2NRAC

Crystal structure of pi initiator protein in complex with iteron dna
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
260
structure length
252
Chain Sequence
VNKKTKIRHRNELNHTLAQLPLPAKRVMYMALALIDSKEPLERGRVFKIRAEDLAALAKITPSLAYRQLKEGGKLLGASKISLRGDDIIALAKELNSEELDLNIIEWIAYSPDEGYLSLKFTRTIEPYISSLIGKKNKFTTQLLTASLRLSSQYSSSLYQLIRKHYSNFKKKNYFIISVDELKEELIAYTFDKDGNIEYKYPDFPIFKRDVLNKAIAEIKKKTEISFVGFTVHEKEGRKISKLKFEFVVDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of pi initiator protein-iteron complex of plasmid R6K: implications for initiation of plasmid DNA replication.
pubmed doi rcsb
molecule keywords 5'-D(*GP*AP*AP*CP*AP*TP*GP*AP*GP*AP*GP*CP*TP*TP*AP*GP*TP*AP*
molecule tags Replication/dna
source organism Escherichia coli
total genus 71
structure length 252
sequence length 260
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01051 Rep_3 Initiator Replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nraC02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nraC01
3I58A 3VFZA 1K78A 4ZZDA 1OYWA 1JGSA 5ICFA 4F7ZA 2X4HA 1ON1A 1XGSA 1Z1DA 4IXAA 2WWYA 2VE8A 4ESBA 4PDKA 2B0LA 3H92A 1QQIA 3QOPA 3JSPA 1Z05A 3HRUA 4I09A 2VC1A 1KU9A 1TW2A 3KP6A 2DPDA 1XSDA 5JI6A 4HV6A 2K86A 3BPXA 2G7UA 3FZVA 3HYIA 1J5YA 4A0ZA 4MTDA 4LLGF 3SFZA 3RIRA 3ROUA 2EV0A 5K1YA 1MD0A 3ZPLA 1FT9A 4KIFA 4AIJA 2ESNA 3K0LA 1IW7F 1DPUA 2RNJA 2FBHA 1YFHA 3W6KB 1T38A 2DTRA 4KFCA 4YIFA 4ENMA 2CWEA 5H6RA 1AWCA 3C7JA 2CGPA 1FBUA 3ZN1A 3WTTC 3K1NA 2EWNA 3KFWX 2FSWA 3KP4A 3L7WA 3ULQB 5ICEA 1LDKB 3CUOA 1HBXG 3ELKA 4HDVA 2FBKA 1F1ZA 2ZBKA 3EYYA 2LSOA 2Y75A 2EJRA 3FMQA 3C3WA 2V1XA 2ETHA 3MAJA 1KYWA 2MH2A 5A2QZ 3GVAA 2YR2A 4UXNA 3GEZA 2IRFG 1ULYA 1J59A 2HDCA 4RAYA 4HX8A 5D4SA 2P4WA 2Y0MA 1ZARA 4MEXF 4L9JA 3BJAA 4BHCA 2IT0A 4KNYA 4Y13A 1RUNA 3QPTA 4MQVA 2NS0A 1TW3A 4U7BA 2M5WA 2KJBA 3W6JB 4N0BA 1G3SA 5DCMA 2WV0A 2OZ6A 3GZ6A 3WTUC 1MDMA 2C6YA 2FA5A 1XMKA 3V8KA 1FP1D 1D8KA 4HF2A 1ZH5A 1ZG3A 1D5VA 3MFKA 3WE3A 3V7RA 5LEJA 5E8GA 3ML6A 4N9HA 2HZTA 2P5LC 2FXAA 3WGHA 4EM1A 4EJUA 1T98A 3KZYA 3E6CC 5F1RA 4NHJA 3I4PA 4LB6B 2EFPA 4CYDA 5A2QK 2A3SA 1B9NA 1OPCA 3WGGA 3T8RA 3P7NA 1LVAA 1ON2A 1QO0D 2H6BA 5FO5A 3E6BA 3QU6A 4UNOA 2QBYB 4P9UA 2DW4A 3P9CA 1W5SA 1IN7A 2DBBA 4RGSA 5DYMA 3QP6A 3T5XA 2E7XA 1HXDA 1RIOH 1QZYA 2QM3A 4KA4A 4I0AA 2ISYA 5E1ZB 3KLNA 2PBIA 5J6XA 3HRSA 5D8KB 1UHWA 2HEOA 5L3EA 3M8EA 3TOAA 1G4DA 1DUXC 2L54A 1AOYA 4OMZA 1P4AA 1XSXA 4OOIA 2XAJA 3E97A 3FX3A 1KYZA 1U5TC 1GXPA 2IJLA 4L5IA 5HS9A 3I59A 3V7SA 2HR3A 1FYMA 2YPRA 3KP2A 4BAYA 2BE5F 1U3EM 2GA2A 1J9IA 1ZN2A 1B4AA 2W85A 1XGOA 3TKYA 1Z7UA 4WXCA 4PGGA 3RTRA 3FHZA 2Z5UA 4I7HA 5E1WA 1LB2A 3K1PA 5FFZA 4FX4A 3LSTA 5CLSA 4HAMA 3RI4A 4P96A 1IRFA 3RKWA 1SFUA 4M9ZA 4I0BA 2OD5A 5L3DA 2LNBA 5HLGA 3GLXA 3DKWA 2IA0A 1JHHA 4O5VA 5JFRA 1ZG1A 4RS8A 2WTEA 5CVUA 4NB5A 1IXCA 4UV9A 2XAGA 5D5XB 2D1HA 1ZLKA 4P55A 5LGUA 2W24A 1XCVA 3EDPA 2PN6A 2R7FA 5E20A 5E17F 5CYVA 2HS5A 2BBYA 4KMUX 5DCFA 3K69A 1WWXA 3LFKA 1FSEA 1YTYA 1R22A 4AD9A 1W7PA 5DUIA 1GVJA 4ESJA 1STZA 2ZMEA 2EB7A 2JPBA 4RGXA 4ZYHA 4HX4A 2J5PA 4R8HA 2UXNA 3T0YA 2P5KA 4OIOF 1J7KA 2XGXA 1U6GA 3PQKA 2QQ9A 4ENJA 2VE9A 3K2ZA 5E8IA 1LDDA 1Z9CA 2P7CB 3TO9A 2GAUA 3T1BA 1OKRA 2PFBA 4UHTA 5LBQA 5D6FA 1IRGA 3V8LA 1EH8A 3MCZA 3FXQA 2ZCWA 5BPIA 1WI9A 3KE2A 3TDZC 3GFJA 3SZPA 1IF1A 4Y15A 4RB0A 2H27A 1FNNA 3IKTA 4WCGA 3TO6A 2GIVA 2R3SA 4CHUA 3SXYA 3WTWC 3V8JA 1OMIA 2M1BA 5L3FA 5L3GA 2ACJA 3L2CA 3EYIA 4EQQA 4O3MA 4U0YA 5K5QA 1W7PD 1YYVA 2GQQA 3F8BA 3GUDA 2YX7A 3WTZA 4L9VA 3VODA 5CVRA 3VEPA 3ABTA 3WODF 4S04A 2ADUA 4RB3C 4M6YA 2UWMA 1F9NA 3T8TA 2ESHA 1HSJA 3HOTA 3ZMVA 1ZREA 1PDNC 1E2XA 3WU0A 3TO7A 4OMYA 4JBAA 4MTEA 1RNLA 1PUEE 4PGHA 3BY6A 5EEHA 3E5XA 1UHMA 4BQAA 5ICGA 4ZYEA 1L3LA 3CTAA 2HYGD 3CUQB 2EFNA 3R6SA 4L9NA 5ICCA 2KIUA 2DFIA 2EFOA 2STWA 2HWVA 4HX7A 2XIGA 1CF7B 4ASNA 4RAZA 2Y48A 2RQPA 4ZZLA 2DQLA 3DV8A 3ZMZA 5AONA 1T39A 2VONA 1B59A 4HW0A 3WE2A 2EV5A 2IVMA 1F5TA 4L0ZB 4KICA 1EH7A 4Z2YA 5K5OA 1O3TA 3HTSB 1B9MA 1JHFA 2JTVA 4K2EA 3I5UA 3L09A 4A0YA 1L0OC 3Q5FA 1JXSA 2PG4A 2FMLA 3TDUC 4A6DA 3DPLC 3N97A 5DV5A 4D0PA 1KQ9A 2RV8A 1SFEA 4M72A 3E6MA 3FWEA 3SHFA 4AIKA 1SD6A 2P6SA 2DO7A 2JRTA 4QLCU 2A6EF 2CG4A 4O6JA 4XSZF 2QQBA 3IC7A 1R5GA 1O7FA 3TOBA 5HDKA 3MZHA 4G7ZF 4S05A 3EQLF 1OR7A 2HQNA 1WSUA 2HQRA 1S7AA 2DPUA 2VC0A 4RB2C 4MGRA 2EFQA 1FBSA 3FM3A 1XMAA 2YX4A 2DLLA 3WU1B 2XHKA 1FOKA 1RZ4A 4ZYDA 2RKHA 4HLXA 1X3UA 1S7OA 2O61A 1T0FA 1Z6TA 3QAHA 4G94A 4GO1A 4MQ9F 2DK8A 1ZLJA 4KT5C 5BQTA 3O6BB 4PZJA 1QPMA 5AIQA 1U5TB 4N9IA 2R7DA 4UVAA 2D45A 4CICA 2D1VA 1JE8A 4Q4ZF 2RVCA 1YW9A 2XRNA 5HDGA 1FYKA 2F2EA 1BIBA 4B8XA 4FHTA 1YS6A 2Z3YA 1REPC 5D5WB 1KU3A 3CUQC 1HKSA 3F8MA 4LG0B 1LEAA 1R23A 5LHHA 2KIFA 2VT2A 4LGWA 2CW0F 4HF0A 2CSOA 2VBXA 4LFUA 3JAMZ 3IL2A 4ZH4F 4UVCA 2QENA 4HBLA 5LHIA 2IPQX 1QNTA 3O3KA 5D5UB 1HQCA 1P4WA 2NNYA 2VT3A 3ABUA 2K27A 2IW5A 1R1UA 4EJWA 4UUVA 3VOEA 4Y17A 4LB5A 2E1NA 5F64A 2XROA 4IPAA 1H9GA 3F3XA 2VOPA 2FNPA 4YFNF 2X0LA 4LLNA 3QRFF 4ENNA 2YU3A 4KMFA 1XSVA 1E17A 2QQAA 1YS7A 3J81Z 5IT9Z 1YW7A 2DU9A 3R60A 1IN6A 2QYOA 1YG2A 2JPCA 3U1DA 1KA8A 4XLPF 3OOPA 2VBZA 3JAMK 1D3YA 1LQ1A 2FE3A 2HOEA 1G6NA 1ZRCA 1DP7P 3GFIA 3WTSC 4HF1A 2A69F 3EETA 1LDJA 2K4JA 5CJ9A 4LK1F 4M9XA 3ZMSA 2V79A 1WKMA 3HOSA 3BZ6A 3HRTA 2O0YA 3HSRA 1HW5A 2F5CA 3V7CA 3G73A 3QU3A 1XGNA 4LLLA 1FPQA 1Y0UA 5FD5A 1USSA 2RGVA 4WWCA 3N4MA 1I1GA 5LRRA 1U78A 2EA4A 2QBYA 4LK0F 2QVOA 5ERIA 1IXSB 3MEXA 2M45A 1ZGJA 4I2OA 2MA3A 3J81K 1HW1A 5IT9K 2GZWA 2J5OA 5TJJA 2ZNYA 3J7AO 3F21A 5ED4A 1KQ8A 3G3ZA 4M9SA 4FT8A 4B09A 1MJ9A 4CXFA 4OU0A 2OA4A 3KETA 3I0TA 1KQ0A 4DNCA 1TQIA 3O2PE 3OV8A 3FM5A 2FNAA 1TQMA 2BGCA 3M9AA 1TNTA 3R0JA 5LHGA 2DAOA 1PP7U 3DEUA 1EV7A 1K79A 1V4RA 2CFXA 5L3CA 1FX7A 4BH9A 1XGMA 5CVVA 2A61A 2KRFA 1VTNC 1GXQA 4M6XA 2STTA 2GXBA 4BHPA 1HKQA 4HQEA 2Q0OA 3FXUA 2LF7A 3ECHA 4U0VA 3IWFA 2IA1A 4OIQF 1SFXA 4JK1X 4IRIA 2GWRA 4BHBA 1TTYA 3BWGA 3DPTA 3LAPA 2K02A 4KIBA 4G7HF 5HLIA 3HUGA 4CZZA 3QP5A 3ERED 2FU4A 5LLQA 3LWFA 1SAXA 5HOOA 2LF8A 4M73A 5FFXA 1R1VA 4WXHA 1LNWA 3LA2A 3DXJF 2CO5A 4KIGA 1IUYA 2OBPA 4EGYA 4PCQA 2CQKA 5DDGA 5HDNA 4LJZF 3F72A 2XKOA 3RKXA 2BEOA 1SMYF 4IRHA 4I98B 5KVRA 2NAZA 3F6OA 2A5YB 2OQGA 1DDNA 2FEZA 2MH9A 3NRVA 3F23A 1Z6RA 3L00A 2EV6A 4L5JA 5DUKA 3WTXC 1XN7A 4OIRF 2O6GE 1B1BA 5BPDA 2MC3A 3JW4A 3D0SA 3QPHA 4AWXB 1MKMA 3CJNA 3F22A 4L18B 3FXRA 4HYEA 3IWZA 4GYGA 4IHTA 1KU2A 2M87A 4TV7A 5F6FA 4EM2A 2RN7A 4IVNA 4HLYA 1YW8A 3LQRA 1T2KA 3RPUA 3I64A 1FC3A 1G3WA 3B73A 1LJ9A 4IJAA 2XAQA 4CGZA 1BIAA 4CO8A 2A68F 4ZYGA 4OIPF 4M74A 2H6CA 1LEBA 2KIMA 4BXUA 2E1CA 2AS5F 4U0WA 2XV4S 4XSXF 2HTJA 5FLXZ 2IA2A 2OU2A 3RPQA 2UZKA 4DQ2A 1SMTA 2K7LA 1FP2A 2XKPA 3ZQ7A 2O03A 3F8CA 1K78B 3H3ZA 2QWWA 3SQNA 3MWMA 1P2FA 1BI3A 1ODDA 2PJPA 4GGGA 5KK1A 1O3SA 1ZYRF 4IF4A 2MLGA 2EFWA 1KU7A 1YO5C 1F4KA 2PMUA 4IHSA 2DT5A 3WTYC 3CUQA 4XLNF 5K5RA 1J0RA 3L9FA 4G6DA 2ZJ2A 1Z91A 2PLYA 1B6AA 3ZN0A 4NQWA 3IHUA 3ZP5A 3FMRA 4L9TA 5H20A 2OQRA 1CF7A 2MLKA 2COMA 4KDPA 5EEGA 3LQQA 3JSOA 1UB9A 4HZFA 1U8RA 2L01A 3C18A 5FLXK 4OINF 2Q2EA 3BJOA 2DQRA 3LAJA 1FY7A 2L4AA 2QZ8A 1BC7C 1V3FA 5CVJA 2A6HF 4MNUA 2FF4A 2FMYA 2HKXA 1O3QA 2ZKZA 2F5FA 4WF2A 1QBJA 1QZZA 1SD5A 3C1DA 1G3TA 3GYHX 5JHUA 3P9IA 2P7VB 3J80Z 3KEOA 1ZG5A 2L4MA 3CLOA 3ECOA 5LGNA 1FBQA 1MJBA 1S8NA 4AIHA 1D8JA 4H0EA 4HV5A 3ZMDA 2NRAC 3Q9SA 2W57A 2PMHA 2E7WA 3REOA 1U2WA 5H6QA 2MBFA 4RGRA 4ETSA 3WG9A 2FQ3A 4GYIA 2A07F 3K9TA 5DCMB 3R0AA 3VB2A 4EV0A 5J8CA 1R1TA 1ZGAA 4KN7X 1J2XA 2P5VA 1MDMB 2GA1A 5CVIA 1K6OA 3HTUA 2GXGA 2VODA 3MQ0A 2DK5A 2Z99A 1BC8C 2TDXA 1U5TA 3GZ5A 1IZ1A 3J80K 5BMZA 2IP2A 1SD4A 3K1MA 3DP7A 3NEUA 3IRQA 2KJCA 3RYPA 2NNNA 3U2RA 3F8FA 3F6VA 3PQJA 1KGSA 3E3VA 2JZYA 3M7GA 5ILUA 4I01A 1ZRFA 2MD5A 1BM9A 4R1HA 5JVTA 1A04A 4LG0A 3RDIA 3HRMA 4BNCA 1YQAA 5J8FA 2Z9OA 2OZUA 4EMSA 1R36A 1HKTA 2BV6A 1P4XA 3BDDA 1BJAA 2WC2A 3M1EA 4M71A 1R00A 5FD6A 4G6QA 1FZPB 2F5DA 4AVPA 1PP8F 2XUBA 1I5ZA 2FOKA 2HGCA 1ONVA 1XDSA 2QUFA 5DEQA 5TRDA 2ZO4A 3KP5A 5IT3A 4G9YA 1OYIA 4LMYA 1MZBA 3MZYA 3BPVA 3CO6C 5LEKA 3BP8A 3RJPA 4HQMA 3HHGA 2V1UA 4KYWA 4KN4X 4YFKF 2H94A 3I59B 3CDHA 1HSTA 1IN5A 4UVBA 2XAHA 3ZMTA 4EJOA 1J75A 2KKOA 4LD5A 4ESFA 2HTSA 4HA8A 1C0WA 1P6RA 1NHAA 2W84A 4A6EA 3EUHA 3ISPA 3KP7A 1QGPA 5E1XA 3U9GA 2VOOA 2LKPA 4ON0A 1MGTA 5ILVA 5AIPA 5L3BA 2ISZA 3HSFA 2QLZA 3D5LA 1S3JA 3KCCA 2V9VA 2JSCA 4P9FA 2V6CA 3DF8A 3B02A 3HSEA 2G9WA 4ENKA 1XCBA 3I53A 3I54A 2ZFWA 2W25A 3DQVC 1GHCA 3E5UA 3GX4X 4EM0B 2DI3A 1XDUA 2RC4A 3E6DA 3GFMA 1RI7A 2O3FA 2RDPA 1W5TA 1BI0A 5D5VB 4YG2F 4WXDA 4EJTA 1W7PB 3RYRA 1O3RA 3R61A 1TQPA 1WQ2A 2P8TA 2JT1A 4U88A 2HYFA 2ZMEB 3KP3A 1TLHB 3GW2A 2FRHA 3KEQA 2BYVE 1FYLA 2EA2A 4HDUA 2D2WA 1RUOA 3HHHA 1YLFA 4A0XA 4WX9A 1XB4A 3AAFA 2ELHA 1S29A 1TBXA 1FWZA 4A12A 1CGPA 5D6EA 1UCRA 3PFIA 4Q5SF 4XBFA 4BYYA 3KZZA 2VBYA 4A5MA 3GF2A 1WRJA 5D4RA 2VBWA 1R5HA 2XAFA 4G8XA 4A5NA 1T6SA 4YIIA 1ZAOA 1UFMA 2PEXA 3COAC 2L3DA 4MEYF 1FLIA 4QWQA 1ZRDA 3Q9VA 2M30A 4RGUA 1O57A 3GWZA 2P6TA 1BBYA 3IRRA 3FF5A 3DFGA 2F5EA 2O8XA 1BI2A 1H9TA 2OAZA 3JTHA 4P5OA 5HS8A 1IN4A 1YIOA 5DD4A 4EJVA 1BI1A 5ILSA 1XD7A 2ZXJA 1Q1HA 5E18F 3SZTA 3TQNA 2AXLA 1I1SA 3P9KA 5DD8A 3CO7C 2Z33A 3FMSA 4GXOA 2V1DA 3M8FA 3I71A 4FX0A 1IAWA 2K4BA 4L0YB 5BOXA 5HVQC 1USTA 2VXZA 1K7AA 1H0MA 3LA3A 4Q47A 1I6XA 3H3UA 2NYXA 3GO5A 1W4MA 4U7DA 1BOAA 1O7LA 6PAXA 3E5QA 5FB2A 3LA7A 4G7OF 4I02A 2HFHA 1OYYA 1DPRA 3BOQA 4A2UA 2M8EA 3F8NA 2G7HA 2XVCA 4EVIA 4JQFA 2ZNZA 3KLOA 5D8LB 1ZHFA 3GXOA 2CYYA 2HKOA 3BJ6A 3S2WA 4YFXF 4EGZA 3JTGA 2PQ8A 3NQOA 2Q8KA 3TGNA 1FSHA 1HW2A 1BN5A 2VN2A 3GFLA 1P92A 4CDGA 1SD7A 5HS7A 5BS6A 3R4KA 1R58A 4KUMA 5LRSA 4MHGA 1EH6A 5FGMA 1TNSA 2H09A 1G3YA 2XASA 4UV8A 3ZMUA 1IXRC 5LGTA 2YSRA 5JR3A 4HOBA 3WGIA 3IKVA 2PI0A 1R7JA 1MJAA 2EK5A 4RB1A 4Q48A 3RKYA 4GCVA 2FBIA 1I27A 4IRGA 2UXXA 3HIFA 4R79A 5HLHA 4WK8F 1IN8A 2LDUA 3BROA 4E70A 3V4GA 3WTVC 4XRFA 1S6LA 2L02A
chains in the Genus database with same CATH superfamily
