VB6 A;  3OYF A;  2L7K A;  3JRE A;  2XDV A;  3CLQ A;  1EJ9 A;  1NG7 A;  2EFW A;  3WTX C;  1Z77 A;  5EDN A;  5LRR A;  1IUY A;  2CUZ A;  2O8K A;  3ZCO A;  3QRF F;  2J5P A;  3L1P A;  1PDN C;  2OUM A;  2P5V A;  4DYQ A;  3QPH A;  2OD5 A;  4XLP F;  4LK0 F;  2W4S A;  1G3W A;  1BJZ A;  2DU9 A;  1T33 A;  3GFJ A;  2IA0 A;  2Y69 H;  5IT9 Z;  2VBW A;  3C1D A;  2EA2 A;  3S1R J;  1JTX A;  2XAF A;  1O57 A;  3EUA A;  2R5Z B;  3JCU C;  2MW8 A;  2XKP A;  4TV7 A;  4NQW B;  4ZTJ A;  4XRM A;  3HXL A;  1IXC A;  1YIO A;  4XKW A;  1ONV A;  2LBF A;  3KCC A;  2VXD A;  3KLN A;  4KT5 C;  3A2K A;  1MJ9 A;  4QLC U;  5K7H A;  2W1O A;  2Z99 A;  4L5J A;  3FBI B;  2KJC A;  4XON A;  2JK3 A;  3K4B A;  5BS6 A;  1TT0 A;  2XF5 A;  1WJC A;  2A07 F;  2HQA A;  3PQJ A;  4YEJ A;  1GV5 A;  2OTJ I;  6PAX A;  3BPV A;  3BTJ A;  3TQN A;  5JR3 A;  4WXD A;  2DN0 A;  2MC3 A;  2HWV A;  2D1H A;  3IP4 B;  1FP1 D;  3ZN1 A;  1HSJ A;  3ECO A;  2DMQ A;  3L2R A;  4OIR F;  2DK8 A;  3MQ0 A;  4U0V A;  1KU7 A;  3W3C A;  3DPT A;  4Y3O A;  1SMY F;  2M8G X;  2RNJ A;  4IQJ A;  3QOE A;  2XGX A;  2QWW A;  3SDB A;  3ZGK A;  1IDZ A;  5LD2 C;  2FEZ A;  4M3D A;  3OSF A;  4OMY A;  3LQQ A;  5IOZ A;  2XPV A;  4LD5 A;  3NQO A;  4IHX A;  2W48 A;  3HGG A;  5C4X J;  3I55 I;  1Z0X A;  1FMW A;  4BQO A;  3MKY B;  4DNC A;  4C3H J;  2PJR B;  2DFH A;  2CGP A;  1K83 J;  1FYK A;  4AU7 A;  1PJR A;  4B8X A;  2GXB A;  1I1S A;  1KQ8 A;  1D5V A;  2V1N A;  3WTZ A;  2HDC A;  1I5Z A;  2GZW A;  2OCE A;  1FC3 A;  3JW4 A;  3HSR A;  1IRZ A;  1MJB A;  5F0F A;  2XAJ A;  3TO7 A;  2QSH X;  4DW6 A;  5GAE J;  3ZMU A;  5J8C A;  2QF7 A;  2MLG A;  4BDZ A;  4HRI A;  1ETV A;  1AKH B;  5E1Z B;  2GM4 A;  3CC7 I;  1UG2 A;  3FK6 A;  5ICC A;  4IX7 A;  4A6E A;  1HOM A;  2LF7 A;  1RNL A;  2JQ7 A;  2ICW G;  1SVL A;  3DXJ F;  4ZDL A;  3BQZ A;  4YFN F;  2A6T A;  2V79 A;  1FP2 A;  4LB6 B;  5HDG A;  1NHA A;  5HS7 A;  1QVU A;  1ZG5 A;  1ZQ3 P;  2K3F A;  4MGR A;  1T6S A;  1QVT A;  4G9Y A;  3O6B B;  3BR2 A;  4RMN A;  4F93 B;  2VUM J;  2DW4 A;  1G2H A;  2FNA A;  4XOT A;  2ZFU A;  2X6W A;  3LA3 A;  3TBI A;  1C0W A;  4K2E A;  2M2E A;  4NC6 A;  3WTS C;  2M34 A;  3AG4 H;  4X0G A;  1KA8 A;  1TQI A;  2NS8 A;  3WG7 H;  4EQQ A;  3ZN0 A;  2R3S A;  3HOZ J;  3GBG A;  3PIP F;  3K4K A;  2JUG A;  2QKL B;  2TCT A;  4D7N A;  1LVK A;  2M87 A;  3CP2 A;  4GXO A;  3ZXS A;  3HL2 A;  3AKZ A;  3WTY C;  4XLE A;  2A6H F;  2IGK A;  3HKZ N;  2EZL A;  1D0X A;  5EZG A;  3RYP A;  2K4J A;  2ACJ A;  1Z7L A;  5K7Z A;  4ABZ A;  1HF0 A;  2TRT A;  4G6T B;  4NHJ A;  2EZI A;  3I3L A;  2EZH A;  3RDI A;  1G59 A;  5IP6 A;  1WFX A;  3L2C A;  1XDU A;  1T2K A;  