2NRAC

Crystal structure of pi initiator protein in complex with iteron dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
260
structure length
252
Chain Sequence
VNKKTKIRHRNELNHTLAQLPLPAKRVMYMALALIDSKEPLERGRVFKIRAEDLAALAKITPSLAYRQLKEGGKLLGASKISLRGDDIIALAKELNSEELDLNIIEWIAYSPDEGYLSLKFTRTIEPYISSLIGKKNKFTTQLLTASLRLSSQYSSSLYQLIRKHYSNFKKKNYFIISVDELKEELIAYTFDKDGNIEYKYPDFPIFKRDVLNKAIAEIKKKTEISFVGFTVHEKEGRKISKLKFEFVVDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*AP*AP*CP*AP*TP*GP*AP*GP*AP*GP*CP*TP*TP*AP*GP*TP*AP*
publication title Crystal structure of pi initiator protein-iteron complex of plasmid R6K: implications for initiation of plasmid DNA replication.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
total genus 71
structure length 252
sequence length 260
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01051 Rep_3 Initiator Replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nraC02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nraC01
2EK5A 3ZMUA 1YIOA 3ZMTA 1OYIA 2PEXA 3ABUA 1S3JA 1ON1A 1WKMA 3ELKA 5LBQA 1BBYA 1MKMA 1HW5A 4RAYA 3E5QA 3IL2A 2FSWA 4BH9A 1FX7A 4RGRA 4U0VA 4A5NA 2NNNA 1R7JA 2P7CB 1LEBA 3CUQA 3O3KA 3WTXC 1G3WA 4U7BA 2V1UA 4EM2A 4KIGA 5L3FA 1W5SA 2XAFA 1K7AA 3C3WA 4U0YA 5F64A 4WWCA 2QM3A 3GW2A 2NRAC 4LK1F 2WV0A 5HLGA 2A3SA 1TQIA 3LAPA 2PLYA 4ON0A 1IRFA 3OOPA 3VEPA 2A61A 5E1WA 3WE3A 5D5VB 4KN4X 1IN6A 1MJ9A 2IRFG 2GQQA 4OU0A 1W7PD 5HDGA 1FPQA 3F23A 4UVBA 2ISYA 5FLXK 4WXCA 2M8EA 2ZJ2A 2FBIA 1OYWA 4CICA 3JAMK 2RGVA 3CLOA 1JHFA 1U3EM 4RGXA 2FBHA 3EYYA 5J8FA 1OYYA 4RB0A 1E2XA 3J80Z 2EV0A 4M73A 3HRUA 1XGSA 3GLXA 5DCMA 3EETA 5CVRA 4Z2YA 2QQBA 2G7HA 3EQLF 3HOTA 3WTTC 2HQRA 3TKYA 1FWZA 2XGXA 2V79A 3DKWA 1YW8A 4LG0A 1ZARA 4ESBA 2R7DA 2F5FA 4MEXF 1BM9A 1ZRFA 3R4KA 3HUGA 2UXXA 3LQQA 4AIKA 3R0AA 2W57A 1K6OA 1ZHFA 3WTZA 2IA2A 3Q9VA 3Q9SA 2FXAA 1D8KA 2FOKA 1U5TB 4HQMA 2HKOA 2ESHA 1IN8A 1JXSA 1ZG1A 2L3DA 2IT0A 3FMSA 2DTRA 2CQKA 1UCRA 4O3MA 3FZVA 2LNBA 1L3LA 4FX0A 3F3XA 4EJVA 4ZYHA 3E5XA 2Q2EA 5TJJA 5TRDA 2L4MA 3D0SA 1J0RA 1QGPA 3P9KA 3ZP5A 4BQAA 3RPUA 2EFNA 4FHTA 1P92A 3K0LA 3L7WA 3RTRA 4AD9A 4G6QA 1B4AA 2QQ9A 4HA8A 1UB9A 5ICEA 3I58A 3MFKA 1USSA 1XCBA 3ZMVA 2QBYA 3I64A 2KKOA 3TO6A 6PAXA 1FYLA 4YIFA 2FU4A 3P7NA 1T2KA 1GVJA 4EJUA 1I1SA 2YPRA 3GZ6A 2XV4S 2E1CA 1IRGA 2DW4A 1TW3A 1BI0A 2H6BA 2IJLA 3H3ZA 4U88A 2EJRA 3BP8A 3HSFA 4BXUA 3KZZA 3HHHA 3RPQA 5E20A 4B8XA 1QQIA 4PDKA 1LDKB 1SD7A 5ICCA 1YW7A 2EFOA 2VE9A 4MNUA 1YO5C 4RB2C 3EDPA 1PUEE 3C1DA 5L3GA 4I0BA 5HLIA 2UZKA 3KZYA 2PQ8A 4HV6A 4S05A 3F8BA 4OMZA 1ONVA 4UVAA 3TDUC 2W84A 2LSOA 4P9UA 2O0YA 5ILVA 2VODA 1S6LA 1P4XA 4HBLA 5LGUA 3RKXA 1QZYA 4IXAA 3I59A 2XAQA 2PJPA 2KIFA 1RUOA 3WODF 1C0WA 1SD5A 3ZN1A 4GXOA 1TNTA 3KP6A 1F5TA 2CYYA 2MLGA 3HTUA 2KJBA 3CUQC 3CUOA 4QWQA 2E7XA 2ZMEB 4FT8A 5LHGA 2HWVA 2GAUA 5JVTA 2A5YB 1CF7A 1G3YA 2KRFA 3PQKA 5CYVA 1R23A 2DFIA 1ZN2A 3IKTA 1HKQA 1HQCA 4KICA 1W5TA 3J81K 5ILUA 1F4KA 1PP8F 1Z1DA 1YS7A 2G9WA 5D8KB 5FFZA 3KEOA 5HLHA 2ZNZA 4HQEA 3IC7A 3CO7C 2EA4A 2ZCWA 1RI7A 2P7VB 3QP5A 5BOXA 2M45A 3GO5A 2JTVA 3T8TA 4NB5A 4CHUA 3T8RA 1XGOA 2EFPA 3E5UA 4N9HA 4Q4ZF 4GYIA 5D5WB 4R1HA 1LNWA 4UHTA 1ZG5A 1EH6A 1KYWA 3SXYA 3MQ0A 2STTA 2A6EF 2HQNA 2V1DA 2JT1A 1T39A 1FC3A 3FM5A 1R22A 2HZTA 2FMLA 4BYYA 1ODDA 2HS5A 3RKYA 4EQQA 3HHGA 1ZGJA 1BOAA 3LFKA 2A69F 5H6QA 2P6SA 4KNYA 1U78A 3KLOA 1EH8A 1DPUA 2MH2A 4UXNA 3ML6A 4N0BA 3DF8A 3LA3A 1LQ1A 3QP6A 1W7PB 4R8HA 1O7LA 2YSRA 4MEYF 2A68F 3F8NA 2JRTA 1DUXC 1STZA 3O6BB 3R0JA 3C18A 1SMYF 1XSXA 2JSCA 3TO9A 2FEZA 3QOPA 4CDGA 1O57A 4XRFA 2FE3A 3T1BA 2ELHA 1ZLJA 2OBPA 1H9GA 4MTEA 2JZYA 3JW4A 1O3RA 1MZBA 4P5OA 2IW5A 1IN5A 3ERED 2DU9A 2M30A 3U1DA 3DP7A 4ETSA 1MGTA 5ICGA 4QLCU 5FLXZ 4LGWA 5HVQC 2WWYA 4ZYDA 2ZBKA 2ETHA 3FF5A 2M1BA 2QUFA 3L00A 1KQ0A 2Z33A 1D8JA 4GYGA 3JAMZ 1HSJA 2FNAA 4OIRF 1SFXA 4UVCA 3CO6C 4GO1A 3AAFA 3BPVA 3KP2A 3MWMA 3S2WA 1OMIA 3M8FA 3JSPA 4A6DA 1TBXA 4ESFA 5DCFA 2H27A 3E6MA 3BWGA 3B02A 1WQ2A 2AXLA 1GXQA 3QU3A 2V1XA 1IXCA 2F2EA 1HXDA 3DPTA 4L0YB 1U6GA 1K78B 4XSZF 4IJAA 1P6RA 1ZLKA 1UHMA 3K1MA 3WTYC 2V6CA 5ERIA 1FSEA 4G94A 3TOBA 2BGCA 2D1HA 1BN5A 3I5UA 1R5GA 5ILSA 4KT5C 5J6XA 2CSOA 1KU2A 1V4RA 2QWWA 2H09A 3ZN0A 1GXPA 2VOPA 4XSXF 3K1PA 3J7AO 2FF4A 4XLPF 3KE2A 2YU3A 2P5KA 4OIPF 1YTYA 2VC1A 2BYVE 1FBUA 2EV5A 1P2FA 1R5HA 5KK1A 1U2WA 5HS7A 4D0PA 2UWMA 4HAMA 1HSTA 4PCQA 4MQ9F 4HYEA 1X3UA 1B6AA 4G9YA 3B73A 2P5LC 1KA8A 5L3CA 1KYZA 2QYOA 1IN4A 4HX4A 1G6NA 4P96A 5JFRA 2VOOA 3LWFA 1YLFA 2GA2A 2Q8KA 4MGRA 1BJAA 2A07F 1FOKA 5FGMA 5DD8A 1T38A 5E1ZB 3GWZA 5K1YA 4EV0A 2VE8A 1ZG3A 4KUMA 1JGSA 2OD5A 1VTNC 2LKPA 3G3ZA 3WU1B 3V7SA 4ENNA 3JTHA 3RIRA 3K1NA 1ZH5A 2QVOA 1OKRA 1DP7P 1YQAA 2EA2A 1FY7A 4IHSA 5AONA 3GFJA 3WTVC 5K5RA 2COMA 1TQMA 3HRTA 4OIOF 1ZREA 2K27A 1FP2A 4B09A 1O3TA 2HR3A 4KDPA 1FBSA 5H20A 1QBJA 1DPRA 2YX4A 1R1UA 2TDXA 5JI6A 1A04A 1QO0D 2UXNA 4O6JA 2OAZA 4HF0A 1EV7A 3DPLC 1PDNC 1TLHB 5FB2A 1T6SA 1XN7A 2DI3A 1O3SA 4WXDA 2XAGA 5DEQA 4M72A 3DFGA 1YW9A 4I02A 5LRRA 2FQ3A 2J5PA 2VBXA 3L09A 4I2OA 1QNTA 1FP1D 4NQWA 2ZMEA 4AVPA 4Q47A 4G7OF 2VXZA 3WE2A 1LDDA 2ACJA 3M8EA 2D45A 5LRSA 2IVMA 2HOEA 3J81Z 3WTSC 2QZ8A 5IT3A 1S7OA 3HOSA 1D5VA 1QZZA 1Z9CA 3K2ZA 2RC4A 1F9NA 4RB1A 2C6YA 4YFXF 2ESNA 4AIHA 2XKOA 1ULYA 2VT3A 2RNJA 1WWXA 1SD6A 2RKHA 4UUVA 3GVAA 2XVCA 5JR3A 3PFIA 3F8MA 2HDCA 4EGYA 4RGSA 5LEKA 2VBZA 5LHIA 1KQ8A 4PGGA 3QU6A 3KCCA 4I09A 4LG0B 2XAHA 3E97A 2O03A 4UV8A 1G4DA 5HDKA 1BI1A 3W6KB 1IXSB 2EV6A 4M9XA 3ZMDA 1H9TA 4M9ZA 2NNYA 4HW0A 3V8KA 3M1EA 3M7GA 2VN2A 1XCVA 2STWA 4LLGF 2P4WA 3FMQA 3SZPA 2KIUA 1R1TA 5LHHA 3MAJA 1Z7UA 5IT9K 5J8CA 1I1GA 3FXQA 3COAC 5EEGA 2O6GE 2P5VA 4CZZA 2OZUA 2ZNYA 4EVIA 3KP4A 1XSVA 4EJWA 5BMZA 2EFWA 2VC0A 2HTSA 5H6RA 4P55A 2Q0OA 2CO5A 1S8NA 5ICFA 4ENMA 2QLZA 1SFUA 4A0XA 1O3QA 1PP7U 3GZ5A 1F1ZA 5LGTA 3V8JA 4L9TA 1FYKA 2KIMA 4A12A 5A2QK 1HKSA 3CTAA 2E7WA 4RB3C 4EM0B 3Q5FA 4WXHA 4ZYGA 3E3VA 4IRHA 4DNCA 3GF2A 2X0LA 2DBBA 5DV5A 2DK5A 3LA2A 2H6CA 4ZYEA 2CW0F 3RI4A 4LD5A 3ROUA 3BPXA 4TV7A 2MA3A 3TQNA 2H94A 2IA0A 1B59A 2PMUA 4CO8A 4WF2A 1XMKA 2FBKA 2B0LA 3R6SA 5K5QA 1BIAA 4G6DA 3ECOA 4AWXB 2VBYA 3HRSA 2DO7A 3HSRA 1IAWA 1MD0A 3IHUA 3N4MA 2K7LA 3GEZA 4LJZF 2GWRA 3FM3A 2GXGA 4CGZA 2L54A 4F7ZA 2JPBA 5L3EA 4CYDA 2EWNA 1J75A 3BJ6A 3V7RA 4EJTA 1B9NA 2MD5A 3R61A 2DPDA 1JHHA 1TW2A 3I59B 1YFHA 3KP5A 1P4AA 3WGIA 4MHGA 1TQPA 1K78A 3SHFA 1XGNA 3ISPA 3BDDA 3V4GA 1TNSA 3IKVA 3LAJA 2W25A 4BHPA 5BPIA 1UHWA 3MZYA 1CF7B 1I5ZA 2M87A 3K69A 5CVVA 3ZMZA 1SD4A 3C7JA 3QRFF 3SZTA 5CVUA 4FX4A 4KMFA 5E17F 4JQFA 2F5DA 2IPQX 3QPTA 1KU3A 4L5JA 1HW1A 4IRGA 2PI0A 4ENKA 3GUDA 3GFLA 4A2UA 1MDMB 5F6FA 3HYIA 1IZ1A 2RV8A 3GXOA 4ZZDA 2XRNA 3FX3A 3EUHA 3FMRA 1LJ9A 1LVAA 1TTYA 2PBIA 4Y15A 4HF2A 1FBQA 4JK1X 1RZ4A 1BIBA 2CFXA 2F5EA 1BC7C 2Y48A 2CGPA 2DAOA 4IPAA 5BPDA 3IRQA 4R79A 3I54A 1J5YA 4GCVA 2BV6A 2NYXA 1NHAA 3HRMA 2HYGD 5E8GA 4PGHA 1EH7A 2XHKA 5KVRA 4WK8F 2K4JA 4KMUX 2ZKZA 1SAXA 3VB2A 3DXJF 2BBYA 4OIQF 4G8XA 1L0OC 4YIIA 2G7UA 1G3SA 3QPHA 2ZO4A 3EYIA 3GX4X 1K79A 3KP7A 3K9TA 1U5TA 4LB6B 2BEOA 2WC2A 1J59A 1R36A 3PQJA 4EMSA 5D4RA 1BC8C 5HOOA 2K86A 2VONA 1FNNA 2M5WA 1IN7A 3BOQA 4BAYA 4OOIA 1BI2A 5AIPA 4O5VA 1O7FA 1RNLA 4LFUA 5LLQA 1R58A 4M6YA 5FD5A 2MC3A 4LB5A 1KU9A 3IWFA 3NEUA 2PN6A 1B9MA 2GXBA 1ON2A 4S04A 3LSTA 2Z3YA 2GIVA 4MTDA 1AOYA 3GYHX 4KFCA 3O2PE 2CWEA 1ZAOA 2CG4A 1RUNA 2HFHA 1OR7A 1YYVA 3HSEA 2A6HF 3OV8A 1XDUA 3SQNA 1IF1A 1LB2A 1I27A 2RDPA 2ISZA 4M74A 2IP2A 1QPMA 3F8CA 2ZFWA 4Q5SF 1KQ9A 2OA4A 3M9AA 3FHZA 1H0MA 4KIFA 4BHCA 3BJAA 3VOEA 1MJBA 4A5MA 1SMTA 3E6CC 3KP3A 1YS6A 3F6OA 4YG2F 1IW7F 3MZHA 3BJOA 2NAZA 4ESJA 1Z91A 3WU0A 5F1RA 1YG2A 2LF8A 5HS8A 2Y75A 3CUQB 1Z6TA 3LA7A 5IT9Z 1XDSA 4L9JA 2Z99A 2LDUA 1ZRCA 4CXFA 3W6JB 4I7HA 3D5LA 5L3DA 1HW2A 2EFQA 1FT9A 4E70A 5CVIA 2DT5A 2MH9A 4ZH4F 1GHCA 2OQGA 3IRRA 3L2CA 4HLYA 1ZRDA 2GZWA 3VODA 2O8XA 1USTA 4XBFA 3RDIA 2YR2A 3KETA 2PG4A 4HZFA 2ZXJA 5A2QZ 3TDZC 3QAHA 4L0ZB 2MBFA 3CDHA 2IA1A 1OPCA 4AIJA 1CGPA 1WI9A 3WGGA 5ED4A 2Z5UA 1KGSA 5CLSA 2HKXA 1LDJA 4U0WA 1G3TA 3JSOA 5DCMB 3TOAA 4XLNF 4UNOA 3J80K 2PMHA 2O3FA 3L9FA 3P9CA 1E17A 5DUKA 5DDGA 3BY6A 1MJAA 1REPC 3DEUA 5D8LB 2AS5F 5CVJA 4L9NA 2DQLA 2RVCA 4HX7A 4BNCA 5L3BA 4LLNA 2XIGA 4IRIA 3H3UA 2L02A 4I0AA 2Y0MA 5D4SA 1T0FA 4RAZA 4K2EA 3WG9A 2O61A 4DQ2A 3F22A 4EM1A 1R00A 1V3FA 3F21A 4A0ZA 2DPUA 5D6EA 4M9SA 3R60A 1WSUA 1B1BA 4U7DA 3E6DA 5LEJA 3H92A 2D1VA 3U2RA 1FSHA 2BE5F 1W7PA 5E1XA 2P6TA 4UV9A 1XB4A 2RN7A 5BQTA 4EGZA 4A6EA 2D2WA 4NHJA 3RYPA 3ZQ7A 2FA5A 2E1NA 4MQVA 1Z6RA 5DUIA 2LF7A 1U5TC 1LEAA 4Y13A 2K02A 2HYFA 3I4PA 4IVNA 1WRJA 2L4AA 1U8RA 2X4HA 2NS0A 4KYWA 2R7FA 2K4BA 3KEQA 3WGHA 2QENA 2FRHA 2VT2A 3BZ6A 2DQRA 4YFNF 1FZPB 2XKPA 1XD7A 2QBYB 3U9GA 4ASNA 3G73A 1J7KA 3ZMSA 3FWEA 2OU2A 5FO5A 5K5OA 1FYMA 3GFIA 1FLIA 2OQRA 3CJNA 5DYMA 1MDMA 2FNPA 2WTEA 5E18F 3RJPA 4M6XA 5EEHA 1Z05A 2JPCA 1S29A 3F6VA 3FXUA 1UFMA 5HDNA 4HDVA 3WTUC 2ADUA 3MEXA 4EJOA 4G7HF 3I0TA 3LQRA 2P8TA 3HTSB 3ECHA 2L01A 3BROA 1I6XA 1J2XA 1SFEA 3MCZA 5DD4A 2XASA 1XMAA 5LGNA 4WCGA 4ENJA 4LMYA 3IWZA 4KN7X 2GA1A 4YFKF 3ZPLA 3NRVA 2DK8A 2W85A 4L5IA 1P4WA 2XUBA 3JTGA 4GGGA 1JE8A 3KLNA 2HTJA 5D6FA 2DLLA 3N97A 4I98B 1J9IA 1R1VA 4JBAA 5AIQA 3DV8A 5JHUA 4G7ZF 4IHTA 3RKWA 2FMYA 1IXRC 2KJCA 2F5CA 4OMYA 4KA4A 3I53A 4P9FA 4Y17A 4M71A 4A0YA 3T0YA 1ZYRF 2PFBA 1HBXG 3TGNA 5BS6A 4I01A 3I71A 2W24A 4HV5A 3REOA 3NQOA 3V8LA 5D5UB 4HOBA 4ZZLA 4OINF 1DDNA 4KIBA 4HF1A 3DQVC 3E6BA 4IF4A 2HGCA 3TO7A 3F72A 4PZJA 1KU7A 3GFMA 2R3SA 4N9IA 1Y0UA 5FD6A 3KFWX 4LK0F 3T5XA 3ULQB 4BHBA 4L9VA 1XSDA 3FXRA 1Q1HA 5CJ9A 1S7AA 2XROA 4HX8A 4RS8A 1AWCA 4RGUA 5HS9A 4LLLA 3SFZA 2XAJA 5FFXA 1BI3A 4L18B 4HLXA 1IUYA 2OZ6A 1XGMA 1W4MA 1ZGAA 2V9VA 4Q48A 2VBWA 1RIOH 4HDUA 3VFZA 2HEOA 4H0EA 3ABTA 1T98A 4WX9A 3V7CA 2EB7A 3P9IA 2Z9OA 1HKTA 5D5XB 2MLKA 2J5OA 2YX7A 3F8FA 1D3YA 3RYRA 3HIFA 3WTWC 2QQAA 2RQPA 5E8IA
chains in the Genus database with same CATH superfamily