3I58A 3VFZA 1K78A 4ZZDA 1S72I 1OYWA 3M1CA 3OR1C 2ICWG 5TGTA 1JGSA 2LTPA 5ICFA 1UMQA 3I4MJ 2YUSA 3S1RJ 4V2FA 5EYRA 4F52A 4F7ZA 2X4HA 3CDIA 1ON1A 1XGSA 1Z1DA 2R7SA 3J7ZI 4IXAA 2GBYA 2WWYA 2VE8A 4ESBA 4PDKA 2B0LA 4GDFA 3H92A 1QQIA 3QOPA 3JSPA 1Z05A 3CMEI 3HRUA 4I09A 2VC1A 4C2UA 4MEXF 2GXAA 3PJRA 1KU9A 1TW2A 1S5LC 3KP6A 2GLOA 1UAAA 2VQCA 1XSDA 2DPDA 2IS6A 1FIPA 2DDAA 2H1KA 2AQEA 4HV6A 5JI6A 2K86A 3BPXA 4YIRX 2G7UA 3FZVA 3HYIA 1J5YA 4A0ZA 3OYIA 4MTDA 1TT0A 4BEHB 4LLGF 3SFZA 5GP9A 3RIRA 2EV0A 3ROUA 1T95A 5K1YA 2HVRA 1MD0A 2HI3A 1FT9A 3ZPLA 4KIFA 4AIJA 5K7FA 4G6TB 2ESNA 3K0LA 2LY9A 1IW7F 1DPUA 2RNJA 3A4CA 3OYHA 2OPTA 1OCCH 2E60A 2FBHA 1YFHA 3W6KB 4AU7A 1JKOC 1T38A 2DTRA 3PM1A 4HSRA 4YIFA 4KFCA 1QU3A 2GOMA 4ENMA 2CWEA 5F04A 4I6ZA 1R4NB 5H6RA 1AWCA 3C7JA 2CGPA 1FBUA 4X1EA 5LD2C 3ZN1A 1PUFA 3VSLA 3WTTC 1H89C 2QSGX 3K1NA 1NG7A 1WPKA 2EWNA 3KFWX 4MFEA 1I50J 1MIJA 2DA2A 4BL0B 2FSWA 3KP4A 2R7VA 1ETWA 3IP4B 3L7WA 3KYDB 1N77A 3ULQB 5DS9A 3S15J 5ICEA 1LDKB 3CUOA 1HBXG 1VQ9I 1WH7A 3ELKA 3O8GA 4HDVA 2CU7A 2FBKA 3HC7A 1F1ZA 2OTLI 5IY5H 2ZBKA 3EYYA 2X48A 2LSOA 1ZKGA 2X6WA 3JRGA 2Y75A 2EJRA 4C3JJ 3FMQA 3DKXA 3C3WA 1FTTA 2M7BA 2WA0A 3S1QJ 1LUJB 3EUAA 2V1XA 5J4YA 2ETHA 3MAJA 1FTZA 2X1DA 1KYWA 2MH2A 5A2QZ 3S1MJ 3GVAA 1X19A 1A36A 2YR2A 3KEYA 4I76A 4ZDLA 2E5NA 2KRHA 3A01B 4PFPA 2YU9J 2I10A 4UXNA 3GEZA 2DOFA 1ULYA 2IRFG 2QGUA 1J59A 2HDCA 1I6HJ 4CSWA 2DA6A 4RAYA 2W4SA 4HX8A 5D4SA 2P4WA 1WJAA 1ZARA 1EA3A 2NOJB 2Y0MA 4L9JA 1MBGA 1Z3XA 3BJAA 4BHCA 2IT0A 4KNYA 4Y13A 2CQQA 2XSDC 2HPMA 1RUNA 3QPTA 4HG2A 4J01A 4MQVA 2NS0A 4BY1J 1TW3A 4U7BA 2M5WA 2KJBA 3AG3H 1RKTA 2HNHA 3W6JB 4N0BA 1P7IA 2F4OB 3ABLH 3BCBA 1WCMJ 1T33A 2DMTA 3GMEA 3H36A 4FISA 1G3SA 3DTKA 5DCMA 4CCKA 2WV0A 4II3A 3BLYA 2OZ6A 2X6XA 3GZ6A 4XL9A 5J40A 3WTUC 1MDMA 2C6YA 2FA5A 1XMKA 4ZC3A 3V8KA 1D1AA 1FP1D 1D8KA 4IO9F 4HF2A 1ZH5A 1ZG3A 1D5VA 4ZJZA 3MFKA 3WE3A 3V7RA 1OR7C 5LEJA 5E8GA 3ML6A 1NK2P 4N9HA 2HZTA 4L5EA 2P5LC 2FXAA 3FISA 4NDLA 3E7LA 1X3ZB 3LSGA 2HZDA 3WGHA 4EM1A 4EJUA 1RRJA 1T98A 3KZYA 4XR6A 3CJTB 3E6CC 4DYCA 3CF2A 5F1RA 4NHJA 2YS9A 3I4PA 2E35A 4LB6B 2EFPA 1E0EA 4CYDA 5A2QK 1VQ8I 2WY8Q 1Y0NA 4N4NB 3N05A 2QKLB 3BZKA 2X1CA 3FXKA 2A3SA 1B9NA 3PSIA 1OPCA 4XKCA 2LREA 3WGGA 2FOWA 3T8RA 2WAQN 3P7NA 2V1NA 4QIWN 1LVAA 3OYEA 2L7KA 1ON2A 1QO0D 2H8WA 2H6BA 5FO5A 3H1CA 1WVRA 5GPAA 4IHVA 3E6BA 3QU6A 4UNOA 3ZQGA 2KZGA 3OYAA 2QBYB 4P9UA 2DW4A 3SFIA 3P9CA 1W5SA 3OSFA 1IN7A 2DBBA 2R5ZB 4RGSA 1OCTC 2IGMA 5DYMA 4PFOA 3QP6A 3T5XA 3CLQA 1VQNI 2E7XA 4A3DJ 1HXDA 3OWTA 1RIOH 3ERMA 1QZYA 2QM3A 1DGRM 4KA4A 4XK4A 2DA1A 1WFXA 4I0AA 2ISYA 1ETKA 2V26A 5E1ZB 4B1RA 3HJEA 3KLNA 2PBIA 5J6XA 3KYLA 4EEFG 3WG7H 3HRSA 5D8KB 3Q0VA 2L5QA 1UHWA 2HEOA 3OMYA 5L3EA 1Y56A 4NNJA 3M8EA 3HOUJ 1ETXA 3DKYA 3TOAA 1YE9A 1G4DA 1DUXC 2L54A 2LBFB 1X1DA 1AOYA 4FETA 4OMZA 1P4AA 1R71A 4Y33A 4V19K 1XSXA 4C3HJ 2LKXA 4HNTA 5KAIC 4AYBA 4OOIA 1XG1A 3ZQCA 4E7ZA 2BHZA 1ORKA 2ECCA 4RM2A 5M3FJ 5DM7F 2BVLA 3JRDA 1GVDA 2KT0A 2XAJA 3E97A 3FX3A 3PO2J 1KYZA 1U5TC 1GXPA 2IJLA 4L5IA 3JRFA 5HS9A 3I59A 3OYDA 3V7SA 2HR3A 1FYMA 2MW8A 2YPRA 1MNDA 3KP2A 1XS9A 4BAYA 4MLOA 2BE5F 1U3EM 2R4GA 2GA2A 3QODA 2DCEA 1I39A 1ZN2A 1J9IA 1ZTRA 2FX0A 1B4AA 2W85A 1XGOA 3TKYA 1Z7UA 4WXCA 4PGGA 4XLAA 3RTRA 3FHZA 2Z5UA 4I7HA 5GADJ 5E1WA 1LB2A 4FE4A 3K7AJ 3K1PA 3S17J 5FFZA 3OY9A 4FX4A 5B5EC 2MD0A 3LSTA 5CLSA 4HAMA 3ZQHA 3RI4A 2E2JJ 5DM6F 2PX9A 4P96A 3BR5A 2CUFA 4NC7A 4D1QA 1IRFA 3RKWA 2B9SA 1SFUA 4M9ZA 4I0BA 2HQ5A 2KHMA 2B63J 2IS2A 3MD2A 3W2WA 3IH3A 4XORA 2QA4I 3Q0UA 2OD5A 3C2HA 5L3DA 2LC2A 2LNBA 3OYGA 2M3AA 5HLGA 3GLXA 3DKWA 2Y9ZA 2IA0A 3HUGB 1JHHA 1Y39A 4O5VA 5JFRA 5M5WJ 2KIQA 2K3PA 1ZG1A 2DXIA 1Y1VJ 1FOXA 4RS8A 2WTEA 1K83J 3DCFA 5CVUA 1YITI 4NB5A 1IXCA 3IUOA 4UV9A 2XAGA 3GTOJ 5D5XB 3W2VA 2DJIA 3RQ4A 2D1HA 4NUBA 1TWHJ 3L2RA 4HSTA 2FJ1A 1ZLKA 4P55A 5LGUA 2W24A 1XCVA 3EDPA 4X6AJ 2XF7A 1MSEC 2PN6A 2R7FA 5E20A 3K6GA 4BU2A 4NBQA 5E17F 5CYVA 2HS5A 2BBYA 2LYCA 4KMUX 5DCFA 3K69A 2F6CA 2JSPA 1WWXA 3RSNA 1MNMC 3LFKA 1FSEA 1UHSA 3HKZA 1R22A 1YTYA 4AD9A 1AU7A 1W7PA 5DUIA 3G2BA 5EZHA 1GVJA 5F0CA 4ESJA 1STZA 2ZMEA 2DODA 2OJED 4ABZA 2EB7A 3PFYA 2DYRH 2JPBA 4RGXA 3K4CA 4BXFA 3S3MA 3B6AA 4ZYHA 1MH4A 4HX4A 2J5PA 2RREA 5CPRB 4R8HA 2UUZA 2UXNA 3T0YA 1IDZA 3SEZA 5JLXA 2P5KA 2CW7A 3ZQIA 2XRLA 1J7KA 2XGXA 4OIOF 1OQYA 1U6GA 2A6TA 3PQKA 4A3BJ 1ACIA 2X6YA 2QQ9A 4ENJA 2OCCH 2ZFUA 2VE9A 2K9LA 3K2ZA 1LDDA 5E8IA 2FD5A 1Z9CA 2P7CB 4AIDA 3TO9A 2P81A 2GAUA 3LSPA 3T1BA 1OKRA 4UUTA 2PFBA 4UHTA 3DU5A 3OS2A 5LBQA 5D6FA 1IRGA 3HKZN 5IYBJ 1X3WB 3V8LA 1EH8A 2XPVA 3MCZA 3OS1A 3FXQA 2ZCWA 5BPIA 1R6RA 1WI9A 3KE2A 4FQGA 2L9SA 3TDZC 3GFJA 1X1CA 3ZGKA 1EJ9A 2IBDA 3SZPA 2JWTA 1IF1A 3CC4I 4V2GA 2LH9A 4Y15A 4RB0A 2H27A 1FNNA 1SVMA 3IKTA 4BE1A 4WCGA 2EH3A 3TO6A 4J19A 2K85A 2GIVA 2R3SA 1W36D 4HEA2 4CHUA 3SXYA 3WTWC 3V8JA 3RZDJ 1OMIA 2M1BA 2XGEA 3BG6A 3RCOA 2DT6A 5L3FA 5L3GA 2ACJA 3L2CA 2CUEA 3EYIA 4EQQA 1W1WE 3BR3A 4O3MA 2OV7A 4U0YA 3DWLE 3LMMA 1T56A 5K5QA 1W7PD 1YYVA 1Z21A 1RETA 4OAYA 2E1MB 2GQQA 3F8BA 3GUDA 1AHDP 2YX7A 3WTZA 4DIQA 5FJ8J 1EF4A 4Y4RA 2OF7A 3H9QA 4L9VA 3PO3J 2QSFX 1QVTA 1WGXA 1YJWI 4RLFA 3TP3A 5CVRA 3VODA 2DJNA 2L7FP 3U21A 3A0HC 2KLOA 1QVUA 3VEPA 3ABTA 3WODF 3DBHB 3A02A 2ADUA 4S04A 4RB3C 1IC8A 4RBOA 2M4KA 4M6YA 1JT0A 2UWMA 4CCLA 1F9NA 2HOTA 4XN0A 3T8TA 5CQEA 4B43A 2ESHA 1HSJA 2NVYJ 4G12A 2M9HA 3PNTA 1JKPC 1JTYA 2LRDA 4ZDOA 3G1LA 2DMUA 3HBLA 2CQ7A 3HOTA 2IAIA 1VQPI 2PMZA 3GLLA 3ZMVA 1ZREA 4IEJA 1PDNC 9ANTA 1IRZA 1E2XA 3W6VA 3WU0A 3TO7A 4OMYA 4HPQA 4JBAA 4MTEA 3GTMJ 1RNLA 2JA6J 4B3XA 1D5YA 2CMPA 3FBNB 1PUEE 3MZ8A 1MW7A 4PGHA 3BY6A 2R5YA 5EEHA 1VZ0A 3E5XA 4XKVA 4XONA 4C2MJ 1UHMA 4BQAA 1YI2I 2VXDA 1BJZA 5ICGA 4Y3OA 4ZYEA 1L3LA 5FKLA 2KQRA 3CTAA 2HYGD 1PYVA 3K2AA 5IP6A 3CUQB 1OLTA 2EFNA 2JUCA 2OC6A 2K9MA 3R6SA 2PMZN 3VWBA 4L9NA 5ICCA 4ZTJA 2KIUA 2LKSA 2L2OA 4A3CJ 2Q1ZB 4IZZA 2DFIA 2EFOA 2STWA 3H5NA 3LSIA 4NQWB 2HWVA 1N25A 4JOMA 2H8RA 4HX7A 2XIGA 1CF7B 4ASNA 1F36A 4RAZA 1MMDA 2Y48A 2RQPA 4ZZLA 2DQLA 3DV8A 3ZMZA 1XTAA 5AONA 3GTKJ 1D0ZA 5E3LA 1I3QJ 4XLEA 1T39A 3BG9A 2VONA 1B59A 2WY7Q 4HW0A 3WE2A 2EV5A 1JUSA 2IVMA 1F5TA 4L0ZB 4U87A 2Q2EB 4KICA 1EH7A 4XM3A 4LIVA 2EIJH 4Z2YA 1ZR4A 5K5OA 4BBSJ 1O3TA 1YX3A 4MFDA 5J3LA 3HTSB 4FASD 2CW8A 1B9MA 3AKZA 3ESWB 1JHFA 1QRYA 2XPUA 3C2GA 2JTVA 4K2EA 3I5UA 3L09A 4A0YA 3S16J 3VYSB 1POGA 2WB1A 4AC0A 1L0OC 3Q5FA 5CKTA 2KP6A 1JXSA 2PG4A 4ZTFA 1VNDA 2CUZA 2FMLA 3TDUC 4A6DA 3DPLC 2BW3B 2QCOA 4PJJA 3N97A 2DA7A 5DV5A 4D0PA 1KQ9A 2RV8A 2HOAA 3BG3A 3H0DA 1SFEA 4M72A 2Y30A 3E6MA 3FWEA 3SHFA 4AIKA 1SD6A 2P6SA 2DO7A 3CQZJ 3PNVA 2JRTA 4PJNA 4QLCU 5EGOB 2MFZA 2A6EF 3MVPA 2CG4A 4II2A 2AHQA 4O6JA 4XSZF 2QQBA 3LNQA 3IC7A 1R5GA 5FRNA 1O7FA 3OSGA 3TOBA 2WB1N 5B1AH 5HDKA 1Z67A 3MZHA 2MSYA 2VPLA 1SAUA 3H0GJ 4W1UA 4G7ZF 5J4VA 3GBGA 4S05A 2ZXWH 3EQLF 3W2AA 1OR7A 1PJRA 2HQNA 5EZGA 1WSUA 2OTJI 2VASA 2HQRA 1S7AA 2R0QC 2DPUA 2VC0A 4RB2C 2L9VA 2EZIA 4MGRA 2EFQA 2BY1A 2E1MC 5M3MJ 5E3OA 2D5VA 1FBSA 3E1SA 3FM3A 3OIPA 1XMAA 2YX4A 4E7IA 2MGQA 4XLFA 2DLLA 3WU1B 1NG6A 3ASNH 2XHKA 2LY2A 1FOKA 2AO9A 2BY3A 1S7EA 3OL3A 4PJMA 1RZ4A 4ZYDA 2RKHA 2DFFA 1UG0A 1YRNB 4HLXA 3OIOA 2M4GA 2K9NA 3K10A 1U8BA 1X3UA 2E1OA 4DBQA 4Y52J 1S7OA 1SVOA 2NOGA 2O61A 1T0FA 1MBFA 1Z6TA 3QAHA 1U9OA 4G94A 4GO1A 4MQ9F 1VQLI 4RLQA 3S2DJ 2DK8A 3K70C 1ZLJA 3SDBA 2VI6A 4KT5C 4CCJA 5BQTA 3GTJJ 3O6BB 1MSFC 4PZJA 1QPMA 2BY2A 5AIQA 1U5TB 2N8GA 2R7DA 4N9IA 5FRMA 4D9JA 4UVAA 3DEWA 4BEHA 2D45A 4M3BA 4CICA 3CF5F 2XB5A 2D1VA 3P5JA 1JE8A 4Q4ZF 2RNGA 2RVCA 4M3FA 1YW9A 2XRNA 2X51A 2Z16A 2KDOA 2EZKA 5HDGA 4DGWB 1FYKA 1MBHA 2JVGA 2F2EA 1GT0C 1BIBA 4B8XA 4FHTA 1YS6A 5EEAA 5F0FA 3RQIA 2Z3YA 1REPC 5D5WB 2LY1A 1KU3A 1UELB 3JR9A 3CUQC 1R9TJ 3FXLA 4XICA 2BHYA 4ITVA 1X1PA 4BDZA 1QA6A 4D7NA 4KT6A 1HKSA 3F8MA 3QYBA 4PSWA 3BR6A 3FKJA 4LG0B 1LEAA 2W48A 2R93J 2X6OA 1R23A 5LHHA 2KIFA 2VT2A 4LGWA 4DZJA 2E2HJ 2CW0F 4A3LJ 1WJDA 2CSOA 2W82A 3ONQA 4HF0A 2VBXA 4LFUA 3JAMZ 3IL2A 4ZH4F 4KJZA 4UVCA 3D1NI 2JK3A 2QENA 3CCYA 4HBLA 5J1UA 3A03A 5LHIA 4CYCB 3QYFA 1HF0A 1N75A 3QPSA 3CCJI 2IPQX 1QNTA 4BQQA 3O3KA 5D5UB 2VPRA 5EJCA 1HQCA 1P4WA 2MYSA 3S93A 2NNYA 1SEUA 1ETYA 2ZC2A 2VT3A 3ABUA 2ME6A 1SVLA 1E3OC 3TMOA 2K27A 2IW5A 1R1UA 3M07A 4PJ0C 2LVSA 1MMAA 1JUMA 4EJWA 3A01A 2UV1A 4UUVA 3VOEA 4LG3A 2L7ZA 4Y17A 2IXSA 1VQ4I 4LB5A 2E1NA 1RC9A 3CP2A 5F64A 2W7NA 2XROA 3QWLA 2Z1DA 4IPAA 5IOYA 2QF7A 3FK7A 4A3MJ 1H9GA 3F3XA 1FOYA 2VOPA 2FNPA 4YFNF 2X0LA 4BJ6C 4LLNA 3QRFF 3LSHA 2VKDA 5KNLA 1UJ8A 2YU3A 4ENNA 2HXIA 1GDTA 2NS7A 4KMFA 3G71I 5C4XJ 1XSVA 1E17A 2VJJA 2QKMB 2QQAA 4BY7J 4IQJA 3FDYA 4UB6C 1BW5A 1JI8A 1APLC 1YS7A 3J81Z 5IT9Z 1YW7A 1RR7A 2DU9A 3R60A 4RA2A 1BA5A 4RAGA 1IN6A 2QYOA 1YG2A 2JPCA 3U1DA 1VI0A 2XGDA 1KA8A 5IYCJ 4XLPF 2NVQJ 4J00A 2JA7J 3OOPA 2X85A 2VBZA 3JAMK 4DOZA 1D3YA 4BUPA 1LQ1A 1MNEA 1DU6A 2E5ZA 2FE3A 2HOEA 1IUFA 1Q1VA 4PK4A 1G6NA 1ZRCA 3CP8A 2K40A 1DP7P 3GFIA 3IAS2 4QPQA 2GIZA 2DA4A 3BG5A 2EIMH 3WTSC 1D1CA 2E36A 3AG4H 4HF1A 1ETQA 2A69F 1QPIA 1N78A 3EETA 1LDJA 2K4JA 1B72B 5CJ9A 1GV2A 4LK1F 4M9XA 3HB9A 3ZMSA 2V79A 1WKMA 3HOSA 3BZ6A 2EPFA 3HRTA 4N4OB 2O0YA 3HSRA 1HW5A 2F5CA 3CESA 3V7CA 3G73A 1XX5A 3QU3A 1LE8B 1XGNA 2KISA 1IRXA 4LLLA 1FPQA 3UR3C 2HDDA 3IAM2 1X4OA 1Y0UA 1Y8QB 5FD5A 1USSA 2RGVA 4WWCA 1UG2A 1I1GA 2F4IA 3N4MA 5LRRA 1U78A 4M3GA 2EA4A 2QBYA 4LK0F 4C30A 2QVOA 4M3DA 3HEFA 3H9GA 1IXSB 3MEXA 5ERIA 2M45A 2DT7B 3VYUB 2R5ZA 1YX5A 3DLAA 2E34A 3GZNB 1ZGJA 4XQFA 1SFOJ 2R7XA 2I5UA 4I2OA 1IGNA 4MIMA 2ZB9A 4CCNA 1DU0A 2JQ7A 2MA3A 3J81K 1HW1A 5IT9K 1X1AA 2GZWA 2J5OA 5TJJA 3ZXSA 2ZSIB 2ZNYA 3CJQB 4OWRB 2DA3A 3J7AO 3F21A 1G59A 1VFCA 5ED4A 1KQ8A 2KZVA 2LLKA 5IP9J 2R7UA 3G3ZA 3ZQFA 2CH0A 2XDVA 4M9SA 4FT8A 1FMVA 4B09A 3GTQJ 2ECBA 3S1NJ 1MJ9A 4AYBN 2WV1A 1DGWY 4CXFA 3OYBA 4OU0A 2LBFA 5CQGA 3BTJA 1BR2A 2OA4A 3KETA 4AUXA 4IKFA 3I0TA 1KQ0A 1Y1WJ 4XKBA 4DNCA 4E7JA 2JJ7A 4S0HB 1TQIA 3O2PE 3OV8A 2EZLA 3MN2A 4BQOA 2CV1A 5KAFC 1K61A 1QHHD 3FM5A 4YELA 2FNAA 1TQMA 2BGCA 3S2HJ 3M9AA 4BXXJ 2EZHA 1TNTA 3R0JA 5J47A 5LHGA 2DAOA 1PP7U 3DEUA 1EV7A 1K79A 3ZOBA 2W00A 1V4RA 2DDBA 3WU2C 2CFXA 5L3CA 1FX7A 4BH9A 1XGMA 5CVVA 1DQUA 2A61A 2IS1A 2KRFA 3CC2I 2L0KA 2CFOA 1VTNC 1GXQA 3PSFA 4M6XA 2STTA 2GXBA 2PJRB 4BHPA 1HKQA 4HQEA 5IP7J 4D5CA 2Q0OA 1X4PA 3FXUA 2NVUB 2LF7A 3ECHA 1W0UA 2AQFA 4U0VA 3CMMA 3IWFA 3LSJA 3I4NJ 2IA1A 2NVXJ 4OIQF 1V5FA 2CQNA 1O4XA 2E19A 4UUSB 1SFXA 3L2VA 1FEXA 4JK1X 4IRIA 2GWRA 1AKHB 4BHBA 3KX2A 2EBIA 1TTYA 3BWGA 3DPTA 1X2MA 3LAPA 2K02A 4C2TA 4KIBA 4G7HF 3L2QA 1K4SA 5HLIA 3HUGA 4CZZA 3QP5A 3ERED 2FU4A 3SJMA 1QZEA 1RESA 5LLQA 1D1BA 2DFHA 3LWFA 4OAZA 3TBIA 1SAXA 1PVEA 5HOOA 2F4MB 2K5CA 2LF8A 2IEKA 3JRCA 4M73A 5FFXA 4F92B 3EUHC 2ZXIA 3FXJA 1R1VA 4WXHA 3RKQA 2VKEA 3MKLA 1LNWA 2BVMA 2VJ4A 3LA2A 3DXJF 3VSKA 1TWGJ 2CRGA 1MBKA 2CO5A 4KIGA 1IUYA 4H4KC 1Z7LA 2OBPA 4XOTA 4EGYA 4PCQA 4BJ5C 4RDUA 2CQKA 5DDGA 3NWSA 3H5AA 1IO2A 5HDNA 