3CUQ B;  3DFG A;  4ASN A;  3DPL C;  4R8H A;  5E1W A;  3BR6 A;  5FRM A;  1U2W A;  4LLL A;  1KQ0 A;  2QSF X;  1UST A;  2DXI A;  4C2U A;  4AWX B;  3K7A J;  3EUH C;  1W0U A;  4UVC A;  4WCG A;  4UV9 A;  3HGY A;  3UKG A;  3VYT B;  1BN5 A;  3H5A A;  2YR2 A;  4QTR A;  3CCU I;  1QO0 D;  5BQT A;  3BP8 A;  3VOE A;  5IT9 K;  1WRJ A;  4J01 A;  4UNO A;  2EZK A;  2LP0 A;  2VC1 A;  1S3J A;  5HVQ C;  1DGR M;  2L54 A;  3RYR A;  4P9F A;  4XLC A;  3RKQ A;  1GHC A;  3LNQ A;  3A01 A;  4HOB A;  1AWC A;  2BY2 A;  1PUE E;  4R79 A;  1NTC A;  1PP7 U;  2HXO A;  3BC8 A;  4AID A;  4G7H F;  1ZG1 A;  1N77 A;  2K9N A;  1OCR H;  1RKW A;  4IO9 F;  2JN6 A;  1LJ9 A;  5EF6 A;  2P81 A;  1JKQ C;  1B9N A;  3I59 B;  2XSD C;  1LDK B;  1XCB A;  1E17 A;  2DQL A;  1UHM A;  3AFH A;  4I7H A;  1WHU A;  3BQY A;  2HQN A;  4U0W A;  1VFC A;  3FDY A;  4U87 A;  1SD4 A;  2CRG A;  5FD6 A;  4YG2 F;  2V6C A;  5C4J J;  1CF7 B;  1LEA A;  4KNY A;  3B02 A;  1HKQ A;  3O2P E;  1UJ8 A;  5L3C A;  2NXN B;  5FKM A;  3GUD A;  1BBY A;  1JKR C;  3C7J A;  1PVE A;  4OMZ A;  2KZV A;  4MQ9 F;  4AYB N;  1T95 A;  3ASN H;  2Y30 A;  1BI3 A;  4RAZ A;  4NC8 A;  2LBF B;  2I5U A;  5J4V A;  5KNL A;  4CSW A;  2R5Y B;  2R7V A;  2BVM A;  2FA5 A;  3FM3 A;  2R7T A;  3GEZ A;  4ZZD A;  5BOX A;  4RA2 A;  1E3H A;  4ZYE A;  2IA1 A;  4NQW A;  2HXI A;  2WA0 A;  1BA5 A;  1BW5 A;  3FHN A;  4EGZ A;  2E36 A;  4R1H A;  3H36 A;  2DA5 A;  2DFF A;  1LDD A;  4B09 A;  2DA1 A;  2UXX A;  2QM3 A;  2VI6 A;  1Y0N A;  2VJI A;  2Y0S A;  4CCM A;  4XQF A;  2H8R A;  2G0E A;  2M0M A;  1MMN A;  1MNE A;  2PX9 A;  1SFX A;  5GPA A;  4JQF A;  3AG3 H;  3SDG A;  3DU5 A;  4LG3 A;  3HBL A;  3O8G A;  1LQ1 A;  1IG7 A;  2WV0 A;  4PJL A;  3Q9S A;  4ZYD A;  5M3F J;  1G4D A;  1X1P A;  4XLN F;  3A01 B;  5H6Q A;  3GFI A;  1GLN A;  1CQT A;  3DCF A;  3OYE A;  2CG4 A;  2KP6 A;  2K9M A;  1TT5 B;  2HU9 A;  4A3L J;  2K85 A;  2CW8 A;  2JA5 J;  3CD6 I;  3V7R A;  3P9C A;  1HKS A;  3F23 A;  4BXU A;  1IF1 A;  1FTZ A;  1EKE A;  4ENN A;  1IN7 A;  2STT A;  3ZQL A;  2NOJ B;  2HVQ A;  4GRI A;  2O5R A;  1XB4 A;  1CGP A;  2EFP A;  1R5H A;  3LSR A;  3V42 A;  3I53 A;  4Y52 J;  4XKV A;  5E3O A;  4E7K A;  1DQU A;  1QZE A;  2DTR A;  3QOP A;  2BXY A;  4L9N A;  2FD5 A;  3FWE A;  2NVU B;  4B43 A;  4B3A A;  2H27 A;  5DEQ A;  3CUO A;  4BEH A;  1FX7 A;  2R0Q C;  5DUK A;  2Y9Y A;  3QP5 A;  2LKP A;  3MVP A;  3CF2 A;  5EGO B;  3DKX A;  3GME A;  2O6G E;  3CUQ A;  2JPC A;  4XN3 A;  2ZSH B;  3TP0 A;  1FBS A;  4M3F A;  1WSU A;  1JUS A;  3DTI A;  4BKX A;  1YG2 A;  3ABU A;  1WJD A;  3FMQ A;  2VQL A;  3EDP A;  2M3A A;  3O3K A;  2HGC A;  3OOU A;  2EIN H;  4LIT