1UG2A 2EK5A 3ZMUA 1YIOA 2KISA 2E71A 2M9HA 3ZMTA 1OYIA 3A03A 1YRNB 4A3KJ 2PEXA 3ABUA 1S3JA 3ZQGA 1ON1A 2Y9ZA 1WKMA 2B9SA 3ELKA 5LBQA 2GXAA 1BBYA 1MKMA 1HW5A 4RAYA 3M4OJ 1Z67A 3E5QA 3H9JA 3IL2A 2FSWA 4BH9A 1FX7A 3J7ZI 4RGRA 1ETVA 1ZKGA 1UMQA 4AYBN 4U0VA 4A5NA 2NNNA 1WJBA 1T0FC 2H8WA 1R7JA 2WADA 2P7CB 1LEBA 3CUQA 3HB9A 3OS1A 3O3KA 3WTXC 1G3WA 4U7BA 1XC5A 2V1UA 4EM2A 1VZ0A 4KIGA 2R5YA 3CF2A 5L3FA 1W5SA 2V26A 4J19A 2XAFA 2WAQA 1K7AA 4CCNA 3C3WA 4U0YA 5F64A 4WWCA 2QM3A 2Y69H 1AKHA 3GW2A 2L9VA 2NRAC 1VNDA 4LK1F 2WV0A 2WV1A 3AG4H 5HLGA 5HNFA 4RDUA 1JJ8C 2A3SA 5KAFC 3S3NA 2EPFA 1WJCA 5M5WJ 1TQIA 3LAPA 2PLYA 2DT6A 3HKZN 4ON0A 4KITB 1R49A 1IRFA 1A31A 1VQ9I 4A3DJ 3OOPA 3VEPA 3H9GA 2A61A 4G12A 4W1UA 2CV0A 5E1WA 5EGOB 2JUGA 2XF6A 4E6KG 3WE3A 1LE8A 2JK3A 2WB1N 5D5VB 3HEFA 1Y1VJ 2M0MA 1IN6A 1MJ9A 4KN4X 4EATA 2IRFG 1RETA 4E7IA 1ZR4A 2E35A 3VYTB 3GTLJ 2GQQA 4OU0A 1W7PD 1DU0A 2HZDA 1OISA 5HDGA 5IYBJ 1MBFA 1FPQA 2XDVA 2HYJA 3F23A 5TISC 4UVBA 2GM4A 4XLAA 2ISYA 2JUCA 3H35A 5C4JJ 3G6EI 5FLXK 4WXCA 3FKIJ 2M8EA 2ZSHB 2ZJ2A 4UUSA 2FBIA 1OYWA 4AYBA 3O8HA 2VLAA 2CV2A 3A02A 4BJ6C 4W97A 4CICA 3JAMK 2RGVA 3CLOA 1JHFA 1U3EM 3DTIA 3H5NA 4IO9F 4CYCB 4RGXA 1K61A 4GRIA 2KT0A 1Z7LA 2EZKA 4XLCA 3DLLF 2BXZA 2FBHA 4B48A 3EYYA 4X1EA 5J8FA 1OYYA 1CQTA 4RB0A 1S5LC 1X1DA 3PUFA 2KFDA 1PUFA 1E2XA 3J80Z 2EV0A 4M73A 3HRUA 1XGSA 4NNJA 3GLXA 5DCMA 3EETA 5CVRA 4MIMA 4Z2YA 4BBSJ 2R93J 1MBEA 4AIDA 1PVEA 2QQBA 2G7HA 3S2DJ 3EQLF 3HKZA 3HOTA 2OCCH 5J4YA 3WTTC 5K7FA 2HQRA 4V2FA 3TKYA 1FWZA 2XGXA 3HOXJ 2V79A 3DKWA 1YW8A 4LG0A 4I6ZA 1I50J 1ZARA 4ESBA 2L7ZA 2WB1A 4XLHA 2XRLA 2R7DA 2XPVA 2F5FA 3ZQQA 1UG0A 4MEXF 3KIOA 3CCSI 1BM9A 1BW6A 1OQYA 1ZRFA 4Y3OA 3MZ8A 3R4KA 3HUGA 4JP0A 4M3GA 2CW7A 2UXXA 3LQQA 4AIKA 3DBLB 3R0AA 2W57A 1D1BA 1K6OA 1UELB 3QPLA 1QPIA 2ZSIB 1ZHFA 3MN2A 3FK6A 3WTZA 3BR5A 3TBIA 2IA2A 3Q9VA 2QGUA 2HXIA 3HL2A 3Q9SA 2IS1A 2FXAA 1D8KA 1G59A 2FOKA 3OMYA 3JRDA 1U5TB 1R4MB 4HQMA 2HKOA 3CC7I 2ESHA 3SYTA 5LD2C 1X4PA 4XICA 1IN8A 4UY8I 5FKNA 1ZG1A 1JXSA 4M6VA 3HPHA 2L3DA 2IT0A 3FMSA 2FOWA 2DTRA 4AC0A 2CQKA 1UCRA 4O3MA 2FUG2 3FZVA 2LNBA 1L3LA 4FX0A 1JJ6C 3F3XA 4EJVA 1YHQI 2IBDA 4ZYHA 3E5XA 2XGDA 1E3HA 2Q2EA 2NVXJ 1N25A 1D0YA 1N78A 2CQQA 3D5SC 2L9RA 5TJJA 5TRDA 3DBRB 3K2AA 4XNFA 2L4MA 5FKOA 3D0SA 1J0RA 4JYKA 1QGPA 3P9KA 3ZP5A 4BQAA 3RPUA 2EFNA 4FHTA 2XPWA 1P92A 3S1MJ 3K0LA 3L7WA 2VXDA 3RTRA 4AD9A 3OYLA 1MSEC 4G6QA 3J7YJ 4CSWA 1M1EB 1B4AA 5HLTA 2QQ9A 4HA8A 4BY7J 1IRZA 2V9PA 4BDYA 2HQ5A 1UB9A 1MBJA 5ICEA 3I58A 4IHYA 3MFKA 1USSA 1XCBA 2HPMA 3ZMVA 5BNGA 3I64A 2QBYA 1SAUA 2KKOA 3TO6A 6PAXA 3K4LA 1FYLA 3QYEA 3QYBA 4YIFA 3EUKL 2FU4A 3P7NA 3W3CA 1T2KA 5KCMA 1H89C 3A01A 1GVJA 2VIXA 4EJUA 1I1SA 2BY1A 2YPRA 3GZ6A 2Y31A 2XV4S 2E1CA 1SVMA 3LSGA 4ZYAA 1IRGA 2UUZA 1SFOJ 2F48A 1U9OA 1HOMA 2DW4A 3CP2A 3OYIA 1TW3A 1BI0A 2H6BA 2IJLA 5DS9A 3H3ZA 2L5QA 2QF7A 1X2MA 3K7AJ 4U88A 2EJRA 3OR2C 3BP8A 1YOVB 2DA7A 3HSFA 4BXUA 4ZDOA 3KZZA 4E7ZA 2CUZA 3WU2C 3HHHA 3RPQA 3VYRB 5E20A 2FD5A 3BZCA 5EZGA 1QQIA 4B8XA 4PDKA 1LDKB 5FRMA 1SD7A 3M8JA 5CKTA 5ICCA 1YW7A 2EZHA 2EFOA 2VE9A 2R92J 4Z6YA 4MNUA 1IDYA 2NVUB 1YO5C 3DLAA 4PSWA 4RB2C 2ECCA 3EDPA 2LP0A 3PIOF 3HGYA 1PUEE 2KIQA 4QPQA 4XIDA 3W2WA 3C1DA 5L3GA 3AG3H 4I0BA 5HLIA 1TT0A 3C2BA 1V54H 5B1BH 2UZKA 3BR3A 4IOAF 3KZYA 2PQ8A 2OPTA 4HV6A 3AG1H 2K9SA 4XN0A 1SANA 1MH4A 2M34A 2VKVA 3F8BA 4S05A 3DPUA 1ETKA 4OMZA 1ONVA 4UVAA 3I3LA 4E7SA 4GDFA 3BZKA 3TDUC 1IV6A 2W84A 2LSOA 2E2HJ 4P9UA 2O0YA 4YRVA 3KYCB 3BCAA 4BQQA 5ILVA 3PNVA 2VODA 1S6LA 1N77A 2LFBA 2XB0X 1P4XA 2CRGA 3BT9A 4HBLA 5LGUA 3RKXA 4RAGA 5IP7J 1QZYA 3PNYA 3IKTA 4IXAA 5F1JA 4CCMA 3I59A 2ZFUA 2XAQA 2PJPA 2KIFA 3Q0WA 1RUOA 5CPRB 4CZCA 3L2RA 1QHGA 3WODF 1C0WA 1R71A 1SD5A 3ZN1A 2QSFX 4GXOA 1RRJA 1TNTA 3KP6A 1F5TA 2CYYA 2MLGA 3HTUA 3BTCA 3B6CA 2KJBA 3CUQC 3CUOA 4QWQA 3GTPJ 1KONA 2LREA 1YX3A 2E7XA 2ZMEB 4FT8A 3G1MA 2DFEA 5LHGA 3JR9A 2HWVA 2GAUA 1UZCA 5JVTA 4YEJA 1Z21A 2DOEA 2A5YB 3BLYA 3OIOA 2O9LA 1CF7A 2I10A 1G3YA 4IHWA 2LBFB 2KRFA 3M07A 3PQKA 5CYVA 3S32A 2JA8J 3FK7A 1YE9A 4MO7A 2FQ4A 3VYSB 2CV1A 1WHUA 1R23A 2P0WA 2JRMA 3IAM2 2L9NA 4DBRA 2DFIA 1ZN2A 2X85A 1HKQA 1HQCA 5H2FC 3OYDA 4KICA 1W5TA 3J81K 1MBGA 3CJQB 2MABA 5ILUA 1F4KA 2VB6A 1PP8F 1Z1DA 3VSKA 1YS7A 5FKKA 2G9WA 5D8KB 3K4JA 4DYCA 1W36D 2MD0A 3BR2A 5FFZA 2ID6A 3KEOA 2KZGA 3KYLA 5HLHA 2ZNZA 3GTKJ 4B43A 4HQEA 3FISA 3OR1C 3IC7A 3CO7C 2EA4A 2ZCWA 1RI7A 2P7VB 3QP5A 4Y33A 3GTOJ 5BOXA 3DKXA 2M45A 3GO5A 4DOZA 2JTVA 4IHVA 3HOVJ 1HC8A 3T8TA 4C3JJ 4NB5A 4CHUA 1QU3A 1ZK8A 3E5UA 1XGOA 2EFPA 3T8RA 4BGDA 4A93J 2M4KA 4N4OB 4N9HA 4BEHA 4Q4ZF 3H5RA 2H1LA 4GYIA 4D7NA 5D5WB 5E3NA 3PJRA 1TZLA 3P5JA 4R1HA 1WFXA 3G4SI 1LNWA 4UHTA 1ZG5A 1EH6A 2Z1DA 1KYWA 4AVZA 3SXYA 2LG4A 2M7BA 3MQ0A 2STTA 2A6EF 3BG9A 2HQNA 2V1DA 2A6TA 3ABKH 2WBMA 4PJJA 2JT1A 1T39A 1D0XA 1FC3A 2K40A 3BG5A 4XK4A 5EG0B 3FM5A 3MMYB 1R22A 2HZTA 2EZIA 2VJ5A 5FLMJ 2FMLA 4BYYA 1ODDA 2X6YA 5CQEA 4PFOA 1OCTC 2DMPA 5FJ8J 5EEAA 2HS5A 3RKYA 4EQQA 2LLKA 3HHGA 1ZGJA 1BOAA 3LFKA 1BJZA 4HNUA 2A69F 3PSIA 2P6SA 5H6QA 1RESA 5J1UA 4KNYA 1U78A 3KLOA 1EH8A 3AG2H 1DPUA 2MH2A 1BR4A 4UXNA 3ML6A 3JRAA 1W1WE 4C3HJ 1BR1A 4N0BA 3TP3A 3DF8A 5F0FA 4RBOA 2BOLA 3JREA 3LA3A 2XGCA 3GTGJ 2Q1ZB 1LQ1A 3QP6A 1YRNA 1W7PB 3ZR8X 2CUEA 4R8HA 2MSYA 5EYRA 2IS4A 4DYQA 4BQNA 1O4XA 2E60A 5GAEJ 2JA6J 1O7LA 3HJEA 3E0JB 2YSRA 1A6QA 4MEYF 2Y30A 2A68F 2PJRA 3F8NA 1JT6A 1TWAJ 2JRTA 3H36A 4E7LA 1ETYA 3FXLA 1DUXC 4E7HA 1D1AA 1STZA 2BVLA 2IGKA 3O6BB 3R0JA 4A3IJ 1VQNI 3C18A 1SMYF 3DKYA 1MMNA 2VQGA 1H8AC 1XSXA 2JSCA 3TO9A 3FDYA 1X4OA 2FEZA 1YJNI 1FJLA 2X6WA 3QOPA 4CDGA 1O57A 4XRFA 2FE3A 4PJ0C 3T1BA 2Z16A 3NAUA 3ZQCA 1T33A 1ZLJA 2ELHA 2OBPA 4XLFA 1H9GA 4OAYA 4MTEA 3OS0A 2JZYA 3HXLA 4E7KA 2VPRA 2X6OA 3JW4A 1O3RA 1MZBA 4P5OA 3W2VA 3H0DA 2IW5A 1IN5A 2A05A 3TP0A 3ERED 3LSKA 2DU9A 2M30A 3U1DA 1YJ9I 1WH7A 3DP7A 3HM5A 2DCEA 4ETSA 1MGTA 5ICGA 4QLCU 5FLXZ 1V5GA 4LGWA 5HVQC 2WWYA 4ZYDA 2MW8A 4PFPA 2ZBKA 2BVMA 2ETHA 3FF5A 2M1BA 1V5FA 4C2TA 2IS6A 1QVTA 2QUFA 3L00A 1KQ0A 2Z33A 1D8JA 2LKSA 4GYGA 4OAZA 3JAMZ 1T08B 1HSJA 1KZHA 1MNDA 2FNAA 2DYSH 4OIRF 1SFXA 4UVCA 2F5VA 2XSJC 3CO6C 5E8IA 3JRBA 1UAAA 4GO1A 2K9LA 3QYFA 3AAFA 2KZVA 3CCJI 3BPVA 3OYFA 3KP2A 3RKQA 3MWMA 2CUFA 3S2WA 4CYCA 2HVSA 1APLC 1OMIA 1B72B 1MNMC 2M4GA 1SVLA 3M8FA 3JSPA 4A6DA 2VPLA 1TBXA 4D1QA 1RR8C 3K70C 4FQGA 1GT0C 3QPSA 3RQIA 4ESFA 3L2VA 4C9YA 5DCFA 2YU9J 4MFDA 3KEYA 2R0QC 3DEEA 2H27A 3E6MA 4XLEA 4A3BJ 3BWGA 3B02A 1FTZA 4C30A 2DTZA 1WQ2A 4XKBA 2AXLA 1Y8QB 4HNTA 1GXQA 2ZC2A 3QU3A 2V1XA 1IXCA 3IUOA 2F2EA 4B3XA 3HBLA 3TL4X 4I99C 1RR7A 1HXDA 2FX0A 1HDPA 3DPTA 4UUTA 1TWFJ 4L0YB 2KQRA 1U6GA 1K78B 4XSZF 1WJEA 3S1QJ 4IJAA 5HNHA 2W1OA 3JRGA 1P6RA 1ZLKA 1VQ7I 1UHMA 3GBGA 1Z77A 3K1MA 5DM7F 3WTYC 2V6CA 3DTKA 5ERIA 4BJ5C 2R5ZB 1FSEA 4G94A 4XKCA 3TOBA 2QA4I 2BGCA 2D1HA 1BN5A 3I5UA 1R5GA 4BJTA 1K4TA 5ILSA 3IH2A 4KT5C 5J6XA 1PJRA 2CSOA 1KU2A 1V4RA 4ZDLA 2QWWA 1YITI 2H09A 3V42A 3ZN0A 3A4CA 1GXPA 2VOPA 1ENHA 4XSXF 3K1PA 3J7AO 4LIUA 2FF4A 4XR6A 2R7SA 1BR2A 4AUXA 3KE2A 4XLPF 2YU3A 2K3PA 1U9NA 2P5KA 2AXTC 4OIPF 1Y6IA 4IKFA 1YTYA 4II3A 3OYAA 2VC1A 2XGEA 2LY9A 2BYVE 3FXMA 1FBUA 2EV5A 3E7LA 1P2FA 1R5HA 2G0EA 5KK1A 5GTIC 1U2WA 1BOBA 1WPKA 5HS7A 4D0PA 3BC8A 4FTHA 2F4IA 4HAMA 2UWMA 1HSTA 4PCQA 4HYEA 4MQ9F 1YJWI 4LITA 1X3UA 1B6AA 1X1CA 2DN0A 4A3MJ 2DODA 4G9YA 3SEZA 3AFHA 3B73A 1VF9A 1RKTA 1XG1A 1DQUA 2KDOA 5B1AH 4F92B 3PFYA 2HVRA 2P5LC 1KA8A 3S3MA 5L3CA 1KYZA 2QYOA 3OYGA 2K3FA 1IN4A 3KZIC 4HX4A 4UB8C 1G6NA 4P96A 4DIQA 5C3EJ 5JFRA 1XTAA 2AQFA 2KMUA 2VOOA 3VPRA 3LWFA 1YLFA 2GA2A 2Q8KA 1W0UA 3CCRI 4MGRA 2GLOA 1BJAA 4C2MJ 2I8DA 2LRDA 4LG3A 2O8KA 2A07F 1FOKA 2R7ZJ 2FJ1A 4DGWB 4XL9A 2VQCA 5FGMA 5DD8A 1T38A 1DU6A 1MW7A 4UB6C 2XSDC 5E1ZB 3GWZA 4J01A 3AKZA 2R7TA 5K1YA 4H4KC 1WJAA 4EV0A 2VE8A 2K9MA 3CMYA 1ZG3A 5F27A 2JA7J 4KUMA 1B8IB 2E5NA 1JGSA 1R6RA 2OD5A 5E3LA 1MNEA 1VTNC 3NWSA 2VKHA 2LKPA 2JVGA 3G3ZA 4AU7A 3L2WA 1VFCA 1IO2A 1Y8RB 3WU1B 3V7SA 3RSNA 4ENNA 3JTHA 3RIRA 3K1NA 1ZH5A 2QVOA 1OKRA 3HG9A 3VWBA 2GOMA 2X1EA 1DP7P 2WA0A 1YQAA 2EA2A 3L1PA 1FY7A 4IHSA 1ERDA 5AONA 5FROA 2XB5A 3GFJA 2JA2A 2M3AA 2L9SA 3RQ4A 3WTVC 5M3FJ 3G71I 5K5RA 2COMA 3UR3C 3K10A 1TQMA 4ZDPA 4ANJA 3OSGA 3HRTA 3S1NJ 2QEXI 4OIOF 1ZREA 2K27A 5EF6A 1IGNA 3BG6A 1E3OC 3SZGA 1FP2A 4B09A 1O3TA 2HR3A 4KDPA 1FBSA 1E0EA 5H20A 1QBJA 1DPRA 2YX4A 2VI6A 1R1UA 2IGOA 2TDXA 5JI6A 1A04A 1QO0D 2UXNA 4O6JA 3HOUJ 2VUMJ 2BZTA 2OAZA 2GOXB 4HF0A 4V19K 1EV7A 3DPLC 1PDNC 1TLHB 2QQ8A 1JUPA 1AKHB 5FB2A 3QWLA 1A36A 1JKRC 1T6SA 1XN7A 2DI3A 1O3SA 1QVUA 3DU6A 4WXDA 4BQOA 2XAGA 5DEQA 2OC6A 4M72A 5E3MA 2BY3A 3DFGA 1N75A 1YW9A 3K4CA 1ZTRA 1HF0A 4I02A 5LRRA 2FQ3A 3CJRB 4B44A 2J5PA 2VBXA 3L09A 1W5CC 1TL8A 4I2OA 4F3QA 2YUSA 1QNTA 1G8XA 1FP1D 4NQWA 2ZMEA 3FBNB 4AVPA 1X3WB 4JX5A 2VQHA 4Q47A 1IRXA 1VQMI 4G7OF 2VXZA 4XM3A 3WE2A 1LDDA 2DA1A 2ACJA 1VQ8I 2HOTA 3M8EA 5B66C 2D45A 2DA6A 3SEQA 2IVMA 5LRSA 3HPGA 2HOEA 3J81Z 4UUSB 3H5AA 3WTSC 3I9V2 5FKMA 2QZ8A 5IP6A 5IT3A 1I3AA 1QA6A 3CDIA 3DEWA 1LVKA 1S7OA 3HOSA 1FOWA 1D5VA 1QZZA 1Z9CA 3K2ZA 2IXSA 2RC4A 1F9NA 4IL6C 4RB1A 1Z0XA 2C6YA 4YFXF 1ETQA 4DBQA 1IUFA 4IZZA 1RC9A 2ESNA 4AIHA 2XKOA 4IEJA 4GFBA 1ULYA 2VT3A 2RNJA 1WWXA 1SD6A 2RKHA 3JCUC 3HDDA 4C3IJ 3VDXA 1VQKI 1EF4A 2CUJA 4UUVA 3GVAA 2XVCA 5JR3A 2LKXA 2X1DA 3F8MA 3PFIA 2HDCA 4EGYA 2ZXHA 2BY0A 1A6IA 4RGSA 3CMMA 5LEKA 2VBZA 5LHIA 2X51A 1KQ8A 4KT6A 4PGGA 2DMUA 3QU6A 3KCCA 5DM6F 4I09A 2NVQJ 2D5VA 4LG0B 2HQAA 2XAHA 3E97A 3WHBA 2O03A 4UV8A 1G4DA 5HDKA 1S9HA 1BI1A 3QODA 4LIVA 1WJ5A 2PMZN 3W6KB 2EILH 1IXSB 2EV6A 4L5EA 4M9XA 3UNGC 1Y56A 3ZMDA 1H9TA 3ZOBA 4M9ZA 2NNYA 3NWTA 4HW0A 3V8KA 3M1EA 3M7GA 2VN2A 1X19A 5GP9A 1XCVA 2EIMH 2V6EA 2STWA 3S15J 4LLGF 2P4WA 3FMQA 3K4KA 2NOJB 3SZPA 2KIUA 1R1TA 5LHHA 1NK2P 3GMEA 3MAJA 1P7IA 4XKWA 1Z7UA 2W4SA 5IT9K 5J8CA 5KNLA 2NXNB 1I1GA 4BE0A 4IQJA 3FXQA 4XRMA 2E1OA 3COAC 5EEGA 5K7ZA 2O6GE 5IPAA 2P5VA 3OYJA 4NDLA 1ZR2A 4CZZA 2OZUA 2ZNYA 2E1MB 4EVIA 4PJMA 3KP4A 2R7UA 1XSVA 4EJWA 3JRIA 5BMZA 1S7EA 2Y2ZA 2EFWA 2ME0A 3CCLI 1VI0A 2VC0A 2HTSA 4XOTA 3S3OA 5H6RA 1WCMJ 4P55A 2ZXIA 2Q0OA 2Q2EB 2ZJPF 2CO5A 1S8NA 2VJ4A 3CLQA 5ICFA 2ZXWH 4ENMA 4HPQA 2QLZA 3BTIA 1AHDP 1SFUA 4A0XA 1O3QA 2PMZA 1PP7U 4HG2A 2HXOA 4M3FA 1E3PA 3GZ5A 4RM3A 1F1ZA 3PSFA 1MH3A 1G2HA 5LGTA 3M3YJ 5FLVA 1JGGA 3V8JA 9ANTA 1SVOA 2RREA 4L9TA 1FYKA 2KIMA 2JQ7A 2K85A 4DJAA 4A12A 5JHFA 1X2NA 5A2QK 3LFUA 2ZJRF 1HKSA 2IS2A 3CTAA 3HOWJ 3OYMA 2E7WA 4RB3C 4EM0B 3Q5FA 4WXHA 2IGMA 3H3VK 1WI3A 4ZYGA 3E3VA 3OS2A 4IRHA 3A0BC 4DNCA 3SDGA 1UJ8A 3GF2A 2X0LA 2DBBA 5DV5A 2R7OA 2DK5A 3LA2A 2JA5J 2H6CA 2LTPA 1U8BA 4ZYEA 2EINH 1J09A 2CW0F 3RI4A 4LD5A 4DYRA 3ROUA 3A01B 1SFKA 2O5RA 2CMPA 3BPXA 4TV7A 2MA3A 3VSLA 3TQNA 3CMAI 2H94A 2IA0A 4JOMA 4A3LJ 2LH9A 1NK3P 4NBQA 4ABZA 1B59A 2PMUA 4CO8A 2LD5A 3HOYJ 4WF2A 3I4NJ 4D9JA 2LY1A 3SFIA 1XMKA 2FBKA 3OYKA 5J47A 2B0LA 2ELJA 2EH3A 2GIZA 2WY8Q 3R6SA 5K5QA 3RZOJ 5EJCA 2EQRA 1A35A 3CC2I 1YX5A 2AO9A 1BIAA 4G6DA 2BW3A 3ECOA 4BS9A 3PO3J 4AWXB 2VBYA 3HRSA 3CCEI 2DO7A 3HSRA 4FETA 2N8GA 1IAWA 1MD0A 2X1CA 3IHUA 2K7LA 3GEZA 3N4MA 3DTEA 3S1RJ 4LJZF 2GWRA 3IP4B 2NVTJ 3CF5F 2DYRH 2GXGA 3FM3A 4CGZA 2L54A 4F7ZA 2JPBA 5L3EA 3A1YA 4CYDA 2EWNA 5EZHA 1T56A 1FOXA 3HOZJ 1J75A 3BJ6A 4X6AJ 4RMNA 1IC8A 2DA5A 3V7RA 4EJTA 5B3SH 3CMEI 1B9NA 3CESA 4JX6A 2MD5A 2OCEA 2EZLA 3R61A 3ZQIA 2DPDA 4RAFA 1W0TA 4E7JA 1JHHA 4FCYA 1TW2A 5FKLA 3K4NA 3I59B 4HSRA 1YFHA 3KP5A 4CUGA 1P4AA 3WGIA 4MHGA 1WVRA 3A0HC 1TQPA 3QQAA 1LPQA 1K78A 3SHFA 3PM1A 1XGNA 2EIKH 4BU2A 2X48A 3LSMA 3ISPA 1U0JA 3BDDA 1GV2A 3LSJA 3V4GA 1TNSA 3IKVA 2VQLA 3LAJA 2W25A 2ME6A 4BHPA 5BPIA 1UHWA 4PSXA 2CQXA 3HZJA 2Y9YA 2B63J 3MZYA 1SC7A 1XMXA 4PK4A 2GBYA 1CF7B 4N4NB 4RM2A 1VQ6I 2LC2A 1I5ZA 2M87A 1D5YA 2WAEA 3K69A 5CVVA 3ZMZA 1SD4A 3C7JA 3QRFF 2XC7A 4BXXJ 2E34A 3SZTA 1JKPC 5EGOA 5CVUA 1X58A 2CQ7A 2DDBA 3B6AA 4FX4A 3K4BA 4KMFA 2E5ZA 5E17F 4JQFA 2F5DA 2IPQX 3QPTA 5TGTA 2DOAA 2WAFA 4NC6A 2KLOA 3FXJA 3I56I 2ZMEC 1KU3A 2VASA 4L5JA 1HW1A 3J7AY 4IRGA 2PI0A 4ENKA 1HCRA 3GUDA 1VQ4I 2HVQA 3BTLA 3GFLA 4A2UA 4HEA2 5GTHC 1MDMB 2F4OB 1ZQ3P 3OY9A 3IH3A 5F6FA 2E19A 3HYIA 1IZ1A 1GVDA 1LFBA 3L2UA 2W82A 2RV8A 3CD6I 4BACA 3DBHB 5GADJ 3GXOA 4ITVA 4ZZDA 2LK2A 2V4JC 2XRNA 1XX5A 3FX3A 2OTLI 3EUHA 3FMRA 4BY1J 4XRSA 1LJ9A 1LVAA 1TTYA 3RPUD 4D5CA 2PBIA 4Y52J 3PIPF 4Y15A 4HF2A 1FBQA 4JK1X 1RZ4A 1BIBA 2CFXA 4QSHA 2H1KA 2F5EA 1BC7C 3I55I 4DZPA 2NS8A 2Y48A 3PNTA 2CGPA 3BTJA 4IOCF 3ZRGA 2DAOA 3FKJA 4IPAA 5BPDA 2CS3A 3IRQA 2JJ7A 4R79A 3I54A 3GTMJ 2JSPA 2QSHX 1J5YA 4GCVA 1B8IA 2VJJA 2CW8A 3FXKA 1X1BA 1OCPA 1P7JA 3U21A 1MMGA 2BV6A 2NYXA 4YELA 3S2HJ 1NHAA 3HRMA 4IHXA 3TEDA 1OJLA 2HYGD 1RKWA 4PGHA 5E8GA 1MSFC 2VKEA 2HI3A 5IYCJ 1EH7A 2XHKA 5KVRA 5GPCA 5KAIC 4WK8F 2K4JA 1OCZH 4KMUX 2ZKZA 4FE7A 1SAXA 3VB2A 3DXJF 2HOSA 1FEXA 2BBYA 4J00A 2Y0SN 5EDNA 1D1CA 4OIQF 3FXOA 4G8XA 5IYDJ 4M3EA 4Y4RA 1L0OC 4YIIA 1JKOC 2BHZA 2G7UA 2PJRB 1G3SA 1LFUP 3QPHA 1K6YA 2CQNA 2ZO4A 3EYIA 3BCBA 3GX4X 1K79A 3KP7A 2AQEA 3K9TA 1NH3A 3JRFA 2MC4A 1U5TA 1ZELA 4LB6B 2BEOA 5J4VA 3ZXSA 2WC2A 4CH7A 1J59A 1R36A 3PQJA 4EMSA 5D4RA 5HODA 1BC8C 4D5FA 5HOOA 2K86A 4RA2A 2VONA 1FNNA 2X9DA 1YI2I 2M5WA 2IGNA 1IN7A 3BOQA 4BAYA 4OOIA 4JX4A 1Z3YA 1BI2A 2RAEA 1VQPI 4NC7A 4B47A 3F9KA 5AIPA 4O5VA 1O7FA 3S16J 1RNLA 4LFUA 5LLQA 2QSGX 1R58A 4MLOA 3GLLA 3L2QA 2LR8A 3JRCA 4M6YA 5FD5A 2MC3A 3U1KA 4LB5A 1KU9A 2ID3A 3IWFA 3NEUA 2PN6A 