3I9V2 4LJZF 3WHBA 4UUSA 3F72A 2XKOA 1V5GA 3RKXA 1K4TA 2XSJC 1A31A 4QTRA 1CQTA 2LOOA 3QOEA 2BEOA 1SMYF 4IRHA 4I98B 5KVRA 2VJIA 2NAZA 3F6OA 2A5YB 2OQGA 1DDNA 2FEZA 2MH9A 2K9SA 2O5RA 3F0CA 2BXZA 2DMPA 3NRVA 3F23A 1Z6RA 4IOCF 3L00A 4CCOA 4I99C 2EV6A 3HM5A 3OYLA 5IPAA 4L5JA 3BT9A 1K6YA 5DUKA 3WTXC 1XN7A 2BXYA 1H88C 4GFBA 4OIRF 2O6GE 3J7AY 1B1BA 3VPRA 4IOAF 3LSKA 4PJLA 2MC3A 2V9PA 3JW4A 3D0SA 4LOCA 5BPDA 3QPHA 3UNGC 4AWXB 1MKMA 1WHUA 3CJNA 3F22A 4L18B 5IOZA 1FJLA 3FXRA 2LFBA 4HYEA 3DTEA 3IWZA 2R7RA 4GYGA 4IHTA 4KITB 2O8KA 1KU2A 4D5FA 5FKNA 2M87A 3CC7I 3M4OJ 4TV7A 5F6FA 4EM2A 2RN7A 4IVNA 1TL8A 2HDWA 3BQZA 4B44A 4HLYA 1YW8A 3LQRA 1T2KA 3Q3SA 2ZJQF 2JA5J 2ME0A 1LFUP 3VDXA 3DPUA 3RPUA 3I64A 5GAEJ 1FC3A 1NK3P 1G3WA 1LVKA 3B73A 1FMWA 1HA8A 3MMYB 1LJ9A 3ZQQA 2L9RA 4F55A 4IJAA 3G6EI 2IGNA 1TT5B 2XAQA 4CGZA 1BIAA 2V7FA 4CO8A 1ETOA 3OYCA 1W36C 2A68F 1GLNA 4ZYGA 4OIPF 4M74A 3CCRI 1LPQA 1X58A 2H6CA 4E6KG 3O8HA 1LEBA 4UB8C 1MBEA 2KIMA 4BXUA 2E1CA 2NXNB 2AS5F 3ZR8X 1E3HA 4A3KJ 5HNFA 1BR1A 4U0WA 2XV4S 1Z3YA 4XSXF 4XN3A 5C44J 3WHCA 2HTJA 2ZMEC 5GAHJ 5FLXZ 2IA2A 2OU2A 5EG0B 1ERDA 5H2FC 2VB6A 3RPQA 2QSHX 2UZKA 5FKOA 4DQ2A 1SMTA 2CS3A 1HDPA 2K7LA 1FP2A 2XKPA 3D5SC 5TISC 3ZQ7A 2O03A 3F8CA 3FXMA 1K78B 1IG7A 2E71A 3H3ZA 2QWWA 3SQNA 3MWMA 1P2FA 2Y31A 1BI3A 2VL8A 4B48A 1X2NA 1ODDA 2PJPA 4GGGA 3D5RC 5FKKA 5KK1A 1O3SA 1ZYRF 4BQNA 4IF4A 2WAFA 2MLGA 4NC6A 2HVSA 2EFWA 1P9QC 1HDDC 2K9QA 2K3FA 4M6VA 1YO5C 1KU7A 1F4KA 2PMUA 3BQYA 4IHSA 2P0WA 2DT5A 3RPUD 1A5JA 3FKIJ 3NWTA 3WTYC 1G8XA 2XF5A 3HL2A 2L9NA 2KFDA 3CUQA 5GPCA 2HQAA 4XLNF 5M5XJ 5K5RA 1J0RA 1BR4A 2X1EA 3L9FA 1JKQC 4G6DA 2ZJ2A 1Z91A 5M5YJ 2PLYA 4RAFA 1B6AA 2ELKA 3OR2C 3ZN0A 1XC5A 1FOWA 3CDLA 4NQWA 3IHUA 3FBIB 3ZP5A 3FMRA 4L9TA 2G0EA 3HOWJ 4DJAA 4P1WA 5H20A 2OQRA 1NH3A 1CF7A 2MLKA 2COMA 3EUKL 4BGDA 2Z2SB 4KDPA 3BCAA 2Y0SA 2FUG2 2M8GX 2LR8A 3BC8A 5EEGA 3ASOH 3LQQA 1V54H 3JSOA 1UB9A 5GAGJ 3BR2A 2FQ4A 5IYDJ 4HZFA 3CCSI 4AVZA 2EQRA 3BG7A 1S9HA 2VQGA 5GTHC 1U8RA 2L01A 3CCUI 3C18A 2IGOA 5FLXK 4OINF 3DBLB 2Q2EA 4CH7A 3PIPF 2CQXA 3K70D 3BJOA 1KONA 2IS4A 1RKWA 2DQRA 4B3AA 3M8JA 3LAJA 1FY7A 2L4AA 4EATA 2QZ8A 4JP0A 2DYSH 5HLTA 1BC7C 1V3FA 3A0BC 1T8IA 1VQKI 1PUFB 1V5EA 2ID6A 3BZCA 5CVJA 2A6HF 4MNUA 4BE2A 2FF4A 2FMYA 3FXOA 2Y0SN 1TZLA 2HKXA 3IH4A 1NTCA 2LMDA 1O3QA 2EIKH 2ZKZA 3ZQLA 3BTLA 2TCTA 2F5FA 3GTLJ 4WF2A 1RPWA 2Y69H 1QBJA 2RAEA 1QZZA 2DA5A 1SD5A 1E3PA 3C1DA 2BW3A 1G3TA 1OCPA 3GYHX 2VKVA 3HGYA 3LL7A 3E0JB 2M0MA 5JHUA 5EF6A 4ZYAA 3P9IA 1HCRA 1YIJI 2P7VB 3RZOJ 1BW6A 3J80Z 3KEOA 5EGOA 1ZG5A 5BNGA 2L4MA 4X0GA 2QQ8A 3BTCA 3CLOA 3ECOA 2EINH 1VQMI 4MO7A 5LGNA 1FBQA 1MJBA 1S8NA 2OCEA 4AIHA 5JLWA 5K7HA 3K4BA 4XMYA 2F5VA 1D8JA 4H0EA 2V6EA 2CJJA 4HV5A 2LG4A 3TL4X 3ZMDA 4W97A 5DTDA 3Q9SA 2NRAC 1W5CC 2W57A 2WADA 2PMHA 1WJ5A 3SDGA 2E7WA 3REOA 3CJRB 1U2WA 4XNFA 5H6QA 4XIDA 2MBFA 3K4JA 2DOAA 4RGRA 2MABA 2HOSA 4ETSA 1JTXA 3WG9A 2FQ3A 3L2WA 4RM3A 2V9KA 4GYIA 1IV8A 2A07F 1YRNA 3K9TA 5DCMB 3R0AA 3VB2A 3A1YA 4EV0A 5J8CA 1R1TA 1IV6A 2M7AA 3B6CA 1ZGAA 4KN7X 4QPOA 3H3VK 1J2XA 1JT6A 2P5VA 1MDMB 1ITYA 1TC3C 2GA1A 5CVIA 1K6OA 1DP3A 3HTUA 1XPXA 3KPHA 3W3CA 1LFBA 4A3JJ 2GXGA 3LSMA 3I55I 5B1BH 2VODA 2DMNA 3MQ0A 4CA0A 2DK5A 2Z99A 3ABKH 1BC8C 3FIWA 3LSRA 2TDXA 1U5TA 3GZ5A 3KZIC 3H35A 3K4LA 3OYFA 3I3LA 1IZ1A 2VLAA 3J80K 3AG1H 5BMZA 2IP2A 1SD4A 4XLHA 2R92J 1U9NA 3K1MA 3DP7A 2DTZA 4Y7NJ 3NEUA 1RR8C 3IRQA 2KJCA 1A35A 3OYMA 3RYPA 3BR0A 3GTPJ 2NNNA 3U2RA 4DBRA 1SC7A 3F8FA 1F43A 3F6VA 3PQJA 3HPGA 1KGSA 5K7ZA 4IHYA 5FKMA 4HNUA 3JRBA 1SFKA 3E3VA 1WI3A 3AL0C 2JZYA 3M7GA 4LIUA 2MG4A 5ILUA 3NAUA 4I01A 4B4CA 1ZRFA 2WAQA 2MD5A 5C4JJ 1BM9A 4R1HA 2LP0A 3I56I 2HPIA 5JVTA 5FLVA 4M3EA 1A04A 4LG0A 3LFUA 3RDIA 1HC8A 2AXTC 3HRMA 4BNCA 1YQAA 1JGGA 5J8FA 2Z9OA 1MBJA 2OZUA 3JRHA 4EMSA 1R36A 5F08A 1HKTA 2BV6A 1P4XA 3BDDA 1BJAA 2WC2A 3M1EA 3QYEA 1WH5A 4M71A 1R00A 1OCZH 4AM3A 5FD6A 2XB0X 4G6QA 1MMGA 1V55H 4CYCA 2O9LA 1FZPB 4IHWA 2M34A 2F5DA 3PL8A 4AVPA 1OJLA 5C3EJ 1PP8F 3HOZJ 2XUBA 1I5ZA 2FOKA 2HVQA 3L2UA 2HGCA 1ONVA 1XDSA 2QUFA 1HLVA 3K4KA 4YRVA 5DEQA 1TP4A 5TRDA 2ZO4A 3KP5A 3MKZA 5IT3A 1T0FC 1OYIA 4G9YA 1MZBA 2XPWA 4LMYA 3MZYA 3S14J 3BPVA 3CO6C 5LEKA 3BP8A 3RJPA 4HQMA 4HNVA 2DMQA 3HHGA 4F3QA 2V1UA 4KYWA 1M1EB 2KDZA 4KN4X 4YFKF 1Z0XA 2H94A 3I59B 3CDHA 1HSTA 3IH2A 2KL4A 1IN5A 3QQAA 4UVBA 2XAHA 3ZMTA 4EJOA 4F93B 1J75A 2KKOA 2RQQA 3GCMA 4LD5A 5KHDA 4ESFA 2JMWA 2X9DA 3HOYJ 4DZPA 1OCRH 2NS8A 2TRTA 3SEQA 2HTSA 4E4HA 3HGGA 2LD5A 4C9YA 2XC7A 4NC8A 4HA8A 2GM4A 1G2HA 1OCOH 3PUBA 1C0WA 1P6RA 1NHAA 2W1OA 2W84A 3JREA 4A6EA 5JVGF 3EUHA 3ISPA 3KP7A 1YJNI 1QGPA 5E1XA 3U9GA 3EPZA 2VOOA 2LKPA 4ON0A 1MGTA 2XAUA 5ILVA 5AIPA 5L3BA 3CD6I 2ISZA 3HSFA 4HRIA 4ZDPA 5E79C 2QLZA 2JVHA 4UY8I 1XMXA 2EILH 3D5LA 1S3JA 3KCCA 4IHXA 2V9VA 1H8AC 2JSCA 4P9FA 1B72A 2ELJA 2V6CA 1OISA 3DF8A 3B02A 3HSEA 3JCUC 3BR1A 3H9JA 1WJCA 4XKWA 2G9WA 1VF9A 4ENKA 1XCBA 3I53A 2DFEA 2Y9YA 3I54A 1TWFJ 1LE8A 3U1KA 2ZFWA 3G4SI 2W25A 4KISA 3DQVC 2A05A 1GHCA 3E5UA 3GX4X 1WJBA 3KYCB 1YHQI 4EM0B 2DI3A 1KZHA 1XDUA 2VKHA 2RC4A 3PNYA 1T08B 4A69C 3E6DA 1JUPA 2ZSHB 3JRIA 3MKYB 1WJFA 1ZGWA 3GFMA 1ETVA 1RI7A 2I8DA 2O3FA 2VIXA 1D0YA 2M0CA 2RDPA 3K4MA 1W5TA 1U0JA 1BI0A 4A3GJ 5D5VB 3L1PA 4YG2F 4WXDA 4EJTA 5FROA 1Y8RB 1W7PB 2XF6A 3RYRA 4BS9A 3R61A 1TQPA 1O3RA 1WQ2A 2P8TA 3G1OA 2JT1A 4U88A 2CV0A 2HYFA 2ZMEB 3TW6A 2JUGA 3KP3A 1TLHB 3OYNA 3GW2A 2FRHA 1BL0A 3KEQA 1A6IA 2QEXI 2IGKA 2BYVE 1FYLA 2EA2A 4CCMA 4HDUA 2D2WA 2HU9A 1RUOA 2JRMA 5E3MA 1I3AA 2ZXHA 3M3YJ 3HHHA 1YLFA 3TP0A 3J7YJ 4A0XA 3DEEA 4WX9A 1XB4A 3AAFA 3S32A 5HNHA 3X2QH 5HODA 1JKRC 3S8PA 2ELHA 4XOPA 4BE0A 1S29A 4LITA 1TBXA 3HPHA 4XRSG 1FWZA 3JRAA 1LFPA 3ABMH 4A12A 1A6QA 5EDNA 3CCQI 4DYQA 3HDDA 1CGPA 5D6EA 3S3OA 1UCRA 3PFIA 4Q5SF 4XBFA 4GRIA 4BJTA 4BYYA 1FIAA 1ZK8A 3KZZA 2VBYA 4A5MA 2MC4A 3GF2A 4BDYA 5F1JA 2KPMA 1WRJA 3DLLF 3ZCOA 3F9KA 5D4RA 1BOBA 2VBWA 3OYKA 1R5HA 2XAFA 4G8XA 4A5NA 1T6SA 4YIIA 1ZAOA 1UFMA 2PEXA 3COAC 2L3DA 2R7QA 2JN6A 4CZCA 4MEYF 2VUMJ 1FLIA 2ZJRF 4QWQA 4JX6A 2PJRA 1ZRDA 3SYTA 2BOLA 1Y6IA 3Q9VA 5B3SH 2CUJA 2M30A 4RGUA 1O57A 2O7OA 3GWZA 2OUMA 3HG9A 3A2KA 2P6TA 3AG2H 3PUFA 1R4MB 4YEJA 1BBYA 1W0TA 3VYTB 3IRRA 2HXOA 3FF5A 3DFGA 4ANJA 3UKGA 1AA7A 2F5EA 1R49A 2DN0A 2JA2A 2O8XA 1UZCA 1AKHA 1BI2A 1H9TA 3CMYA 1QHGA 2OAZA 3JTHA 4P5OA 5HS8A 1VQ5I 1IN4A 1YIOA 5DD4A 4D7MA 4EJVA 1BI1A 4XRSA 4FE7A 2M2EA 5KCMA 4F91B 1B8IB 2A5WA 3CZ6A 5ILSA 1XD7A 5F0HA 2ZXJA 1Q1HA 3OS0A 1EKEA 5E18F 4E7HA 3SZTA 3TQNA 4IL6C 3OIQA 2AXLA 1I1SA 3P9KA 5DD8A 4C3IJ 3CO7C 3CCMI 2Z33A 3FMSA 5J1RA 4GXOA 1MH3A 2V1DA 3C2BA 3M8FA 2R7WA 3I71A 4FX0A 1Z77A 3KIOA 3TW7A 1IAWA 2K4BA 2ID3A 3CMAI 4L0YB 5BOXA 4PSXA 2R7TA 5HVQC 3CCVI 1USTA 2VXZA 4Z6YA 1K7AA 3CCEI 3QPLA 1TWCJ 4JX5A 2R5YB 2BZTA 1H0MA 2HYJA 2LK2A 3LA3A 1I6XA 2VJ5A 3H3UA 4Q47A 3AFHA 3HXLA 2NYXA 3MKWB 2BY0A 3GO5A 2VQLA 1W4MA 4U7DA 2L7MP 2Y2ZA 1BOAA 1IJWC 2R7ZJ 1O7LA 3TEDA 6PAXA 1LKXA 3DU6A 3HOVJ 3E5QA 3G1MA 5FB2A 3LOCA 3LA7A 4G7OF 4I02A 2HFHA 1B8IA 1OYYA 1DPRA 1TWAJ 3BOQA 1X1BA 1JJ6C 1VQ7I 4A2UA 2M8EA 2B7EA 4FTHA 2DOEA 2KRCA 3F8NA 2F48A 2G7HA 1WJEA 2XVCA 3VYRB 4BBRJ 1ENHA 4EVIA 4A3EJ 4JQFA 2ZNZA 3KLOA 5D8LB 1ZHFA 1R5ID 3GXOA 1JJ8C 2CYYA 3S3NA 2HKOA 3BJ6A 4QSHA 3S2WA 2JA8J 1J09A 1WZ2A 4JYKA 3DTIA 4XRMA 3K4NA 4YFXF 4EGZA 4A3FJ 3JTGA 2WAEA 3Q0WA 2CV2A 2PQ8A 3NQOA 2COBA 4CUGA 2Q8KA 3TGNA 1FSHA 5J1YA 1P7JA 4IQ4A 4A3IJ 1D0XA 1BN5A 4IX7A 2VN2A 1HW2A 3GFLA 4E7KA 3HZJA 1P92A 4CDGA 2KMUA 2WBMA 1ZR2A 1SD7A 1GV5A 1ZELA 3IV5A 3V42A 5HS7A 5BS6A 3R4KA 1OFCX 5E3NA 5FLMJ 3OYJA 1GUUA 1MMNA 1ZQ3P 1R58A 3CCLI 3OL4A 4KUMA 5LRSA 4MHGA 1EH6A 5FGMA 4B47A 4DW6A 1TNSA 2H09A 3HOXJ 4E7LA 4DYRA 1VQ6I 1G3YA 2H1LA 2XGCA 2XASA 4UV8A 3ZMUA 5B66C 3FHNA 2ZJPF 3NARA 1IXRC 2NVTJ 4E7SA 1YOVB 4FCYA 4PUSA 5LGTA 1SANA 2YSRA 1HOMA 3GTGJ 5LFAA 3BTIA 4BKXA 5JR3A 4HOBA 5GTIC 3WGIA 3IKVA 2PI0A 3PIOF 1R7JA 1MJAA 2EK5A 4RB1A 4Q48A 3RKYA 4GCVA 1YJ9I 3AL0B 2FBIA 4A93J 2V4JC 1I27A 2GOXB 2R7OA 2E2IJ 3H5RA 4IRGA 2UXXA 3FK6A 3HIFA 3OOUA 4R79A 4JX4A 3ZRGA 5HLHA 5EG0A 1MMSA 4WK8F 1IDYA 3DBRB 1IN8A 1VQOI 2LDUA 3BROA 4E70A 3V4GA 5F27A 3WTVC 5JHFA 3SZGA 4XRFA 4BACA 2VQHA 4RMNA 1S6LA 2L02A 4XLCA
chains in the Genus database with same CATH topology
3I58A 3VFZA 1K78A 4ZZDA 1OYWA 1JGSA 5ICFA 4F7ZA 2X4HA 1ON1A 1XGSA 1Z1DA 4IXAA 2WWYA 2VE8A 4ESBA 4PDKA 2B0LA 3H92A 1QQIA 3QOPA 3JSPA 1Z05A 3HRUA 4I09A 2VC1A 1KU9A 1TW2A 3KP6A 2DPDA 1XSDA 5JI6A 4HV6A 2K86A 3BPXA 2G7UA 3FZVA 3HYIA 1J5YA 4A0ZA 4MTDA 4LLGF 3SFZA 3RIRA 3ROUA 2EV0A 5K1YA 1MD0A 3ZPLA 1FT9A 4KIFA 4AIJA 2ESNA 3K0LA 1IW7F 1DPUA 2RNJA 2FBHA 1YFHA 3W6KB 1T38A 2DTRA 4KFCA 4YIFA 4ENMA 2CWEA 5H6RA 1AWCA 3C7JA 2CGPA 1FBUA 3ZN1A 3WTTC 3K1NA 2EWNA 3KFWX 2FSWA 3KP4A 3L7WA 3ULQB 5ICEA 1LDKB 3CUOA 1HBXG 3ELKA 4HDVA 2FBKA 1F1ZA 2ZBKA 3EYYA 2LSOA 2Y75A 2EJRA 3FMQA 3C3WA 2V1XA 2ETHA 3MAJA 1KYWA 2MH2A 5A2QZ 3GVAA 2YR2A 4UXNA 3GEZA 2IRFG 1ULYA 1J59A 2HDCA 4RAYA 4HX8A 5D4SA 2P4WA 2Y0MA 1ZARA 4MEXF 4L9JA 3BJAA 4BHCA 2IT0A 4KNYA 4Y13A 1RUNA 3QPTA 4MQVA 2NS0A 1TW3A 4U7BA 2M5WA 2KJBA 3W6JB 4N0BA 1G3SA 5DCMA 2WV0A 2OZ6A 3GZ6A 3WTUC 1MDMA 2C6YA 2FA5A 1XMKA 3V8KA 1FP1D 1D8KA 4HF2A 1ZH5A 1ZG3A 1D5VA 3MFKA 3WE3A 3V7RA 5LEJA 5E8GA 3ML6A 4N9HA 2HZTA 2P5LC 2FXAA 3WGHA 4EM1A 4EJUA 1T98A 3KZYA 3E6CC 5F1RA 4NHJA 3I4PA 4LB6B 2EFPA 4CYDA 5A2QK 2A3SA 1B9NA 1OPCA 3WGGA 3T8RA 3P7NA 1LVAA 1ON2A 1QO0D 2H6BA 5FO5A 3E6BA 3QU6A 4UNOA 2QBYB 4P9UA 2DW4A 3P9CA 1W5SA 1IN7A 2DBBA 4RGSA 5DYMA 3QP6A 3T5XA 2E7XA 1HXDA 1RIOH 1QZYA 2QM3A 4KA4A 4I0AA 2ISYA 5E1ZB 3KLNA 2PBIA 5J6XA 3HRSA 5D8KB 1UHWA 2HEOA 5L3EA 3M8EA 3TOAA 1G4DA 1DUXC 2L54A 1AOYA 4OMZA 1P4AA 1XSXA 4OOIA 2XAJA 3E97A 3FX3A 1KYZA 1U5TC 1GXPA 2IJLA 4L5IA 5HS9A 3I59A 3V7SA 2HR3A 1FYMA 2YPRA 3KP2A 4BAYA 2BE5F 1U3EM 2GA2A 1J9IA 1ZN2A 1B4AA 2W85A 1XGOA 3TKYA 1Z7UA 4WXCA 4PGGA 3RTRA 3FHZA 2Z5UA 4I7HA 5E1WA 1LB2A 3K1PA 5FFZA 4FX4A 3LSTA 5CLSA 4HAMA 3RI4A 4P96A 1IRFA 3RKWA 1SFUA 4M9ZA 4I0BA 2OD5A 5L3DA 2LNBA 5HLGA 3GLXA 3DKWA 2IA0A 1JHHA 4O5VA 5JFRA 1ZG1A 4RS8A 2WTEA 5CVUA 4NB5A 1IXCA 4UV9A 2XAGA 5D5XB 2D1HA 1ZLKA 4P55A 5LGUA 2W24A 1XCVA 3EDPA 2PN6A 2R7FA 5E20A 5E17F 5CYVA 2HS5A 2BBYA 4KMUX 5DCFA 3K69A 1WWXA 3LFKA 1FSEA 1YTYA 1R22A 4AD9A 1W7PA 5DUIA 1GVJA 4ESJA 1STZA 2ZMEA 2EB7A 2JPBA 4RGXA 4ZYHA 4HX4A 2J5PA 4R8HA 2UXNA 3T0YA 2P5KA 4OIOF 1J7KA 2XGXA 1U6GA 3PQKA 2QQ9A 4ENJA 2VE9A 3K2ZA 5E8IA 1LDDA 1Z9CA 2P7CB 3TO9A 2GAUA 3T1BA 1OKRA 2PFBA 4UHTA 