A;  1H9T A;  3GYH X;  3CES A;  5LHG A;  1VQK I;  4V19 K;  2XAH A;  5F1J A;  5FFX A;  1P6R A;  4XKC A;  2R7S A;  4V2G A;  3KP2 A;  5JVG F;  3PNY A;  2ZJP F;  1FYL A;  1MMS A;  2KIS A;  3AG1 H;  1ZRE A;  1OIS A;  2O3F A;  2BHY A;  4ESJ A;  2JA2 A;  4L0Z B;  3H9Q A;  3Q9V A;  3NWT A;  5DYM A;  3HPH A;  5B66 C;  1FLI A;  4PGG A;  1GDT A;  5J3L A;  3J80 K;  4IQ4 A;  2X0L A;  1MIJ A;  1V5G A;  4XKB A;  3CCY A;  3S32 A;  2LY2 A;  1SAU A;  2B63 J;  1UB9 A;  1Y6I A;  2FNP A;  4XR6 A;  3DBH B;  4M9S A;  4FX4 A;  2K9L A;  3GFL A;  2A5Y B;  4MIM A;  1F1Z A;  2PMH A;  3VSL A;  1HLV A;  1KQ9 A;  4FHT A;  1W0T A;  1HCR A;  3IH3 A;  3IUO A;  3BG6 A;  4KJZ A;  4IZZ A;  2IS4 A;  1TWA J;  2K7L A;  5E20 A;  1ON2 A;  3JRA A;  4ENM A;  2GXA A;  1OLT A;  2DPU A;  4KFC A;  1FT9 A;  4IRG A;  3TW7 A;  2CFO A;  1EH8 A;  4G6Q A;  2E35 A;  3W2W A;  2ELK A;  3QYB A;  3M3Y J;  2MD0 A;  1U8R A;  3WE3 A;  3C2G A;  1FMV A;  3L09 A;  1I27 A;  2IXS A;  4C2T A;  2X1C A;  1KU9 A;  4OU0 A;  4CYC B;  3ELK A;  3GF2 A;  1U9O A;  4BYY A;  4DZP A;  1QBJ A;  3U9G A;  2ISZ A;  2Z9O A;  3IL2 A;  1BOB A;  3J7Z I;  1SAN A;  2OC6 A;  1LE8 A;  3IAS 2;  3SZG A;  2F5E A;  4BJT A;  3RPU D;  1SEU A;  1SAX A;  2HDD A;  1ETK A;  4EJV A;  2H6C A;  1VQO I;  3FK7 A;  5DDG A;  4I6Z A;  2VON A;  3WU0 A;  5LEK A;  3QPS A;  2V26 A;  3GVA A;  3QOD A;  2LKX A;  2EV5 A;  1FTT A;  3EQL F;  2DA2 A;  2P7C B;  1R5I D;  1W4M A;  5B1B H;  3CCM I;  4XL9 A;  2V9V A;  2MFZ A;  1D1B A;  2OPT A;  2V1D A;  3GTL J;  1WCM J;  4Q47 A;  4L18 B;  1TWG J;  2HKO A;  4ZDP A;  3IH4 A;  3TO6 A;  5K5R A;  1W5T A;  2HR3 A;  3NAR A;  3CMA I;  4FIS A;  5K5O A;  3KE2 A;  1TWF J;  5LHI A;  2H1K A;  3BLY A;  5FKK A;  1PP8 F;  5HOD A;  1A6I A;  1Y1W J;  3G3Z A;  1HW2 A;  3KEQ A;  4HG2 A;  2O8X A;  4HW0 A;  4KIB A;  3CZ6 A;  2IPQ X;  1X58 A;  1YO5 C;  3ZMV A;  2HTS A;  1DGW Y;  3ZMZ A;  3F8F A;  4UVA A;  4BNC A;  1S29 A;  5LGN A;  5KVR A;  3GZ5 A;  3IAM 2;  4M3E A;  1FSE A;  1EF4 A;  2ME6 A;  2DFE A;  4D9J A;  2KHM A;  3JRH A;  1K4S A;  1EA3 A;  1K4T A;  4QPO A;  3VYS B;  2IT0 A;  2RVC A;  2ZXJ A;  3HC7 A;  3CME I;  3CCL I;  4FX0 A;  5JLX A;  4QPQ A;  2WAQ N;  2OCC H;  3FXM A;  2VQH A;  2C6Y A;  4I02 A;  3OIP A;  3GZN B;  1WKM A;  4BQN A;  1RUO A;  4IJA A;  2KDO A;  3K4L A;  2X6Y A;  4Q5S F;  1UG0 A;  3ERE D;  4MEY F;  5CLS A;  1ETY A;  3PL8 A;  5CQG A;  5E17 F;  3S1M J;  2M9H A;  1MDM B;  2R7F A;  4Z6Y A;  1OCZ H;  4F7Z A;  1S7A A;  2GWR A;  4BY7 J;  2QEX I;  2DPD A;  2EPF A;  1IDY A;  2X51 A;  1D5Y A;  1RPW A;  3A1Y A;  4YFK F;  2IS6 A;  3PNV A;  3KFW X;  2DLL A; 