1MBHA 1B9MA 4F55A 2GXBA 1ON2A 4S04A 3LSTA 2L7FP 2MG4A 2Y0SA 1ETOA 2Z3YA 2GIVA 3LSRA 4MTDA 3CCQI 1AOYA 2M2EA 3CJTB 1F36A 3D5RC 4RLQA 3GYHX 4KFCA 2DFHA 3O2PE 2CWEA 1ZAOA 2CG4A 1RUNA 2HFHA 4QIWN 3GCMA 2HDDA 1OR7A 1YYVA 3HSEA 3LNQA 1ACIA 1ETXA 2A6HF 2L2OA 3OV8A 1XDUA 4IQ4A 3SQNA 3ZCOA 2LOOA 1IF1A 1LB2A 4IX7A 4G6TB 1I27A 1FMVA 2RDPA 4M74A 1T8IA 2ISZA 2IP2A 1QPMA 2LY2A 3F8CA 3AL0C 3BG7A 3O8GA 2ZFWA 4Q5SF 1KQ9A 2OUMA 3OIPA 2OA4A 4QPOA 3M9AA 3FHZA 3ABMH 3LOCA 1H0MA 3BR0A 4KIFA 4BHCA 3BJAA 1X1AA 3H9QA 3VOEA 1MJBA 4XKVA 1SMTA 1DGWY 4A5MA 3E6CC 1MMSA 1XS9A 3KP3A 1YS6A 2CU7A 3CZ6A 3F6OA 3BQYA 4YG2F 1IW7F 1YIJI 4A3GJ 2DA3A 3ZQHA 1ORKA 3MZHA 3BJOA 3MVPA 2NAZA 3PUBA 4ESJA 3C2HA 1I3QJ 1Z91A 2VKDA 3K6GA 3S17J 1R9TJ 4A3CJ 1TWCJ 1JUSA 2OJED 2BHYA 3WG7H 3WU0A 2NVYJ 1EA3A 1YG2A 5F1RA 4FE4A 2JN6A 2LF8A 5HS8A 3ZQFA 1R5ID 5J1RA 1I39A 2Y75A 3CUQB 1Z6TA 1OCCH 3LA7A 5IT9Z 1XDSA 3OYBA 4L9JA 4A3FJ 2R5YB 2DXIA 2Z99A 1WJFA 2IAIA 2R7XA 1OCRH 2QKMB 3LSHA 3JRHA 1I6HJ 1TP4A 2LDUA 1ZRCA 4CXFA 3FHNA 2M7AA 2P81A 4I7HA 3D5LA 3W6JB 1LKXA 4A3EJ 5L3DA 2XAUA 3CQZJ 3OIQA 1HW2A 2KPMA 1MIJA 3C2GA 2EFQA 1GLNA 1RPWA 5C44J 4M3BA 1FMWA 1FT9A 3HGGA 4D7MA 1IJWC 4E70A 5IOYA 5CVIA 4HSTA 2DT5A 1LE8B 2E36A 2MH9A 2NOGA 2V1NA 4ZH4F 1GHCA 2OQGA 2COBA 1WZ2A 3CCVI 3IRRA 5M5YJ 3L2CA 4S0HB 5F0HA 5IY5H 4HLYA 3ONQA 2MFZA 1ZRDA 2DJNA 4XOPA 2GZWA 3D1NI 2LBFA 2M0CA 3VODA 2O8XA 1USTA 4XBFA 3RDIA 3GTQJ 2YR2A 3KETA 2PG4A 2E2IJ 4HZFA 2ZXJA 5A2QZ 3TDZC 1JT0A 3QAHA 4L0ZB 2MBFA 3CDHA 2IA1A 3DU5A 3PL8A 2HNHA 1AU7A 1OPCA 4XORA 4AIJA 1CGPA 3FBIB 1WI9A 3EPZA 1IDZA 3WGGA 2R7VA 4RLFA 3RCOA 5ED4A 1V55H 4I76A 2Z5UA 1KGSA 3IAS2 2IEKA 2TCTA 4M3DA 2KL4A 1PUFB 1HLVA 3KX2A 5CLSA 2HKXA 1LDJA 4U0WA 3BG3A 1G3TA 3JSOA 1QRYA 5IP9J 5DCMB 4AM3A 1X1PA 1GDTA 4FISA 2L7KA 3TOAA 3OOUA 4XLNF 4UNOA 5CQGA 3J80K 2PMHA 2O3FA 3L9FA 3P9CA 1E17A 4F52A 1Y0NA 2ECBA 2RQQA 4CCLA 5DUKA 3OYCA 2DA4A 5DDGA 2LVSA 3BY6A 1MJAA 1WGXA 1REPC 3EUHC 3DEUA 1P9QC 1OCOH 5D8LB 2K9QA 2AS5F 2VJIA 3ZQLA 1XPXA 5CVJA 3CCMI 4L9NA 4B3AA 4E4HA 2DQLA 2RVCA 4HX7A 2BXYA 4XQFA 4ZTJA 4BNCA 3HUGB 4CCKA 1JUMA 5L3BA 4A3JJ 4LLNA 4Y7NJ 5EG0A 3IV5A 2ELKA 3KPHA 3UKGA 1Y39A 2XIGA 3OYHA 4IRIA 3H3UA 4XONA 2L02A 1Y1WJ 2Z2SB 4LOCA 4I0AA 3QOEA 2KDZA 2Y0MA 1QHHD 3GZNB 3CCUI 5D4SA 1T0FA 4RAZA 4K2EA 5J3LA 3ASOH 3WG9A 2O61A 1POGA 4DQ2A 3F22A 1OLTA 2ZB9A 3DCFA 1R00A 4B1RA 4EM1A 3VYUB 1V3FA 3F21A 4A0ZA 2DPUA 5D6EA 4M9SA 3R60A 1WSUA 2MYSA 1B1BA 1JTYA 5B5EC 2F4MB 4U7DA 3RZDJ 3BR1A 3LSPA 3E6DA 5LEJA 3H92A 2D1VA 3U2RA 1FSHA 2BE5F 2CH0A 2KHMA 1W7PA 5E1XA 4XN3A 3ZGKA 1PYVA 2XF5A 3G1LA 2P6TA 4UV9A 1XB4A 2B7EA 2RN7A 1VQLI 5BQTA 1GV5A 4EGZA 3G1OA 2HPIA 3G2BA 4PJNA 3OYEA 4A6EA 2D2WA 1Z3XA 4NHJA 3RYPA 3ZQ7A 2K5CA 2FA5A 2A5WA 2ZJQF 5K7HA 2E1NA 4MQVA 1Z6RA 5DUIA 2LF7A 3CC4I 4PUSA 1U5TC 1LEAA 3M1CA 4Y13A 1DP3A 2K02A 2HYFA 3I4PA 4NQWB 2E2JJ 3KYDB 2L0KA 2OTJI 4IVNA 3WHCA 3ASNH 1WRJA 1W36C 2L4AA 1U8RA 2X4HA 2NS0A 3HC7A 4F93B 4KYWA 2R7FA 4XRSG 2K4BA 4EEFG 1T95A 2V9KA 5DTDA 3TW7A 3EUAA 3BR6A 3KEQA 1K4SA 1F43A 2KRHA 3WGHA 2QENA 2FRHA 2VT2A 3BZ6A 2DQRA 4YFNF 1FZPB 4X0GA 2XKPA 1XD7A 2QBYB 5JLXA 1TC3C 4MFEA 4CCOA 3U9GA 2H8RA 4ASNA 1NTCA 5J1YA 3G73A 2ICWG 4DW6A 1J7KA 2PX9A 2KP6A 3ZMSA 1VQ5I 1BW5A 3LL7A 1BA5A 4OWRB 3FWEA 2OU2A 5FO5A 5K5OA 1FYMA 2JMWA 2EIJH 3GFIA 1FLIA 5JVGF 4XMYA 2OQRA 1R4NB 1WJDA 3CJNA 3MD2A 5DYMA 1MDMA 5KHDA 2FNPA 2WTEA 2UV1A 5E18F 3RJPA 4M6XA 5EEHA 1Z05A 1OFCX 4P1WA 2JPCA 2O7OA 1S29A 4CCJA 3F6VA 3FXUA 1UFMA 5HDNA 4HDVA 3LMMA 3WTUC 2ADUA 3ESWB 3H0GJ 3MEXA 4EJOA 1OR7C 3S93A 2DMTA 3Q0VA 4DZJA 3I0TA 4G7HF 1A5JA 3TW6A 3LQRA 1MMAA 1V5EA 2DJIA 2L01A 1K83J 2P8TA 3ECHA 5IOZA 1B72A 4HNVA 3HTSB 1D0ZA 3BQZA 3BROA 1I6XA 1ETWA 5E79C 1EKEA 2DOFA 1J2XA 4ZTFA 3FIWA 3GTJJ 1SFEA 2DDAA 1FIPA 3DWLE 2R7WA 3MCZA 4U87A 1TT5B 3ERMA 5DD4A 2XASA 1XMAA 3CDLA 5LGNA 3NARA 4WCGA 1ZGWA 2R4GA 4ENJA 2I5UA 4LMYA 2DT7B 3IWZA 4KN7X 2GA1A 5F08A 1Q1VA 2L7MP 4YFKF 2V7FA 5E3OA 5F0CA 3ZPLA 2CJJA 3NRVA 3OSFA 2DK8A 2W85A 3W2AA 2YS9A 4BKXA 4L5IA 2MGQA 1MMDA 1P4WA 2W00A 2XUBA 2K9NA 4GGGA 3JTGA 1JE8A 2RNGA 1NG7A 3I4MJ 3KLNA 2HTJA 5FRNA 5D6FA 5JLWA 2DLLA 3N97A 4HRIA 4I98B 5J40A 1J9IA 3A2KA 5M3MJ 1R1VA 2W48A 1TWHJ 4JBAA 3SJMA 5AIQA 1FOYA 2AHQA 4B4CA 3W6VA 5GAGJ 1MBKA 1IG7A 3DV8A 3N05A 5JHUA 2R5ZA 2M8GX 4BE1A 4G7ZF 4IHTA 3MKLA 4II2A 1DGRM 3RKWA 2FMYA 1IXRC 2KJCA 2F5CA 4A69C 1FIAA 4YIRX 4CA0A 4OMYA 4ZJZA 2JWTA 4KA4A 4KISA 3K4MA 3I53A 4P9FA 4Y17A 4BL0B 3OL3A 2OV7A 4M71A 1ITYA 4A0YA 2X6XA 2F6CA 5F04A 3T0YA 1ZYRF 2PFBA 1HBXG 1AA7A 3TGNA 5BS6A 2DA2A 4I01A 1JTXA 3I71A 2W24A 1NG6A 4HV5A 3REOA 3NQOA 1GUUA 5M5XJ 3V8LA 3F0CA 5D5UB 5GPAA 4HOBA 4ZZLA 4OINF 2QKLB 4BE2A 1DDNA 2R7RA 2OF7A 4KIBA 3IH4A 4F91B 5C4XJ 2HDWA 4HF1A 3DQVC 3OYNA 1WH5A 3E6BA 4IF4A 3OL4A 2E1MC 3CP8A 4BBRJ 4PJLA 2HGCA 1H88C 4NUBA 3TO7A 3F72A 4PZJA 1KU7A 3GFMA 2R3SA 4N9IA 3MKZA 2VL8A 1Y0UA 3H1CA 5FD6A 5LFAA 1LUJB 1JKQC 3KFWX 4LK0F 2HOAA 3T5XA 3ULQB 4BHBA 4L9VA 1XSDA 3FXRA 1Q1HA 5CJ9A 1SEUA 1S7AA 2DFFA 2XROA 3X2QH 3S14J 4HX8A 1BL0A 4RS8A 1JI8A 3S8PA 1AWCA 4RGUA 5HS9A 4LLLA 3SFZA 1IV8A 3MKWB 2R7QA 3TMOA 4BDZA 4BEHB 2XAJA 5FFXA 3AL0B 1BI3A 2DMNA 2WY7Q 4NC8A 4L18B 4HLXA 1IUYA 2EBIA 2OZ6A 2CFOA 1XGMA 1W4MA 1ZGAA 1EJ9A 3Q0UA 1HA8A 4BUPA 2V9VA 4Q48A 2VBWA 4ZC3A 1FTTA 1X3ZB 2HU9A 1RIOH 4HDUA 3VFZA 3PO2J 2HEOA 2WAQN 2QCOA 3LSIA 1HDDC 4H0EA 2JVHA 4KJZA 2KRCA 3ABTA 1T98A 2BW3B 4WX9A 2TRTA 3MKYB 1VQOI 3V7CA 2EB7A 3P9IA 2Z9OA 1LFPA 1HKTA 4BXFA 5D5XB 2MLKA 4C2UA 4QTRA 1TWGJ 2J5OA 2W7NA 1S72I 3ABLH 1UHSA 2YX7A 4V2GA 3F8FA 3CCYA 1D3YA 2DMQA 2LMDA 3RYRA 3HIFA 4FASD 3Q3SA 5GAHJ 3WTWC 3E1SA 2XF7A 2XPUA 2BY2A 3SDBA 1QZEA 2QQAA 2RQPA 2LYCA 3K70D 2NS7A 3OWTA
chains in the Genus database with same CATH topology
2EK5A 3ZMUA 1YIOA 3ZMTA 1OYIA 2PEXA 3ABUA 1S3JA 1ON1A 1WKMA 3ELKA 5LBQA 1BBYA 1MKMA 1HW5A 4RAYA 3E5QA 3IL2A 2FSWA 4BH9A 1FX7A 4RGRA 4U0VA 4A5NA 2NNNA 1R7JA 2P7CB 1LEBA 3CUQA 3O3KA 3WTXC 1G3WA 4U7BA 2V1UA 4EM2A 4KIGA 5L3FA 1W5SA 2XAFA 1K7AA 3C3WA 4U0YA 5F64A 4WWCA 2QM3A 3GW2A 2NRAC 4LK1F 2WV0A 5HLGA 2A3SA 1TQIA 3LAPA 2PLYA 4ON0A 1IRFA 3OOPA 3VEPA 2A61A 5E1WA 3WE3A 5D5VB 4KN4X 1IN6A 1MJ9A 2IRFG 2GQQA 4OU0A 1W7PD 5HDGA 1FPQA 3F23A 4UVBA 2ISYA 5FLXK 4WXCA 2M8EA 2ZJ2A 2FBIA 1OYWA 4CICA 3JAMK 2RGVA 3CLOA 1JHFA 1U3EM 4RGXA 2FBHA 3EYYA 5J8FA 1OYYA 4RB0A 1E2XA 3J80Z 2EV0A 4M73A 3HRUA 1XGSA 3GLXA 5DCMA 3EETA 5CVRA 4Z2YA 2QQBA 2G7HA 3EQLF 3HOTA 3WTTC 2HQRA 3TKYA 1FWZA 2XGXA 2V79A 3DKWA 1YW8A 4LG0A 1ZARA 4ESBA 2R7DA 2F5FA 4MEXF 1BM9A 1ZRFA 3R4KA 3HUGA 2UXXA 3LQQA 4AIKA 3R0AA 2W57A 1K6OA 1ZHFA 3WTZA 2IA2A 3Q9VA 3Q9SA 2FXAA 1D8KA 2FOKA 1U5TB 4HQMA 2HKOA 2ESHA 1IN8A 1JXSA 1ZG1A 2L3DA 2IT0A 3FMSA 2DTRA 2CQKA 1UCRA 4O3MA 3FZVA 2LNBA 1L3LA 4FX0A 3F3XA 4EJVA 4ZYHA 3E5XA 2Q2EA 5TJJA 5TRDA 2L4MA 3D0SA 1J0RA 1QGPA 3P9KA 3ZP5A 4BQAA 3RPUA 2EFNA 4FHTA 1P92A 3K0LA 3L7WA 3RTRA 4AD9A 4G6QA 1B4AA 2QQ9A 4HA8A 1UB9A 5ICEA 3I58A 3MFKA 1USSA 1XCBA 3ZMVA 2QBYA 3I64A 2KKOA 3TO6A 6PAXA 1FYLA 4YIFA 2FU4A 3P7NA 1T2KA 1GVJA 4EJUA 1I1SA 2YPRA 3GZ6A 2XV4S 2E1CA 1IRGA 2DW4A 1TW3A 1BI0A 2H6BA 2IJLA 3H3ZA 4U88A 2EJRA 3BP8A 3HSFA 4BXUA 3KZZA 3HHHA 3RPQA 5E20A 4B8XA 1QQIA 4PDKA 1LDKB 1SD7A 5ICCA 1YW7A 2EFOA 2VE9A 4MNUA 1YO5C 4RB2C 3EDPA 1PUEE 3C1DA 5L3GA 4I0BA 5HLIA 2UZKA 3KZYA 2PQ8A 4HV6A 4S05A 3F8BA 4OMZA 1ONVA 4UVAA 3TDUC 2W84A 2LSOA 4P9UA 2O0YA 5ILVA 2VODA 1S6LA 1P4XA 4HBLA 5LGUA 3RKXA 1QZYA 4IXAA 3I59A 2XAQA 2PJPA 2KIFA 1RUOA 3WODF 1C0WA 1SD5A 3ZN1A 4GXOA 1TNTA 3KP6A 1F5TA 2CYYA 2MLGA 3HTUA 2KJBA 3CUQC 3CUOA 4QWQA 2E7XA 2ZMEB 4FT8A 5LHGA 2HWVA 2GAUA 5JVTA 2A5YB 1CF7A 1G3YA 2KRFA 3PQKA 5CYVA 1R23A 2DFIA 1ZN2A 3IKTA 1HKQA 1HQCA 4KICA 1W5TA 3J81K 5ILUA 1F4KA 1PP8F 1Z1DA 1YS7A 2G9WA 5D8KB 5FFZA 3KEOA 5HLHA 2ZNZA 4HQEA 3IC7A 3CO7C 2EA4A 2ZCWA 1RI7A 2P7VB 3QP5A 5BOXA 2M45A 3GO5A 2JTVA 3T8TA 4NB5A 4CHUA 3T8RA 1XGOA 2EFPA 3E5UA 4N9HA 4Q4ZF 4GYIA 5D5WB 4R1HA 1LNWA 4UHTA 1ZG5A 1EH6A 1KYWA 3SXYA 3MQ0A 2STTA 2A6EF 2HQNA 2V1DA 2JT1A 1T39A 1FC3A 3FM5A 1R22A 2HZTA 2FMLA 4BYYA 1ODDA 2HS5A 3RKYA 4EQQA 3HHGA 1ZGJA 1BOAA 3LFKA 2A69F 5H6QA 2P6SA 4KNYA 1U78A 3KLOA 1EH8A 1DPUA 2MH2A 4UXNA 3ML6A 4N0BA 3DF8A 3LA3A 1LQ1A 3QP6A 1W7PB 4R8HA 1O7LA 2YSRA 4MEYF 2A68F 3F8NA 2JRTA 1DUXC 1STZA 3O6BB 3R0JA 3C18A 1SMYF 1XSXA 2JSCA 3TO9A 2FEZA 3QOPA 4CDGA 1O57A 4XRFA 2FE3A 3T1BA 2ELHA 1ZLJA 2OBPA 1H9GA 4MTEA 2JZYA 3JW4A 1O3RA 1MZBA 4P5OA 2IW5A 1IN5A 3ERED 2DU9A 2M30A 3U1DA 3DP7A 4ETSA 1MGTA 5ICGA 4QLCU 5FLXZ 4LGWA 5HVQC 2WWYA 4ZYDA 2ZBKA 2ETHA 3FF5A 2M1BA 2QUFA 3L00A 1KQ0A 2Z33A 1D8JA 4GYGA 3JAMZ 1HSJA 2FNAA 4OIRF 1SFXA 4UVCA 3CO6C 4GO1A 3AAFA 3BPVA 3KP2A 3MWMA 3S2WA 1OMIA 3M8FA 3JSPA 4A6DA 1TBXA 4ESFA 5DCFA 2H27A 3E6MA 3BWGA 3B02A 1WQ2A 2AXLA 1GXQA 3QU3A 2V1XA 1IXCA 2F2EA 1HXDA 3DPTA 4L0YB 1U6GA 1K78B 4XSZF 4IJAA 1P6RA 1ZLKA 1UHMA 3K1MA 3WTYC 2V6CA 5ERIA 1FSEA 4G94A 3TOBA 2BGCA 2D1HA 1BN5A 3I5UA 1R5GA 5ILSA 4KT5C 5J6XA 2CSOA 1KU2A 1V4RA 2QWWA 2H09A 3ZN0A 1GXPA 2VOPA 4XSXF 3K1PA 3J7AO 2FF4A 4XLPF 3KE2A 2YU3A 2P5KA 4OIPF 1YTYA 2VC1A 2BYVE 1FBUA 2EV5A 1P2FA 1R5HA 5KK1A 1U2WA 5HS7A 4D0PA 2UWMA 4HAMA 1HSTA 4PCQA 4MQ9F 4HYEA 1X3UA 1B6AA 4G9YA 3B73A 2P5LC 1KA8A 5L3CA 1KYZA 2QYOA 1IN4A 4HX4A 1G6NA 4P96A 5JFRA 2VOOA 3LWFA 1YLFA 2GA2A 2Q8KA 4MGRA 1BJAA 2A07F 1FOKA 5FGMA 5DD8A 1T38A 5E1ZB 3GWZA 5K1YA 4EV0A 2VE8A 1ZG3A 4KUMA 1JGSA 2OD5A 1VTNC 2LKPA 3G3ZA 3WU1B 3V7SA 4ENNA 3JTHA 3RIRA 3K1NA 1ZH5A 2QVOA 1OKRA 1DP7P 1YQAA 2EA2A 1FY7A 4IHSA 5AONA 3GFJA 3WTVC 5K5RA 2COMA 1TQMA 3HRTA 4OIOF 1ZREA 2K27A 1FP2A 4B09A 1O3TA 2HR3A 4KDPA 1FBSA 5H20A 1QBJA 1DPRA 2YX4A 1R1UA 2TDXA 5JI6A 1A04A 1QO0D 2UXNA 4O6JA 2OAZA 4HF0A 1EV7A 3DPLC 1PDNC 1TLHB 5FB2A 1T6SA 1XN7A 2DI3A 1O3SA 4WXDA 2XAGA 5DEQA 4M72A 3DFGA 1YW9A 4I02A 5LRRA 2FQ3A 2J5PA 2VBXA 3L09A 4I2OA 1QNTA 1FP1D 4NQWA 2ZMEA 4AVPA 4Q47A 4G7OF 2VXZA 3WE2A 1LDDA 2ACJA 3M8EA 2D45A 5LRSA 2IVMA 2HOEA 3J81Z 3WTSC 2QZ8A 5IT3A 1S7OA 3HOSA 1D5VA 1QZZA 1Z9CA 3K2ZA 2RC4A 1F9NA 4RB1A 2C6YA 4YFXF 2ESNA 4AIHA 2XKOA 1ULYA 2VT3A 2RNJA 1WWXA 1SD6A 2RKHA 4UUVA 3GVAA 2XVCA 5JR3A 3PFIA 3F8MA 2HDCA 4EGYA 4RGSA 5LEKA 2VBZA 5LHIA 1KQ8A 4PGGA 3QU6A 3KCCA 4I09A 4LG0B 2XAHA 3E97A 2O03A 4UV8A 1G4DA 5HDKA 1BI1A 3W6KB 1IXSB 2EV6A 4M9XA 3ZMDA 1H9TA 4M9ZA 2NNYA 4HW0A 3V8KA 3M1EA 3M7GA 2VN2A 1XCVA 2STWA 4LLGF 2P4WA 3FMQA 3SZPA 2KIUA 1R1TA 5LHHA 3MAJA 1Z7UA 5IT9K 5J8CA 1I1GA 3FXQA 3COAC 5EEGA 2O6GE 2P5VA 4CZZA 2OZUA 2ZNYA 4EVIA 3KP4A 1XSVA 4EJWA 5BMZA 2EFWA 2VC0A 2HTSA 5H6RA 4P55A 2Q0OA 2CO5A 1S8NA 5ICFA 4ENMA 2QLZA 1SFUA 4A0XA 1O3QA 1PP7U 3GZ5A 1F1ZA 5LGTA 3V8JA 4L9TA 1FYKA 2KIMA 4A12A 5A2QK 1HKSA 3CTAA 2E7WA 4RB3C 4EM0B 3Q5FA 4WXHA 4ZYGA 3E3VA 4IRHA 4DNCA 3GF2A 2X0LA 2DBBA 5DV5A 2DK5A 3LA2A 2H6CA 4ZYEA 2CW0F 3RI4A 4LD5A 3ROUA 3BPXA 4TV7A 2MA3A 3TQNA 2H94A 2IA0A 1B59A 2PMUA 4CO8A 4WF2A 1XMKA 2FBKA 2B0LA 3R6SA 5K5QA 1BIAA 4G6DA 3ECOA 4AWXB 2VBYA 3HRSA 2DO7A 3HSRA 1IAWA 1MD0A 3IHUA 3N4MA 2K7LA 3GEZA 4LJZF 2GWRA 3FM3A 2GXGA 4CGZA 2L54A 4F7ZA 2JPBA 5L3EA 4CYDA 2EWNA 1J75A 3BJ6A 3V7RA 4EJTA 1B9NA 2MD5A 3R61A 2DPDA 1JHHA 1TW2A 3I59B 1YFHA 3KP5A 1P4AA 3WGIA 4MHGA 1TQPA 1K78A 3SHFA 1XGNA 3ISPA 3BDDA 3V4GA 1TNSA 3IKVA 3LAJA 2W25A 4BHPA 5BPIA 1UHWA 3MZYA 1CF7B 1I5ZA 2M87A 3K69A 5CVVA 3ZMZA 1SD4A 3C7JA 3QRFF 3SZTA 5CVUA 4FX4A 4KMFA 5E17F 4JQFA 2F5DA 2IPQX 3QPTA 1KU3A 4L5JA 1HW1A 4IRGA 2PI0A 4ENKA 3GUDA 3GFLA 4A2UA 1MDMB 5F6FA 3HYIA 1IZ1A 2RV8A 3GXOA 4ZZDA 2XRNA 3FX3A 3EUHA 3FMRA 1LJ9A 1LVAA 1TTYA 2PBIA 4Y15A 4HF2A 1FBQA 4JK1X 1RZ4A 1BIBA 2CFXA 2F5EA 1BC7C 2Y48A 2CGPA 2DAOA 4IPAA 5BPDA 3IRQA 4R79A 3I54A 1J5YA 4GCVA 2BV6A 2NYXA 1NHAA 3HRMA 2HYGD 5E8GA 4PGHA 1EH7A 2XHKA 5KVRA 4WK8F 2K4JA 4KMUX 2ZKZA 1SAXA 