5LBQA 5D6FA 1IRGA 3V8LA 1EH8A 3MCZA 3FXQA 2ZCWA 5BPIA 1WI9A 3KE2A 3TDZC 3GFJA 3SZPA 1IF1A 4Y15A 4RB0A 2H27A 1FNNA 3IKTA 4WCGA 3TO6A 2GIVA 2R3SA 4CHUA 3SXYA 3WTWC 3V8JA 1OMIA 2M1BA 5L3FA 5L3GA 2ACJA 3L2CA 3EYIA 4EQQA 4O3MA 4U0YA 5K5QA 1W7PD 1YYVA 2GQQA 3F8BA 3GUDA 2YX7A 3WTZA 4L9VA 3VODA 5CVRA 3VEPA 3ABTA 3WODF 4S04A 2ADUA 4RB3C 4M6YA 2UWMA 1F9NA 3T8TA 2ESHA 1HSJA 3HOTA 3ZMVA 1ZREA 1PDNC 1E2XA 3WU0A 3TO7A 4OMYA 4JBAA 4MTEA 1RNLA 1PUEE 4PGHA 3BY6A 5EEHA 3E5XA 1UHMA 4BQAA 5ICGA 4ZYEA 1L3LA 3CTAA 2HYGD 3CUQB 2EFNA 3R6SA 4L9NA 5ICCA 2KIUA 2DFIA 2EFOA 2STWA 2HWVA 4HX7A 2XIGA 1CF7B 4ASNA 4RAZA 2Y48A 2RQPA 4ZZLA 2DQLA 3DV8A 3ZMZA 5AONA 1T39A 2VONA 1B59A 4HW0A 3WE2A 2EV5A 2IVMA 1F5TA 4L0ZB 4KICA 1EH7A 4Z2YA 5K5OA 1O3TA 3HTSB 1B9MA 1JHFA 2JTVA 4K2EA 3I5UA 3L09A 4A0YA 1L0OC 3Q5FA 1JXSA 2PG4A 2FMLA 3TDUC 4A6DA 3DPLC 3N97A 5DV5A 4D0PA 1KQ9A 2RV8A 1SFEA 4M72A 3E6MA 3FWEA 3SHFA 4AIKA 1SD6A 2P6SA 2DO7A 2JRTA 4QLCU 2A6EF 2CG4A 4O6JA 4XSZF 2QQBA 3IC7A 1R5GA 1O7FA 3TOBA 5HDKA 3MZHA 4G7ZF 4S05A 3EQLF 1OR7A 2HQNA 1WSUA 2HQRA 1S7AA 2DPUA 2VC0A 4RB2C 4MGRA 2EFQA 1FBSA 3FM3A 1XMAA 2YX4A 2DLLA 3WU1B 2XHKA 1FOKA 1RZ4A 4ZYDA 2RKHA 4HLXA 1X3UA 1S7OA 2O61A 1T0FA 1Z6TA 3QAHA 4G94A 4GO1A 4MQ9F 2DK8A 1ZLJA 4KT5C 5BQTA 3O6BB 4PZJA 1QPMA 5AIQA 1U5TB 4N9IA 2R7DA 4UVAA 2D45A 4CICA 2D1VA 1JE8A 4Q4ZF 2RVCA 1YW9A 2XRNA 5HDGA 1FYKA 2F2EA 1BIBA 4B8XA 4FHTA 1YS6A 2Z3YA 1REPC 5D5WB 1KU3A 3CUQC 1HKSA 3F8MA 4LG0B 1LEAA 1R23A 5LHHA 2KIFA 2VT2A 4LGWA 2CW0F 4HF0A 2CSOA 2VBXA 4LFUA 3JAMZ 3IL2A 4ZH4F 4UVCA 2QENA 4HBLA 5LHIA 2IPQX 1QNTA 3O3KA 5D5UB 1HQCA 1P4WA 2NNYA 2VT3A 3ABUA 2K27A 2IW5A 1R1UA 4EJWA 4UUVA 3VOEA 4Y17A 4LB5A 2E1NA 5F64A 2XROA 4IPAA 1H9GA 3F3XA 2VOPA 2FNPA 4YFNF 2X0LA 4LLNA 3QRFF 4ENNA 2YU3A 4KMFA 1XSVA 1E17A 2QQAA 1YS7A 3J81Z 5IT9Z 1YW7A 2DU9A 3R60A 1IN6A 2QYOA 1YG2A 2JPCA 3U1DA 1KA8A 4XLPF 3OOPA 2VBZA 3JAMK 1D3YA 1LQ1A 2FE3A 2HOEA 1G6NA 1ZRCA 1DP7P 3GFIA 3WTSC 4HF1A 2A69F 3EETA 1LDJA 2K4JA 5CJ9A 4LK1F 4M9XA 3ZMSA 2V79A 1WKMA 3HOSA 3BZ6A 3HRTA 2O0YA 3HSRA 1HW5A 2F5CA 3V7CA 3G73A 3QU3A 1XGNA 4LLLA 1FPQA 1Y0UA 5FD5A 1USSA 2RGVA 4WWCA 3N4MA 1I1GA 5LRRA 1U78A 2EA4A 2QBYA 4LK0F 2QVOA 5ERIA 1IXSB 3MEXA 2M45A 1ZGJA 4I2OA 2MA3A 3J81K 1HW1A 5IT9K 2GZWA 2J5OA 5TJJA 2ZNYA 3J7AO 3F21A 5ED4A 1KQ8A 3G3ZA 4M9SA 4FT8A 4B09A 1MJ9A 4CXFA 4OU0A 2OA4A 3KETA 3I0TA 1KQ0A 4DNCA 1TQIA 3O2PE 3OV8A 3FM5A 2FNAA 1TQMA 2BGCA 3M9AA 1TNTA 3R0JA 5LHGA 2DAOA 1PP7U 3DEUA 1EV7A 1K79A 1V4RA 2CFXA 5L3CA 1FX7A 4BH9A 1XGMA 5CVVA 2A61A 2KRFA 1VTNC 1GXQA 4M6XA 2STTA 2GXBA 4BHPA 1HKQA 4HQEA 2Q0OA 3FXUA 2LF7A 3ECHA 4U0VA 3IWFA 2IA1A 4OIQF 1SFXA 4JK1X 4IRIA 2GWRA 4BHBA 1TTYA 3BWGA 3DPTA 3LAPA 2K02A 4KIBA 4G7HF 5HLIA 3HUGA 4CZZA 3QP5A 3ERED 2FU4A 5LLQA 3LWFA 1SAXA 5HOOA 2LF8A 4M73A 5FFXA 1R1VA 4WXHA 1LNWA 3LA2A 3DXJF 2CO5A 4KIGA 1IUYA 2OBPA 4EGYA 4PCQA 2CQKA 5DDGA 5HDNA 4LJZF 3F72A 2XKOA 3RKXA 2BEOA 1SMYF 4IRHA 4I98B 5KVRA 2NAZA 3F6OA 2A5YB 2OQGA 1DDNA 2FEZA 2MH9A 3NRVA 3F23A 1Z6RA 3L00A 2EV6A 4L5JA 5DUKA 3WTXC 1XN7A 4OIRF 2O6GE 1B1BA 5BPDA 2MC3A 3JW4A 3D0SA 3QPHA 4AWXB 1MKMA 3CJNA 3F22A 4L18B 3FXRA 4HYEA 3IWZA 4GYGA 4IHTA 1KU2A 2M87A 4TV7A 5F6FA 4EM2A 2RN7A 4IVNA 4HLYA 1YW8A 3LQRA 1T2KA 3RPUA 3I64A 1FC3A 1G3WA 3B73A 1LJ9A 4IJAA 2XAQA 4CGZA 1BIAA 4CO8A 2A68F 4ZYGA 4OIPF 4M74A 2H6CA 1LEBA 2KIMA 4BXUA 2E1CA 2AS5F 4U0WA 2XV4S 4XSXF 2HTJA 5FLXZ 2IA2A 2OU2A 3RPQA 2UZKA 4DQ2A 1SMTA 2K7LA 1FP2A 2XKPA 3ZQ7A 2O03A 3F8CA 1K78B 3H3ZA 2QWWA 3SQNA 3MWMA 1P2FA 1BI3A 1ODDA 2PJPA 4GGGA 5KK1A 1O3SA 1ZYRF 4IF4A 2MLGA 2EFWA 1KU7A 1YO5C 1F4KA 2PMUA 4IHSA 2DT5A 3WTYC 3CUQA 4XLNF 5K5RA 1J0RA 3L9FA 4G6DA 2ZJ2A 1Z91A 2PLYA 1B6AA 3ZN0A 4NQWA 3IHUA 3ZP5A 3FMRA 4L9TA 5H20A 2OQRA 1CF7A 2MLKA 2COMA 4KDPA 5EEGA 3LQQA 3JSOA 1UB9A 4HZFA 1U8RA 2L01A 3C18A 5FLXK 4OINF 2Q2EA 3BJOA 2DQRA 3LAJA 1FY7A 2L4AA 2QZ8A 1BC7C 1V3FA 5CVJA 2A6HF 4MNUA 2FF4A 2FMYA 2HKXA 1O3QA 2ZKZA 2F5FA 4WF2A 1QBJA 1QZZA 1SD5A 3C1DA 1G3TA 3GYHX 5JHUA 3P9IA 2P7VB 3J80Z 3KEOA 1ZG5A 2L4MA 3CLOA 3ECOA 5LGNA 1FBQA 1MJBA 1S8NA 4AIHA 1D8JA 4H0EA 4HV5A 3ZMDA 2NRAC 3Q9SA 2W57A 2PMHA 2E7WA 3REOA 1U2WA 5H6QA 2MBFA 4RGRA 4ETSA 3WG9A 2FQ3A 4GYIA 2A07F 3K9TA 5DCMB 3R0AA 3VB2A 4EV0A 5J8CA 1R1TA 1ZGAA 4KN7X 1J2XA 2P5VA 1MDMB 2GA1A 5CVIA 1K6OA 3HTUA 2GXGA 2VODA 3MQ0A 2DK5A 2Z99A 1BC8C 2TDXA 1U5TA 3GZ5A 1IZ1A 3J80K 5BMZA 2IP2A 1SD4A 3K1MA 3DP7A 3NEUA 3IRQA 2KJCA 3RYPA 2NNNA 3U2RA 3F8FA 3F6VA 3PQJA 1KGSA 3E3VA 2JZYA 3M7GA 5ILUA 4I01A 1ZRFA 2MD5A 1BM9A 4R1HA 5JVTA 1A04A 4LG0A 3RDIA 3HRMA 4BNCA 1YQAA 5J8FA 2Z9OA 2OZUA 4EMSA 1R36A 1HKTA 2BV6A 1P4XA 3BDDA 1BJAA 2WC2A 3M1EA 4M71A 1R00A 5FD6A 4G6QA 1FZPB 2F5DA 4AVPA 1PP8F 2XUBA 1I5ZA 2FOKA 2HGCA 1ONVA 1XDSA 2QUFA 5DEQA 5TRDA 2ZO4A 3KP5A 5IT3A 4G9YA 1OYIA 4LMYA 1MZBA 3MZYA 3BPVA 3CO6C 5LEKA 3BP8A 3RJPA 4HQMA 3HHGA 2V1UA 4KYWA 4KN4X 4YFKF 2H94A 3I59B 3CDHA 1HSTA 1IN5A 4UVBA 2XAHA 3ZMTA 4EJOA 1J75A 2KKOA 4LD5A 4ESFA 2HTSA 4HA8A 1C0WA 1P6RA 1NHAA 2W84A 4A6EA 3EUHA 3ISPA 3KP7A 1QGPA 5E1XA 3U9GA 2VOOA 2LKPA 4ON0A 1MGTA 5ILVA 5AIPA 5L3BA 2ISZA 3HSFA 2QLZA 3D5LA 1S3JA 3KCCA 2V9VA 2JSCA 4P9FA 2V6CA 3DF8A 3B02A 3HSEA 2G9WA 4ENKA 1XCBA 3I53A 3I54A 2ZFWA 2W25A 3DQVC 1GHCA 3E5UA 3GX4X 4EM0B 2DI3A 1XDUA 2RC4A 3E6DA 3GFMA 1RI7A 2O3FA 2RDPA 1W5TA 1BI0A 5D5VB 4YG2F 4WXDA 4EJTA 1W7PB 3RYRA 1O3RA 3R61A 1TQPA 1WQ2A 2P8TA 2JT1A 4U88A 2HYFA 2ZMEB 3KP3A 1TLHB 3GW2A 2FRHA 3KEQA 2BYVE 1FYLA 2EA2A 4HDUA 2D2WA 1RUOA 3HHHA 1YLFA 4A0XA 4WX9A 1XB4A 3AAFA 2ELHA 1S29A 1TBXA 1FWZA 4A12A 1CGPA 5D6EA 1UCRA 3PFIA 4Q5SF 4XBFA 4BYYA 3KZZA 2VBYA 4A5MA 3GF2A 1WRJA 5D4RA 2VBWA 1R5HA 2XAFA 4G8XA 4A5NA 1T6SA 4YIIA 1ZAOA 1UFMA 2PEXA 3COAC 2L3DA 4MEYF 1FLIA 4QWQA 1ZRDA 3Q9VA 2M30A 4RGUA 1O57A 3GWZA 2P6TA 1BBYA 3IRRA 3FF5A 3DFGA 2F5EA 2O8XA 1BI2A 1H9TA 2OAZA 3JTHA 4P5OA 5HS8A 1IN4A 1YIOA 5DD4A 4EJVA 1BI1A 5ILSA 1XD7A 2ZXJA 1Q1HA 5E18F 3SZTA 3TQNA 2AXLA 1I1SA 3P9KA 5DD8A 3CO7C 2Z33A 3FMSA 4GXOA 2V1DA 3M8FA 3I71A 4FX0A 1IAWA 2K4BA 4L0YB 5BOXA 5HVQC 1USTA 2VXZA 1K7AA 1H0MA 3LA3A 4Q47A 1I6XA 3H3UA 2NYXA 3GO5A 1W4MA 4U7DA 1BOAA 1O7LA 6PAXA 3E5QA 5FB2A 3LA7A 4G7OF 4I02A 2HFHA 1OYYA 1DPRA 3BOQA 4A2UA 2M8EA 3F8NA 2G7HA 2XVCA 4EVIA 4JQFA 2ZNZA 3KLOA 5D8LB 1ZHFA 3GXOA 2CYYA 2HKOA 3BJ6A 3S2WA 4YFXF 4EGZA 3JTGA 2PQ8A 3NQOA 2Q8KA 3TGNA 1FSHA 1HW2A 1BN5A 2VN2A 3GFLA 1P92A 4CDGA 1SD7A 5HS7A 5BS6A 3R4KA 1R58A 4KUMA 5LRSA 4MHGA 1EH6A 5FGMA 1TNSA 2H09A 1G3YA 2XASA 4UV8A 3ZMUA 1IXRC 5LGTA 2YSRA 5JR3A 4HOBA 3WGIA 3IKVA 2PI0A 1R7JA 1MJAA 2EK5A 4RB1A 4Q48A 3RKYA 4GCVA 2FBIA 1I27A 4IRGA 2UXXA 3HIFA 4R79A 5HLHA 4WK8F 1IN8A 2LDUA 3BROA 4E70A 3V4GA 3WTVC 4XRFA 1S6LA 2L02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I58 A;  3VFZ A;  1K78 A;  4ZZD A;  1OYW A;  1JGS A;  5ICF A;  4F7Z A;  2X4H A;  1ON1 A;  1XGS A;  1Z1D A;  4IXA A;  2WWY A;  2VE8 A;  4ESB A;  4PDK A;  2B0L A;  3H92 A;  1QQI A;  3QOP A;  3JSP A;  1Z05 A;  3HRU A;  4I09 A;  2VC1 A;  1KU9 A;  1TW2 A;  3KP6 A;  2DPD A;  1XSD A;  5JI6 A;  4HV6 A;  2K86 A;  3BPX A;  2G7U A;  3FZV A;  3HYI A;  1J5Y A;  4A0Z A;  4MTD A;  4LLG F;  3SFZ A;  3RIR A;  3ROU A;  2EV0 A;  5K1Y A;  1MD0 A;  3ZPL A;  1FT9 A;  4KIF A;  4AIJ A;  2ESN A;  3K0L A;  1IW7 F;  1DPU A;  2RNJ A;  2FBH A;  1YFH A;  3W6K B;  1T38 A;  2DTR A;  4KFC A;  4YIF A;  4ENM A;  2CWE A;  5H6R A;  1AWC A;  3C7J A;  2CGP A;  1FBU A;  3ZN1 A;  3WTT C;  3K1N A;  2EWN A;  3KFW X;  2FSW A;  3KP4 A;  3L7W A;  3ULQ B;  5ICE A;  1LDK B;  3CUO A;  1HBX G;  3ELK A;  4HDV A;  2FBK A;  1F1Z A;  2ZBK A;  3EYY A;  2LSO A;  2Y75 A;  2EJR A;  3FMQ A;  3C3W A;  2V1X A;  2ETH A;  3MAJ A;  1KYW A;  2MH2 A;  5A2Q Z;  3GVA A;  2YR2 A;  4UXN A;  3GEZ A;  2IRF G;  1ULY A;  1J59 A;  2HDC A;  4RAY A;  4HX8 A;  5D4S A;  2P4W A;  2Y0M A;  1ZAR A;  4MEX F;  4L9J A;  3BJA A;  4BHC A;  2IT0 A;  4KNY A;  4Y13 A;  1RUN A;  3QPT A;  4MQV A;  2NS0 A;  1TW3 A;  4U7B A;  2M5W A;  2KJB A;  3W6J B;  4N0B A;  1G3S A;  5DCM A;  2WV0 A;  2OZ6 A;  3GZ6 A;  3WTU C;  1MDM A;  2C6Y A;  2FA5 A;  1XMK A;  3V8K A;  1FP1 D;  1D8K A;  4HF2 A;  1ZH5 A;  1ZG3 A;  1D5V A;  3MFK A;  3WE3 A;  3V7R A;  5LEJ A;  5E8G A;  3ML6 A;  4N9H A;  2HZT A;  2P5L C;  2FXA A;  3WGH A;  4EM1 A;  4EJU A;  1T98 A;  3KZY A;  3E6C C;  5F1R A;  4NHJ A;  3I4P A;  4LB6 B;  2EFP A;  4CYD A;  5A2Q K;  2A3S A;  1B9N A;  1OPC A;  3WGG A;  3T8R A;  3P7N A;  1LVA A;  1ON2 A;  1QO0 D;  2H6B A;  5FO5 A;  3E6B A;  3QU6 A;  4UNO A;  2QBY B;  4P9U A;  2DW4 A;  3P9C A;  1W5S A;  1IN7 A;  2DBB A;  4RGS A;  5DYM A;  3QP6 A;  3T5X A;  2E7X A;  1HXD A;  1RIO H;  1QZY A;  2QM3 A;  4KA4 A;  4I0A A;  2ISY A;  5E1Z B;  3KLN A;  2PBI A;  5J6X A;  3HRS A;  5D8K B;  1UHW A;  2HEO A;  5L3E A;  3M8E A;  3TOA A;  1G4D A;  1DUX C;  2L54 A;  1AOY A;  4OMZ A;  1P4A A;  1XSX A;  4OOI A;  2XAJ A;  3E97 A;  3FX3 A;  1KYZ A;  1U5T C;  1GXP A;  2IJL A;  4L5I A;  5HS9 A;  3I59 A;  3V7S A;  2HR3 A;  1FYM A;  2YPR A;  3KP2 A;  4BAY A;  2BE5 F;  1U3E M;  2GA2 A;  1J9I A;  1ZN2 A;  1B4A A;  2W85 A;  1XGO A;  3TKY A;  1Z7U A;  4WXC A;  4PGG A;  3RTR A;  3FHZ A;  2Z5U A;  4I7H A;  5E1W A;  1LB2 A;  3K1P A;  5FFZ A;  4FX4 A;  3LST A;  5CLS A;  4HAM A;  3RI4 A;  4P96 A;  1IRF A;  3RKW A;  1SFU A;  4M9Z A;  4I0B A;  2OD5 A;  5L3D A;  2LNB A;  5HLG A;  3GLX A;  3DKW A;  2IA0 A;  1JHH A;  4O5V A;  5JFR A;  1ZG1 A;  4RS8 A;  2WTE A;  5CVU A;  4NB5 A;  1IXC A;  4UV9 A;  2XAG A;  5D5X B;  2D1H A;  1ZLK A;  4P55 A;  5LGU A;  2W24 A;  1XCV A;  3EDP A;  2PN6 A;  2R7F A;  5E20 A;  5E17 F;  5CYV A;  2HS5 A;  2BBY A;  4KMU X;  5DCF A;  3K69 A;  1WWX A;  3LFK A;  1FSE A;  1YTY A;  1R22 A;  4AD9 A;  1W7P A;  5DUI A;  1GVJ A;  4ESJ A;  1STZ A;  2ZME A;  2EB7 A;  2JPB A;  4RGX A;  4ZYH A;  4HX4 A;  2J5P A;  4R8H A;  2UXN A;  3T0Y A;  2P5K A;  4OIO F;  1J7K A;  2XGX A;  1U6G A;  3PQK A;  2QQ9 A;  4ENJ A;  2VE9 A;  3K2Z A;  5E8I A;  1LDD A;  1Z9C A;  2P7C B;  3TO9 A;  2GAU A;  3T1B A;  1OKR A;  2PFB A;  4UHT A;  5LBQ A;  5D6F A;  1IRG A;  3V8L A;  1EH8 A;  3MCZ A;  3FXQ A;  2ZCW A;  5BPI A;  1WI9 A;  3KE2 A;  3TDZ C;  3GFJ A;  3SZP A;  1IF1 A;  4Y15 A;  4RB0 A;  2H27 A;  1FNN A;  3IKT A;  4WCG A;  3TO6 A;  2GIV A;  2R3S A;  4CHU A;  3SXY A;  3WTW C;  3V8J A;  1OMI A;  2M1B A;  5L3F A;  5L3G A;  2ACJ A;  3L2C A;  3EYI A;  4EQQ A;  4O3M A;  4U0Y A;  5K5Q A;  1W7P D;  1YYV A;  2GQQ A;  3F8B A;  3GUD A;  