#chains in the Genus database with same CATH homology
 1FYM A;  5ILS A;  3K1N A;  2H6B A;  5LRS A;  5BPI A;  5E18 F;  4OIP F;  1R7J A;  1D8J A;  1LB2 A;  4KIG A;  3W6K B;  2OU2 A;  4OIN F;  5D4S A;  2ZFW A;  5HS9 A;  3LAP A;  2V1X A;  1EH7 A;  3J81 Z;  2MA3 A;  2Y75 A;  1W7P D;  4I01 A;  2R7D A;  3RTR A;  3EYI A;  2P5K A;  1WWX A;  3JTH A;  2VE8 A;  2VXZ A;  4AIK A;  2XAG A;  4I98 B;  4CDG A;  1XMK A;  1OR7 A;  2GIV A;  1QZY A;  2QEN A;  2LF8 A;  2OQG A;  5FD5 A;  5ED4 A;  2VBY A;  2JTV A;  1LDJ A;  2M1B A;  5L3G A;  1IN8 A;  1B1B A;  5FFZ A;  2FRH A;  1ZAR A;  4HV5 A;  2EJR A;  4KIF A;  4KMF A;  4G94 A;  1UHW A;  1P92 A;  1CF7 A;  2Z3Y A;  3K9T A;  3FMR A;  3ZMT A;  3WGI A;  4A0X A;  4M6Y A;  4L9T A;  3I59 A;  2FBH A;  3N4M A;  5CVV A;  2HOE A;  3RKW A;  1QGP A;  2IJL A;  2VT3 A;  5TJJ A;  1F9N A;  2P4W A;  5ILV A;  3KLO A;  1R1U A;  4AIJ A;  4EJW A;  2ZO4 A;  4EJT A;  1B6A A;  5HDN A;  3GZ6 A;  5D5W B;  4PGH A;  2E7W A;  4U7D A;  3RPU A;  2PLY A;  2PN6 A;  3WTT C;  3I5U A;  4U0Y A;  1XSD A;  4Y13 A;  3C18 A;  1P4W A;  3VB2 A;  2ESN A;  1XSV A;  2P8T A;  1BIB A;  2BV6 A;  4G6D A;  2E7X A;  4A5M A;  1TQP A;  1T38 A;  1YQA A;  1FBQ A;  4N9I A;  4EV0 A;  4EGY A;  3T1B A;  1G6N A;  4M6X A;  5EEH A;  2KJB A;  3TDU C;  1W7P A;  4CXF A;  4JBA A;  4FT8 A;  5H6R A;  1DPR A;  3K1M A;  1O3T A;  3H92 A;  2QVO A;  3FM5 A;  1F5T A;  3HIF A;  1XMA A;  1TLH B;  2KIU A;  4GYI A;  3BOQ A;  5LBQ A;  1R5G A;  4AVP A;  1FNN A;  2W57 A;  4LMY A;  1TTY A;  3W6J B;  3GLX A;  2PBI A;  3REO A;  1EV7 A;  3ROU A;  4YFX F;  3TO9 A;  2P7V B;  3JAM Z;  1O3R A;  1IN5 A;  4NB5 A;  1S7O A;  2Z33 A;  3QAH A;  3FXU A;  1V3F A;  4MTE A;  3BY6 A;  2ELH A;  2F5F A;  1YW7 A;  3K0L A;  4KIC A;  1J75 A;  2E1N A;  3WGH A;  2GA2 A;  1KYZ A;  1U5T A;  2P6S A;  1BI1 A;  3ULQ B;  3MZY A;  5HLI A;  5HOO A;  5A2Q K;  3FMS A;  1ODD A;  4XSX F;  2UZK A;  2OZU A;  4GO1 A;  1R1T A;  1XSX A;  3GXO A;  3SXY A;  4EM2 A;  4A5N A;  4M74 A;  1P4X A;  1V4R A;  2CSO A;  3FXR A;  2MBF A;  4DQ2 A;  2L01 A;  2NNN A;  2QYO A;  1FPQ A;  3WTU C;  2FSW A;  4MTD A;  1IN6 A;  3ZP5 A;  4WXC A;  4GYG A;  3RKY A;  4KYW A;  2GA1 A;  3IKV A;  4L0Y B;  2QBY A;  2O61 A;  2QQ9 A;  1ZG3 A;  4L9J A;  5CVR A;  2ZME A;  3AAF A;  2X4H A;  2Q0O A;  1ULY A;  5ICE A;  4WX9 A;  1IXR C;  2A3S A;  2OBP A;  5A2Q Z;  2RC4 A;  4UV8 A;  2L3D A;  4A0Y A;  1Y0U A;  4ESB A;  3KET A;  4ZYG A;  3F72 A;  4LB5 A;  2WTE A;  3FX3 A;  3G73 A;  2L02 A;  3ECH A;  4BHB A;  4P5O A;  3T5X A;  5ICF A;  4MHG A;  4M9X A;  1KYW A;  2NRA C;  5BMZ A;  4RGU A;  5K5Q A;  2FOK A;  3HSF A;  3LST A;  1ZN2 A;  2H94 A;  3E5Q