3VB2A 3DXJF 2BBYA 4OIQF 4G8XA 1L0OC 4YIIA 2G7UA 1G3SA 3QPHA 2ZO4A 3EYIA 3GX4X 1K79A 3KP7A 3K9TA 1U5TA 4LB6B 2BEOA 2WC2A 1J59A 1R36A 3PQJA 4EMSA 5D4RA 1BC8C 5HOOA 2K86A 2VONA 1FNNA 2M5WA 1IN7A 3BOQA 4BAYA 4OOIA 1BI2A 5AIPA 4O5VA 1O7FA 1RNLA 4LFUA 5LLQA 1R58A 4M6YA 5FD5A 2MC3A 4LB5A 1KU9A 3IWFA 3NEUA 2PN6A 1B9MA 2GXBA 1ON2A 4S04A 3LSTA 2Z3YA 2GIVA 4MTDA 1AOYA 3GYHX 4KFCA 3O2PE 2CWEA 1ZAOA 2CG4A 1RUNA 2HFHA 1OR7A 1YYVA 3HSEA 2A6HF 3OV8A 1XDUA 3SQNA 1IF1A 1LB2A 1I27A 2RDPA 2ISZA 4M74A 2IP2A 1QPMA 3F8CA 2ZFWA 4Q5SF 1KQ9A 2OA4A 3M9AA 3FHZA 1H0MA 4KIFA 4BHCA 3BJAA 3VOEA 1MJBA 4A5MA 1SMTA 3E6CC 3KP3A 1YS6A 3F6OA 4YG2F 1IW7F 3MZHA 3BJOA 2NAZA 4ESJA 1Z91A 3WU0A 5F1RA 1YG2A 2LF8A 5HS8A 2Y75A 3CUQB 1Z6TA 3LA7A 5IT9Z 1XDSA 4L9JA 2Z99A 2LDUA 1ZRCA 4CXFA 3W6JB 4I7HA 3D5LA 5L3DA 1HW2A 2EFQA 1FT9A 4E70A 5CVIA 2DT5A 2MH9A 4ZH4F 1GHCA 2OQGA 3IRRA 3L2CA 4HLYA 1ZRDA 2GZWA 3VODA 2O8XA 1USTA 4XBFA 3RDIA 2YR2A 3KETA 2PG4A 4HZFA 2ZXJA 5A2QZ 3TDZC 3QAHA 4L0ZB 2MBFA 3CDHA 2IA1A 1OPCA 4AIJA 1CGPA 1WI9A 3WGGA 5ED4A 2Z5UA 1KGSA 5CLSA 2HKXA 1LDJA 4U0WA 1G3TA 3JSOA 5DCMB 3TOAA 4XLNF 4UNOA 3J80K 2PMHA 2O3FA 3L9FA 3P9CA 1E17A 5DUKA 5DDGA 3BY6A 1MJAA 1REPC 3DEUA 5D8LB 2AS5F 5CVJA 4L9NA 2DQLA 2RVCA 4HX7A 4BNCA 5L3BA 4LLNA 2XIGA 4IRIA 3H3UA 2L02A 4I0AA 2Y0MA 5D4SA 1T0FA 4RAZA 4K2EA 3WG9A 2O61A 4DQ2A 3F22A 4EM1A 1R00A 1V3FA 3F21A 4A0ZA 2DPUA 5D6EA 4M9SA 3R60A 1WSUA 1B1BA 4U7DA 3E6DA 5LEJA 3H92A 2D1VA 3U2RA 1FSHA 2BE5F 1W7PA 5E1XA 2P6TA 4UV9A 1XB4A 2RN7A 5BQTA 4EGZA 4A6EA 2D2WA 4NHJA 3RYPA 3ZQ7A 2FA5A 2E1NA 4MQVA 1Z6RA 5DUIA 2LF7A 1U5TC 1LEAA 4Y13A 2K02A 2HYFA 3I4PA 4IVNA 1WRJA 2L4AA 1U8RA 2X4HA 2NS0A 4KYWA 2R7FA 2K4BA 3KEQA 3WGHA 2QENA 2FRHA 2VT2A 3BZ6A 2DQRA 4YFNF 1FZPB 2XKPA 1XD7A 2QBYB 3U9GA 4ASNA 3G73A 1J7KA 3ZMSA 3FWEA 2OU2A 5FO5A 5K5OA 1FYMA 3GFIA 1FLIA 2OQRA 3CJNA 5DYMA 1MDMA 2FNPA 2WTEA 5E18F 3RJPA 4M6XA 5EEHA 1Z05A 2JPCA 1S29A 3F6VA 3FXUA 1UFMA 5HDNA 4HDVA 3WTUC 2ADUA 3MEXA 4EJOA 4G7HF 3I0TA 3LQRA 2P8TA 3HTSB 3ECHA 2L01A 3BROA 1I6XA 1J2XA 1SFEA 3MCZA 5DD4A 2XASA 1XMAA 5LGNA 4WCGA 4ENJA 4LMYA 3IWZA 4KN7X 2GA1A 4YFKF 3ZPLA 3NRVA 2DK8A 2W85A 4L5IA 1P4WA 2XUBA 3JTGA 4GGGA 1JE8A 3KLNA 2HTJA 5D6FA 2DLLA 3N97A 4I98B 1J9IA 1R1VA 4JBAA 5AIQA 3DV8A 5JHUA 4G7ZF 4IHTA 3RKWA 2FMYA 1IXRC 2KJCA 2F5CA 4OMYA 4KA4A 3I53A 4P9FA 4Y17A 4M71A 4A0YA 3T0YA 1ZYRF 2PFBA 1HBXG 3TGNA 5BS6A 4I01A 3I71A 2W24A 4HV5A 3REOA 3NQOA 3V8LA 5D5UB 4HOBA 4ZZLA 4OINF 1DDNA 4KIBA 4HF1A 3DQVC 3E6BA 4IF4A 2HGCA 3TO7A 3F72A 4PZJA 1KU7A 3GFMA 2R3SA 4N9IA 1Y0UA 5FD6A 3KFWX 4LK0F 3T5XA 3ULQB 4BHBA 4L9VA 1XSDA 3FXRA 1Q1HA 5CJ9A 1S7AA 2XROA 4HX8A 4RS8A 1AWCA 4RGUA 5HS9A 4LLLA 3SFZA 2XAJA 5FFXA 1BI3A 4L18B 4HLXA 1IUYA 2OZ6A 1XGMA 1W4MA 1ZGAA 2V9VA 4Q48A 2VBWA 1RIOH 4HDUA 3VFZA 2HEOA 4H0EA 3ABTA 1T98A 4WX9A 3V7CA 2EB7A 3P9IA 2Z9OA 1HKTA 5D5XB 2MLKA 2J5OA 2YX7A 3F8FA 1D3YA 3RYRA 3HIFA 3WTWC 2QQAA 2RQPA 5E8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK5 A;  3ZMU A;  1YIO A;  3ZMT A;  1OYI A;  2PEX A;  3ABU A;  1S3J A;  1ON1 A;  1WKM A;  3ELK A;  5LBQ A;  1BBY A;  1MKM A;  1HW5 A;  4RAY A;  3E5Q A;  3IL2 A;  2FSW A;  4BH9 A;  1FX7 A;  4RGR A;  4U0V A;  4A5N A;  2NNN A;  1R7J A;  2P7C B;  1LEB A;  3CUQ A;  3O3K A;  3WTX C;  1G3W A;  4U7B A;  2V1U A;  4EM2 A;  4KIG A;  5L3F A;  1W5S A;  2XAF A;  1K7A A;  3C3W A;  4U0Y A;  5F64 A;  4WWC A;  2QM3 A;  3GW2 A;  2NRA C;  4LK1 F;  2WV0 A;  5HLG A;  2A3S A;  1TQI A;  3LAP A;  2PLY A;  4ON0 A;  1IRF A;  3OOP A;  3VEP A;  2A61 A;  5E1W A;  3WE3 A;  5D5V B;  4KN4 X;  1IN6 A;  1MJ9 A;  2IRF G;  2GQQ A;  4OU0 A;  1W7P D;  5HDG A;  1FPQ A;  3F23 A;  4UVB A;  2ISY A;  5FLX K;  4WXC A;  2M8E A;  2ZJ2 A;  2FBI A;  1OYW A;  4CIC A;  3JAM K;  2RGV A;  3CLO A;  1JHF A;  1U3E M;  4RGX A;  2FBH A;  3EYY A;  5J8F A;  1OYY A;  4RB0 A;  1E2X A;  3J80 Z;  2EV0 A;  4M73 A;  3HRU A;  1XGS A;  3GLX A;  5DCM A;  3EET A;  5CVR A;  4Z2Y A;  2QQB A;  2G7H A;  3EQL F;  3HOT A;  3WTT C;  2HQR A;  3TKY A;  1FWZ A;  2XGX A;  2V79 A;  3DKW A;  1YW8 A;  4LG0 A;  1ZAR A;  4ESB A;  2R7D A;  2F5F A;  4MEX F;  1BM9 A;  1ZRF A;  3R4K A;  3HUG A;  2UXX A;  3LQQ A;  4AIK A;  3R0A A;  2W57 A;  1K6O A;  1ZHF A;  3WTZ A;  2IA2 A;  3Q9V A;  3Q9S A;  2FXA A;  1D8K A;  2FOK A;  1U5T B;  4HQM A;  2HKO A;  2ESH A;  1IN8 A;  1JXS A;  1ZG1 A;  2L3D A;  2IT0 A;  3FMS A;  2DTR A;  2CQK A;  1UCR A;  4O3M A;  3FZV A;  2LNB A;  1L3L A;  4FX0 A;  3F3X A;  4EJV A;  4ZYH A;  3E5X A;  2Q2E A;  5TJJ A;  5TRD A;  2L4M A;  3D0S A;  1J0R A;  1QGP A;  3P9K A;  3ZP5 A;  4BQA A;  3RPU A;  2EFN A;  4FHT A;  1P92 A;  3K0L A;  3L7W A;  3RTR A;  4AD9 A;  4G6Q A;  1B4A A;  2QQ9 A;  4HA8 A;  1UB9 A;  5ICE A;  3I58 A;  3MFK A;  1USS A;  1XCB A;  3ZMV A;  2QBY A;  3I64 A;  2KKO A;  3TO6 A;  6PAX A;  1FYL A;  4YIF A;  2FU4 A;  3P7N A;  1T2K A;  1GVJ A;  4EJU A;  1I1S A;  2YPR A;  3GZ6 A;  2XV4 S;  2E1C A;  1IRG A;  2DW4 A;  1TW3 A;  1BI0 A;  2H6B A;  2IJL A;  3H3Z A;  4U88 A;  2EJR A;  3BP8 A;  3HSF A;  4BXU A;  3KZZ A;  3HHH A;  3RPQ A;  5E20 A;  4B8X A;  1QQI A;  4PDK A;  1LDK B;  1SD7 A;  5ICC A;  1YW7 A;  2EFO A;  2VE9 A;  4MNU A;  1YO5 C;  4RB2 C;  3EDP A;  1PUE E;  3C1D A;  5L3G A;  4I0B A;  5HLI A;  2UZK A;  3KZY A;  2PQ8 A;  4HV6 A;  4S05 A;  3F8B A;  4OMZ A;  1ONV A;  4UVA A;  3TDU C;  2W84 A;  2LSO A;  4P9U A;  2O0Y A;  5ILV A;  2VOD A;  1S6L A;  1P4X A;  4HBL A;  5LGU A;  3RKX A;  1QZY A;  4IXA A;  3I59 A;  2XAQ A;  2PJP A;  2KIF A;  1RUO A;  3WOD F;  1C0W A;  1SD5 A;  3ZN1 A;  4GXO A;  1TNT A;  3KP6 A;  1F5T A;  2CYY A;  2MLG A;  3HTU A;  2KJB A;  3CUQ C;  3CUO A;  4QWQ A;  2E7X A;  2ZME B;  4FT8 A;  5LHG A;  2HWV A;  2GAU A;  5JVT A;  2A5Y B;  1CF7 A;  1G3Y A;  2KRF A;  3PQK A;  5CYV A;  1R23 A;  2DFI A;  1ZN2 A;  3IKT A;  1HKQ A;  1HQC A;  4KIC A;  1W5T A;  3J81 K;  5ILU A;  1F4K A;  1PP8 F;  1Z1D A;  1YS7 A;  2G9W A;  5D8K B;  5FFZ A;  3KEO A;  5HLH A;  2ZNZ A;  4HQE A;  3IC7 A;  3CO7 C;  2EA4 A;  2ZCW A;  1RI7 A;  2P7V B;  3QP5 A;  5BOX A;  2M45 A;  3GO5 A;  2JTV A;  3T8T A;  4NB5 A;  4CHU A;  3T8R A;  1XGO A;  2EFP A;  3E5U A;  4N9H A;  4Q4Z F;  4GYI A;  5D5W B;  4R1H A;  1LNW A;  4UHT A;  1ZG5 A;  1EH6 A;  1KYW A;  3SXY A;  3MQ0 A;  2STT A;  2A6E F;  2HQN A;  2V1D A;  2JT1 A;  1T39 A;  1FC3 A;  3FM5 A;  1R22 A;  2HZT A;  2FML A;  4BYY A;  1ODD A;  2HS5 A;  3RKY A;  4EQQ A;  3HHG A;  1ZGJ A;  1BOA A;  3LFK A;  2A69 F;  5H6Q A;  2P6S A;  4KNY A;  1U78 A;  3KLO A;  1EH8 A;  1DPU A;  2MH2 A;  4UXN A;  3ML6 A;  4N0B A;  3DF8 A;  3LA3 A;  1LQ1 A;  3QP6 A;  1W7P B;  4R8H A;  1O7L A;  2YSR A;  4MEY F;  2A68 F;  3F8N A;  2JRT A;  1DUX C;  1STZ A;  3O6B B;  3R0J A;  3C18 A;  1SMY F;  1XSX A;  2JSC A;  3TO9 A;  2FEZ A;  3QOP A;  4CDG A;  1O57 A;  4XRF A;  2FE3 A;  3T1B A;  2ELH A;  1ZLJ A;  2OBP A;  1H9G A;  4MTE A;  2JZY A;  3JW4 A;  1O3R A;  1MZB A;  4P5O A;  2IW5 A;  1IN5 A;  3ERE D;  2DU9 A;  2M30 A;  3U1D A;  3DP7 A;  4ETS A;  1MGT A;  5ICG A;  4QLC U;  5FLX Z;  4LGW A;  5HVQ C;  2WWY A;  4ZYD A;  2ZBK A;  2ETH A;  3FF5 A;  2M1B A;  2QUF A;  3L00 A;  1KQ0 A;  2Z33 A;  1D8J A;  4GYG A;  3JAM Z;  1HSJ A;  2FNA A;  4OIR F;  1SFX A;  4UVC A;  3CO6 C;  4GO1 A;  3AAF A;  3BPV A;  3KP2 A;  3MWM A;  3S2W A;  1OMI A;  3M8F A;  3JSP A;  4A6D A;  1TBX A;  4ESF A;  5DCF A;  2H27 A;  3E6M A;  3BWG A;  3B02 A;  1WQ2 A;  2AXL A;  1GXQ A;  3QU3 A;  2V1X A;  1IXC A;  2F2E A;  1HXD A;  3DPT A;  4L0Y B;  1U6G A;  1K78 B;  4XSZ F;  4IJA A;  1P6R A;  1ZLK A;  1UHM A;  3K1M A;  3WTY C;  2V6C A;  5ERI A;  1FSE A;  4G94 A;  3TOB A;  2BGC A;  2D1H A;  1BN5 A;  3I5U A;  1R5G A;  5ILS A;  4KT5 C;  5J6X A;  2CSO A;  1KU2 A;  1V4R A;  2QWW A;  2H09 A;  3ZN0 A;  1GXP A;  2VOP A;  4XSX F;  3K1P A;  3J7A O;  2FF4 A;  4XLP F;  3KE2 A;  2YU3 A;  2P5K A;  4OIP F;  1YTY A;  2VC1 A;  2BYV E;  1FBU A;  2EV5 A;  1P2F A;  1R5H A;  5KK1 A;  1U2W A;  5HS7 A;  4D0P A;  2UWM A;  4HAM A;  1HST A;  4PCQ A;  4MQ9 F;  4HYE A;  1X3U A;  1B6A A;  4G9Y A;  3B73 A;  2P5L C;  1KA8 A;  5L3C A;  1KYZ A;  2QYO A;  1IN4 A;  4HX4 A;  1G6N A;  4P96 A;  5JFR A;  2VOO A;  3LWF A;  1YLF A;  2GA2 A;  2Q8K A;  4MGR A;  1BJA A;  2A07 F;  1FOK A;  5FGM A;  5DD8 A;  1T38 A;  5E1Z B;  3GWZ A;  5K1Y A;  4EV0 A;  2VE8 A;  1ZG3 A;  4KUM A;  1JGS A;  2OD5 A;  1VTN C;  2LKP A;  3G3Z A;  3WU1 B;  3V7S A;  4ENN A;  3JTH A;  3RIR A;  3K1N A;  1ZH5 A;  2QVO A;  1OKR A;  1DP7 P;  1YQA A;  2EA2 A;  1FY7 A;  4IHS A;  5AON A;  3GFJ A;  3WTV C;  5K5R A;  2COM A;  1TQM A;  3HRT A;  4OIO F;  1ZRE A;  2K27 A;  1FP2 A;  4B09 A;  1O3T A;  2HR3 A;  4KDP A;  1FBS A;  5H20 A;  1QBJ A;  1DPR A;  2YX4 A;  1R1U A;  2TDX A;  5JI6 A;  1A04 A;  1QO0 D;  2UXN A;  4O6J A;  2OAZ A;  4HF0 A;  1EV7 A;  3DPL C;  1PDN C;  1TLH B;  5FB2 A;  1T6S A;  1XN7 A;  2DI3 A;  1O3S A;  4WXD A;  2XAG A;  5DEQ A;  4M72 A;  3DFG A;  1YW9 A;  4I02 A;  5LRR A;  2FQ3 A;  2J5P A;  2VBX A;  3L09 A;  4I2O A;  1QNT A;  1FP1 D;  4NQW A;  2ZME A;  4AVP A;  4Q47 A;  4G7O F;  2VXZ A;  3WE2 A;  1LDD A;  2ACJ A;  3M8E A;  2D45 A;  5LRS A;  2IVM A;  2HOE A;  3J81 Z;  3WTS C;  2QZ8 A;  5IT3 A;  1S7O A;  3HOS A;  1D5V A;  1QZZ A;  1Z9C A;  3K2Z A;  2RC4 A;  1F9N A;  4RB1 A;  2C6Y A;  4YFX F;  2ESN A;  4AIH A;  2XKO A;  1ULY A;  2VT3 A;  2RNJ A;  1WWX A;  1SD6 A;  2RKH A;  4UUV A;  3GVA A;  2XVC A;  5JR3 A;  3PFI A;  3F8M A;  2HDC A;  4EGY A;  4RGS A;  5LEK A;  2VBZ A;  5LHI A;  1KQ8 A;  4PGG A;  3QU6 A;  3KCC A;  4I09 A;  4LG0 B;  2XAH A;  3E97 A;  2O03 A;  4UV8 A;  1G4D A;  5HDK A;  1BI1 A;  3W6K B;  1IXS B;  2EV6 A;  4M9X A;  3ZMD A;  1H9T A;  4M9Z A;  2NNY A;  4HW0 A;  3V8K A;  3M1E A;  3M7G A;  2VN2 A;  1XCV A;  2STW A;  4LLG F;  2P4W A;  3FMQ A;  3SZP A;  2KIU A;  1R1T A;  5LHH A;  3MAJ A;  1Z7U A;  5IT9 K;  5J8C A;  1I1G A;  3FXQ A;  3COA C;  5EEG A;  2O6G E;  2P5V A;  4CZZ A;  2OZU A;  2ZNY A;  4EVI A;  3KP4 A;  1XSV A;  4EJW A;  5BMZ A;  2EFW A;  2VC0 A;  2HTS A;  5H6R A;  4P55 A;  2Q0O A;  2CO5 A;  1S8N A;  5ICF A;  4ENM A;  2QLZ A;  1SFU A;  4A0X A;  1O3Q A;  1PP7 U;  3GZ5 A;  1F1Z A;  5LGT A;  3V8J A;  4L9T A;  1FYK A;  2KIM A;  4A12 A;  5A2Q K;  1HKS A;  3CTA A;  2E7W A;  4RB3 C;  4EM0 B;  3Q5F A;  4WXH A;  4ZYG A;  3E3V A;  4IRH A;  4DNC A;  3GF2 A;  2X0L A;  2DBB A;  5DV5 A;  2DK5 A;  3LA2 A;  2H6C A;  4ZYE A;  2CW0 F;  3RI4 A;  4LD5 A;  3ROU A;  3BPX A;  4TV7 A;  2MA3 A;  3TQN A;  2H94 A;  2IA0 A;  1B59 A;  2PMU A;  4CO8 A;  4WF2 A;  1XMK A;  2FBK A;  2B0L A;  3R6S A;  5K5Q A;  1BIA A;  4G6D A;  3ECO A;  4AWX B;  2VBY A;  3HRS A;  2DO7 A;  3HSR A;  1IAW A;  1MD0 A;  3IHU A;  3N4M A;  2K7L A;  3GEZ A;  4LJZ F;  2GWR A;  3FM3 A;  2GXG A;  4CGZ A;  2L54 A;  4F7Z A;  2JPB A;  5L3E A;  4CYD A;  2EWN A;  1J75 A;  3BJ6 A;  3V7R A;  4EJT A;  1B9N A;  2MD5 A;  3R61 A;  2DPD A;  1JHH A;  1TW2 A;  3I59 B;  1YFH A;  3KP5 A;  1P4A A;  3WGI A;  4MHG A;  1TQP A;  1K78 A;  3SHF A;  1XGN A;  3ISP A;  3BDD A;  3V4G A;  1TNS A;  3IKV A;  3LAJ A;  2W25 A;  4BHP A;  5BPI A;  1UHW A;  3MZY A;  1CF7 B;  1I5Z A;  2M87 A;  3K69 A;  5CVV A;  3ZMZ A;  1SD4 A;  3C7J A;  3QRF F;  3SZT A;  5CVU A;  4FX4 A;  4KMF A;  5E17 F;  4JQF A;  2F5D A;  2IPQ X;  3QPT A;  1KU3 A;  4L5J A;  1HW1 A;  4IRG A;  2PI0 A;  4ENK A;  3GUD A;  3GFL A;  4A2U A;  1MDM B;  5F6F A;  3HYI A;  1IZ1 A;  2RV8 A;  3GXO A;  4ZZD A;  2XRN A;  3FX3 A;  3EUH A;  3FMR A;  1LJ9 A;  1LVA A;  1TTY A;  2PBI A;  4Y15 A;  4HF2 A;  1FBQ A;  4JK1 X;  1RZ4 A;  1BIB A;  2CFX A;  2F5E A;  1BC7 C;  2Y48 A;  2CGP A;  2DAO