2YX7 A;  3WTZ A;  4L9V A;  3VOD A;  5CVR A;  3VEP A;  3ABT A;  3WOD F;  4S04 A;  2ADU A;  4RB3 C;  4M6Y A;  2UWM A;  1F9N A;  3T8T A;  2ESH A;  1HSJ A;  3HOT A;  3ZMV A;  1ZRE A;  1PDN C;  1E2X A;  3WU0 A;  3TO7 A;  4OMY A;  4JBA A;  4MTE A;  1RNL A;  1PUE E;  4PGH A;  3BY6 A;  5EEH A;  3E5X A;  1UHM A;  4BQA A;  5ICG A;  4ZYE A;  1L3L A;  3CTA A;  2HYG D;  3CUQ B;  2EFN A;  3R6S A;  4L9N A;  5ICC A;  2KIU A;  2DFI A;  2EFO A;  2STW A;  2HWV A;  4HX7 A;  2XIG A;  1CF7 B;  4ASN A;  4RAZ A;  2Y48 A;  2RQP A;  4ZZL A;  2DQL A;  3DV8 A;  3ZMZ A;  5AON A;  1T39 A;  2VON A;  1B59 A;  4HW0 A;  3WE2 A;  2EV5 A;  2IVM A;  1F5T A;  4L0Z B;  4KIC A;  1EH7 A;  4Z2Y A;  5K5O A;  1O3T A;  3HTS B;  1B9M A;  1JHF A;  2JTV A;  4K2E A;  3I5U A;  3L09 A;  4A0Y A;  1L0O C;  3Q5F A;  1JXS A;  2PG4 A;  2FML A;  3TDU C;  4A6D A;  3DPL C;  3N97 A;  5DV5 A;  4D0P A;  1KQ9 A;  2RV8 A;  1SFE A;  4M72 A;  3E6M A;  3FWE A;  3SHF A;  4AIK A;  1SD6 A;  2P6S A;  2DO7 A;  2JRT A;  4QLC U;  2A6E F;  2CG4 A;  4O6J A;  4XSZ F;  2QQB A;  3IC7 A;  1R5G A;  1O7F A;  3TOB A;  5HDK A;  3MZH A;  4G7Z F;  4S05 A;  3EQL F;  1OR7 A;  2HQN A;  1WSU A;  2HQR A;  1S7A A;  2DPU A;  2VC0 A;  4RB2 C;  4MGR A;  2EFQ A;  1FBS A;  3FM3 A;  1XMA A;  2YX4 A;  2DLL A;  3WU1 B;  2XHK A;  1FOK A;  1RZ4 A;  4ZYD A;  2RKH A;  4HLX A;  1X3U A;  1S7O A;  2O61 A;  1T0F A;  1Z6T A;  3QAH A;  4G94 A;  4GO1 A;  4MQ9 F;  2DK8 A;  1ZLJ A;  4KT5 C;  5BQT A;  3O6B B;  4PZJ A;  1QPM A;  5AIQ A;  1U5T B;  4N9I A;  2R7D A;  4UVA A;  2D45 A;  4CIC A;  2D1V A;  1JE8 A;  4Q4Z F;  2RVC A;  1YW9 A;  2XRN A;  5HDG A;  1FYK A;  2F2E A;  1BIB A;  4B8X A;  4FHT A;  1YS6 A;  2Z3Y A;  1REP C;  5D5W B;  1KU3 A;  3CUQ C;  1HKS A;  3F8M A;  4LG0 B;  1LEA A;  1R23 A;  5LHH A;  2KIF A;  2VT2 A;  4LGW A;  2CW0 F;  4HF0 A;  2CSO A;  2VBX A;  4LFU A;  3JAM Z;  3IL2 A;  4ZH4 F;  4UVC A;  2QEN A;  4HBL A;  5LHI A;  2IPQ X;  1QNT A;  3O3K A;  5D5U B;  1HQC A;  1P4W A;  2NNY A;  2VT3 A;  3ABU A;  2K27 A;  2IW5 A;  1R1U A;  4EJW A;  4UUV A;  3VOE A;  4Y17 A;  4LB5 A;  2E1N A;  5F64 A;  2XRO A;  4IPA A;  1H9G A;  3F3X A;  2VOP A;  2FNP A;  4YFN F;  2X0L A;  4LLN A;  3QRF F;  4ENN A;  2YU3 A;  4KMF A;  1XSV A;  1E17 A;  2QQA A;  1YS7 A;  3J81 Z;  5IT9 Z;  1YW7 A;  2DU9 A;  3R60 A;  1IN6 A;  2QYO A;  1YG2 A;  2JPC A;  3U1D A;  1KA8 A;  4XLP F;  3OOP A;  2VBZ A;  3JAM K;  1D3Y A;  1LQ1 A;  2FE3 A;  2HOE A;  1G6N A;  1ZRC A;  1DP7 P;  3GFI A;  3WTS C;  4HF1 A;  2A69 F;  3EET A;  1LDJ A;  2K4J A;  5CJ9 A;  4LK1 F;  4M9X A;  3ZMS A;  2V79 A;  1WKM A;  3HOS A;  3BZ6 A;  3HRT A;  2O0Y A;  3HSR A;  1HW5 A;  2F5C A;  3V7C A;  3G73 A;  3QU3 A;  1XGN A;  4LLL A;  1FPQ A;  1Y0U A;  5FD5 A;  1USS A;  2RGV A;  4WWC A;  3N4M A;  1I1G A;  5LRR A;  1U78 A;  2EA4 A;  2QBY A;  4LK0 F;  2QVO A;  5ERI A;  1IXS B;  3MEX A;  2M45 A;  1ZGJ A;  4I2O A;  2MA3 A;  3J81 K;  1HW1 A;  5IT9 K;  2GZW A;  2J5O A;  5TJJ A;  2ZNY A;  3J7A O;  3F21 A;  5ED4 A;  1KQ8 A;  3G3Z A;  4M9S A;  4FT8 A;  4B09 A;  1MJ9 A;  4CXF A;  4OU0 A;  2OA4 A;  3KET A;  3I0T A;  1KQ0 A;  4DNC A;  1TQI A;  3O2P E;  3OV8 A;  3FM5 A;  2FNA A;  1TQM A;  2BGC A;  3M9A A;  1TNT A;  3R0J A;  5LHG A;  2DAO A;  1PP7 U;  3DEU A;  1EV7 A;  1K79 A;  1V4R A;  2CFX A;  5L3C A;  1FX7 A;  4BH9 A;  1XGM A;  5CVV A;  2A61 A;  2KRF A;  1VTN C;  1GXQ A;  4M6X A;  2STT A;  2GXB A;  4BHP A;  1HKQ A;  4HQE A;  2Q0O A;  3FXU A;  2LF7 A;  3ECH A;  4U0V A;  3IWF A;  2IA1 A;  4OIQ F;  1SFX A;  4JK1 X;  4IRI A;  2GWR A;  4BHB A;  1TTY A;  3BWG A;  3DPT A;  3LAP A;  2K02 A;  4KIB A;  4G7H F;  5HLI A;  3HUG A;  4CZZ A;  3QP5 A;  3ERE D;  2FU4 A;  5LLQ A;  3LWF A;  1SAX A;  5HOO A;  2LF8 A;  4M73 A;  5FFX A;  1R1V A;  4WXH A;  1LNW A;  3LA2 A;  3DXJ F;  2CO5 A;  4KIG A;  1IUY A;  2OBP A;  4EGY A;  4PCQ A;  2CQK A;  5DDG A;  5HDN A;  4LJZ F;  3F72 A;  2XKO A;  3RKX A;  2BEO A;  1SMY F;  4IRH A;  4I98 B;  5KVR A;  2NAZ A;  3F6O A;  2A5Y B;  2OQG A;  1DDN A;  2FEZ A;  2MH9 A;  3NRV A;  3F23 A;  1Z6R A;  3L00 A;  2EV6 A;  4L5J A;  5DUK A;  3WTX C;  1XN7 A;  4OIR F;  2O6G E;  1B1B A;  5BPD A;  2MC3 A;  3JW4 A;  3D0S A;  3QPH A;  4AWX B;  1MKM A;  3CJN A;  3F22 A;  4L18 B;  3FXR A;  4HYE A;  3IWZ A;  4GYG A;  4IHT A;  1KU2 A;  2M87 A;  4TV7 A;  5F6F A;  4EM2 A;  2RN7 A;  4IVN A;  4HLY A;  1YW8 A;  3LQR A;  1T2K A;  3RPU A;  3I64 A;  1FC3 A;  1G3W A;  3B73 A;  1LJ9 A;  4IJA A;  2XAQ A;  4CGZ A;  1BIA A;  4CO8 A;  2A68 F;  4ZYG A;  4OIP F;  4M74 A;  2H6C A;  1LEB A;  2KIM A;  4BXU A;  2E1C A;  2AS5 F;  4U0W A;  2XV4 S;  4XSX F;  2HTJ A;  5FLX Z;  2IA2 A;  2OU2 A;  3RPQ A;  2UZK A;  4DQ2 A;  1SMT A;  2K7L A;  1FP2 A;  2XKP A;  3ZQ7 A;  2O03 A;  3F8C A;  1K78 B;  3H3Z A;  2QWW A;  3SQN A;  3MWM A;  1P2F A;  1BI3 A;  1ODD A;  2PJP A;  4GGG A;  5KK1 A;  1O3S A;  1ZYR F;  4IF4 A;  2MLG A;  2EFW A;  1KU7 A;  1YO5 C;  1F4K A;  2PMU A;  4IHS A;  2DT5 A;  3WTY C;  3CUQ A;  4XLN F;  5K5R A;  1J0R A;  3L9F A;  4G6D A;  2ZJ2 A;  1Z91 A;  2PLY A;  1B6A A;  3ZN0 A;  4NQW A;  3IHU A;  3ZP5 A;  3FMR A;  4L9T A;  5H20 A;  2OQR A;  1CF7 A;  2MLK A;  2COM A;  4KDP A;  5EEG A;  3LQQ A;  3JSO A;  1UB9 A;  4HZF A;  1U8R A;  2L01 A;  3C18 A;  5FLX K;  4OIN F;  2Q2E A;  3BJO A;  2DQR A;  3LAJ A;  1FY7 A;  2L4A A;  2QZ8 A;  1BC7 C;  1V3F A;  5CVJ A;  2A6H F;  4MNU A;  2FF4 A;  2FMY A;  2HKX A;  1O3Q A;  2ZKZ A;  2F5F A;  4WF2 A;  1QBJ A;  1QZZ A;  1SD5 A;  3C1D A;  1G3T A;  3GYH X;  5JHU A;  3P9I A;  2P7V B;  3J80 Z;  3KEO A;  1ZG5 A;  2L4M A;  3CLO A;  3ECO A;  5LGN A;  1FBQ A;  1MJB A;  1S8N A;  4AIH A;  1D8J A;  4H0E A;  4HV5 A;  3ZMD A;  2NRA C;  3Q9S A;  2W57 A;  2PMH A;  2E7W A;  3REO A;  1U2W A;  5H6Q A;  2MBF A;  4RGR A;  4ETS A;  3WG9 A;  2FQ3 A;  4GYI A;  2A07 F;  3K9T A;  5DCM B;  3R0A A;  3VB2 A;  4EV0 A;  5J8C A;  1R1T A;  1ZGA A;  4KN7 X;  1J2X A;  2P5V A;  1MDM B;  2GA1 A;  5CVI A;  1K6O A;  3HTU A;  2GXG A;  2VOD A;  3MQ0 A;  2DK5 A;  2Z99 A;  1BC8 C;  2TDX A;  1U5T A;  3GZ5 A;  1IZ1 A;  3J80 K;  5BMZ A;  2IP2 A;  1SD4 A;  3K1M A;  3DP7 A;  3NEU A;  3IRQ A;  2KJC A;  3RYP A;  2NNN A;  3U2R A;  3F8F A;  3F6V A;  3PQJ A;  1KGS A;  3E3V A;  2JZY A;  3M7G A;  5ILU A;  4I01 A;  1ZRF A;  2MD5 A;  1BM9 A;  4R1H A;  5JVT A;  1A04 A;  4LG0 A;  3RDI A;  3HRM A;  4BNC A;  1YQA A;  5J8F A;  2Z9O A;  2OZU A;  4EMS A;  1R36 A;  1HKT A;  2BV6 A;  1P4X A;  3BDD A;  1BJA A;  2WC2 A;  3M1E A;  4M71 A;  1R00 A;  5FD6 A;  4G6Q A;  1FZP B;  2F5D A;  4AVP A;  1PP8 F;  2XUB A;  1I5Z A;  2FOK A;  2HGC A;  1ONV A;  1XDS A;  2QUF A;  5DEQ A;  5TRD A;  2ZO4 A;  3KP5 A;  5IT3 A;  4G9Y A;  1OYI A;  4LMY A;  1MZB A;  3MZY A;  3BPV A;  3CO6 C;  5LEK A;  3BP8 A;  3RJP A;  4HQM A;  3HHG A;  2V1U A;  4KYW A;  4KN4 X;  4YFK F;  2H94 A;  3I59 B;  3CDH A;  1HST A;  1IN5 A;  4UVB A;  2XAH A;  3ZMT A;  4EJO A;  1J75 A;  2KKO A;  4LD5 A;  4ESF A;  2HTS A;  4HA8 A;  1C0W A;  1P6R A;  1NHA A;  2W84 A;  4A6E A;  3EUH A;  3ISP A;  3KP7 A;  1QGP A;  5E1X A;  3U9G A;  2VOO A;  2LKP A;  4ON0 A;  1MGT A;  5ILV A;  5AIP A;  5L3B A;  2ISZ A;  3HSF A;  2QLZ A;  3D5L A;  1S3J A;  3KCC A;  2V9V A;  2JSC A;  4P9F A;  2V6C A;  3DF8 A;  3B02 A;  3HSE A;  2G9W A;  4ENK A;  1XCB A;  3I53 A;  3I54 A;  2ZFW A;  2W25 A;  3DQV C;  1GHC A;  3E5U A;  3GX4 X;  4EM0 B;  2DI3 A;  1XDU A;  2RC4 A;  3E6D A;  3GFM A;  1RI7 A;  2O3F A;  2RDP A;  1W5T A;  1BI0 A;  5D5V B;  4YG2 F;  4WXD A;  4EJT A;  1W7P B;  3RYR A;  1O3R A;  3R61 A;  1TQP A;  1WQ2 A;  2P8T A;  2JT1 A;  4U88 A;  2HYF A;  2ZME B;  3KP3 A;  1TLH B;  3GW2 A;  2FRH A;  3KEQ A;  2BYV E;  1FYL A;  2EA2 A;  4HDU A;  2D2W A;  1RUO A;  3HHH A;  1YLF A;  4A0X A;  4WX9 A;  1XB4 A;  3AAF A;  2ELH A;  1S29 A;  1TBX A;  1FWZ A;  4A12 A;  1CGP A;  5D6E A;  1UCR A;  3PFI A;  4Q5S F;  4XBF A;  4BYY A;  3KZZ A;  2VBY A;  4A5M A;  3GF2 A;  1WRJ A;  5D4R A;  2VBW A;  1R5H A;  2XAF A;  4G8X A;  4A5N A;  1T6S A;  4YII A;  1ZAO A;  1UFM A;  2PEX A;  3COA C;  2L3D A;  4MEY F;  1FLI A;  4QWQ A;  1ZRD A;  3Q9V A;  2M30 A;  4RGU A;  1O57 A;  3GWZ A;  2P6T A;  1BBY A;  3IRR A;  3FF5 A;  3DFG A;  2F5E A;  2O8X A;  1BI2 A;  1H9T A;  2OAZ A;  3JTH A;  4P5O A;  5HS8 A;  1IN4 A;  1YIO A;  5DD4 A;  4EJV A;  1BI1 A;  5ILS A;  1XD7 A;  2ZXJ A;  1Q1H A;  5E18 F;  3SZT A;  3TQN A;  2AXL A;  1I1S A;  3P9K A;  5DD8 A;  3CO7 C;  2Z33 A;  3FMS A;  4GXO A;  2V1D A;  3M8F A;  3I71 A;  4FX0 A;  1IAW A;  2K4B A;  4L0Y B;  5BOX A;  5HVQ C;  1UST A;  2VXZ A;  1K7A A;  1H0M A;  3LA3 A;  4Q47 A;  1I6X A;  3H3U A;  2NYX A;  3GO5 A;  1W4M A;  4U7D A;  1BOA A;  1O7L A;  6PAX A;  3E5Q A;  5FB2 A;  3LA7 A;  4G7O F;  4I02 A;  2HFH A;  1OYY A;  1DPR A;  3BOQ A;  4A2U A;  2M8E A;  3F8N A;  2G7H A;  2XVC A;  4EVI A;  4JQF A;  2ZNZ A;  3KLO A;  5D8L B;  1ZHF A;  3GXO A;  2CYY A;  2HKO A;  3BJ6 A;  3S2W A;  4YFX F;  4EGZ A;  3JTG A;  2PQ8 A;  3NQO A;  2Q8K A;  3TGN A;  1FSH A;  1HW2 A;  1BN5 A;  2VN2 A;  3GFL A;  1P92 A;  4CDG A;  1SD7 A;  5HS7 A;  5BS6 A;  3R4K A;  1R58 A;  4KUM A;  5LRS A;  4MHG A;  1EH6 A;  5FGM A;  1TNS A;  2H09 A;  1G3Y A;  2XAS A;  4UV8 A;  3ZMU A;  1IXR C;  5LGT A;  2YSR A;  5JR3 A;  4HOB A;  3WGI A;  3IKV A;  2PI0 A;  1R7J A;  1MJA A;  2EK5 A;  4RB1 A;  4Q48 A;  3RKY A;  4GCV A;  2FBI A;  1I27 A;  4IRG A;  2UXX A;  3HIF A;  4R79 A;  5HLH A;  4WK8 F;  1IN8 A;  2LDU A;  3BRO A;  4E70 A;  3V4G A;  3WTV C;  4XRF A;  1S6L A;  2L02 A; 
#chains in the Genus database with same CATH topology