A;  5DCF A;  2VT2 A;  4LLN A;  5IT3 A;  4O3M A;  3I54 A;  1G3S A;  1Z7U A;  3DQV C;  4LG0 A;  3S2W A;  2WC2 A;  5JFR A;  1MDM A;  2NYX A;  3E6B A;  1R36 A;  3LA7 A;  3J80 Z;  2AS5 F;  2QUF A;  3U1D A;  3VEP A;  1FZP B;  3T8R A;  1IN4 A;  3IHU A;  1HQC A;  2F5D A;  4LLG F;  2VC0 A;  2DBB A;  2HFH A;  3IWZ A;  1BC7 C;  2PMU A;  3LQR A;  1BOA A;  1DPU A;  3L00 A;  2A69 F;  3H3Z A;  2Y0M A;  5HS8 A;  5HLG A;  1P2F A;  2D2W A;  3E5U A;  2Z5U A;  4OOI A;  1QNT A;  3KP7 A;  4HDV A;  5H20 A;  2MLK A;  3MWM A;  1H0M A;  1ZLK A;  5FLX K;  3HOS A;  2RGV A;  2EFN A;  4BAY A;  1QQI A;  2OAZ A;  1FOK A;  5D4R A;  1ZAO A;  3LA2 A;  1BI2 A;  4WF2 A;  4HDU A;  3I64 A;  4RS8 A;  1FBU A;  2G9W A;  2IW5 A;  4UXN A;  2Q8K A;  3DV8 A;  2YX4 A;  3QU6 A;  3F8C A;  4LK1 F;  2BEO A;  3GFM A;  3L9F A;  1YLF A;  3DKW A;  5CVI A;  2UXN A;  3CO6 C;  3L7W A;  3M8F A;  2HYG D;  4P96 A;  1SFU A;  2QZ8 A;  3QPT A;  4XBF A;  2GQQ A;  2G7H A;  5CJ9 A;  5CYV A;  1UFM A;  4Y15 A;  2VOP A;  2O0Y A;  2ZBK A;  1EH6 A;  1J59 A;  2PG4 A;  2BYV E;  1SFE A;  4M72 A;  3SFZ A;  2DI3 A;  4HLX A;  3EYY A;  4CYD A;  4QWQ A;  2CYY A;  1R00 A;  2QBY B;  3E6D A;  5DD8 A;  1XDS A;  1K7A A;  5E8G A;  3C3W A;  3F8N A;  1GXQ A;  5JI6 A;  3GO5 A;  3FF5 A;  1JXS A;  4OIQ F;  4HQM A;  2K27 A;  3FHZ A;  2E1C A;  3HHH A;  3P9I A;  3MCZ A;  2XRO A;  2DFI A;  1MJA A;  2VBZ A;  3F6V A;  1TNS A;  1WQ2 A;  2HZT A;  4MQV A;  4CZZ A;  2HTJ A;  2J5O A;  4A0Z A;  2D45 A;  2QLZ A;  3IRR A;  1O3Q A;  1Z6R A;  4Z2Y A;  1DP7 P;  2IVM A;  1O3S A;  1YTY A;  1Q1H A;  5TRD A;  2KKO A;  1U6G A;  1TBX A;  3DF8 A;  4WXH A;  1ZLJ A;  1FSH A;  2RQP A;  2EK5 A;  3I58 A;  2BE5 F;  1BI0 A;  4G7Z F;  2O03 A;  1X3U A;  1Z91 A;  2W85 A;  3KZY A;  1Z9C A;  1RIO H;  1TW3 A;  3P9K A;  1BJA A;  2DT5 A;  4HX7 A;  3TOA A;  1SD6 A;  3PFI A;  1USS A;  3R6S A;  2VOO A;  3K2Z A;  4P9U A;  1KU3 A;  1T39 A;  2BBY A;  1U3E M;  4RGX A;  3VFZ A;  1FY7 A;  3ZQ7 A;  4XRF A;  3CJN A;  4RB2 C;  5F1R A;  1U5T B;  4CIC A;  4IF4 A;  4ESF A;  1K78 B;  3ZMD A;  3RJP A;  3CTA A;  2L4M A;  5LGU A;  4KMU X;  5L3E A;  1J9I A;  4HYE A;  4UVB A;  4A6D A;  2OQR A;  3HRT A;  3ZPL A;  3HHG A;  2RDP A;  2PI0 A;  3BWG A;  4GCV A;  4PZJ A;  5HDK A;  2ZNY A;  2Q2E A;  3D5L A;  3V8J A;  2EA4 A;  3H3U A;  5J6X A;  2PQ8 A;  1IZ1 A;  3HRU A;  1ZGA A;  3MAJ A;  1XGO A;  4ENK A;  1W7P B;  3RPQ A;  2XKO A;  1U78 A;  4N0B A;  2FBI A;  3N97 A;  1FWZ A;  3WE2 A;  2XAQ A;  3KEO A;  5E1X A;  1MD0 A;  2JPB A;  4WK8 F;  1MGT A;  2XHK A;  3HRS A;  5ICG A;  1ZRD A;  4HA8 A;  1HW1 A;  2ZCW A;  1YW9 A;  5LLQ A;  2EFQ A;  1B59 A;  2GXG