A;  4IPA A;  5BPD A;  3IRQ A;  4R79 A;  3I54 A;  1J5Y A;  4GCV A;  2BV6 A;  2NYX A;  1NHA A;  3HRM A;  2HYG D;  5E8G A;  4PGH A;  1EH7 A;  2XHK A;  5KVR A;  4WK8 F;  2K4J A;  4KMU X;  2ZKZ A;  1SAX A;  3VB2 A;  3DXJ F;  2BBY A;  4OIQ F;  4G8X A;  1L0O C;  4YII A;  2G7U A;  1G3S A;  3QPH A;  2ZO4 A;  3EYI A;  3GX4 X;  1K79 A;  3KP7 A;  3K9T A;  1U5T A;  4LB6 B;  2BEO A;  2WC2 A;  1J59 A;  1R36 A;  3PQJ A;  4EMS A;  5D4R A;  1BC8 C;  5HOO A;  2K86 A;  2VON A;  1FNN A;  2M5W A;  1IN7 A;  3BOQ A;  4BAY A;  4OOI A;  1BI2 A;  5AIP A;  4O5V A;  1O7F A;  1RNL A;  4LFU A;  5LLQ A;  1R58 A;  4M6Y A;  5FD5 A;  2MC3 A;  4LB5 A;  1KU9 A;  3IWF A;  3NEU A;  2PN6 A;  1B9M A;  2GXB A;  1ON2 A;  4S04 A;  3LST A;  2Z3Y A;  2GIV A;  4MTD A;  1AOY A;  3GYH X;  4KFC A;  3O2P E;  2CWE A;  1ZAO A;  2CG4 A;  1RUN A;  2HFH A;  1OR7 A;  1YYV A;  3HSE A;  2A6H F;  3OV8 A;  1XDU A;  3SQN A;  1IF1 A;  1LB2 A;  1I27 A;  2RDP A;  2ISZ A;  4M74 A;  2IP2 A;  1QPM A;  3F8C A;  2ZFW A;  4Q5S F;  1KQ9 A;  2OA4 A;  3M9A A;  3FHZ A;  1H0M A;  4KIF A;  4BHC A;  3BJA A;  3VOE A;  1MJB A;  4A5M A;  1SMT A;  3E6C C;  3KP3 A;  1YS6 A;  3F6O A;  4YG2 F;  1IW7 F;  3MZH A;  3BJO A;  2NAZ A;  4ESJ A;  1Z91 A;  3WU0 A;  5F1R A;  1YG2 A;  2LF8 A;  5HS8 A;  2Y75 A;  3CUQ B;  1Z6T A;  3LA7 A;  5IT9 Z;  1XDS A;  4L9J A;  2Z99 A;  2LDU A;  1ZRC A;  4CXF A;  3W6J B;  4I7H A;  3D5L A;  5L3D A;  1HW2 A;  2EFQ A;  1FT9 A;  4E70 A;  5CVI A;  2DT5 A;  2MH9 A;  4ZH4 F;  1GHC A;  2OQG A;  3IRR A;  3L2C A;  4HLY A;  1ZRD A;  2GZW A;  3VOD A;  2O8X A;  1UST A;  4XBF A;  3RDI A;  2YR2 A;  3KET A;  2PG4 A;  4HZF A;  2ZXJ A;  5A2Q Z;  3TDZ C;  3QAH A;  4L0Z B;  2MBF A;  3CDH A;  2IA1 A;  1OPC A;  4AIJ A;  1CGP A;  1WI9 A;  3WGG A;  5ED4 A;  2Z5U A;  1KGS A;  5CLS A;  2HKX A;  1LDJ A;  4U0W A;  1G3T A;  3JSO A;  5DCM B;  3TOA A;  4XLN F;  4UNO A;  3J80 K;  2PMH A;  2O3F A;  3L9F A;  3P9C A;  1E17 A;  5DUK A;  5DDG A;  3BY6 A;  1MJA A;  1REP C;  3DEU A;  5D8L B;  2AS5 F;  5CVJ A;  4L9N A;  2DQL A;  2RVC A;  4HX7 A;  4BNC A;  5L3B A;  4LLN A;  2XIG A;  4IRI A;  3H3U A;  2L02 A;  4I0A A;  2Y0M A;  5D4S A;  1T0F A;  4RAZ A;  4K2E A;  3WG9 A;  2O61 A;  4DQ2 A;  3F22 A;  4EM1 A;  1R00 A;  1V3F A;  3F21 A;  4A0Z A;  2DPU A;  5D6E A;  4M9S A;  3R60 A;  1WSU A;  1B1B A;  4U7D A;  3E6D A;  5LEJ A;  3H92 A;  2D1V A;  3U2R A;  1FSH A;  2BE5 F;  1W7P A;  5E1X A;  2P6T A;  4UV9 A;  1XB4 A;  2RN7 A;  5BQT A;  4EGZ A;  4A6E A;  2D2W A;  4NHJ A;  3RYP A;  3ZQ7 A;  2FA5 A;  2E1N A;  4MQV A;  1Z6R A;  5DUI A;  2LF7 A;  1U5T C;  1LEA A;  4Y13 A;  2K02 A;  2HYF A;  3I4P A;  4IVN A;  1WRJ A;  2L4A A;  1U8R A;  2X4H A;  2NS0 A;  4KYW A;  2R7F A;  2K4B A;  3KEQ A;  3WGH A;  2QEN A;  2FRH A;  2VT2 A;  3BZ6 A;  2DQR A;  4YFN F;  1FZP B;  2XKP A;  1XD7 A;  2QBY B;  3U9G A;  4ASN A;  3G73 A;  1J7K A;  3ZMS A;  3FWE A;  2OU2 A;  5FO5 A;  5K5O A;  1FYM A;  3GFI A;  1FLI A;  2OQR A;  3CJN A;  5DYM A;  1MDM A;  2FNP A;  2WTE A;  5E18 F;  3RJP A;  4M6X A;  5EEH A;  1Z05 A;  2JPC A;  1S29 A;  3F6V A;  3FXU A;  1UFM A;  5HDN A;  4HDV A;  3WTU C;  2ADU A;  3MEX A;  4EJO A;  4G7H F;  3I0T A;  3LQR A;  2P8T A;  3HTS B;  3ECH A;  2L01 A;  3BRO A;  1I6X A;  1J2X A;  1SFE A;  3MCZ A;  5DD4 A;  2XAS A;  1XMA A;  5LGN A;  4WCG A;  4ENJ A;  4LMY A;  3IWZ A;  4KN7 X;  2GA1 A;  4YFK F;  3ZPL A;  3NRV A;  2DK8 A;  2W85 A;  4L5I A;  1P4W A;  2XUB A;  3JTG A;  4GGG A;  1JE8 A;  3KLN A;  2HTJ A;  5D6F A;  2DLL A;  3N97 A;  4I98 B;  1J9I A;  1R1V A;  4JBA A;  5AIQ A;  3DV8 A;  5JHU A;  4G7Z F;  4IHT A;  3RKW A;  2FMY A;  1IXR C;  2KJC A;  2F5C A;  4OMY A;  4KA4 A;  3I53 A;  4P9F A;  4Y17 A;  4M71 A;  4A0Y A;  3T0Y A;  1ZYR F;  2PFB A;  1HBX G;  3TGN A;  5BS6 A;  4I01 A;  3I71 A;  2W24 A;  4HV5 A;  3REO A;  3NQO A;  3V8L A;  5D5U B;  4HOB A;  4ZZL A;  4OIN F;  1DDN A;  4KIB A;  4HF1 A;  3DQV C;  3E6B A;  4IF4 A;  2HGC A;  3TO7 A;  3F72 A;  4PZJ A;  1KU7 A;  3GFM A;  2R3S A;  4N9I A;  1Y0U A;  5FD6 A;  3KFW X;  4LK0 F;  3T5X A;  3ULQ B;  4BHB A;  4L9V A;  1XSD A;  3FXR A;  1Q1H A;  5CJ9 A;  1S7A A;  2XRO A;  4HX8 A;  4RS8 A;  1AWC A;  4RGU A;  5HS9 A;  4LLL A;  3SFZ A;  2XAJ A;  5FFX A;  1BI3 A;  4L18 B;  4HLX A;  1IUY A;  2OZ6 A;  1XGM A;  1W4M A;  1ZGA A;  2V9V A;  4Q48 A;  2VBW A;  1RIO H;  4HDU A;  3VFZ A;  2HEO A;  4H0E A;  3ABT A;  1T98 A;  4WX9 A;  3V7C A;  2EB7 A;  3P9I A;  2Z9O A;  1HKT A;  5D5X B;  2MLK A;  2J5O A;  2YX7 A;  3F8F A;  1D3Y A;  3RYR A;  3HIF A;  3WTW C;  2QQA A;  2RQP A;  5E8I A; 
#chains in the Genus database with same CATH topology
 1UG2 A;  2EK5 A;  3ZMU A;  1YIO A;  2KIS A;  2E71 A;  2M9H A;  3ZMT A;  1OYI A;  3A03 A;  1YRN B;  4A3K J;  2PEX A;  3ABU A;  1S3J A;  3ZQG A;  1ON1 A;  2Y9Z A;  1WKM A;  2B9S A;  3ELK A;  5LBQ A;  2GXA A;  1BBY A;  1MKM A;  1HW5 A;  4RAY A;  3M4O J;  1Z67 A;  3E5Q A;  3H9J A;  3IL2 A;  2FSW A;  4BH9 A;  1FX7 A;  3J7Z I;  4RGR A;  1ETV A;  1ZKG A;  1UMQ A;  4AYB N;  4U0V A;  4A5N A;  2NNN A;  1WJB A;  1T0F C;  2H8W A;  1R7J A;  2WAD A;  2P7C B;  1LEB A;  3CUQ A;  3HB9 A;  3OS1 A;  3O3K A;  3WTX C;  1G3W A;  4U7B A;  1XC5 A;  2V1U A;  4EM2 A;  1VZ0 A;  4KIG A;  2R5Y A;  3CF2 A;  5L3F A;  1W5S A;  2V26 A;  4J19 A;  2XAF A;  2WAQ A;  1K7A A;  4CCN A;  3C3W A;  4U0Y A;  5F64 A;  4WWC A;  2QM3 A;  2Y69 H;  1AKH A;  3GW2 A;  2L9V A;  2NRA C;  1VND A;  4LK1 F;  2WV0 A;  2WV1 A;  3AG4 H;  5HLG A;  5HNF A;  4RDU A;  1JJ8 C;  2A3S A;  5KAF C;  3S3N A;  2EPF A;  1WJC A;  5M5W J;  1TQI A;  3LAP A;  2PLY A;  2DT6 A;  3HKZ N;  4ON0 A;  4KIT B;  1R49 A;  1IRF A;  1A31 A;  1VQ9 I;  4A3D J;  3OOP A;  3VEP A;  3H9G A;  2A61 A;  4G12 A;  4W1U A;  2CV0 A;  5E1W A;  5EGO B;  2JUG A;  2XF6 A;  4E6K G;  3WE3 A;  1LE8 A;  2JK3 A;  2WB1 N;  5D5V B;  3HEF A;  1Y1V J;  2M0M A;  1IN6 A;  1MJ9 A;  4KN4 X;  4EAT A;  2IRF G;  1RET A;  4E7I A;  1ZR4 A;  2E35 A;  3VYT B;  3GTL J;  2GQQ A;  4OU0 A;  1W7P D;  1DU0 A;  2HZD A;  1OIS A;  5HDG A;  5IYB J;  1MBF A;  1FPQ A;  2XDV A;  2HYJ A;  3F23 A;  5TIS C;  4UVB A;  2GM4 A;  4XLA A;  2ISY A;  2JUC A;  3H35 A;  5C4J J;  3G6E I;  5FLX K;  4WXC A;  3FKI J;  2M8E A;  2ZSH B;  2ZJ2 A;  4UUS A;  2FBI A;  1OYW A;  4AYB A;  3O8H A;  2VLA A;  2CV2 A;  3A02 A;  4BJ6 C;  4W97 A;  4CIC A;  3JAM K;  2RGV A;  3CLO A;  1JHF A;  1U3E M;  3DTI A;  3H5N A;  4IO9 F;  4CYC B;  4RGX A;  1K61 A;  4GRI A;  2KT0 A;  1Z7L A;  2EZK A;  4XLC A;  3DLL F;  2BXZ A;  2FBH A;  4B48 A;  3EYY A;  4X1E A;  5J8F A;  1OYY A;  1CQT A;  4RB0 A;  1S5L C;  1X1D A;  3PUF A;  2KFD A;  1PUF A;  1E2X A;  3J80 Z;  2EV0 A;  4M73 A;  3HRU A;  1XGS A;  4NNJ A;  3GLX A;  5DCM A;  3EET A;  5CVR A;  4MIM A;  4Z2Y A;  4BBS J;  2R93 J;  1MBE A;  4AID A;  1PVE A;  2QQB A;  2G7H A;  3S2D J;  3EQL F;  3HKZ A;  3HOT A;  2OCC H;  5J4Y A;  3WTT C;  5K7F A;  2HQR A;  4V2F A;  3TKY A;  1FWZ A;  2XGX A;  3HOX J;  2V79 A;  3DKW A;  1YW8 A;  4LG0 A;  4I6Z A;  1I50 J;  1ZAR A;  4ESB A;  2L7Z A;  2WB1 A;  4XLH A;  2XRL A;  2R7D A;  2XPV A;  2F5F A;  3ZQQ A;  1UG0 A;  4MEX F;  3KIO A;  3CCS I;  1BM9 A;  1BW6 A;  1OQY A;  1ZRF A;  4Y3O A;  3MZ8 A;  3R4K A;  3HUG A;  4JP0 A;  4M3G A;  2CW7 A;  2UXX A;  3LQQ A;  4AIK A;  3DBL B;  3R0A A;  2W57 A;  1D1B A;  1K6O A;  1UEL B;  3QPL A;  1QPI A;  2ZSI B;  1ZHF A;  3MN2 A;  3FK6 A;  3WTZ A;  3BR5 A;  3TBI A;  2IA2 A;  3Q9V A;  2QGU A;  2HXI A;  3HL2 A;  3Q9S A;  2IS1 A;  2FXA A;  1D8K A;  1G59 A;  2FOK A;  3OMY A;  3JRD A;  1U5T B;  1R4M B;  4HQM A;  2HKO A;  3CC7 I;  2ESH A;  3SYT A;  5LD2 C;  1X4P A;  4XIC A;  1IN8 A;  4UY8 I;  5FKN A;  1ZG1 A;  1JXS A;  4M6V A;  3HPH A;  2L3D A;  2IT0 A;  3FMS A;  2FOW A;  2DTR A;  4AC0 A;  2CQK A;  1UCR A;  4O3M A;  2FUG 2;  3FZV A;  2LNB A;  1L3L A;  4FX0 A;  1JJ6 C;  3F3X A;  4EJV A;  1YHQ I;  2IBD A;  4ZYH A;  3E5X A;  2XGD A;  1E3H A;  2Q2E A;  2NVX J;  1N25 A;  1D0Y A;  1N78 A;  2CQQ A;  3D5S C;  2L9R A;  5TJJ A;  5TRD A;  3DBR B;  3K2A A;  4XNF A;  2L4M A;  5FKO A;  3D0S A;  1J0R A;  4JYK A;  1QGP A;  3P9K A;  3ZP5 A;  4BQA A;  3RPU A;  2EFN A;  4FHT A;  2XPW A;  1P92 A;  3S1M J;  3K0L A;  3L7W A;  2VXD A;  3RTR A;  4AD9 A;  3OYL A;  1MSE C;  4G6Q A;  3J7Y J;  4CSW A;  1M1E B;  1B4A A;  5HLT A;  2QQ9 A;  4HA8 A;  4BY7 J;  1IRZ A;  2V9P A;  4BDY A;  2HQ5 A;  1UB9 A;  1MBJ A;  5ICE A;  3I58 A;  4IHY A;  3MFK A;  1USS A;  1XCB A;  2HPM A;  3ZMV A;  5BNG A;  3I64 A;  2QBY A;  1SAU A;  2KKO A;  3TO6 A;  6PAX A;  3K4L A;  1FYL A;  3QYE A;  3QYB A;  4YIF A;  3EUK L;  2FU4 A;  3P7N A;  3W3C A;  1T2K A;  5KCM A;  1H89 C;  3A01 A;  1GVJ A;  2VIX A;  4EJU A;  1I1S A;  2BY1 A;  2YPR A;  3GZ6 A;  2Y31 A;  2XV4 S;  2E1C A;  1SVM A;  3LSG A;  4ZYA A;  1IRG A;  2UUZ A;  1SFO J;  2F48 A;  1U9O A;  1HOM A;  2DW4 A;  3CP2 A;  3OYI A;  1TW3 A;  1BI0 A;  2H6B A;  2IJL A;  5DS9 A;  3H3Z A;  2L5Q A;  2QF7 A;  1X2M A;  3K7A J;  4U88 A;  2EJR A;  3OR2 C;  3BP8 A;  1YOV B;  2DA7 A;  3HSF A;  4BXU A;  4ZDO A;  3KZZ A;  4E7Z A;  2CUZ A;  3WU2 C;  3HHH A;  3RPQ A;  3VYR B;  5E20 A;  2FD5 A;  3BZC A;  5EZG A;  1QQI A;  4B8X A;  4PDK A;  1LDK B;  5FRM A;  1SD7 A;  3M8J A;  5CKT A;  5ICC A;  1YW7 A;  2EZH A;  2EFO A;  2VE9 A;  2R92 J;  4Z6Y A;  4MNU A;  1IDY A;  2NVU B;  1YO5 C;  3DLA A;  4PSW A;  4RB2 C;  2ECC A;  3EDP A;  2LP0 A;  3PIO F;  3HGY A;  1PUE E;  2KIQ A;  4QPQ A;  4XID A;  3W2W A;  3C1D A;  5L3G A;  3AG3 H;  4I0B A;  5HLI A;  1TT0 A;  3C2B A;  1V54 H;  5B1B H;  2UZK A;  3BR3 A;  4IOA F;  3KZY A;  2PQ8 A;  2OPT A;  4HV6 A;  3AG1 H;  2K9S A;  4XN0 A;  1SAN A;  1MH4 A;  2M34 A;  2VKV A;  3F8B A;  4S05 A;  3DPU A;  1ETK A;  4OMZ A;  1ONV A;  4UVA A;  3I3L A;  4E7S A;  4GDF A;  3BZK A;  3TDU C;  1IV6 A;  2W84 A;  2LSO A;  2E2H J;  4P9U A;  2O0Y A;  4YRV A;  3KYC B;  3BCA A;  4BQQ A;  5ILV A;  3PNV A;  2VOD A;  1S6L A;  1N77 A;  2LFB A;  2XB0 X;  1P4X A;  2CRG A;  3BT9 A;  4HBL A;  5LGU A;  3RKX A;  4RAG A;  5IP7 J;  1QZY A;  3PNY A;  3IKT A;  4IXA A;  5F1J A;  4CCM A;  3I59 A;  2ZFU A;  2XAQ A;  2PJP A;  2KIF A;  3Q0W A;  1RUO A;  5CPR B;  4CZC A;  3L2R A;  1QHG A;  3WOD F;  1C0W A;  1R71 A;  1SD5 A;  3ZN1 A;  2QSF X;  4GXO A;  1RRJ A;  1TNT A;  3KP6 A;  1F5T A;  2CYY A;  2MLG A;  3HTU A;  3BTC A;  3B6C A;  2KJB A;  3CUQ C;  3CUO A;  4QWQ A;  3GTP J;  1KON A;  2LRE A;  1YX3 A;  2E7X A;  2ZME B;  4FT8 A;  3G1M A;  2DFE A;  5LHG A;  3JR9 A;  2HWV A;  2GAU A;  1UZC A;  5JVT A;  4YEJ A;  1Z21 A;  2DOE A;  2A5Y B;  3BLY A;  3OIO A;  2O9L A;  1CF7 A;  2I10 A;  1G3Y A;  4IHW A;  2LBF B;  2KRF A;  3M07 A;  3PQK A;  5CYV A;  3S32 A;  2JA8 J;  3FK7 A;  1YE9 A;  4MO7 A;  2FQ4 A;  3VYS B;  2CV1 A;  1WHU A;  1R23 A;  2P0W A;  2JRM A;  3IAM 2;  2L9N A;  4DBR A;  2DFI A;  1ZN2 A;  2X85 A;  1HKQ A;  1HQC A;  5H2F C;  3OYD A;  4KIC A;  1W5T A;  3J81 K;  1MBG A;  3CJQ B;  2MAB A;  5ILU A;  1F4K A;  2VB6 A;  1PP8 F;  1Z1D A;  3VSK A;  1YS7 A;  5FKK A;  2G9W A;  5D8K B;  3K4J A;  4DYC A;  1W36 D;  2MD0 A;  3BR2 A;  5FFZ A;  2ID6 A;  3KEO A;  2KZG A;  3KYL A;  5HLH A;  2ZNZ A;  3GTK J;  4B43 A;  4HQE A;  3FIS A;  3OR1 C;  3IC7 A;  3CO7 C;  2EA4 A;  2ZCW A;  1RI7 A;  2P7V B;  3QP5 A;  4Y33 A;  3GTO J;  5BOX A;  3DKX A;  2M45 A;  3GO5 A;  4DOZ A;  2JTV A;  4IHV A;  3HOV J;  1HC8 A;  3T8T A;  4C3J J;  4NB5 A;  4CHU A;  1QU3 A;  1ZK8 A;  3E5U A;  1XGO A;  2EFP A;  3T8R A;  4BGD A;  4A93 J;  2M4K A;  4N4O B;  4N9H A;  4BEH A;  4Q4Z F;  3H5R A;  2H1L A;  4GYI A;  4D7N A;  5D5W B;  5E3N A;  3PJR A;  1TZL A;  3P5J A;  4R1H