 3I58 A;  3VFZ A;  1K78 A;  4ZZD A;  1S72 I;  1OYW A;  3M1C A;  3OR1 C;  2ICW G;  5TGT A;  1JGS A;  2LTP A;  5ICF A;  1UMQ A;  3I4M J;  2YUS A;  3S1R J;  4V2F A;  5EYR A;  4F52 A;  4F7Z A;  2X4H A;  3CDI A;  1ON1 A;  1XGS A;  1Z1D A;  2R7S A;  3J7Z I;  4IXA A;  2GBY A;  2WWY A;  2VE8 A;  4ESB A;  4PDK A;  2B0L A;  4GDF A;  3H92 A;  1QQI A;  3QOP A;  3JSP A;  1Z05 A;  3CME I;  3HRU A;  4I09 A;  2VC1 A;  4C2U A;  4MEX F;  2GXA A;  3PJR A;  1KU9 A;  1TW2 A;  1S5L C;  3KP6 A;  2GLO A;  1UAA A;  2VQC A;  1XSD A;  2DPD A;  2IS6 A;  1FIP A;  2DDA A;  2H1K A;  2AQE A;  4HV6 A;  5JI6 A;  2K86 A;  3BPX A;  4YIR X;  2G7U A;  3FZV A;  3HYI A;  1J5Y A;  4A0Z A;  3OYI A;  4MTD A;  1TT0 A;  4BEH B;  4LLG F;  3SFZ A;  5GP9 A;  3RIR A;  2EV0 A;  3ROU A;  1T95 A;  5K1Y A;  2HVR A;  1MD0 A;  2HI3 A;  1FT9 A;  3ZPL A;  4KIF A;  4AIJ A;  5K7F A;  4G6T B;  2ESN A;  3K0L A;  2LY9 A;  1IW7 F;  1DPU A;  2RNJ A;  3A4C A;  3OYH A;  2OPT A;  1OCC H;  2E60 A;  2FBH A;  1YFH A;  3W6K B;  4AU7 A;  1JKO C;  1T38 A;  2DTR A;  3PM1 A;  4HSR A;  4YIF A;  4KFC A;  1QU3 A;  2GOM A;  4ENM A;  2CWE A;  5F04 A;  4I6Z A;  1R4N B;  5H6R A;  1AWC A;  3C7J A;  2CGP A;  1FBU A;  4X1E A;  5LD2 C;  3ZN1 A;  1PUF A;  3VSL A;  3WTT C;  1H89 C;  2QSG X;  3K1N A;  1NG7 A;  1WPK A;  2EWN A;  3KFW X;  4MFE A;  1I50 J;  1MIJ A;  2DA2 A;  4BL0 B;  2FSW A;  3KP4 A;  2R7V A;  1ETW A;  3IP4 B;  3L7W A;  3KYD B;  1N77 A;  3ULQ B;  5DS9 A;  3S15 J;  5ICE A;  1LDK B;  3CUO A;  1HBX G;  1VQ9 I;  1WH7 A;  3ELK A;  3O8G A;  4HDV A;  2CU7 A;  2FBK A;  3HC7 A;  1F1Z A;  2OTL I;  5IY5 H;  2ZBK A;  3EYY A;  2X48 A;  2LSO A;  1ZKG A;  2X6W A;  3JRG A;  2Y75 A;  2EJR A;  4C3J J;  3FMQ A;  3DKX A;  3C3W A;  1FTT A;  2M7B A;  2WA0 A;  3S1Q J;  1LUJ B;  3EUA A;  2V1X A;  5J4Y A;  2ETH A;  3MAJ A;  1FTZ A;  2X1D A;  1KYW A;  2MH2 A;  5A2Q Z;  3S1M J;  3GVA A;  1X19 A;  1A36 A;  2YR2 A;  3KEY A;  4I76 A;  4ZDL A;  2E5N A;  2KRH A;  3A01 B;  4PFP A;  2YU9 J;  2I10 A;  4UXN A;  3GEZ A;  2DOF A;  1ULY A;  2IRF G;  2QGU A;  1J59 A;  2HDC A;  1I6H J;  4CSW A;  2DA6 A;  4RAY A;  2W4S A;  4HX8 A;  5D4S A;  2P4W A;  1WJA A;  1ZAR A;  1EA3 A;  2NOJ B;  2Y0M A;  4L9J A;  1MBG A;  1Z3X A;  3BJA A;  4BHC A;  2IT0 A;  4KNY A;  4Y13 A;  2CQQ A;  2XSD C;  2HPM A;  1RUN A;  3QPT A;  4HG2 A;  4J01 A;  4MQV A;  2NS0 A;  4BY1 J;  1TW3 A;  4U7B A;  2M5W A;  2KJB A;  3AG3 H;  1RKT A;  2HNH A;  3W6J B;  4N0B A;  1P7I A;  2F4O B;  3ABL H;  3BCB A;  1WCM J;  1T33 A;  2DMT A;  3GME A;  3H36 A;  4FIS A;  1G3S A;  3DTK A;  5DCM A;  4CCK A;  2WV0 A;  4II3 A;  3BLY A;  2OZ6 A;  2X6X A;  3GZ6 A;  4XL9 A;  5J40 A;  3WTU C;  1MDM A;  2C6Y A;  2FA5 A;  1XMK A;  4ZC3 A;  3V8K A;  1D1A A;  1FP1 D;  1D8K A;  4IO9 F;  4HF2 A;  1ZH5 A;  1ZG3 A;  1D5V A;  4ZJZ A;  3MFK A;  3WE3 A;  3V7R A;  1OR7 C;  5LEJ A;  5E8G A;  3ML6 A;  1NK2 P;  4N9H A;  2HZT A;  4L5E A;  2P5L C;  2FXA A;  3FIS A;  4NDL A;  3E7L A;  1X3Z B;  3LSG A;  2HZD A;  3WGH A;  4EM1 A;  4EJU A;  1RRJ A;  1T98 A;  3KZY A;  4XR6 A;  3CJT B;  3E6C C;  4DYC A;  3CF2 A;  5F1R A;  4NHJ A;  2YS9 A;  3I4P A;  2E35 A;  4LB6 B;  2EFP A;  1E0E A;  4CYD A;  5A2Q K;  1VQ8 I;  2WY8 Q;  1Y0N A;  4N4N B;  3N05 A;  2QKL B;  3BZK A;  2X1C A;  3FXK A;  2A3S A;  1B9N A;  3PSI A;  1OPC A;  4XKC A;  2LRE A;  3WGG A;  2FOW A;  3T8R A;  2WAQ N;  3P7N A;  2V1N A;  4QIW N;  1LVA A;  3OYE A;  2L7K A;  1ON2 A;  1QO0 D;  2H8W A;  2H6B A;  5FO5 A;  3H1C A;  1WVR A;  5GPA A;  4IHV A;  3E6B A;  3QU6 A;  4UNO A;  3ZQG A;  2KZG A;  3OYA A;  2QBY B;  4P9U A;  2DW4 A;  3SFI A;  3P9C A;  1W5S A;  3OSF A;  1IN7 A;  2DBB A;  2R5Z B;  4RGS A;  1OCT C;  2IGM A;  5DYM A;  4PFO A;  3QP6 A;  3T5X A;  3CLQ A;  1VQN I;  2E7X A;  4A3D J;  1HXD A;  3OWT A;  1RIO H;  3ERM A;  1QZY A;  2QM3 A;  1DGR M;  4KA4 A;  4XK4 A;  2DA1 A;  1WFX A;  4I0A A;  2ISY A;  1ETK A;  2V26 A;  5E1Z B;  4B1R A;  3HJE A;  3KLN A;  2PBI A;  5J6X A;  3KYL A;  4EEF G;  3WG7 H;  3HRS A;  5D8K B;  3Q0V A;  2L5Q A;  1UHW A;  2HEO A;  3OMY A;  5L3E A;  1Y56 A;  4NNJ A;  3M8E A;  3HOU J;  1ETX A;  3DKY A;  3TOA A;  1YE9 A;  1G4D A;  1DUX C;  2L54 A;  2LBF B;  1X1D A;  1AOY A;  4FET A;  4OMZ A;  1P4A A;  1R71 A;  4Y33 A;  4V19 K;  1XSX A;  4C3H J;  2LKX A;  4HNT A;  5KAI C;  4AYB A;  4OOI A;  1XG1 A;  3ZQC A;  4E7Z A;  2BHZ A;  1ORK A;  2ECC A;  4RM2 A;  5M3F J;  5DM7 F;  2BVL A;  3JRD A;  1GVD A;  2KT0 A;  2XAJ A;  3E97 A;  3FX3 A;  3PO2 J;  1KYZ A;  1U5T C;  1GXP A;  2IJL A;  4L5I A;  3JRF A;  5HS9 A;  3I59 A;  3OYD A;  3V7S A;  2HR3 A;  1FYM A;  2MW8 A;  2YPR A;  1MND A;  3KP2 A;  1XS9 A;  4BAY A;  4MLO A;  2BE5 F;  1U3E M;  2R4G A;  2GA2 A;  3QOD A;  2DCE A;  1I39 A;  1ZN2 A;  1J9I A;  1ZTR A;  2FX0 A;  1B4A A;  2W85 A;  1XGO A;  3TKY A;  1Z7U A;  4WXC A;  4PGG A;  4XLA A;  3RTR A;  3FHZ A;  2Z5U A;  4I7H A;  5GAD J;  5E1W A;  1LB2 A;  4FE4 A;  3K7A J;  3K1P A;  3S17 J;  5FFZ A;  3OY9 A;  4FX4 A;  5B5E C;  2MD0 A;  3LST A;  5CLS A;  4HAM A;  3ZQH A;  3RI4 A;  2E2J J;  5DM6 F;  2PX9 A;  4P96 A;  3BR5 A;  2CUF A;  4NC7 A;  4D1Q A;  1IRF A;  3RKW A;  2B9S A;  1SFU A;  4M9Z A;  4I0B A;  2HQ5 A;  2KHM A;  2B63 J;  2IS2 A;  3MD2 A;  3W2W A;  3IH3 A;  4XOR A;  2QA4 I;  3Q0U A;  2OD5 A;  3C2H A;  5L3D A;  2LC2 A;  2LNB A;  3OYG A;  2M3A A;  5HLG A;  3GLX A;  3DKW A;  2Y9Z A;  2IA0 A;  3HUG B;  1JHH A;  1Y39 A;  4O5V A;  5JFR A;  5M5W J;  2KIQ A;  2K3P A;  1ZG1 A;  2DXI A;  1Y1V J;  1FOX A;  4RS8 A;  2WTE A;  1K83 J;  3DCF A;  5CVU A;  1YIT I;  4NB5 A;  1IXC A;  3IUO A;  4UV9 A;  2XAG A;  3GTO J;  5D5X B;  3W2V A;  2DJI A;  3RQ4 A;  2D1H A;  4NUB A;  1TWH J;  3L2R A;  4HST A;  2FJ1 A;  1ZLK A;  4P55 A;  5LGU A;  2W24 A;  1XCV A;  3EDP A;  4X6A J;  2XF7 A;  1MSE C;  2PN6 A;  2R7F A;  5E20 A;  3K6G A;  4BU2 A;  4NBQ A;  5E17 F;  5CYV A;  2HS5 A;  2BBY A;  2LYC A;  4KMU X;  5DCF A;  3K69 A;  2F6C A;  2JSP A;  1WWX A;  3RSN A;  1MNM C;  3LFK A;  1FSE A;  1UHS A;  3HKZ A;  1R22 A;  1YTY A;  4AD9 A;  1AU7 A;  1W7P A;  5DUI A;  3G2B A;  5EZH A;  1GVJ A;  5F0C A;  4ESJ A;  1STZ A;  2ZME A;  2DOD A;  2OJE D;  4ABZ A;  2EB7 A;  3PFY A;  2DYR H;  2JPB A;  4RGX A;  3K4C A;  4BXF A;  3S3M A;  3B6A A;  4ZYH A;  1MH4 A;  4HX4 A;  2J5P A;  2RRE A;  5CPR B;  4R8H A;  2UUZ A;  2UXN A;  3T0Y A;  1IDZ A;  3SEZ A;  5JLX A;  2P5K A;  2CW7 A;  3ZQI A;  2XRL A;  1J7K A;  2XGX A;  4OIO F;  1OQY A;  1U6G A;  2A6T A;  3PQK A;  4A3B J;  1ACI A;  2X6Y A;  2QQ9 A;  4ENJ A;  2OCC H;  2ZFU A;  2VE9 A;  2K9L A;  3K2Z A;  1LDD A;  5E8I A;  2FD5 A;  1Z9C A;  2P7C B;  4AID A;  3TO9 A;  2P81 A;  2GAU A;  3LSP A;  3T1B A;  1OKR A;  4UUT A;  2PFB A;  4UHT A;  3DU5 A;  3OS2 A;  5LBQ A;  5D6F A;  1IRG A;  3HKZ N;  5IYB J;  1X3W B;  3V8L A;  1EH8 A;  2XPV A;  3MCZ A;  3OS1 A;  3FXQ A;  2ZCW A;  5BPI A;  1R6R A;  1WI9 A;  3KE2 A;  4FQG A;  2L9S A;  3TDZ C;  3GFJ A;  1X1C A;  3ZGK A;  1EJ9 A;  2IBD A;  3SZP A;  2JWT A;  1IF1 A;  3CC4 I;  4V2G A;  2LH9 A;  4Y15 A;  4RB0 A;  2H27 A;  1FNN A;  1SVM A;  3IKT A;  4BE1 A;  4WCG A;  2EH3 A;  3TO6 A;  4J19 A;  2K85 A;  2GIV A;  2R3S A;  1W36 D;  4HEA 2;  4CHU A;  3SXY A;  3WTW C;  3V8J A;  3RZD J;  1OMI A;  2M1B A;  2XGE A;  3BG6 A;  3RCO A;  2DT6 A;  5L3F A;  5L3G A;  2ACJ A;  3L2C A;  2CUE A;  3EYI A;  4EQQ A;  1W1W E;  3BR3 A;  4O3M A;  2OV7 A;  4U0Y A;  3DWL E;  3LMM A;  1T56 A;  5K5Q A;  1W7P D;  1YYV A;  1Z21 A;  1RET A;  4OAY A;  2E1M B;  2GQQ A;  3F8B A;  3GUD A;  1AHD P;  2YX7 A;  3WTZ A;  4DIQ A;  5FJ8 J;  1EF4 A;  4Y4R A;  2OF7 A;  3H9Q A;  4L9V A;  3PO3 J;  2QSF X;  1QVT A;  1WGX A;  1YJW I;  4RLF A;  3TP3 A;  5CVR A;  3VOD A;  2DJN A;  2L7F P;  3U21 A;  3A0H C;  2KLO A;  1QVU A;  3VEP A;  3ABT A;  3WOD F;  3DBH B;  3A02 A;  2ADU A;  4S04 A;  4RB3 C;  1IC8 A;  4RBO A;  2M4K A;  4M6Y A;  1JT0 A;  2UWM A;  4CCL A;  1F9N A;  2HOT A;  4XN0 A;  3T8T A;  5CQE A;  4B43 A;  2ESH A;  1HSJ A;  2NVY J;  4G12 A;  2M9H A;  3PNT A;  1JKP C;  1JTY A;  2LRD A;  4ZDO A;  3G1L A;  2DMU A;  3HBL A;  2CQ7 A;  3HOT A;  2IAI A;  1VQP I;  2PMZ A;  3GLL A;  3ZMV A;  1ZRE A;  4IEJ A;  1PDN C;  9ANT A;  1IRZ A;  1E2X A;  3W6V A;  3WU0 A;  3TO7 A;  4OMY A;  4HPQ A;  4JBA A;  4MTE A;  3GTM J;  1RNL A;  2JA6 J;  4B3X A;  1D5Y A;  2CMP A;  3FBN B;  1PUE E;  3MZ8 A;  1MW7 A;  4PGH A;  3BY6 A;  2R5Y A;  5EEH A;  1VZ0 A;  3E5X A;  4XKV A;  4XON A;  4C2M J;  1UHM A;  4BQA A;  1YI2 I;  2VXD A;  1BJZ A;  5ICG A;  4Y3O A;  4ZYE A;  1L3L A;  5FKL A;  2KQR A;  3CTA A;  2HYG D;  1PYV A;  3K2A A;  5IP6 A;  3CUQ B;  1OLT A;  2EFN A;  2JUC A;  2OC6 A;  2K9M A;  3R6S A;  2PMZ N;  3VWB A;  4L9N A;  5ICC A;  4ZTJ A;  2KIU A;  2LKS A;  2L2O A;  4A3C J;  2Q1Z B;  4IZZ A;  2DFI A;  2EFO A;  2STW A;  3H5N A;  3LSI A;  4NQW B;  2HWV A;  1N25 A;  4JOM A;  2H8R A;  4HX7 A;  2XIG A;  1CF7 B;  4ASN A;  1F36 A;  4RAZ A;  1MMD A;  2Y48 A;  2RQP A;  4ZZL A;  2DQL A;  3DV8 A;  3ZMZ A;  1XTA A;  5AON A;  3GTK J;  1D0Z A;  5E3L A;  1I3Q J;  4XLE A;  1T39 A;  3BG9 A;  2VON A;  1B59 A;  2WY7 Q;  4HW0 A;  3WE2 A;  2EV5 A;  1JUS A;  2IVM A;  1F5T A;  4L0Z B;  4U87 A;  2Q2E B;  4KIC A;  1EH7 A;  4XM3 A;  4LIV A;  2EIJ H;  4Z2Y A;  1ZR4 A;  5K5O A;  4BBS J;  1O3T A;  1YX3 A;  4MFD A;  5J3L A;  3HTS B;  4FAS D;  2CW8 A;  1B9M A;  3AKZ A;  3ESW B;  1JHF A;  1QRY A;  2XPU A;  3C2G A;  2JTV A;  4K2E A;  3I5U A;  3L09 A;  4A0Y A;  3S16 J;  3VYS B;  1POG A;  2WB1 A;  4AC0 A;  1L0O C;  3Q5F A;  5CKT A;  2KP6 A;  1JXS A;  2PG4 A;  4ZTF A;  1VND A;  2CUZ A;  2FML A;  3TDU C;  4A6D A;  3DPL C;  2BW3 B;  2QCO A;  4PJJ A;  3N97 A;  2DA7 A;  5DV5 A;  4D0P A;  1KQ9 A;  2RV8 A;  2HOA A;  3BG3 A;  3H0D A;  1SFE A;  4M72 A;  2Y30 A;  3E6M A;  3FWE A;  3SHF A;  4AIK A;  1SD6 A;  2P6S A;  2DO7 A;  3CQZ J;  3PNV A;  2JRT A;  4PJN A;  4QLC U;  5EGO B;  2MFZ A;  2A6E F;  3MVP A;  2CG4 A;  4II2 A;  2AHQ A;  4O6J A;  4XSZ F;  2QQB A;  3LNQ A;  3IC7 A;  1R5G A;  5FRN A;  1O7F A;  3OSG A;  3TOB A;  2WB1 N;  5B1A H;  5HDK A;  1Z67 A;  3MZH A;  2MSY A;  2VPL A;  1SAU A;  3H0G J;  4W1U A;  4G7Z F;  5J4V A;  3GBG A;  4S05 A;  2ZXW H;  3EQL F;  3W2A A;  1OR7 A;  1PJR A;  2HQN A;  5EZG A;  1WSU A;  2OTJ I;  2VAS A;  2HQR A;  1S7A A;  2R0Q C;  2DPU A;  2VC0 A;  4RB2 C;  2L9V A;  2EZI A;  4MGR A;  2EFQ A;  2BY1 A;  2E1M C;  5M3M J;  5E3O A;  2D5V A;  1FBS A;  3E1S A;  3FM3 A;  3OIP A;  1XMA A;  2YX4 A;  4E7I A;  2MGQ A;  4XLF A;  2DLL A;  3WU1 B;  1NG6 A;  3ASN H;  2XHK A;  2LY2 A;  1FOK A;  2AO9 A;  2BY3 A;  1S7E A;  3OL3 A;  4PJM A;  1RZ4 A;  4ZYD A;  2RKH A;  2DFF A;  1UG0 A;  1YRN B;  4HLX A;  3OIO A;  2M4G A;  2K9N A;  3K10 A;  1U8B A;  1X3U A;  2E1O A;  4DBQ A;  4Y52 J;  1S7O A;  1SVO A;  2NOG A;  2O61 A;  1T0F A;  1MBF A;  1Z6T A;  3QAH A;  1U9O A;  4G94 A;  4GO1 A;  4MQ9 F;  1VQL I;  4RLQ A;  3S2D J;  2DK8 A;  3K70 C;  1ZLJ A;  3SDB A;  2VI6 A;  4KT5 C;  4CCJ A;  5BQT A;  3GTJ J;  3O6B B;  1MSF C;  4PZJ A;  1QPM A;  2BY2 A;  5AIQ A;  1U5T B;  2N8G A;  2R7D A;  4N9I A;  5FRM A;  4D9J A;  4UVA A;  3DEW A;  4BEH A;  2D45 A;  4M3B A;  4CIC A;  3CF5 F;  2XB5 