A;  5EEG A;  1P4A A;  2YU3 A;  1ON1 A;  3EET A;  1OYY A;  2PFB A;  4BHC A;  4IXA A;  3CDH A;  2FML A;  3I71 A;  3ISP A;  4U7B A;  4H0E A;  4CHU A;  4IRH A;  1IXS B;  3KP3 A;  1D3Y A;  2A68 F;  3LWF A;  4Y17 A;  3TDZ C;  4A2U A;  4IRI A;  1RUN A;  4RGS A;  1J7K A;  3SHF A;  2BGC A;  4O5V A;  5D6F A;  2FQ3 A;  3IC7 A;  2PJP A;  2HQR A;  3SZT A;  4HBL A;  1K79 A;  3IRQ A;  1XD7 A;  3TKY A;  3BJO A;  4HX4 A;  4BH9 A;  2D1V A;  1W5S A;  4ETS A;  4MEX F;  2TDX A;  2QQB A;  1IRG A;  1OYW A;  1B4A A;  2LSO A;  2CQK A;  3F3X A;  5AIP A;  3B73 A;  2EV0 A;  2IP2 A;  3GWZ A;  3OOP A;  3R4K A;  3JTG A;  1E2X A;  5D8K B;  2ZME B;  4IVN A;  3E5X A;  5CVU A;  3F8B A;  3HTS B;  1KU2 A;  1F4K A;  1S6L A;  1G3Y A;  4XSZ F;  3PQK A;  1Z6T A;  2ESH A;  4EVI A;  4KN4 X;  5L3D A;  5K1Y A;  5JHU A;  4ON0 A;  1T98 A;  4OIO F;  3NRV A;  2FE3 A;  1AOY A;  3BPX A;  3WGG A;  1BM9 A;  3IWF A;  2V1U A;  4AIH A;  3IKT A;  5D5U B;  2EV6 A;  2EWN A;  2NS0 A;  2XIG A;  1TNT A;  3WTV C;  1S8N A;  1L3L A;  2PEX A;  1DDN A;  4LGW A;  1K6O A;  3V4G A;  3WG9 A;  2KIM A;  4HF1 A;  4HF0 A;  2IRF G;  1O7F A;  5D8L B;  3BZ6 A;  3F8M A;  3ABT A;  2K4B A;  2JT1 A;  4HF2 A;  3RI4 A;  3R0A A;  1GVJ A;  2DAO A;  2FBK A;  2K02 A;  5F64 A;  5D5V B;  2XVC A;  5FLX Z;  4HAM A;  4L9V A;  4AD9 A;  1I6X A;  1YW8 A;  3KP4 A;  2ADU A;  5JVT A;  4Q48 A;  1U5T C;  3ML6 A;  3CUQ C;  2Y48 A;  1TQM A;  3TOB A;  3HOT A;  4N9H A;  2VBX A;  1JGS A;  4ZH4 F;  1K78 A;  4U88 A;  2XRN A;  1JE8 A;  1J0R A;  4O6J A;  3U2R A;  2VN2 A;  2NAZ A;  4EMS A;  2L4A A;  2M30 A;  2CFX A;  4G8X A;  2OA4 A;  4BQA A;  3QU3 A;  5DCM A;  4HLY A;  5HLH A;  3MFK A;  3JSP A;  1B9M A;  4Q4Z F;  3R61 A;  3DP7 A;  3J81 K;  3F22 A;  2HYF A;  2FMY A;  4LG0 B;  4UUV A;  1XGS A;  3K1P A;  4L5I A;  1ZYR F;  3E6M A;  1H9G A;  2W24 A;  3LAJ A;  4M9Z A;  4P55 A;  5L3F A;  3SQN A;  4HX8 A;  1ZGJ A;  2A61 A;  4KA4 A;  1OYI A;  5DUI A;  3HRM A;  3WTW C;  2KIF A;  1YS6 A;  2K86 A;  2P5L C;  2FF4 A;  4IHS A;  3SZP A;  3M8E A;  2M5W A;  5E8I A;  3BRO A;  1HKT A;  1J5Y A;  2HS5 A;  1R23 A;  3R60 A;  3NEU A;  2NNY A;  4D0P A;  3HTU A;  4S04 A;  2P6T A;  3D0S A;  3RIR A;  3TGN A;  3V8K A;  2HKX A;  1XCV A;  1HW5 A;  2M45 A;  3CO7 C;  1JHH A;  4JK1 X;  1HXD A;  2MH9 A;  2ZJ2 A;  4I09 A;  5D5X B;  1BC8 C;  1LEB A;  3Q5F A;  3R0J A;  2JSC A;  3V7C A;  5LEJ A;  1L0O C;  1WI9 A;  2LNB A;  1OMI A;  3CLO A;  2WWY A;  2MH2 A;  1Z05 A;  1LVA A;  1ZH5 A;  1XN7 A;  3T0Y A;  2EFO A;  4RAY A;  4RB0 A;  4GGG A;  4YII A;  1T0F A;  2CO5 A;  3T8T A;  2ISY A;  5ILU A;  2QQA A;  2FXA A;  2RKH A;  2HEO A;  1XGM A;  