A;  1WFX A;  3G4S I;  1LNW A;  4UHT A;  1ZG5 A;  1EH6 A;  2Z1D A;  1KYW A;  4AVZ A;  3SXY A;  2LG4 A;  2M7B A;  3MQ0 A;  2STT A;  2A6E F;  3BG9 A;  2HQN A;  2V1D A;  2A6T A;  3ABK H;  2WBM A;  4PJJ A;  2JT1 A;  1T39 A;  1D0X A;  1FC3 A;  2K40 A;  3BG5 A;  4XK4 A;  5EG0 B;  3FM5 A;  3MMY B;  1R22 A;  2HZT A;  2EZI A;  2VJ5 A;  5FLM J;  2FML A;  4BYY A;  1ODD A;  2X6Y A;  5CQE A;  4PFO A;  1OCT C;  2DMP A;  5FJ8 J;  5EEA A;  2HS5 A;  3RKY A;  4EQQ A;  2LLK A;  3HHG A;  1ZGJ A;  1BOA A;  3LFK A;  1BJZ A;  4HNU A;  2A69 F;  3PSI A;  2P6S A;  5H6Q A;  1RES A;  5J1U A;  4KNY A;  1U78 A;  3KLO A;  1EH8 A;  3AG2 H;  1DPU A;  2MH2 A;  1BR4 A;  4UXN A;  3ML6 A;  3JRA A;  1W1W E;  4C3H J;  1BR1 A;  4N0B A;  3TP3 A;  3DF8 A;  5F0F A;  4RBO A;  2BOL A;  3JRE A;  3LA3 A;  2XGC A;  3GTG J;  2Q1Z B;  1LQ1 A;  3QP6 A;  1YRN A;  1W7P B;  3ZR8 X;  2CUE A;  4R8H A;  2MSY A;  5EYR A;  2IS4 A;  4DYQ A;  4BQN A;  1O4X A;  2E60 A;  5GAE J;  2JA6 J;  1O7L A;  3HJE A;  3E0J B;  2YSR A;  1A6Q A;  4MEY F;  2Y30 A;  2A68 F;  2PJR A;  3F8N A;  1JT6 A;  1TWA J;  2JRT A;  3H36 A;  4E7L A;  1ETY A;  3FXL A;  1DUX C;  4E7H A;  1D1A A;  1STZ A;  2BVL A;  2IGK A;  3O6B B;  3R0J A;  4A3I J;  1VQN I;  3C18 A;  1SMY F;  3DKY A;  1MMN A;  2VQG A;  1H8A C;  1XSX A;  2JSC A;  3TO9 A;  3FDY A;  1X4O A;  2FEZ A;  1YJN I;  1FJL A;  2X6W A;  3QOP A;  4CDG A;  1O57 A;  4XRF A;  2FE3 A;  4PJ0 C;  3T1B A;  2Z16 A;  3NAU A;  3ZQC A;  1T33 A;  1ZLJ A;  2ELH A;  2OBP A;  4XLF A;  1H9G A;  4OAY A;  4MTE A;  3OS0 A;  2JZY A;  3HXL A;  4E7K A;  2VPR A;  2X6O A;  3JW4 A;  1O3R A;  1MZB A;  4P5O A;  3W2V A;  3H0D A;  2IW5 A;  1IN5 A;  2A05 A;  3TP0 A;  3ERE D;  3LSK A;  2DU9 A;  2M30 A;  3U1D A;  1YJ9 I;  1WH7 A;  3DP7 A;  3HM5 A;  2DCE A;  4ETS A;  1MGT A;  5ICG A;  4QLC U;  5FLX Z;  1V5G A;  4LGW A;  5HVQ C;  2WWY A;  4ZYD A;  2MW8 A;  4PFP A;  2ZBK A;  2BVM A;  2ETH A;  3FF5 A;  2M1B A;  1V5F A;  4C2T A;  2IS6 A;  1QVT A;  2QUF A;  3L00 A;  1KQ0 A;  2Z33 A;  1D8J A;  2LKS A;  4GYG A;  4OAZ A;  3JAM Z;  1T08 B;  1HSJ A;  1KZH A;  1MND A;  2FNA A;  2DYS H;  4OIR F;  1SFX A;  4UVC A;  2F5V A;  2XSJ C;  3CO6 C;  5E8I A;  3JRB A;  1UAA A;  4GO1 A;  2K9L A;  3QYF A;  3AAF A;  2KZV A;  3CCJ I;  3BPV A;  3OYF A;  3KP2 A;  3RKQ A;  3MWM A;  2CUF A;  3S2W A;  4CYC A;  2HVS A;  1APL C;  1OMI A;  1B72 B;  1MNM C;  2M4G A;  1SVL A;  3M8F A;  3JSP A;  4A6D A;  2VPL A;  1TBX A;  4D1Q A;  1RR8 C;  3K70 C;  4FQG A;  1GT0 C;  3QPS A;  3RQI A;  4ESF A;  3L2V A;  4C9Y A;  5DCF A;  2YU9 J;  4MFD A;  3KEY A;  2R0Q C;  3DEE A;  2H27 A;  3E6M A;  4XLE A;  4A3B J;  3BWG A;  3B02 A;  1FTZ A;  4C30 A;  2DTZ A;  1WQ2 A;  4XKB A;  2AXL A;  1Y8Q B;  4HNT A;  1GXQ A;  2ZC2 A;  3QU3 A;  2V1X A;  1IXC A;  3IUO A;  2F2E A;  4B3X A;  3HBL A;  3TL4 X;  4I99 C;  1RR7 A;  1HXD A;  2FX0 A;  1HDP A;  3DPT A;  4UUT A;  1TWF J;  4L0Y B;  2KQR A;  1U6G A;  1K78 B;  4XSZ F;  1WJE A;  3S1Q J;  4IJA A;  5HNH A;  2W1O A;  3JRG A;  1P6R A;  1ZLK A;  1VQ7 I;  1UHM A;  3GBG A;  1Z77 A;  3K1M A;  5DM7 F;  3WTY C;  2V6C A;  3DTK A;  5ERI A;  4BJ5 C;  2R5Z B;  1FSE A;  4G94 A;  4XKC A;  3TOB A;  2QA4 I;  2BGC A;  2D1H A;  1BN5 A;  3I5U A;  1R5G A;  4BJT A;  1K4T A;  5ILS A;  3IH2 A;  4KT5 C;  5J6X A;  1PJR A;  2CSO A;  1KU2 A;  1V4R A;  4ZDL A;  2QWW A;  1YIT I;  2H09 A;  3V42 A;  3ZN0 A;  3A4C A;  1GXP A;  2VOP A;  1ENH A;  4XSX F;  3K1P A;  3J7A O;  4LIU A;  2FF4 A;  4XR6 A;  2R7S A;  1BR2 A;  4AUX A;  3KE2 A;  4XLP F;  2YU3 A;  2K3P A;  1U9N A;  2P5K A;  2AXT C;  4OIP F;  1Y6I A;  4IKF A;  1YTY A;  4II3 A;  3OYA A;  2VC1 A;  2XGE A;  2LY9 A;  2BYV E;  3FXM A;  1FBU A;  2EV5 A;  3E7L A;  1P2F A;  1R5H A;  2G0E A;  5KK1 A;  5GTI C;  1U2W A;  1BOB A;  1WPK A;  5HS7 A;  4D0P A;  3BC8 A;  4FTH A;  2F4I A;  4HAM A;  2UWM A;  1HST A;  4PCQ A;  4HYE A;  4MQ9 F;  1YJW I;  4LIT A;  1X3U A;  1B6A A;  1X1C A;  2DN0 A;  4A3M J;  2DOD A;  4G9Y A;  3SEZ A;  3AFH A;  3B73 A;  1VF9 A;  1RKT A;  1XG1 A;  1DQU A;  2KDO A;  5B1A H;  4F92 B;  3PFY A;  2HVR A;  2P5L C;  1KA8 A;  3S3M A;  5L3C A;  1KYZ A;  2QYO A;  3OYG A;  2K3F A;  1IN4 A;  3KZI C;  4HX4 A;  4UB8 C;  1G6N A;  4P96 A;  4DIQ A;  5C3E J;  5JFR A;  1XTA A;  2AQF A;  2KMU A;  2VOO A;  3VPR A;  3LWF A;  1YLF A;  2GA2 A;  2Q8K A;  1W0U A;  3CCR I;  4MGR A;  2GLO A;  1BJA A;  4C2M J;  2I8D A;  2LRD A;  4LG3 A;  2O8K A;  2A07 F;  1FOK A;  2R7Z J;  2FJ1 A;  4DGW B;  4XL9 A;  2VQC A;  5FGM A;  5DD8 A;  1T38 A;  1DU6 A;  1MW7 A;  4UB6 C;  2XSD C;  5E1Z B;  3GWZ A;  4J01 A;  3AKZ A;  2R7T A;  5K1Y A;  4H4K C;  1WJA A;  4EV0 A;  2VE8 A;  2K9M A;  3CMY A;  1ZG3 A;  5F27 A;  2JA7 J;  4KUM A;  1B8I B;  2E5N A;  1JGS A;  1R6R A;  2OD5 A;  5E3L A;  1MNE A;  1VTN C;  3NWS A;  2VKH A;  2LKP A;  2JVG A;  3G3Z A;  4AU7 A;  3L2W A;  1VFC A;  1IO2 A;  1Y8R B;  3WU1 B;  3V7S A;  3RSN A;  4ENN A;  3JTH A;  3RIR A;  3K1N A;  1ZH5 A;  2QVO A;  1OKR A;  3HG9 A;  3VWB A;  2GOM A;  2X1E A;  1DP7 P;  2WA0 A;  1YQA A;  2EA2 A;  3L1P A;  1FY7 A;  4IHS A;  1ERD A;  5AON A;  5FRO A;  2XB5 A;  3GFJ A;  2JA2 A;  2M3A A;  2L9S A;  3RQ4 A;  3WTV C;  5M3F J;  3G71 I;  5K5R A;  2COM A;  3UR3 C;  3K10 A;  1TQM A;  4ZDP A;  4ANJ A;  3OSG A;  3HRT A;  3S1N J;  2QEX I;  4OIO F;  1ZRE A;  2K27 A;  5EF6 A;  1IGN A;  3BG6 A;  1E3O C;  3SZG A;  1FP2 A;  4B09 A;  1O3T A;  2HR3 A;  4KDP A;  1FBS A;  1E0E A;  5H20 A;  1QBJ A;  1DPR A;  2YX4 A;  2VI6 A;  1R1U A;  2IGO A;  2TDX A;  5JI6 A;  1A04 A;  1QO0 D;  2UXN A;  4O6J A;  3HOU J;  2VUM J;  2BZT A;  2OAZ A;  2GOX B;  4HF0 A;  4V19 K;  1EV7 A;  3DPL C;  1PDN C;  1TLH B;  2QQ8 A;  1JUP A;  1AKH B;  5FB2 A;  3QWL A;  1A36 A;  1JKR C;  1T6S A;  1XN7 A;  2DI3 A;  1O3S A;  1QVU A;  3DU6 A;  4WXD A;  4BQO A;  2XAG A;  5DEQ A;  2OC6 A;  4M72 A;  5E3M A;  2BY3 A;  3DFG A;  1N75 A;  1YW9 A;  3K4C A;  1ZTR A;  1HF0 A;  4I02 A;  5LRR A;  2FQ3 A;  3CJR B;  4B44 A;  2J5P A;  2VBX A;  3L09 A;  1W5C C;  1TL8 A;  4I2O A;  4F3Q A;  2YUS A;  1QNT A;  1G8X A;  1FP1 D;  4NQW A;  2ZME A;  3FBN B;  4AVP A;  1X3W B;  4JX5 A;  2VQH A;  4Q47 A;  1IRX A;  1VQM I;  4G7O F;  2VXZ A;  4XM3 A;  3WE2 A;  1LDD A;  2DA1 A;  2ACJ A;  1VQ8 I;  2HOT A;  3M8E A;  5B66 C;  2D45 A;  2DA6 A;  3SEQ A;  2IVM A;  5LRS A;  3HPG A;  2HOE A;  3J81 Z;  4UUS B;  3H5A A;  3WTS C;  3I9V 2;  5FKM A;  2QZ8 A;  5IP6 A;  5IT3 A;  1I3A A;  1QA6 A;  3CDI A;  3DEW A;  1LVK A;  1S7O A;  3HOS A;  1FOW A;  1D5V A;  1QZZ A;  1Z9C A;  3K2Z A;  2IXS A;  2RC4 A;  1F9N A;  4IL6 C;  4RB1 A;  1Z0X A;  2C6Y A;  4YFX F;  1ETQ A;  4DBQ A;  1IUF A;  4IZZ A;  1RC9 A;  2ESN A;  4AIH A;  2XKO A;  4IEJ A;  4GFB A;  1ULY A;  2VT3 A;  2RNJ A;  1WWX A;  1SD6 A;  2RKH A;  3JCU C;  3HDD A;  4C3I J;  3VDX A;  1VQK I;  1EF4 A;  2CUJ A;  4UUV A;  3GVA A;  2XVC A;  5JR3 A;  2LKX A;  2X1D A;  3F8M A;  3PFI A;  2HDC A;  4EGY A;  2ZXH A;  2BY0 A;  1A6I A;  4RGS A;  3CMM A;  5LEK A;  2VBZ A;  5LHI A;  2X51 A;  1KQ8 A;  4KT6 A;  4PGG A;  2DMU A;  3QU6 A;  3KCC A;  5DM6 F;  4I09 A;  2NVQ J;  2D5V A;  4LG0 B;  2HQA A;  2XAH A;  3E97 A;  3WHB A;  2O03 A;  4UV8 A;  1G4D A;  5HDK A;  1S9H A;  1BI1 A;  3QOD A;  4LIV A;  1WJ5 A;  2PMZ N;  3W6K B;  2EIL H;  1IXS B;  2EV6 A;  4L5E A;  4M9X A;  3UNG C;  1Y56 A;  3ZMD A;  1H9T A;  3ZOB A;  4M9Z A;  2NNY A;  3NWT A;  4HW0 A;  3V8K A;  3M1E A;  3M7G A;  2VN2 A;  1X19 A;  5GP9 A;  1XCV A;  2EIM H;  2V6E A;  2STW A;  3S15 J;  4LLG F;  2P4W A;  3FMQ A;  3K4K A;  2NOJ B;  3SZP A;  2KIU A;  1R1T A;  5LHH A;  1NK2 P;  3GME A;  3MAJ A;  1P7I A;  4XKW A;  1Z7U A;  2W4S A;  5IT9 K;  5J8C A;  5KNL A;  2NXN B;  1I1G A;  4BE0 A;  4IQJ A;  3FXQ A;  4XRM A;  2E1O A;  3COA C;  5EEG A;  5K7Z A;  2O6G E;  5IPA A;  2P5V A;  3OYJ A;  4NDL A;  1ZR2 A;  4CZZ A;  2OZU A;  2ZNY A;  2E1M B;  4EVI A;  4PJM A;  3KP4 A;  2R7U A;  1XSV A;  4EJW A;  3JRI A;  5BMZ A;  1S7E A;  2Y2Z A;  2EFW A;  2ME0 A;  3CCL I;  1VI0 A;  2VC0 A;  2HTS A;  4XOT A;  3S3O A;  5H6R A;  1WCM J;  4P55 A;  2ZXI A;  2Q0O A;  2Q2E B;  2ZJP F;  2CO5 A;  1S8N A;  2VJ4 A;  3CLQ A;  5ICF A;  2ZXW H;  4ENM A;  4HPQ A;  2QLZ A;  3BTI A;  1AHD P;  1SFU A;  4A0X A;  1O3Q A;  2PMZ A;  1PP7 U;  4HG2 A;  2HXO A;  4M3F A;  1E3P A;  3GZ5 A;  4RM3 A;  1F1Z A;  3PSF A;  1MH3 A;  1G2H A;  5LGT A;  3M3Y J;  5FLV A;  1JGG A;  3V8J A;  9ANT A;  1SVO A;  2RRE A;  4L9T A;  1FYK A;  2KIM A;  2JQ7 A;  2K85 A;  4DJA A;  4A12 A;  5JHF A;  1X2N A;  5A2Q K;  3LFU A;  2ZJR F;  1HKS A;  2IS2 A;  3CTA A;  3HOW J;  3OYM A;  2E7W A;  4RB3 C;  4EM0 B;  3Q5F A;  4WXH A;  2IGM A;  3H3V K;  1WI3 A;  4ZYG A;  3E3V A;  3OS2 A;  4IRH A;  3A0B C;  4DNC A;  3SDG A;  1UJ8 A;  3GF2 A;  2X0L A;  2DBB A;  5DV5 A;  2R7O A;  2DK5 A;  3LA2 A;  2JA5 J;  2H6C A;  2LTP A;  1U8B A;  4ZYE A;  2EIN H;  1J09 A;  2CW0 F;  3RI4 A;  4LD5 A;  4DYR A;  3ROU A;  3A01 B;  1SFK A;  2O5R A;  2CMP A;  3BPX A;  4TV7 A;  2MA3 A;  3VSL A;  3TQN A;  3CMA I;  2H94 A;  2IA0 A;  4JOM A;  4A3L J;  2LH9 A;  1NK3 P;  4NBQ A;  4ABZ A;  1B59 A;  2PMU A;  4CO8 A;  2LD5 A;  3HOY J;  4WF2 A;  3I4N J;  4D9J A;  2LY1 A;  3SFI A;  1XMK A;  2FBK A;  3OYK A;  5J47 A;  2B0L A;  2ELJ A;  2EH3 A;  2GIZ A;  2WY8 Q;  3R6S A;  5K5Q A;  3RZO J;  5EJC A;  2EQR A;  1A35 A;  3CC2 I;  1YX5 A;  2AO9 A;  1BIA A;  4G6D A;  2BW3 A;  3ECO A;  4BS9 A;  3PO3 J;  4AWX B;  2VBY A;  3HRS A;  3CCE I;  2DO7 A;  3HSR A;  4FET A;  2N8G A;  1IAW A;  1MD0 A;  2X1C A;  3IHU A;  2K7L A;  3GEZ A;  3N4M A;  3DTE A;  3S1R J;  4LJZ F;  2GWR A;  3IP4 B;  2NVT J;  3CF5 F;  2DYR H;  2GXG A;  3FM3 A;  4CGZ A;  2L54 A;  4F7Z A;  2JPB A;  5L3E A;  3A1Y A;  4CYD A;  2EWN A;  5EZH A;  1T56 A;  1FOX A;  3HOZ J;  1J75 A;  3BJ6 A;  4X6A J;  4RMN A;  1IC8 A;  2DA5 A;  3V7R A;  4EJT A;  5B3S H;  3CME I;  1B9N A;  3CES A;  4JX6 A;  2MD5 A;  2OCE A;  2EZL A;  3R61 A;  3ZQI A;  2DPD A;  4RAF A;  1W0T A;  4E7J A;  1JHH A;  4FCY A;  1TW2 A;  5FKL A;  3K4N A;  3I59 B;  4HSR A;  1YFH A;  3KP5 A;  4CUG A;  1P4A A;  3WGI A;  4MHG A;  1WVR A;  3A0H C;  1TQP A;  3QQA A;  1LPQ A;  1K78 A;  3SHF A;  3PM1 A;  1XGN A;  2EIK H;  4BU2 A;  2X48 A;  3LSM A;  3ISP A;  1U0J A;  3BDD A;  1GV2 A;  3LSJ A;  3V4G A;  1TNS A;  3IKV A;  2VQL A;  3LAJ A;  2W25 A;  2ME6 A;  4BHP A;  5BPI A;  1UHW A;  4PSX A;  2CQX A;  3HZJ A;  2Y9Y A;  2B63 J;  3MZY A;  1SC7 A;  1XMX A;  4PK4 A;  2GBY A;  1CF7 B;  4N4N B;  4RM2 A;  1VQ6 I;  2LC2 A;  1I5Z A;  2M87 A;  1D5Y A;  2WAE A;  3K69 A;  5CVV A;  3ZMZ A;  1SD4 A;  3C7J A;  3QRF F;  2XC7 A;  4BXX J;  2E34 A;  3SZT A;  1JKP C;  5EGO A;  5CVU A;  1X58 A;  2CQ7 A;  2DDB A;  3B6A A;  4FX4 A;  3K4B A;  4KMF A;  2E5Z A;  5E17 F;  4JQF A;  2F5D A;  2IPQ X;  3QPT A;  5TGT A;  2DOA A;  2WAF A;  4NC6 A;  2KLO A;  3FXJ A;  3I56 I;  2ZME C;  1KU3 A;  2VAS A;  4L5J A;  1HW1 A;  3J7A Y;  4IRG A;  2PI0 A;  4ENK A;  1HCR A;  3GUD A;  1VQ4 I;  2HVQ A;  3BTL A;  3GFL A;  4A2U A;  4HEA 2;  5GTH C;  1MDM B;  2F4O B;  1ZQ3 P;  3OY9 A;  3IH3 A;  5F6F A;  2E19 A;  3HYI A;  1IZ1 A;  1GVD A;  1LFB A;  3L2U A;  2W82 A;  2RV8 A;  3CD6 I;  4BAC A;  3DBH B;  5GAD J;  3GXO A;  4ITV A;  4ZZD A;  2LK2 A;  2V4J C;  2XRN A;  1XX5 A;  3FX3 A;  2OTL I;  3EUH A;  3FMR A;  4BY1 J;  4XRS A;  1LJ9 A;  1LVA A;  1TTY A;  3RPU D;  4D5C A;  2PBI A;  4Y52 J;  3PIP F;  4Y15 A;  4HF2 A;  1FBQ A;  4JK1 X;  1RZ4 A;  1BIB A;  2CFX A;  4QSH A;  2H1K A;  2F5E A;  1BC7 C;  3I55 I;  4DZP A;  2NS8 A;  2Y48 A;  3PNT A;  2CGP A;  3BTJ A;  4IOC F;  3ZRG A;  2DAO A;  3FKJ A;  