A;  2D1V A;  3P5J A;  1JE8 A;  4Q4Z F;  2RNG A;  2RVC A;  4M3F A;  1YW9 A;  2XRN A;  2X51 A;  2Z16 A;  2KDO A;  2EZK A;  5HDG A;  4DGW B;  1FYK A;  1MBH A;  2JVG A;  2F2E A;  1GT0 C;  1BIB A;  4B8X A;  4FHT A;  1YS6 A;  5EEA A;  5F0F A;  3RQI A;  2Z3Y A;  1REP C;  5D5W B;  2LY1 A;  1KU3 A;  1UEL B;  3JR9 A;  3CUQ C;  1R9T J;  3FXL A;  4XIC A;  2BHY A;  4ITV A;  1X1P A;  4BDZ A;  1QA6 A;  4D7N A;  4KT6 A;  1HKS A;  3F8M A;  3QYB A;  4PSW A;  3BR6 A;  3FKJ A;  4LG0 B;  1LEA A;  2W48 A;  2R93 J;  2X6O A;  1R23 A;  5LHH A;  2KIF A;  2VT2 A;  4LGW A;  4DZJ A;  2E2H J;  2CW0 F;  4A3L J;  1WJD A;  2CSO A;  2W82 A;  3ONQ A;  4HF0 A;  2VBX A;  4LFU A;  3JAM Z;  3IL2 A;  4ZH4 F;  4KJZ A;  4UVC A;  3D1N I;  2JK3 A;  2QEN A;  3CCY A;  4HBL A;  5J1U A;  3A03 A;  5LHI A;  4CYC B;  3QYF A;  1HF0 A;  1N75 A;  3QPS A;  3CCJ I;  2IPQ X;  1QNT A;  4BQQ A;  3O3K A;  5D5U B;  2VPR A;  5EJC A;  1HQC A;  1P4W A;  2MYS A;  3S93 A;  2NNY A;  1SEU A;  1ETY A;  2ZC2 A;  2VT3 A;  3ABU A;  2ME6 A;  1SVL A;  1E3O C;  3TMO A;  2K27 A;  2IW5 A;  1R1U A;  3M07 A;  4PJ0 C;  2LVS A;  1MMA A;  1JUM A;  4EJW A;  3A01 A;  2UV1 A;  4UUV A;  3VOE A;  4LG3 A;  2L7Z A;  4Y17 A;  2IXS A;  1VQ4 I;  4LB5 A;  2E1N A;  1RC9 A;  3CP2 A;  5F64 A;  2W7N A;  2XRO A;  3QWL A;  2Z1D A;  4IPA A;  5IOY A;  2QF7 A;  3FK7 A;  4A3M J;  1H9G A;  3F3X A;  1FOY A;  2VOP A;  2FNP A;  4YFN F;  2X0L A;  4BJ6 C;  4LLN A;  3QRF F;  3LSH A;  2VKD A;  5KNL A;  1UJ8 A;  2YU3 A;  4ENN A;  2HXI A;  1GDT A;  2NS7 A;  4KMF A;  3G71 I;  5C4X J;  1XSV A;  1E17 A;  2VJJ A;  2QKM B;  2QQA A;  4BY7 J;  4IQJ A;  3FDY A;  4UB6 C;  1BW5 A;  1JI8 A;  1APL C;  1YS7 A;  3J81 Z;  5IT9 Z;  1YW7 A;  1RR7 A;  2DU9 A;  3R60 A;  4RA2 A;  1BA5 A;  4RAG A;  1IN6 A;  2QYO A;  1YG2 A;  2JPC A;  3U1D A;  1VI0 A;  2XGD A;  1KA8 A;  5IYC J;  4XLP F;  2NVQ J;  4J00 A;  2JA7 J;  3OOP A;  2X85 A;  2VBZ A;  3JAM K;  4DOZ A;  1D3Y A;  4BUP A;  1LQ1 A;  1MNE A;  1DU6 A;  2E5Z A;  2FE3 A;  2HOE A;  1IUF A;  1Q1V A;  4PK4 A;  1G6N A;  1ZRC A;  3CP8 A;  2K40 A;  1DP7 P;  3GFI A;  3IAS 2;  4QPQ A;  2GIZ A;  2DA4 A;  3BG5 A;  2EIM H;  3WTS C;  1D1C A;  2E36 A;  3AG4 H;  4HF1 A;  1ETQ A;  2A69 F;  1QPI A;  1N78 A;  3EET A;  1LDJ A;  2K4J A;  1B72 B;  5CJ9 A;  1GV2 A;  4LK1 F;  4M9X A;  3HB9 A;  3ZMS A;  2V79 A;  1WKM A;  3HOS A;  3BZ6 A;  2EPF A;  3HRT A;  4N4O B;  2O0Y A;  3HSR A;  1HW5 A;  2F5C A;  3CES A;  3V7C A;  3G73 A;  1XX5 A;  3QU3 A;  1LE8 B;  1XGN A;  2KIS A;  1IRX A;  4LLL A;  1FPQ A;  3UR3 C;  2HDD A;  3IAM 2;  1X4O A;  1Y0U A;  1Y8Q B;  5FD5 A;  1USS A;  2RGV A;  4WWC A;  1UG2 A;  1I1G A;  2F4I A;  3N4M A;  5LRR A;  1U78 A;  4M3G A;  2EA4 A;  2QBY A;  4LK0 F;  4C30 A;  2QVO A;  4M3D A;  3HEF A;  3H9G A;  1IXS B;  3MEX A;  5ERI A;  2M45 A;  2DT7 B;  3VYU B;  2R5Z A;  1YX5 A;  3DLA A;  2E34 A;  3GZN B;  1ZGJ A;  4XQF A;  1SFO J;  2R7X A;  2I5U A;  4I2O A;  1IGN A;  4MIM A;  2ZB9 A;  4CCN A;  1DU0 A;  2JQ7 A;  2MA3 A;  3J81 K;  1HW1 A;  5IT9 K;  1X1A A;  2GZW A;  2J5O A;  5TJJ A;  3ZXS A;  2ZSI B;  2ZNY A;  3CJQ B;  4OWR B;  2DA3 A;  3J7A O;  3F21 A;  1G59 A;  1VFC A;  5ED4 A;  1KQ8 A;  2KZV A;  2LLK A;  5IP9 J;  2R7U A;  3G3Z A;  3ZQF A;  2CH0 A;  2XDV A;  4M9S A;  4FT8 A;  1FMV A;  4B09 A;  3GTQ J;  2ECB A;  3S1N J;  1MJ9 A;  4AYB N;  2WV1 A;  1DGW Y;  4CXF A;  3OYB A;  4OU0 A;  2LBF A;  5CQG A;  3BTJ A;  1BR2 A;  2OA4 A;  3KET A;  4AUX A;  4IKF A;  3I0T A;  1KQ0 A;  1Y1W J;  4XKB A;  4DNC A;  4E7J A;  2JJ7 A;  4S0H B;  1TQI A;  3O2P E;  3OV8 A;  2EZL A;  3MN2 A;  4BQO A;  2CV1 A;  5KAF C;  1K61 A;  1QHH D;  3FM5 A;  4YEL A;  2FNA A;  1TQM A;  2BGC A;  3S2H J;  3M9A A;  4BXX J;  2EZH A;  1TNT A;  3R0J A;  5J47 A;  5LHG A;  2DAO A;  1PP7 U;  3DEU A;  1EV7 A;  1K79 A;  3ZOB A;  2W00 A;  1V4R A;  2DDB A;  3WU2 C;  2CFX A;  5L3C A;  1FX7 A;  4BH9 A;  1XGM A;  5CVV A;  1DQU A;  2A61 A;  2IS1 A;  2KRF A;  3CC2 I;  2L0K A;  2CFO A;  1VTN C;  1GXQ A;  3PSF A;  4M6X A;  2STT A;  2GXB A;  2PJR B;  4BHP A;  1HKQ A;  4HQE A;  5IP7 J;  4D5C A;  2Q0O A;  1X4P A;  3FXU A;  2NVU B;  2LF7 A;  3ECH A;  1W0U A;  2AQF A;  4U0V A;  3CMM A;  3IWF A;  3LSJ A;  3I4N J;  2IA1 A;  2NVX J;  4OIQ F;  1V5F A;  2CQN A;  1O4X A;  2E19 A;  4UUS B;  1SFX A;  3L2V A;  1FEX A;  4JK1 X;  4IRI A;  2GWR A;  1AKH B;  4BHB A;  3KX2 A;  2EBI A;  1TTY A;  3BWG A;  3DPT A;  1X2M A;  3LAP A;  2K02 A;  4C2T A;  4KIB A;  4G7H F;  3L2Q A;  1K4S A;  5HLI A;  3HUG A;  4CZZ A;  3QP5 A;  3ERE D;  2FU4 A;  3SJM A;  1QZE A;  1RES A;  5LLQ A;  1D1B A;  2DFH A;  3LWF A;  4OAZ A;  3TBI A;  1SAX A;  1PVE A;  5HOO A;  2F4M B;  2K5C A;  2LF8 A;  2IEK A;  3JRC A;  4M73 A;  5FFX A;  4F92 B;  3EUH C;  2ZXI A;  3FXJ A;  1R1V A;  4WXH A;  3RKQ A;  2VKE A;  3MKL A;  1LNW A;  2BVM A;  2VJ4 A;  3LA2 A;  3DXJ F;  3VSK A;  1TWG J;  2CRG A;  1MBK A;  2CO5 A;  4KIG A;  1IUY A;  4H4K C;  1Z7L A;  2OBP A;  4XOT A;  4EGY A;  4PCQ A;  4BJ5 C;  4RDU A;  2CQK A;  5DDG A;  3NWS A;  3H5A A;  1IO2 A;  5HDN A;  3I9V 2;  4LJZ F;  3WHB A;  4UUS A;  3F72 A;  2XKO A;  1V5G A;  3RKX A;  1K4T A;  2XSJ C;  1A31 A;  4QTR A;  1CQT A;  2LOO A;  3QOE A;  2BEO A;  1SMY F;  4IRH A;  4I98 B;  5KVR A;  2VJI A;  2NAZ A;  3F6O A;  2A5Y B;  2OQG A;  1DDN A;  2FEZ A;  2MH9 A;  2K9S A;  2O5R A;  3F0C A;  2BXZ A;  2DMP A;  3NRV A;  3F23 A;  1Z6R A;  4IOC F;  3L00 A;  4CCO A;  4I99 C;  2EV6 A;  3HM5 A;  3OYL A;  5IPA A;  4L5J A;  3BT9 A;  1K6Y A;  5DUK A;  3WTX C;  1XN7 A;  2BXY A;  1H88 C;  4GFB A;  4OIR F;  2O6G E;  3J7A Y;  1B1B A;  3VPR A;  4IOA F;  3LSK A;  4PJL A;  2MC3 A;  2V9P A;  3JW4 A;  3D0S A;  4LOC A;  5BPD A;  3QPH A;  3UNG C;  4AWX B;  1MKM A;  1WHU A;  3CJN A;  3F22 A;  4L18 B;  5IOZ A;  1FJL A;  3FXR A;  2LFB A;  4HYE A;  3DTE A;  3IWZ A;  2R7R A;  4GYG A;  4IHT A;  4KIT B;  2O8K A;  1KU2 A;  4D5F A;  5FKN A;  2M87 A;  3CC7 I;  3M4O J;  4TV7 A;  5F6F A;  4EM2 A;  2RN7 A;  4IVN A;  1TL8 A;  2HDW A;  3BQZ A;  4B44 A;  4HLY A;  1YW8 A;  3LQR A;  1T2K A;  3Q3S A;  2ZJQ F;  2JA5 J;  2ME0 A;  1LFU P;  3VDX A;  3DPU A;  3RPU A;  3I64 A;  5GAE J;  1FC3 A;  1NK3 P;  1G3W A;  1LVK A;  3B73 A;  1FMW A;  1HA8 A;  3MMY B;  1LJ9 A;  3ZQQ A;  2L9R A;  4F55 A;  4IJA A;  3G6E I;  2IGN A;  1TT5 B;  2XAQ A;  4CGZ A;  1BIA A;  2V7F A;  4CO8 A;  1ETO A;  3OYC A;  1W36 C;  2A68 F;  1GLN A;  4ZYG A;  4OIP F;  4M74 A;  3CCR I;  1LPQ A;  1X58 A;  2H6C A;  4E6K G;  3O8H A;  1LEB A;  4UB8 C;  1MBE A;  2KIM A;  4BXU A;  2E1C A;  2NXN B;  2AS5 F;  3ZR8 X;  1E3H A;  4A3K J;  5HNF A;  1BR1 A;  4U0W A;  2XV4 S;  1Z3Y A;  4XSX F;  4XN3 A;  5C44 J;  3WHC A;  2HTJ A;  2ZME C;  5GAH J;  5FLX Z;  2IA2 A;  2OU2 A;  5EG0 B;  1ERD A;  5H2F C;  2VB6 A;  3RPQ A;  2QSH X;  2UZK A;  5FKO A;  4DQ2 A;  1SMT A;  2CS3 A;  1HDP A;  2K7L A;  1FP2 A;  2XKP A;  3D5S C;  5TIS C;  3ZQ7 A;  2O03 A;  3F8C A;  3FXM A;  1K78 B;  1IG7 A;  2E71 A;  3H3Z A;  2QWW A;  3SQN A;  3MWM A;  1P2F A;  2Y31 A;  1BI3 A;  2VL8 A;  4B48 A;  1X2N A;  1ODD A;  2PJP A;  4GGG A;  3D5R C;  5FKK A;  5KK1 A;  1O3S A;  1ZYR F;  4BQN A;  4IF4 A;  2WAF A;  2MLG A;  4NC6 A;  2HVS A;  2EFW A;  1P9Q C;  1HDD C;  2K9Q A;  2K3F A;  4M6V A;  1YO5 C;  1KU7 A;  1F4K A;  2PMU A;  3BQY A;  4IHS A;  2P0W A;  2DT5 A;  3RPU D;  1A5J A;  3FKI J;  3NWT A;  3WTY C;  1G8X A;  2XF5 A;  3HL2 A;  2L9N A;  2KFD A;  3CUQ A;  5GPC A;  2HQA A;  4XLN F;  5M5X J;  5K5R A;  1J0R A;  1BR4 A;  2X1E A;  3L9F A;  1JKQ C;  4G6D A;  2ZJ2 A;  1Z91 A;  5M5Y J;  2PLY A;  4RAF A;  1B6A A;  2ELK A;  3OR2 C;  3ZN0 A;  1XC5 A;  1FOW A;  3CDL A;  4NQW A;  3IHU A;  3FBI B;  3ZP5 A;  3FMR A;  4L9T A;  2G0E A;  3HOW J;  4DJA A;  4P1W A;  5H20 A;  2OQR A;  1NH3 A;  1CF7 A;  2MLK A;  2COM A;  3EUK L;  4BGD A;  2Z2S B;  4KDP A;  3BCA A;  2Y0S A;  2FUG 2;  2M8G X;  2LR8 A;  3BC8 A;  5EEG A;  3ASO H;  3LQQ A;  1V54 H;  3JSO A;  1UB9 A;  5GAG J;  3BR2 A;  2FQ4 A;  5IYD J;  4HZF A;  3CCS I;  4AVZ A;  2EQR A;  3BG7 A;  1S9H A;  2VQG A;  5GTH C;  1U8R A;  2L01 A;  3CCU I;  3C18 A;  2IGO A;  5FLX K;  4OIN F;  3DBL B;  2Q2E A;  4CH7 A;  3PIP F;  2CQX A;  3K70 D;  3BJO A;  1KON A;  2IS4 A;  1RKW A;  2DQR A;  4B3A A;  3M8J A;  3LAJ A;  1FY7 A;  2L4A A;  4EAT A;  2QZ8 A;  4JP0 A;  2DYS H;  5HLT A;  1BC7 C;  1V3F A;  3A0B C;  1T8I A;  1VQK I;  1PUF B;  1V5E A;  2ID6 A;  3BZC A;  5CVJ A;  2A6H F;  4MNU A;  4BE2 A;  2FF4 A;  2FMY A;  3FXO A;  2Y0S N;  1TZL A;  2HKX A;  3IH4 A;  1NTC A;  2LMD A;  1O3Q A;  2EIK H;  2ZKZ A;  3ZQL A;  3BTL A;  2TCT A;  2F5F A;  3GTL J;  4WF2 A;  1RPW A;  2Y69 H;  1QBJ A;  2RAE A;  1QZZ A;  2DA5 A;  1SD5 A;  1E3P A;  3C1D A;  2BW3 A;  1G3T A;  1OCP A;  3GYH X;  2VKV A;  3HGY A;  3LL7 A;  3E0J B;  2M0M A;  5JHU A;  5EF6 A;  4ZYA A;  3P9I A;  1HCR A;  1YIJ I;  2P7V B;  3RZO J;  1BW6 A;  3J80 Z;  3KEO A;  5EGO A;  1ZG5 A;  5BNG A;  2L4M A;  4X0G A;  2QQ8 A;  3BTC A;  3CLO A;  3ECO A;  2EIN H;  1VQM I;  4MO7 A;  5LGN A;  1FBQ A;  1MJB A;  1S8N A;  2OCE A;  4AIH A;  5JLW A;  5K7H A;  3K4B A;  4XMY A;  2F5V A;  1D8J A;  4H0E A;  2V6E A;  2CJJ A;  4HV5 A;  2LG4 A;  3TL4 X;  3ZMD A;  4W97 A;  5DTD A;  3Q9S A;  2NRA C;  1W5C C;  2W57 A;  2WAD A;  2PMH A;  1WJ5 A;  3SDG A;  2E7W A;  3REO A;  3CJR B;  1U2W A;  4XNF A;  5H6Q A;  4XID A;  2MBF A;  3K4J A;  2DOA A;  4RGR A;  2MAB A;  2HOS A;  4ETS A;  1JTX A;  3WG9 A;  2FQ3 A;  3L2W A;  4RM3 A;  2V9K A;  4GYI A;  1IV8 A;  2A07 F;  1YRN A;  3K9T A;  5DCM B;  3R0A A;  3VB2 A;  3A1Y A;  4EV0 A;  5J8C A;  1R1T A;  1IV6 A;  2M7A A;  3B6C A;  1ZGA A;  4KN7 X;  4QPO A;  3H3V K;  1J2X A;  1JT6 A;  2P5V A;  1MDM B;  1ITY A;  1TC3 C;  2GA1 A;  5CVI A;  1K6O A;  1DP3 A;  3HTU A;  1XPX A;  3KPH A;  3W3C A;  1LFB A;  4A3J J;  2GXG A;  3LSM A;  3I55 I;  5B1B H;  2VOD A;  2DMN A;  3MQ0 A;  4CA0 A;  2DK5 A;  2Z99 A;  3ABK H;  1BC8 C;  3FIW A;  3LSR A;  2TDX A;  1U5T A;  3GZ5 A;  3KZI C;  3H35 A;  3K4L A;  3OYF A;  3I3L A;  1IZ1 A;  2VLA A;  3J80 K;  3AG1 H;  5BMZ A;  2IP2 A;  1SD4 A;  4XLH A;  2R92 J;  1U9N A;  3K1M A;  3DP7 A;  2DTZ A;  4Y7N J;  3NEU A;  1RR8 C;  3IRQ A;  2KJC A;  1A35 A;  3OYM A;  3RYP A;  3BR0 A;  3GTP J;  2NNN A;  3U2R A;  4DBR A;  1SC7 A;  3F8F A;  1F43 A;  3F6V A;  3PQJ A;  3HPG A;  1KGS A;  5K7Z A;  4IHY A;  5FKM A;  4HNU A;  3JRB A;  1SFK