1SMT A;  4CGZ A;  5AIQ A;  4KUM A;  2AXL A;  3JAM K;  4A12 A;  2F2E A;  5J8F A;  3BJA A;  2F5C A;  4I0A A;  5FGM A;  5LHH A;  1LNW A;  4LFU A;  1R22 A;  1KGS A;  3COA C;  2JRT A;  1RI7 A;  1QZZ A;  2MD5 A;  4HZF A;  5FO5 A;  1D8K A;  3QP6 A;  3FXQ A;  1HBX G;  3M7G A;  3RKX A;  2EB7 A;  1ZRF A;  4I2O A;  3WU1 B;  4S05 A;  3MEX A;  3WOD F;  4IHT A;  2GAU A;  1TW2 A;  3P7N A;  3GW2 A;  2YX7 A;  3FZV A;  2FU4 A;  4M73 A;  1A04 A;  2DQR A;  1HST A;  4YIF A;  2KRF A;  4PCQ A;  2CWE A;  1QPM A;  2UWM A;  3VOD A;  4KN7 X;  3OV8 A;  4CO8 A;  1MKM A;  1STZ A;  3E6C C;  3MZH A;  3KP5 A;  1YYV A;  2VE9 A;  1I1G A;  3KZZ A;  5LGT A;  1Z1D A;  2W84 A;  5L3B A;  1DUX C;  3F21 A;  4MNU A;  3K69 A;  1O7L A;  5BPD A;  3KP6 A;  5D6E A;  3HUG A;  3I4P A;  1JHF A;  1G3T A;  1OKR A;  1OPC A;  3ZMS A;  2ZKZ A;  3M9A A;  2H09 A;  5DD4 A;  1ZRC A;  3EUH A;  1BIA A;  3LFK A;  1ZHF A;  3V8L A;  1UCR A;  1YFH A;  3BDD A;  4E70 A;  2M8E A;  4EM0 B;  2DO7 A;  2STW A;  1MZB A;  2DK5 A;  5DCM B;  2A6E F;  1IAW A;  4KDP A;  1IRF A;  4LJZ F;  4G7O F;  2RV8 A;  1YS7 A;  5FB2 A;  3E3V A;  5KK1 A;  2RN7 A;  3GX4 X;  2XUB A;  5CVJ A;  1XGN A;  5ERI A;  3V7S A;  3BJ6 A;  2IA2 A;  4WWC A;  2LDU A;  4HV6 A;  4I0B A;  4EM1 A;  1SD7 A;  2W25 A;  5AON A;  5F6F A;  4EJU A;  3J7A O;  1R1V A;  4EJO A;  4ENJ A;  2JZY A;  1VTN C;  4IPA A;  1GXP A;  1J2X A;  5DV5 A;  3E97 A;  2CW0 F;  3F6O A;  4ZZL A;  1REP C;  2YPR A;  1RZ4 A;  3DEU A;  4M71 A;  2YSR A;  4RB3 C;  2XAS A;  4PDK A;  4ZYH A;  2OZ6 A;  4BHP A;  3HYI A;  2ZNZ A;  4HQE A;  3JSO A;  2COM A;  2G7U A;  4UHT A;  3I0T A;  4RB1 A;  1IW7 F;  2VOD A;  2ETH A;  4RGR A;  2B0L A;  3M1E A;  3HSE A;  2XV4 S;  1SD5 A;  1R58 A;  2EFW A;  3WTX C;  5LRR A;  1IUY A;  3QRF F;  2J5P A;  1PDN C;  2P5V A;  3QPH A;  2OD5 A;  4XLP F;  4LK0 F;  1G3W A;  2DU9 A;  3GFJ A;  2IA0 A;  5IT9 Z;  2VBW A;  3C1D A;  2EA2 A;  2XAF A;  1O57 A;  2XKP A;  4TV7 A;  1IXC A;  1YIO A;  1ONV A;  3KCC A;  3KLN A;  4KT5 C;  1MJ9 A;  4QLC U;  2Z99 A;  4L5J A;  2KJC A;  5BS6 A;  2A07 F;  3PQJ A;  6PAX A;  3BPV A;  3TQN A;  5JR3 A;  4WXD A;  2MC3 A;  2HWV A;  2D1H A;  1FP1 D;  3ZN1 A;  1HSJ A;  3ECO A;  4OIR F;  2DK8 A;  3MQ0 A;  4U0V A;  1KU7 A;  3DPT A;  1SMY F;  2RNJ A;  2XGX A;  2QWW A;  2FEZ A;  4OMY A;  3LQQ A;  4LD5 A;  3NQO A;  4DNC A;  2CGP A;  1FYK A;  4B8X A;  2GXB A;  1I1S A;  1KQ8 A;  1D5V A;  3WTZ A;  2HDC A;  1I5Z A;  2GZW A;  3JW4 A;  1FC3 A;  3HSR A;  1MJB A;  2XAJ A;  3TO7 A;  3ZMU A;  5J8C A;  2MLG A;  5E1Z B;  5ICC A;  4A6E A;  2LF7 A;  1RNL A;  3DXJ F;  4YFN F;  2V79 A;  1FP2 A;  4LB6 B;  5HDG A;  1NHA