4IPA A;  5BPD A;  2CS3 A;  3IRQ A;  2JJ7 A;  4R79 A;  3I54 A;  3GTM J;  2JSP A;  2QSH X;  1J5Y A;  4GCV A;  1B8I A;  2VJJ A;  2CW8 A;  3FXK A;  1X1B A;  1OCP A;  1P7J A;  3U21 A;  1MMG A;  2BV6 A;  2NYX A;  4YEL A;  3S2H J;  1NHA A;  3HRM A;  4IHX A;  3TED A;  1OJL A;  2HYG D;  1RKW A;  4PGH A;  5E8G A;  1MSF C;  2VKE A;  2HI3 A;  5IYC J;  1EH7 A;  2XHK A;  5KVR A;  5GPC A;  5KAI C;  4WK8 F;  2K4J A;  1OCZ H;  4KMU X;  2ZKZ A;  4FE7 A;  1SAX A;  3VB2 A;  3DXJ F;  2HOS A;  1FEX A;  2BBY A;  4J00 A;  2Y0S N;  5EDN A;  1D1C A;  4OIQ F;  3FXO A;  4G8X A;  5IYD J;  4M3E A;  4Y4R A;  1L0O C;  4YII A;  1JKO C;  2BHZ A;  2G7U A;  2PJR B;  1G3S A;  1LFU P;  3QPH A;  1K6Y A;  2CQN A;  2ZO4 A;  3EYI A;  3BCB A;  3GX4 X;  1K79 A;  3KP7 A;  2AQE A;  3K9T A;  1NH3 A;  3JRF A;  2MC4 A;  1U5T A;  1ZEL A;  4LB6 B;  2BEO A;  5J4V A;  3ZXS A;  2WC2 A;  4CH7 A;  1J59 A;  1R36 A;  3PQJ A;  4EMS A;  5D4R A;  5HOD A;  1BC8 C;  4D5F A;  5HOO A;  2K86 A;  4RA2 A;  2VON A;  1FNN A;  2X9D A;  1YI2 I;  2M5W A;  2IGN A;  1IN7 A;  3BOQ A;  4BAY A;  4OOI A;  4JX4 A;  1Z3Y A;  1BI2 A;  2RAE A;  1VQP I;  4NC7 A;  4B47 A;  3F9K A;  5AIP A;  4O5V A;  1O7F A;  3S16 J;  1RNL A;  4LFU A;  5LLQ A;  2QSG X;  1R58 A;  4MLO A;  3GLL A;  3L2Q A;  2LR8 A;  3JRC A;  4M6Y A;  5FD5 A;  2MC3 A;  3U1K A;  4LB5 A;  1KU9 A;  2ID3 A;  3IWF A;  3NEU A;  2PN6 A;  1MBH A;  1B9M A;  4F55 A;  2GXB A;  1ON2 A;  4S04 A;  3LST A;  2L7F P;  2MG4 A;  2Y0S A;  1ETO A;  2Z3Y A;  2GIV A;  3LSR A;  4MTD A;  3CCQ I;  1AOY A;  2M2E A;  3CJT B;  1F36 A;  3D5R C;  4RLQ A;  3GYH X;  4KFC A;  2DFH A;  3O2P E;  2CWE A;  1ZAO A;  2CG4 A;  1RUN A;  2HFH A;  4QIW N;  3GCM A;  2HDD A;  1OR7 A;  1YYV A;  3HSE A;  3LNQ A;  1ACI A;  1ETX A;  2A6H F;  2L2O A;  3OV8 A;  1XDU A;  4IQ4 A;  3SQN A;  3ZCO A;  2LOO A;  1IF1 A;  1LB2 A;  4IX7 A;  4G6T B;  1I27 A;  1FMV A;  2RDP A;  4M74 A;  1T8I A;  2ISZ A;  2IP2 A;  1QPM A;  2LY2 A;  3F8C A;  3AL0 C;  3BG7 A;  3O8G A;  2ZFW A;  4Q5S F;  1KQ9 A;  2OUM A;  3OIP A;  2OA4 A;  4QPO A;  3M9A A;  3FHZ A;  3ABM H;  3LOC A;  1H0M A;  3BR0 A;  4KIF A;  4BHC A;  3BJA A;  1X1A A;  3H9Q A;  3VOE A;  1MJB A;  4XKV A;  1SMT A;  1DGW Y;  4A5M A;  3E6C C;  1MMS A;  1XS9 A;  3KP3 A;  1YS6 A;  2CU7 A;  3CZ6 A;  3F6O A;  3BQY A;  4YG2 F;  1IW7 F;  1YIJ I;  4A3G J;  2DA3 A;  3ZQH A;  1ORK A;  3MZH A;  3BJO A;  3MVP A;  2NAZ A;  3PUB A;  4ESJ A;  3C2H A;  1I3Q J;  1Z91 A;  2VKD A;  3K6G A;  3S17 J;  1R9T J;  4A3C J;  1TWC J;  1JUS A;  2OJE D;  2BHY A;  3WG7 H;  3WU0 A;  2NVY J;  1EA3 A;  1YG2 A;  5F1R A;  4FE4 A;  2JN6 A;  2LF8 A;  5HS8 A;  3ZQF A;  1R5I D;  5J1R A;  1I39 A;  2Y75 A;  3CUQ B;  1Z6T A;  1OCC H;  3LA7 A;  5IT9 Z;  1XDS A;  3OYB A;  4L9J A;  4A3F J;  2R5Y B;  2DXI A;  2Z99 A;  1WJF A;  2IAI A;  2R7X A;  1OCR H;  2QKM B;  3LSH A;  3JRH A;  1I6H J;  1TP4 A;  2LDU A;  1ZRC A;  4CXF A;  3FHN A;  2M7A A;  2P81 A;  4I7H A;  3D5L A;  3W6J B;  1LKX A;  4A3E J;  5L3D A;  2XAU A;  3CQZ J;  3OIQ A;  1HW2 A;  2KPM A;  1MIJ A;  3C2G A;  2EFQ A;  1GLN A;  1RPW A;  5C44 J;  4M3B A;  1FMW A;  1FT9 A;  3HGG A;  4D7M A;  1IJW C;  4E70 A;  5IOY A;  5CVI A;  4HST A;  2DT5 A;  1LE8 B;  2E36 A;  2MH9 A;  2NOG A;  2V1N A;  4ZH4 F;  1GHC A;  2OQG A;  2COB A;  1WZ2 A;  3CCV I;  3IRR A;  5M5Y J;  3L2C A;  4S0H B;  5F0H A;  5IY5 H;  4HLY A;  3ONQ A;  2MFZ A;  1ZRD A;  2DJN A;  4XOP A;  2GZW A;  3D1N I;  2LBF A;  2M0C A;  3VOD A;  2O8X A;  1UST A;  4XBF A;  3RDI A;  3GTQ J;  2YR2 A;  3KET A;  2PG4 A;  2E2I J;  4HZF A;  2ZXJ A;  5A2Q Z;  3TDZ C;  1JT0 A;  3QAH A;  4L0Z B;  2MBF A;  3CDH A;  2IA1 A;  3DU5 A;  3PL8 A;  2HNH A;  1AU7 A;  1OPC A;  4XOR A;  4AIJ A;  1CGP A;  3FBI B;  1WI9 A;  3EPZ A;  1IDZ A;  3WGG A;  2R7V A;  4RLF A;  3RCO A;  5ED4 A;  1V55 H;  4I76 A;  2Z5U A;  1KGS A;  3IAS 2;  2IEK A;  2TCT A;  4M3D A;  2KL4 A;  1PUF B;  1HLV A;  3KX2 A;  5CLS A;  2HKX A;  1LDJ A;  4U0W A;  3BG3 A;  1G3T A;  3JSO A;  1QRY A;  5IP9 J;  5DCM B;  4AM3 A;  1X1P A;  1GDT A;  4FIS A;  2L7K A;  3TOA A;  3OOU A;  4XLN F;  4UNO A;  5CQG A;  3J80 K;  2PMH A;  2O3F A;  3L9F A;  3P9C A;  1E17 A;  4F52 A;  1Y0N A;  2ECB A;  2RQQ A;  4CCL A;  5DUK A;  3OYC A;  2DA4 A;  5DDG A;  2LVS A;  3BY6 A;  1MJA A;  1WGX A;  1REP C;  3EUH C;  3DEU A;  1P9Q C;  1OCO H;  5D8L B;  2K9Q A;  2AS5 F;  2VJI A;  3ZQL A;  1XPX A;  5CVJ A;  3CCM I;  4L9N A;  4B3A A;  4E4H A;  2DQL A;  2RVC A;  4HX7 A;  2BXY A;  4XQF A;  4ZTJ A;  4BNC A;  3HUG B;  4CCK A;  1JUM A;  5L3B A;  4A3J J;  4LLN A;  4Y7N J;  5EG0 A;  3IV5 A;  2ELK A;  3KPH A;  3UKG A;  1Y39 A;  2XIG A;  3OYH A;  4IRI A;  3H3U A;  4XON A;  2L02 A;  1Y1W J;  2Z2S B;  4LOC A;  4I0A A;  3QOE A;  2KDZ A;  2Y0M A;  1QHH D;  3GZN B;  3CCU I;  5D4S A;  1T0F A;  4RAZ A;  4K2E A;  5J3L A;  3ASO H;  3WG9 A;  2O61 A;  1POG A;  4DQ2 A;  3F22 A;  1OLT A;  2ZB9 A;  3DCF A;  1R00 A;  4B1R A;  4EM1 A;  3VYU B;  1V3F A;  3F21 A;  4A0Z A;  2DPU A;  5D6E A;  4M9S A;  3R60 A;  1WSU A;  2MYS A;  1B1B A;  1JTY A;  5B5E C;  2F4M B;  4U7D A;  3RZD J;  3BR1 A;  3LSP A;  3E6D A;  5LEJ A;  3H92 A;  2D1V A;  3U2R A;  1FSH A;  2BE5 F;  2CH0 A;  2KHM A;  1W7P A;  5E1X A;  4XN3 A;  3ZGK A;  1PYV A;  2XF5 A;  3G1L A;  2P6T A;  4UV9 A;  1XB4 A;  2B7E A;  2RN7 A;  1VQL I;  5BQT A;  1GV5 A;  4EGZ A;  3G1O A;  2HPI A;  3G2B A;  4PJN A;  3OYE A;  4A6E A;  2D2W A;  1Z3X A;  4NHJ A;  3RYP A;  3ZQ7 A;  2K5C A;  2FA5 A;  2A5W A;  2ZJQ F;  5K7H A;  2E1N A;  4MQV A;  1Z6R A;  5DUI A;  2LF7 A;  3CC4 I;  4PUS A;  1U5T C;  1LEA A;  3M1C A;  4Y13 A;  1DP3 A;  2K02 A;  2HYF A;  3I4P A;  4NQW B;  2E2J J;  3KYD B;  2L0K A;  2OTJ I;  4IVN A;  3WHC A;  3ASN H;  1WRJ A;  1W36 C;  2L4A A;  1U8R A;  2X4H A;  2NS0 A;  3HC7 A;  4F93 B;  4KYW A;  2R7F A;  4XRS G;  2K4B A;  4EEF G;  1T95 A;  2V9K A;  5DTD A;  3TW7 A;  3EUA A;  3BR6 A;  3KEQ A;  1K4S A;  1F43 A;  2KRH A;  3WGH A;  2QEN A;  2FRH A;  2VT2 A;  3BZ6 A;  2DQR A;  4YFN F;  1FZP B;  4X0G A;  2XKP A;  1XD7 A;  2QBY B;  5JLX A;  1TC3 C;  4MFE A;  4CCO A;  3U9G A;  2H8R A;  4ASN A;  1NTC A;  5J1Y A;  3G73 A;  2ICW G;  4DW6 A;  1J7K A;  2PX9 A;  2KP6 A;  3ZMS A;  1VQ5 I;  1BW5 A;  3LL7 A;  1BA5 A;  4OWR B;  3FWE A;  2OU2 A;  5FO5 A;  5K5O A;  1FYM A;  2JMW A;  2EIJ H;  3GFI A;  1FLI A;  5JVG F;  4XMY A;  2OQR A;  1R4N B;  1WJD A;  3CJN A;  3MD2 A;  5DYM A;  1MDM A;  5KHD A;  2FNP A;  2WTE A;  2UV1 A;  5E18 F;  3RJP A;  4M6X A;  5EEH A;  1Z05 A;  1OFC X;  4P1W A;  2JPC A;  2O7O A;  1S29 A;  4CCJ A;  3F6V A;  3FXU A;  1UFM A;  5HDN A;  4HDV A;  3LMM A;  3WTU C;  2ADU A;  3ESW B;  3H0G J;  3MEX A;  4EJO A;  1OR7 C;  3S93 A;  2DMT A;  3Q0V A;  4DZJ A;  3I0T A;  4G7H F;  1A5J A;  3TW6 A;  3LQR A;  1MMA A;  1V5E A;  2DJI A;  2L01 A;  1K83 J;  2P8T A;  3ECH A;  5IOZ A;  1B72 A;  4HNV A;  3HTS B;  1D0Z A;  3BQZ A;  3BRO A;  1I6X A;  1ETW A;  5E79 C;  1EKE A;  2DOF A;  1J2X A;  4ZTF A;  3FIW A;  3GTJ J;  1SFE A;  2DDA A;  1FIP A;  3DWL E;  2R7W A;  3MCZ A;  4U87 A;  1TT5 B;  3ERM A;  5DD4 A;  2XAS A;  1XMA A;  3CDL A;  5LGN A;  3NAR A;  4WCG A;  1ZGW A;  2R4G A;  4ENJ A;  2I5U A;  4LMY A;  2DT7 B;  3IWZ A;  4KN7 X;  2GA1 A;  5F08 A;  1Q1V A;  2L7M P;  4YFK F;  2V7F A;  5E3O A;  5F0C A;  3ZPL A;  2CJJ A;  3NRV A;  3OSF A;  2DK8 A;  2W85 A;  3W2A A;  2YS9 A;  4BKX A;  4L5I A;  2MGQ A;  1MMD A;  1P4W A;  2W00 A;  2XUB A;  2K9N A;  4GGG A;  3JTG A;  1JE8 A;  2RNG A;  1NG7 A;  3I4M J;  3KLN A;  2HTJ A;  5FRN A;  5D6F A;  5JLW A;  2DLL A;  3N97 A;  4HRI A;  4I98 B;  5J40 A;  1J9I A;  3A2K A;  5M3M J;  1R1V A;  2W48 A;  1TWH J;  4JBA A;  3SJM A;  5AIQ A;  1FOY A;  2AHQ A;  4B4C A;  3W6V A;  5GAG J;  1MBK A;  1IG7 A;  3DV8 A;  3N05 A;  5JHU A;  2R5Z A;  2M8G X;  4BE1 A;  4G7Z F;  4IHT A;  3MKL A;  4II2 A;  1DGR M;  3RKW A;  2FMY A;  1IXR C;  2KJC A;  2F5C A;  4A69 C;  1FIA A;  4YIR X;  4CA0 A;  4OMY A;  4ZJZ A;  2JWT A;  4KA4 A;  4KIS A;  3K4M A;  3I53 A;  4P9F A;  4Y17 A;  4BL0 B;  3OL3 A;  2OV7 A;  4M71 A;  1ITY A;  4A0Y A;  2X6X A;  2F6C A;  5F04 A;  3T0Y A;  1ZYR F;  2PFB A;  1HBX G;  1AA7 A;  3TGN A;  5BS6 A;  2DA2 A;  4I01 A;  1JTX A;  3I71 A;  2W24 A;  1NG6 A;  4HV5 A;  3REO A;  3NQO A;  1GUU A;  5M5X J;  3V8L A;  3F0C A;  5D5U B;  5GPA A;  4HOB A;  4ZZL A;  4OIN F;  2QKL B;  4BE2 A;  1DDN A;  2R7R A;  2OF7 A;  4KIB A;  3IH4 A;  4F91 B;  5C4X J;  2HDW A;  4HF1 A;  3DQV C;  3OYN A;  1WH5 A;  3E6B A;  4IF4 A;  3OL4 A;  2E1M C;  3CP8 A;  4BBR J;  4PJL A;  2HGC A;  1H88 C;  4NUB A;  3TO7 A;  3F72 A;  4PZJ A;  1KU7 A;  3GFM A;  2R3S A;  4N9I A;  3MKZ A;  2VL8 A;  1Y0U A;  3H1C A;  5FD6 A;  5LFA A;  1LUJ B;  1JKQ C;  3KFW X;  4LK0 F;  2HOA A;  3T5X A;  3ULQ B;  4BHB A;  4L9V A;  1XSD A;  3FXR A;  1Q1H A;  5CJ9 A;  1SEU A;  1S7A A;  2DFF A;  2XRO A;  3X2Q H;  3S14 J;  4HX8 A;  1BL0 A;  4RS8 A;  1JI8 A;  3S8P A;  1AWC A;  4RGU A;  5HS9 A;  4LLL A;  3SFZ A;  1IV8 A;  3MKW B;  2R7Q A;  3TMO A;  4BDZ A;  4BEH B;  2XAJ A;  5FFX A;  3AL0 B;  1BI3 A;  2DMN A;  2WY7 Q;  4NC8 A;  4L18 B;  4HLX A;  1IUY A;  2EBI A;  2OZ6 A;  2CFO A;  1XGM A;  1W4M A;  1ZGA A;  1EJ9 A;  3Q0U A;  1HA8 A;  4BUP A;  2V9V A;  4Q48 A;  2VBW A;  4ZC3 A;  1FTT A;  1X3Z B;  2HU9 A;  1RIO H;  4HDU A;  3VFZ A;  3PO2 J;  2HEO A;  2WAQ N;  2QCO A;  3LSI A;  1HDD C;  4H0E A;  2JVH A;  4KJZ A;  2KRC A;  3ABT A;  1T98 A;  2BW3 B;  4WX9 A;  2TRT A;  3MKY B;  1VQO I;  3V7C A;  2EB7 A;  3P9I A;  2Z9O A;  1LFP A;  1HKT A;  4BXF A;  5D5X B;  2MLK A;  4C2U A;  4QTR A;  1TWG J;  2J5O A;  2W7N A;  1S72 I;  3ABL H;  1UHS A;  2YX7 A;  4V2G A;  3F8F A;  3CCY A;  1D3Y A;  2DMQ A;  2LMD A;  3RYR A;  3HIF A;  4FAS D;  3Q3S A;  5GAH J;  3WTW C;  3E1S A;  2XF7 A;  2XPU A;  2BY2 A;  3SDB A;  1QZE A;  2QQA A;  2RQP A;  2LYC A;  3K70 D;  2NS7 A;  3OWT A; 
#chains in the Genus database with same CATH homology