A;  5HS7 A;  1ZG5 A;  4MGR A;  1T6S A;  4G9Y A;  3O6B B;  2DW4 A;  2FNA A;  3LA3 A;  1C0W A;  4K2E A;  3WTS C;  1KA8 A;  1TQI A;  4EQQ A;  3ZN0 A;  2R3S A;  2M87 A;  4GXO A;  3WTY C;  2A6H F;  3RYP A;  2K4J A;  2ACJ A;  4NHJ A;  3RDI A;  3L2C A;  1XDU A;  1T2K A;  3CUQ B;  3DFG A;  4ASN A;  3DPL C;  4R8H A;  5E1W A;  1U2W A;  4LLL A;  1KQ0 A;  1UST A;  4AWX B;  4UVC A;  4WCG A;  4UV9 A;  1BN5 A;  2YR2 A;  1QO0 D;  5BQT A;  3BP8 A;  3VOE A;  5IT9 K;  1WRJ A;  4UNO A;  2VC1 A;  1S3J A;  5HVQ C;  2L54 A;  3RYR A;  4P9F A;  1GHC A;  4HOB A;  1AWC A;  1PUE E;  4R79 A;  1PP7 U;  4G7H F;  1ZG1 A;  1LJ9 A;  1B9N A;  3I59 B;  1LDK B;  1XCB A;  1E17 A;  2DQL A;  1UHM A;  4I7H A;  2HQN A;  4U0W A;  1SD4 A;  5FD6 A;  4YG2 F;  2V6C A;  1CF7 B;  1LEA A;  4KNY A;  3B02 A;  1HKQ A;  3O2P E;  5L3C A;  3GUD A;  1BBY A;  3C7J A;  4OMZ A;  4MQ9 F;  1BI3 A;  4RAZ A;  2FA5 A;  3FM3 A;  3GEZ A;  4ZZD A;  5BOX A;  4ZYE A;  2IA1 A;  4NQW A;  4EGZ A;  4R1H A;  1LDD A;  4B09 A;  2UXX A;  2QM3 A;  1SFX A;  4JQF A;  1LQ1 A;  2WV0 A;  4ZYD A;  3Q9S A;  1G4D A;  4XLN F;  5H6Q A;  3GFI A;  2CG4 A;  3V7R A;  3P9C A;  1HKS A;  3F23 A;  4BXU A;  1IF1 A;  4ENN A;  1IN7 A;  2STT A;  1XB4 A;  1CGP A;  2EFP A;  1R5H A;  3I53 A;  4L9N A;  2DTR A;  3QOP A;  3FWE A;  2H27 A;  5DEQ A;  3CUO A;  1FX7 A;  5DUK A;  3QP5 A;  2LKP A;  2O6G E;  3CUQ A;  2JPC A;  1FBS A;  1WSU A;  1YG2 A;  3ABU A;  3O3K A;  3FMQ A;  3EDP A;  1H9T A;  2HGC A;  3GYH X;  5LHG A;  2XAH A;  5FFX A;  1P6R A;  3KP2 A;  1FYL A;  1ZRE A;  2O3F A;  4ESJ A;  4L0Z B;  3Q9V A;  5DYM A;  1FLI A;  4PGG A;  3J80 K;  2X0L A;  1UB9 A;  2FNP A;  4FX4 A;  4M9S A;  3GFL A;  2A5Y B;  1F1Z A;  2PMH A;  1KQ9 A;  4FHT A;  2K7L A;  5E20 A;  1ON2 A;  4ENM A;  2DPU A;  4KFC A;  1FT9 A;  4IRG A;  1EH8 A;  4G6Q A;  1U8R A;  3WE3 A;  3L09 A;  1I27 A;  1KU9 A;  4OU0 A;  3ELK A;  3GF2 A;  4BYY A;  1QBJ A;  3U9G A;  2ISZ A;  2Z9O A;  3IL2 A;  2F5E A;  1SAX A;  4EJV A;  2H6C A;  5DDG A;  2VON A;  3WU0 A;  5LEK A;  3GVA A;  2EV5 A;  3EQL F;  2P7C B;  1W4M A;  2V9V A;  2V1D A;  4Q47 A;  4L18 B;  2HKO A;  3TO6 A;  5K5R A;  1W5T A;  2HR3 A;  5K5O A;  3KE2 A;  5LHI A;  1PP8 F;  3G3Z A;  1HW2 A;  3KEQ A;  2O8X A;  4HW0 A;  4KIB A;  2IPQ X;  1YO5 C;  3ZMV A;  2HTS A;  3ZMZ A;  3F8F A;  4UVA A;  4BNC A;  1S29 A;  5LGN A;  5KVR A;  3GZ5 A;  1FSE A;  2IT0 A;  2RVC A;  2ZXJ A;  4FX0 A;  2C6Y A;  4I02 A;  1WKM A;  1RUO A;  4IJA A;  4Q5S F;  3ERE D;  4MEY F;  5CLS A;  5E17 F;  1MDM B;  2R7F A;  4F7Z A;  1S7A A;  2GWR A;  2DPD A;  4YFK F;  3KFW X;  2DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...