 2EK5 A;  3ZMU A;  1YIO A;  3ZMT A;  1OYI A;  2PEX A;  3ABU A;  1S3J A;  1ON1 A;  1WKM A;  3ELK A;  5LBQ A;  1BBY A;  1MKM A;  1HW5 A;  4RAY A;  3E5Q A;  3IL2 A;  2FSW A;  4BH9 A;  1FX7 A;  4RGR A;  4U0V A;  4A5N A;  2NNN A;  1R7J A;  2P7C B;  1LEB A;  3CUQ A;  3O3K A;  3WTX C;  1G3W A;  4U7B A;  2V1U A;  4EM2 A;  4KIG A;  5L3F A;  1W5S A;  2XAF A;  1K7A A;  3C3W A;  4U0Y A;  5F64 A;  4WWC A;  2QM3 A;  3GW2 A;  2NRA C;  4LK1 F;  2WV0 A;  5HLG A;  2A3S A;  1TQI A;  3LAP A;  2PLY A;  4ON0 A;  1IRF A;  3OOP A;  3VEP A;  2A61 A;  5E1W A;  3WE3 A;  5D5V B;  4KN4 X;  1IN6 A;  1MJ9 A;  2IRF G;  2GQQ A;  4OU0 A;  1W7P D;  5HDG A;  1FPQ A;  3F23 A;  4UVB A;  2ISY A;  5FLX K;  4WXC A;  2M8E A;  2ZJ2 A;  2FBI A;  1OYW A;  4CIC A;  3JAM K;  2RGV A;  3CLO A;  1JHF A;  1U3E M;  4RGX A;  2FBH A;  3EYY A;  5J8F A;  1OYY A;  4RB0 A;  1E2X A;  3J80 Z;  2EV0 A;  4M73 A;  3HRU A;  1XGS A;  3GLX A;  5DCM A;  3EET A;  5CVR A;  4Z2Y A;  2QQB A;  2G7H A;  3EQL F;  3HOT A;  3WTT C;  2HQR A;  3TKY A;  1FWZ A;  2XGX A;  2V79 A;  3DKW A;  1YW8 A;  4LG0 A;  1ZAR A;  4ESB A;  2R7D A;  2F5F A;  4MEX F;  1BM9 A;  1ZRF A;  3R4K A;  3HUG A;  2UXX A;  3LQQ A;  4AIK A;  3R0A A;  2W57 A;  1K6O A;  1ZHF A;  3WTZ A;  2IA2 A;  3Q9V A;  3Q9S A;  2FXA A;  1D8K A;  2FOK A;  1U5T B;  4HQM A;  2HKO A;  2ESH A;  1IN8 A;  1JXS A;  1ZG1 A;  2L3D A;  2IT0 A;  3FMS A;  2DTR A;  2CQK A;  1UCR A;  4O3M A;  3FZV A;  2LNB A;  1L3L A;  4FX0 A;  3F3X A;  4EJV A;  4ZYH A;  3E5X A;  2Q2E A;  5TJJ A;  5TRD A;  2L4M A;  3D0S A;  1J0R A;  1QGP A;  3P9K A;  3ZP5 A;  4BQA A;  3RPU A;  2EFN A;  4FHT A;  1P92 A;  3K0L A;  3L7W A;  3RTR A;  4AD9 A;  4G6Q A;  1B4A A;  2QQ9 A;  4HA8 A;  1UB9 A;  5ICE A;  3I58 A;  3MFK A;  1USS A;  1XCB A;  3ZMV A;  2QBY A;  3I64 A;  2KKO A;  3TO6 A;  6PAX A;  1FYL A;  4YIF A;  2FU4 A;  3P7N A;  1T2K A;  1GVJ A;  4EJU A;  1I1S A;  2YPR A;  3GZ6 A;  2XV4 S;  2E1C A;  1IRG A;  2DW4 A;  1TW3 A;  1BI0 A;  2H6B A;  2IJL A;  3H3Z A;  4U88 A;  2EJR A;  3BP8 A;  3HSF A;  4BXU A;  3KZZ A;  3HHH A;  3RPQ A;  5E20 A;  4B8X A;  1QQI A;  4PDK A;  1LDK B;  1SD7 A;  5ICC A;  1YW7 A;  2EFO A;  2VE9 A;  4MNU A;  1YO5 C;  4RB2 C;  3EDP A;  1PUE E;  3C1D A;  5L3G A;  4I0B A;  5HLI A;  2UZK A;  3KZY A;  2PQ8 A;  4HV6 A;  4S05 A;  3F8B A;  4OMZ A;  1ONV A;  4UVA A;  3TDU C;  2W84 A;  2LSO A;  4P9U A;  2O0Y A;  5ILV A;  2VOD A;  1S6L A;  1P4X A;  4HBL A;  5LGU A;  3RKX A;  1QZY A;  4IXA A;  3I59 A;  2XAQ A;  2PJP A;  2KIF A;  1RUO A;  3WOD F;  1C0W A;  1SD5 A;  3ZN1 A;  4GXO A;  1TNT A;  3KP6 A;  1F5T A;  2CYY A;  2MLG A;  3HTU A;  2KJB A;  3CUQ C;  3CUO A;  4QWQ A;  2E7X A;  2ZME B;  4FT8 A;  5LHG A;  2HWV A;  2GAU A;  5JVT A;  2A5Y B;  1CF7 A;  1G3Y A;  2KRF A;  3PQK A;  5CYV A;  1R23 A;  2DFI A;  1ZN2 A;  3IKT A;  1HKQ A;  1HQC A;  4KIC A;  1W5T A;  3J81 K;  5ILU A;  1F4K A;  1PP8 F;  1Z1D A;  1YS7 A;  2G9W A;  5D8K B;  5FFZ A;  3KEO A;  5HLH A;  2ZNZ A;  4HQE A;  3IC7 A;  3CO7 C;  2EA4 A;  2ZCW A;  1RI7 A;  2P7V B;  3QP5 A;  5BOX A;  2M45 A;  3GO5 A;  2JTV A;  3T8T A;  4NB5 A;  4CHU A;  3T8R A;  1XGO A;  2EFP A;  3E5U A;  4N9H A;  4Q4Z F;  4GYI A;  5D5W B;  4R1H A;  1LNW A;  4UHT A;  1ZG5 A;  1EH6 A;  1KYW A;  3SXY A;  3MQ0 A;  2STT A;  2A6E F;  2HQN A;  2V1D A;  2JT1 A;  1T39 A;  1FC3 A;  3FM5 A;  1R22 A;  2HZT A;  2FML A;  4BYY A;  1ODD A;  2HS5 A;  3RKY A;  4EQQ A;  3HHG A;  1ZGJ A;  1BOA A;  3LFK A;  2A69 F;  5H6Q A;  2P6S A;  4KNY A;  1U78 A;  3KLO A;  1EH8 A;  1DPU A;  2MH2 A;  4UXN A;  3ML6 A;  4N0B A;  3DF8 A;  3LA3 A;  1LQ1 A;  3QP6 A;  1W7P B;  4R8H A;  1O7L A;  2YSR A;  4MEY F;  2A68 F;  3F8N A;  2JRT A;  1DUX C;  1STZ A;  3O6B B;  3R0J A;  3C18 A;  1SMY F;  1XSX A;  2JSC A;  3TO9 A;  2FEZ A;  3QOP A;  4CDG A;  1O57 A;  4XRF A;  2FE3 A;  3T1B A;  2ELH A;  1ZLJ A;  2OBP A;  1H9G A;  4MTE A;  2JZY A;  3JW4 A;  1O3R A;  1MZB A;  4P5O A;  2IW5 A;  1IN5 A;  3ERE D;  2DU9 A;  2M30 A;  3U1D A;  3DP7 A;  4ETS A;  1MGT A;  5ICG A;  4QLC U;  5FLX Z;  4LGW A;  5HVQ C;  2WWY A;  4ZYD A;  2ZBK A;  2ETH A;  3FF5 A;  2M1B A;  2QUF A;  3L00 A;  1KQ0 A;  2Z33 A;  1D8J A;  4GYG A;  3JAM Z;  1HSJ A;  2FNA A;  4OIR F;  1SFX A;  4UVC A;  3CO6 C;  4GO1 A;  3AAF A;  3BPV A;  3KP2 A;  3MWM A;  3S2W A;  1OMI A;  3M8F A;  3JSP A;  4A6D A;  1TBX A;  4ESF A;  5DCF A;  2H27 A;  3E6M A;  3BWG A;  3B02 A;  1WQ2 A;  2AXL A;  1GXQ A;  3QU3 A;  2V1X A;  1IXC A;  2F2E A;  1HXD A;  3DPT A;  4L0Y B;  1U6G A;  1K78 B;  4XSZ F;  4IJA A;  1P6R A;  1ZLK A;  1UHM A;  3K1M A;  3WTY C;  2V6C A;  5ERI A;  1FSE A;  4G94 A;  3TOB A;  2BGC A;  2D1H A;  1BN5 A;  3I5U A;  1R5G A;  5ILS A;  4KT5 C;  5J6X A;  2CSO A;  1KU2 A;  1V4R A;  2QWW A;  2H09 A;  3ZN0 A;  1GXP A;  2VOP A;  4XSX F;  3K1P A;  3J7A O;  2FF4 A;  4XLP F;  3KE2 A;  2YU3 A;  2P5K A;  4OIP F;  1YTY A;  2VC1 A;  2BYV E;  1FBU A;  2EV5 A;  1P2F A;  1R5H A;  5KK1 A;  1U2W A;  5HS7 A;  4D0P A;  2UWM A;  4HAM A;  1HST A;  4PCQ A;  4MQ9 F;  4HYE A;  1X3U A;  1B6A A;  4G9Y A;  3B73 A;  2P5L C;  1KA8 A;  5L3C A;  1KYZ A;  2QYO A;  1IN4 A;  4HX4 A;  1G6N A;  4P96 A;  5JFR A;  2VOO A;  3LWF A;  1YLF A;  2GA2 A;  2Q8K A;  4MGR A;  1BJA A;  2A07 F;  1FOK A;  5FGM A;  5DD8 A;  1T38 A;  5E1Z B;  3GWZ A;  5K1Y A;  4EV0 A;  2VE8 A;  1ZG3 A;  4KUM A;  1JGS A;  2OD5 A;  1VTN C;  2LKP A;  3G3Z A;  3WU1 B;  3V7S A;  4ENN A;  3JTH A;  3RIR A;  3K1N A;  1ZH5 A;  2QVO A;  1OKR A;  1DP7 P;  1YQA A;  2EA2 A;  1FY7 A;  4IHS A;  5AON A;  3GFJ A;  3WTV C;  5K5R A;  2COM A;  1TQM A;  3HRT A;  4OIO F;  1ZRE A;  2K27 A;  1FP2 A;  4B09 A;  1O3T A;  2HR3 A;  4KDP A;  1FBS A;  5H20 A;  1QBJ A;  1DPR A;  2YX4 A;  1R1U A;  2TDX A;  5JI6 A;  1A04 A;  1QO0 D;  2UXN A;  4O6J A;  2OAZ A;  4HF0 A;  1EV7 A;  3DPL C;  1PDN C;  1TLH B;  5FB2 A;  1T6S A;  1XN7 A;  2DI3 A;  1O3S A;  4WXD A;  2XAG A;  5DEQ A;  4M72 A;  3DFG A;  1YW9 A;  4I02 A;  5LRR A;  2FQ3 A;  2J5P A;  2VBX A;  3L09 A;  4I2O A;  1QNT A;  1FP1 D;  4NQW A;  2ZME A;  4AVP A;  4Q47 A;  4G7O F;  2VXZ A;  3WE2 A;  1LDD A;  2ACJ A;  3M8E A;  2D45 A;  5LRS A;  2IVM A;  2HOE A;  3J81 Z;  3WTS C;  2QZ8 A;  5IT3 A;  1S7O A;  3HOS A;  1D5V A;  1QZZ A;  1Z9C A;  3K2Z A;  2RC4 A;  1F9N A;  4RB1 A;  2C6Y A;  4YFX F;  2ESN A;  4AIH A;  2XKO A;  1ULY A;  2VT3 A;  2RNJ A;  1WWX A;  1SD6 A;  2RKH A;  4UUV A;  3GVA A;  2XVC A;  5JR3 A;  3PFI A;  3F8M A;  2HDC A;  4EGY A;  4RGS A;  5LEK A;  2VBZ A;  5LHI A;  1KQ8 A;  4PGG A;  3QU6 A;  3KCC A;  4I09 A;  4LG0 B;  2XAH A;  3E97 A;  2O03 A;  4UV8 A;  1G4D A;  5HDK A;  1BI1 A;  3W6K B;  1IXS B;  2EV6 A;  4M9X A;  3ZMD A;  1H9T A;  4M9Z A;  2NNY A;  4HW0 A;  3V8K A;  3M1E A;  3M7G A;  2VN2 A;  1XCV A;  2STW A;  4LLG F;  2P4W A;  3FMQ A;  3SZP A;  2KIU A;  1R1T A;  5LHH A;  3MAJ A;  1Z7U A;  5IT9 K;  5J8C A;  1I1G A;  3FXQ A;  3COA C;  5EEG A;  2O6G E;  2P5V A;  4CZZ A;  2OZU A;  2ZNY A;  4EVI A;  3KP4 A;  1XSV A;  4EJW A;  5BMZ A;  2EFW A;  2VC0 A;  2HTS A;  5H6R A;  4P55 A;  2Q0O A;  2CO5 A;  1S8N A;  5ICF A;  4ENM A;  2QLZ A;  1SFU A;  4A0X A;  1O3Q A;  1PP7 U;  3GZ5 A;  1F1Z A;  5LGT A;  3V8J A;  4L9T A;  1FYK A;  2KIM A;  4A12 A;  5A2Q K;  1HKS A;  3CTA A;  2E7W A;  4RB3 C;  4EM0 B;  3Q5F A;  4WXH A;  4ZYG A;  3E3V A;  4IRH A;  4DNC A;  3GF2 A;  2X0L A;  2DBB A;  5DV5 A;  2DK5 A;  3LA2 A;  2H6C A;  4ZYE A;  2CW0 F;  3RI4 A;  4LD5 A;  3ROU A;  3BPX A;  4TV7 A;  2MA3 A;  3TQN A;  2H94 A;  2IA0 A;  1B59 A;  2PMU A;  4CO8 A;  4WF2 A;  1XMK A;  2FBK A;  2B0L A;  3R6S A;  5K5Q A;  1BIA A;  4G6D A;  3ECO A;  4AWX B;  2VBY A;  3HRS A;  2DO7 A;  3HSR A;  1IAW A;  1MD0 A;  3IHU A;  3N4M A;  2K7L A;  3GEZ A;  4LJZ F;  2GWR A;  3FM3 A;  2GXG A;  4CGZ A;  2L54 A;  4F7Z A;  2JPB A;  5L3E A;  4CYD A;  2EWN A;  1J75 A;  3BJ6 A;  3V7R A;  4EJT A;  1B9N A;  2MD5 A;  3R61 A;  2DPD A;  1JHH A;  1TW2 A;  3I59 B;  1YFH A;  3KP5 A;  1P4A A;  3WGI A;  4MHG A;  1TQP A;  1K78 A;  3SHF A;  1XGN A;  3ISP A;  3BDD A;  3V4G A;  1TNS A;  3IKV A;  3LAJ A;  2W25 A;  4BHP A;  5BPI A;  1UHW A;  3MZY A;  1CF7 B;  1I5Z A;  2M87 A;  3K69 A;  5CVV A;  3ZMZ A;  1SD4 A;  3C7J A;  3QRF F;  3SZT A;  5CVU A;  4FX4 A;  4KMF A;  5E17 F;  4JQF A;  2F5D A;  2IPQ X;  3QPT A;  1KU3 A;  4L5J A;  1HW1 A;  4IRG A;  2PI0 A;  4ENK A;  3GUD A;  3GFL A;  4A2U A;  1MDM B;  5F6F A;  3HYI A;  1IZ1 A;  2RV8 A;  3GXO A;  4ZZD A;  2XRN A;  3FX3 A;  3EUH A;  3FMR A;  1LJ9 A;  1LVA A;  1TTY A;  2PBI A;  4Y15 A;  4HF2 A;  1FBQ A;  4JK1 X;  1RZ4 A;  1BIB A;  2CFX A;  2F5E A;  1BC7 C;  2Y48 A;  2CGP A;  2DAO A;  4IPA A;  5BPD A;  3IRQ A;  4R79 A;  3I54 A;  1J5Y A;  4GCV A;  2BV6 A;  2NYX A;  1NHA A;  3HRM A;  2HYG D;  5E8G A;  4PGH A;  1EH7 A;  2XHK A;  5KVR A;  4WK8 F;  2K4J A;  4KMU X;  2ZKZ A;  1SAX A;  3VB2 A;  3DXJ F;  2BBY A;  4OIQ F;  4G8X A;  1L0O C;  4YII A;  2G7U A;  1G3S A;  3QPH A;  2ZO4 A;  3EYI A;  3GX4 X;  1K79 A;  3KP7 A;  3K9T A;  1U5T A;  4LB6 B;  2BEO A;  2WC2 A;  1J59 A;  1R36 A;  3PQJ A;  4EMS A;  5D4R A;  1BC8 C;  5HOO A;  2K86 A;  2VON A;  1FNN A;  2M5W A;  1IN7 A;  3BOQ A;  4BAY A;  4OOI A;  1BI2 A;  5AIP A;  4O5V A;  1O7F A;  1RNL A;  4LFU A;  5LLQ A;  1R58 A;  4M6Y A;  5FD5 A;  2MC3 A;  4LB5 A;  1KU9 A;  3IWF A;  3NEU A;  2PN6 A;  1B9M A;  2GXB A;  1ON2 A;  4S04 A;  3LST A;  2Z3Y A;  2GIV A;  4MTD A;  1AOY A;  3GYH X;  4KFC A;  3O2P E;  2CWE A;  1ZAO A;  2CG4 A;  1RUN A;  2HFH A;  1OR7 A;  1YYV A;  3HSE A;  2A6H F;  3OV8 A;  1XDU A;  3SQN A;  1IF1 A;  1LB2 A;  1I27 A;  2RDP A;  2ISZ A;  4M74 A;  2IP2 A;  1QPM A;  3F8C A;  2ZFW A;  4Q5S F;  1KQ9 A;  2OA4 A;  3M9A A;  3FHZ A;  1H0M A;  4KIF A;  4BHC A;  3BJA A;  3VOE A;  1MJB A;  4A5M A;  1SMT A;  3E6C C;  3KP3 A;  1YS6 A;  3F6O A;  4YG2 F;  1IW7 F;  3MZH A;  3BJO A;  2NAZ A;  4ESJ A;  1Z91 A;  3WU0 A;  5F1R A;  1YG2 A;  2LF8 A;  5HS8 A;  2Y75 A;  3CUQ B;  1Z6T A;  3LA7 A;  5IT9 Z;  1XDS A;  4L9J A;  2Z99 A;  2LDU A;  1ZRC A;  4CXF A;  3W6J B;  4I7H A;  3D5L A;  5L3D A;  1HW2 A;  2EFQ A;  1FT9 A;  4E70 A;  5CVI A;  2DT5 A;  2MH9 A;  4ZH4 F;  1GHC A;  2OQG A;  3IRR A;  3L2C A;  4HLY A;  1ZRD A;  2GZW A;  3VOD A;  2O8X A;  1UST A;  4XBF A;  3RDI A;  2YR2 A;  3KET A;  2PG4 A;  4HZF A;  2ZXJ A;  5A2Q Z;  3TDZ C;  3QAH A;  4L0Z B;  2MBF A;  3CDH A;  2IA1 A;  1OPC A;  4AIJ A;  1CGP A;  1WI9 A;  3WGG A;  5ED4 A;  2Z5U A;  1KGS A;  5CLS A;  2HKX A;  1LDJ A;  4U0W A;  1G3T A;  3JSO A;  5DCM B;  3TOA A;  4XLN F;  4UNO A;  3J80 K;  2PMH A;  2O3F A;  3L9F A;  3P9C A;  1E17 A;  5DUK A;  5DDG A;  3BY6 A;  1MJA A;  1REP C;  3DEU A;  5D8L B;  2AS5 F;  5CVJ A;  4L9N A;  2DQL A;  2RVC A;  4HX7 A;  4BNC A;  5L3B A;  4LLN A;  2XIG A;  4IRI A;  3H3U A;  2L02 A;  4I0A A;  2Y0M A;  5D4S A;  1T0F A;  4RAZ A;  4K2E A;  3WG9 A;  2O61 A;  4DQ2 A;  3F22 A;  4EM1 A;  1R00 A;  1V3F A;  3F21 A;  4A0Z A;  2DPU A;  5D6E A;  4M9S A;  3R60 A;  1WSU A;  1B1B A;  4U7D A;  3E6D A;  5LEJ A;  3H92 A;  2D1V A;  3U2R A;  1FSH A;  2BE5 F;  1W7P A;  5E1X A;  2P6T A;  4UV9 A;  1XB4 A;  2RN7 A;  5BQT A;  4EGZ A;  4A6E A;  2D2W A;  4NHJ A;  3RYP A;  3ZQ7 A;  2FA5 A;  2E1N A;  4MQV A;  1Z6R A;  5DUI A;  2LF7 A;  1U5T C;  1LEA A;  4Y13 A;  2K02 A;  2HYF A;  3I4P A;  4IVN A;  1WRJ A;  2L4A A;  1U8R A;  2X4H A;  2NS0 A;  4KYW A;  2R7F A;  2K4B A;  3KEQ A;  3WGH A;  2QEN A;  2FRH A;  2VT2 A;  3BZ6 A;  2DQR A;  4YFN F;  1FZP B;  2XKP A;  1XD7 A;  2QBY B;  3U9G A;  4ASN A;  3G73 A;  1J7K A;  3ZMS A;  3FWE A;  2OU2 A;  5FO5 A;  5K5O A;  1FYM A;  3GFI A;  1FLI A;  2OQR A;  3CJN A;  5DYM A;  1MDM A;  2FNP A;  2WTE A;  5E18 F;  3RJP A;  4M6X A;  5EEH A;  1Z05 A;  2JPC A;  1S29 A;  3F6V A;  3FXU A;  1UFM A;  5HDN A;  4HDV A;  3WTU C;  2ADU A;  3MEX A;  4EJO A;  4G7H F;  3I0T A;  3LQR A;  2P8T A;  3HTS B;  3ECH A;  2L01 A;  3BRO A;  1I6X A;  1J2X A;  1SFE A;  3MCZ A;  5DD4 A;  2XAS A;  1XMA A;  5LGN A;  4WCG A;  4ENJ A;  4LMY A;  3IWZ A;  4KN7 X;  2GA1 A;  4YFK F;  3ZPL A;  3NRV A;  2DK8 A;  2W85 A;  4L5I A;  1P4W A;  2XUB A;  3JTG A;  4GGG A;  1JE8 A;  3KLN A;  2HTJ A;  5D6F A;  2DLL A;  3N97 A;  4I98 B;  1J9I A;  1R1V A;  4JBA A;  5AIQ A;  3DV8 A;  5JHU A;  4G7Z F;  4IHT A;  3RKW A;  2FMY A;  1IXR C;  2KJC A;  2F5C A;  4OMY A;  4KA4 A;  3I53 A;  4P9F A;  4Y17 A;  4M71 A;  4A0Y A;  3T0Y A;  1ZYR F;  2PFB A;  1HBX G;  3TGN A;  5BS6 A;  4I01 A;  3I71 A;  2W24 A;  4HV5 A;  3REO A;  3NQO A;  3V8L A;  5D5U B;  4HOB A;  4ZZL A;  4OIN F;  1DDN A;  4KIB A;  4HF1 A;  3DQV C;  3E6B A;  4IF4 A;  2HGC A;  3TO7 A;  3F72 A;  4PZJ A;  1KU7 A;  3GFM A;  2R3S A;  4N9I A;  1Y0U A;  5FD6 A;  3KFW X;  4LK0 F;  3T5X A;  3ULQ B;  4BHB A;  4L9V A;  1XSD A;  3FXR A;  1Q1H A;  5CJ9 A;  1S7A A;  2XRO A;  4HX8 A;  4RS8 A;  1AWC A;  4RGU A;  5HS9 A;  4LLL A;  3SFZ A;  2XAJ A;  5FFX A;  1BI3 A;  4L18 B;  4HLX A;  1IUY A;  2OZ6 A;  1XGM A;  1W4M A;  1ZGA A;  2V9V A;  4Q48 A;  2VBW A;  1RIO H;  4HDU A;  3VFZ A;  2HEO A;  4H0E A;  3ABT A;  1T98 A;  4WX9 A;  3V7C A;  2EB7 A;  3P9I A;  2Z9O A;  1HKT A;  5D5X B;  2MLK A;  2J5O A;  2YX7 A;  3F8F A;  1D3Y A;  3RYR A;  3HIF A;  3WTW C;  2QQA A;  2RQP A;  5E8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...