A;  3E3V A;  1WI3 A;  3AL0 C;  2JZY A;  3M7G A;  4LIU A;  2MG4 A;  5ILU A;  3NAU A;  4I01 A;  4B4C A;  1ZRF A;  2WAQ A;  2MD5 A;  5C4J J;  1BM9 A;  4R1H A;  2LP0 A;  3I56 I;  2HPI A;  5JVT A;  5FLV A;  4M3E A;  1A04 A;  4LG0 A;  3LFU A;  3RDI A;  1HC8 A;  2AXT C;  3HRM A;  4BNC A;  1YQA A;  1JGG A;  5J8F A;  2Z9O A;  1MBJ A;  2OZU A;  3JRH A;  4EMS A;  1R36 A;  5F08 A;  1HKT A;  2BV6 A;  1P4X A;  3BDD A;  1BJA A;  2WC2 A;  3M1E A;  3QYE A;  1WH5 A;  4M71 A;  1R00 A;  1OCZ H;  4AM3 A;  5FD6 A;  2XB0 X;  4G6Q A;  1MMG A;  1V55 H;  4CYC A;  2O9L A;  1FZP B;  4IHW A;  2M34 A;  2F5D A;  3PL8 A;  4AVP A;  1OJL A;  5C3E J;  1PP8 F;  3HOZ J;  2XUB A;  1I5Z A;  2FOK A;  2HVQ A;  3L2U A;  2HGC A;  1ONV A;  1XDS A;  2QUF A;  1HLV A;  3K4K A;  4YRV A;  5DEQ A;  1TP4 A;  5TRD A;  2ZO4 A;  3KP5 A;  3MKZ A;  5IT3 A;  1T0F C;  1OYI A;  4G9Y A;  1MZB A;  2XPW A;  4LMY A;  3MZY A;  3S14 J;  3BPV A;  3CO6 C;  5LEK A;  3BP8 A;  3RJP A;  4HQM A;  4HNV A;  2DMQ A;  3HHG A;  4F3Q A;  2V1U A;  4KYW A;  1M1E B;  2KDZ A;  4KN4 X;  4YFK F;  1Z0X A;  2H94 A;  3I59 B;  3CDH A;  1HST A;  3IH2 A;  2KL4 A;  1IN5 A;  3QQA A;  4UVB A;  2XAH A;  3ZMT A;  4EJO A;  4F93 B;  1J75 A;  2KKO A;  2RQQ A;  3GCM A;  4LD5 A;  5KHD A;  4ESF A;  2JMW A;  2X9D A;  3HOY J;  4DZP A;  1OCR H;  2NS8 A;  2TRT A;  3SEQ A;  2HTS A;  4E4H A;  3HGG A;  2LD5 A;  4C9Y A;  2XC7 A;  4NC8 A;  4HA8 A;  2GM4 A;  1G2H A;  1OCO H;  3PUB A;  1C0W A;  1P6R A;  1NHA A;  2W1O A;  2W84 A;  3JRE A;  4A6E A;  5JVG F;  3EUH A;  3ISP A;  3KP7 A;  1YJN I;  1QGP A;  5E1X A;  3U9G A;  3EPZ A;  2VOO A;  2LKP A;  4ON0 A;  1MGT A;  2XAU A;  5ILV A;  5AIP A;  5L3B A;  3CD6 I;  2ISZ A;  3HSF A;  4HRI A;  4ZDP A;  5E79 C;  2QLZ A;  2JVH A;  4UY8 I;  1XMX A;  2EIL H;  3D5L A;  1S3J A;  3KCC A;  4IHX A;  2V9V A;  1H8A C;  2JSC A;  4P9F A;  1B72 A;  2ELJ A;  2V6C A;  1OIS A;  3DF8 A;  3B02 A;  3HSE A;  3JCU C;  3BR1 A;  3H9J A;  1WJC A;  4XKW A;  2G9W A;  1VF9 A;  4ENK A;  1XCB A;  3I53 A;  2DFE A;  2Y9Y A;  3I54 A;  1TWF J;  1LE8 A;  3U1K A;  2ZFW A;  3G4S I;  2W25 A;  4KIS A;  3DQV C;  2A05 A;  1GHC A;  3E5U A;  3GX4 X;  1WJB A;  3KYC B;  1YHQ I;  4EM0 B;  2DI3 A;  1KZH A;  1XDU A;  2VKH A;  2RC4 A;  3PNY A;  1T08 B;  4A69 C;  3E6D A;  1JUP A;  2ZSH B;  3JRI A;  3MKY B;  1WJF A;  1ZGW A;  3GFM A;  1ETV A;  1RI7 A;  2I8D A;  2O3F A;  2VIX A;  1D0Y A;  2M0C A;  2RDP A;  3K4M A;  1W5T A;  1U0J A;  1BI0 A;  4A3G J;  5D5V B;  3L1P A;  4YG2 F;  4WXD A;  4EJT A;  5FRO A;  1Y8R B;  1W7P B;  2XF6 A;  3RYR A;  4BS9 A;  3R61 A;  1TQP A;  1O3R A;  1WQ2 A;  2P8T A;  3G1O A;  2JT1 A;  4U88 A;  2CV0 A;  2HYF A;  2ZME B;  3TW6 A;  2JUG A;  3KP3 A;  1TLH B;  3OYN A;  3GW2 A;  2FRH A;  1BL0 A;  3KEQ A;  1A6I A;  2QEX I;  2IGK A;  2BYV E;  1FYL A;  2EA2 A;  4CCM A;  4HDU A;  2D2W A;  2HU9 A;  1RUO A;  2JRM A;  5E3M A;  1I3A A;  2ZXH A;  3M3Y J;  3HHH A;  1YLF A;  3TP0 A;  3J7Y J;  4A0X A;  3DEE A;  4WX9 A;  1XB4 A;  3AAF A;  3S32 A;  5HNH A;  3X2Q H;  5HOD A;  1JKR C;  3S8P A;  2ELH A;  4XOP A;  4BE0 A;  1S29 A;  4LIT A;  1TBX A;  3HPH A;  4XRS G;  1FWZ A;  3JRA A;  1LFP A;  3ABM H;  4A12 A;  1A6Q A;  5EDN A;  3CCQ I;  4DYQ A;  3HDD A;  1CGP A;  5D6E A;  3S3O A;  1UCR A;  3PFI A;  4Q5S F;  4XBF A;  4GRI A;  4BJT A;  4BYY A;  1FIA A;  1ZK8 A;  3KZZ A;  2VBY A;  4A5M A;  2MC4 A;  3GF2 A;  4BDY A;  5F1J A;  2KPM A;  1WRJ A;  3DLL F;  3ZCO A;  3F9K A;  5D4R A;  1BOB A;  2VBW A;  3OYK A;  1R5H A;  2XAF A;  4G8X A;  4A5N A;  1T6S A;  4YII A;  1ZAO A;  1UFM A;  2PEX A;  3COA C;  2L3D A;  2R7Q A;  2JN6 A;  4CZC A;  4MEY F;  2VUM J;  1FLI A;  2ZJR F;  4QWQ A;  4JX6 A;  2PJR A;  1ZRD A;  3SYT A;  2BOL A;  1Y6I A;  3Q9V A;  5B3S H;  2CUJ A;  2M30 A;  4RGU A;  1O57 A;  2O7O A;  3GWZ A;  2OUM A;  3HG9 A;  3A2K A;  2P6T A;  3AG2 H;  3PUF A;  1R4M B;  4YEJ A;  1BBY A;  1W0T A;  3VYT B;  3IRR A;  2HXO A;  3FF5 A;  3DFG A;  4ANJ A;  3UKG A;  1AA7 A;  2F5E A;  1R49 A;  2DN0 A;  2JA2 A;  2O8X A;  1UZC A;  1AKH A;  1BI2 A;  1H9T A;  3CMY A;  1QHG A;  2OAZ A;  3JTH A;  4P5O A;  5HS8 A;  1VQ5 I;  1IN4 A;  1YIO A;  5DD4 A;  4D7M A;  4EJV A;  1BI1 A;  4XRS A;  4FE7 A;  2M2E A;  5KCM A;  4F91 B;  1B8I B;  2A5W A;  3CZ6 A;  5ILS A;  1XD7 A;  5F0H A;  2ZXJ A;  1Q1H A;  3OS0 A;  1EKE A;  5E18 F;  4E7H A;  3SZT A;  3TQN A;  4IL6 C;  3OIQ A;  2AXL A;  1I1S A;  3P9K A;  5DD8 A;  4C3I J;  3CO7 C;  3CCM I;  2Z33 A;  3FMS A;  5J1R A;  4GXO A;  1MH3 A;  2V1D A;  3C2B A;  3M8F A;  2R7W A;  3I71 A;  4FX0 A;  1Z77 A;  3KIO A;  3TW7 A;  1IAW A;  2K4B A;  2ID3 A;  3CMA I;  4L0Y B;  5BOX A;  4PSX A;  2R7T A;  5HVQ C;  3CCV I;  1UST A;  2VXZ A;  4Z6Y A;  1K7A A;  3CCE I;  3QPL A;  1TWC J;  4JX5 A;  2R5Y B;  2BZT A;  1H0M A;  2HYJ A;  2LK2 A;  3LA3 A;  1I6X A;  2VJ5 A;  3H3U A;  4Q47 A;  3AFH A;  3HXL A;  2NYX A;  3MKW B;  2BY0 A;  3GO5 A;  2VQL A;  1W4M A;  4U7D A;  2L7M P;  2Y2Z A;  1BOA A;  1IJW C;  2R7Z J;  1O7L A;  3TED A;  6PAX A;  1LKX A;  3DU6 A;  3HOV J;  3E5Q A;  3G1M A;  5FB2 A;  3LOC A;  3LA7 A;  4G7O F;  4I02 A;  2HFH A;  1B8I A;  1OYY A;  1DPR A;  1TWA J;  3BOQ A;  1X1B A;  1JJ6 C;  1VQ7 I;  4A2U A;  2M8E A;  2B7E A;  4FTH A;  2DOE A;  2KRC A;  3F8N A;  2F48 A;  2G7H A;  1WJE A;  2XVC A;  3VYR B;  4BBR J;  1ENH A;  4EVI A;  4A3E J;  4JQF A;  2ZNZ A;  3KLO A;  5D8L B;  1ZHF A;  1R5I D;  3GXO A;  1JJ8 C;  2CYY A;  3S3N A;  2HKO A;  3BJ6 A;  4QSH A;  3S2W A;  2JA8 J;  1J09 A;  1WZ2 A;  4JYK A;  3DTI A;  4XRM A;  3K4N A;  4YFX F;  4EGZ A;  4A3F J;  3JTG A;  2WAE A;  3Q0W A;  2CV2 A;  2PQ8 A;  3NQO A;  2COB A;  4CUG A;  2Q8K A;  3TGN A;  1FSH A;  5J1Y A;  1P7J A;  4IQ4 A;  4A3I J;  1D0X A;  1BN5 A;  4IX7 A;  2VN2 A;  1HW2 A;  3GFL A;  4E7K A;  3HZJ A;  1P92 A;  4CDG A;  2KMU A;  2WBM A;  1ZR2 A;  1SD7 A;  1GV5 A;  1ZEL A;  3IV5 A;  3V42 A;  5HS7 A;  5BS6 A;  3R4K A;  1OFC X;  5E3N A;  5FLM J;  3OYJ A;  1GUU A;  1MMN A;  1ZQ3 P;  1R58 A;  3CCL I;  3OL4 A;  4KUM A;  5LRS A;  4MHG A;  1EH6 A;  5FGM A;  4B47 A;  4DW6 A;  1TNS A;  2H09 A;  3HOX J;  4E7L A;  4DYR A;  1VQ6 I;  1G3Y A;  2H1L A;  2XGC A;  2XAS A;  4UV8 A;  3ZMU A;  5B66 C;  3FHN A;  2ZJP F;  3NAR A;  1IXR C;  2NVT J;  4E7S A;  1YOV B;  4FCY A;  4PUS A;  5LGT A;  1SAN A;  2YSR A;  1HOM A;  3GTG J;  5LFA A;  3BTI A;  4BKX A;  5JR3 A;  4HOB A;  5GTI C;  3WGI A;  3IKV A;  2PI0 A;  3PIO F;  1R7J A;  1MJA A;  2EK5 A;  4RB1 A;  4Q48 A;  3RKY A;  4GCV A;  1YJ9 I;  3AL0 B;  2FBI A;  4A93 J;  2V4J C;  1I27 A;  2GOX B;  2R7O A;  2E2I J;  3H5R A;  4IRG A;  2UXX A;  3FK6 A;  3HIF A;  3OOU A;  4R79 A;  4JX4 A;  3ZRG A;  5HLH A;  5EG0 A;  1MMS A;  4WK8 F;  1IDY A;  3DBR B;  1IN8 A;  1VQO I;  2LDU A;  3BRO A;  4E70 A;  3V4G A;  5F27 A;  3WTV C;  5JHF A;  3SZG A;  4XRF A;  4BAC A;  2VQH A;  4RMN A;  1S6L A;  2L02 A;  4XLC A; 
#chains in the Genus database with same CATH homology
 3I58 A;  3VFZ A;  1K78 A;  4ZZD A;  1OYW A;  1JGS A;  5ICF A;  4F7Z A;  2X4H A;  1ON1 A;  1XGS A;  1Z1D A;  4IXA A;  2WWY A;  2VE8 A;  4ESB A;  4PDK A;  2B0L A;  3H92 A;  1QQI A;  3QOP A;  3JSP A;  1Z05 A;  3HRU A;  4I09 A;  2VC1 A;  1KU9 A;  1TW2 A;  3KP6 A;  2DPD A;  1XSD A;  5JI6 A;  4HV6 A;  2K86 A;  3BPX A;  2G7U A;  3FZV A;  3HYI A;  1J5Y A;  4A0Z A;  4MTD A;  4LLG F;  3SFZ A;  3RIR A;  3ROU A;  2EV0 A;  5K1Y A;  1MD0 A;  3ZPL A;  1FT9 A;  4KIF A;  4AIJ A;  2ESN A;  3K0L A;  1IW7 F;  1DPU A;  2RNJ A;  2FBH A;  1YFH A;  3W6K B;  1T38 A;  2DTR A;  4KFC A;  4YIF A;  4ENM A;  2CWE A;  5H6R A;  1AWC A;  3C7J A;  2CGP A;  1FBU A;  3ZN1 A;  3WTT C;  3K1N A;  2EWN A;  3KFW X;  2FSW A;  3KP4 A;  3L7W A;  3ULQ B;  5ICE A;  1LDK B;  3CUO A;  1HBX G;  3ELK A;  4HDV A;  2FBK A;  1F1Z A;  2ZBK A;  3EYY A;  2LSO A;  2Y75 A;  2EJR A;  3FMQ A;  3C3W A;  2V1X A;  2ETH A;  3MAJ A;  1KYW A;  2MH2 A;  5A2Q Z;  3GVA A;  2YR2 A;  4UXN A;  3GEZ A;  2IRF G;  1ULY A;  1J59 A;  2HDC A;  4RAY A;  4HX8 A;  5D4S A;  2P4W A;  2Y0M A;  1ZAR A;  4MEX F;  4L9J A;  3BJA A;  4BHC A;  2IT0 A;  4KNY A;  4Y13 A;  1RUN A;  3QPT A;  4MQV A;  2NS0 A;  1TW3 A;  4U7B A;  2M5W A;  2KJB A;  3W6J B;  4N0B A;  1G3S A;  5DCM A;  2WV0 A;  2OZ6 A;  3GZ6 A;  3WTU C;  1MDM A;  2C6Y A;  2FA5 A;  1XMK A;  3V8K A;  1FP1 D;  1D8K A;  4HF2 A;  1ZH5 A;  1ZG3 A;  1D5V A;  3MFK A;  3WE3 A;  3V7R A;  5LEJ A;  5E8G A;  3ML6 A;  4N9H A;  2HZT A;  2P5L C;  2FXA A;  3WGH A;  4EM1 A;  4EJU A;  1T98 A;  3KZY A;  3E6C C;  5F1R A;  4NHJ A;  3I4P A;  4LB6 B;  2EFP A;  4CYD A;  5A2Q K;  2A3S A;  1B9N A;  1OPC A;  3WGG A;  3T8R A;  3P7N A;  1LVA A;  1ON2 A;  1QO0 D;  2H6B A;  5FO5 A;  3E6B A;  3QU6 A;  4UNO A;  2QBY B;  4P9U A;  2DW4 A;  3P9C A;  1W5S A;  1IN7 A;  2DBB A;  4RGS A;  5DYM A;  3QP6 A;  3T5X A;  2E7X A;  1HXD A;  1RIO H;  1QZY A;  2QM3 A;  4KA4 A;  4I0A A;  2ISY A;  5E1Z B;  3KLN A;  2PBI A;  5J6X A;  3HRS A;  5D8K B;  1UHW A;  2HEO A;  5L3E A;  3M8E A;  3TOA A;  1G4D A;  1DUX C;  2L54 A;  1AOY A;  4OMZ A;  1P4A A;  1XSX A;  4OOI A;  2XAJ A;  3E97 A;  3FX3 A;  1KYZ A;  1U5T C;  1GXP A;  2IJL A;  4L5I A;  5HS9 A;  3I59 A;  3V7S A;  2HR3 A;  1FYM A;  2YPR A;  3KP2 A;  4BAY A;  2BE5 F;  1U3E M;  2GA2 A;  1J9I A;  1ZN2 A;  1B4A A;  2W85 A;  1XGO A;  3TKY A;  1Z7U A;  4WXC A;  4PGG A;  3RTR A;  3FHZ A;  2Z5U A;  4I7H A;  5E1W A;  1LB2 A;  3K1P A;  5FFZ A;  4FX4 A;  3LST A;  5CLS A;  4HAM A;  3RI4 A;  4P96 A;  1IRF A;  3RKW A;  1SFU A;  4M9Z A;  4I0B A;  2OD5 A;  5L3D A;  2LNB A;  5HLG A;  3GLX A;  3DKW A;  2IA0 A;  1JHH A;  4O5V A;  5JFR A;  1ZG1 A;  4RS8 A;  2WTE A;  5CVU A;  4NB5 A;  1IXC A;  4UV9 A;  2XAG A;  5D5X B;  2D1H A;  1ZLK A;  4P55 A;  5LGU A;  2W24 A;  1XCV A;  3EDP A;  2PN6 A;  2R7F A;  5E20 A;  5E17 F;  5CYV A;  2HS5 A;  2BBY A;  4KMU X;  5DCF A;  3K69 A;  1WWX A;  3LFK A;  1FSE A;  1YTY A;  1R22 A;  4AD9 A;  1W7P A;  5DUI A;  1GVJ A;  4ESJ A;  1STZ A;  2ZME A;  2EB7 A;  2JPB A;  4RGX A;  4ZYH A;  4HX4 A;  2J5P A;  4R8H A;  2UXN A;  3T0Y A;  2P5K A;  4OIO F;  1J7K A;  2XGX A;  1U6G A;  3PQK A;  2QQ9 A;  4ENJ A;  2VE9 A;  3K2Z A;  5E8I A;  1LDD A;  1Z9C A;  2P7C B;  3TO9 A;  2GAU A;  3T1B A;  1OKR A;  2PFB A;  4UHT A;  5LBQ A;  5D6F A;  1IRG A;  3V8L A;  1EH8 A;  3MCZ A;  3FXQ A;  2ZCW A;  5BPI A;  1WI9 A;  3KE2 A;  3TDZ C;  3GFJ A;  3SZP A;  1IF1 A;  4Y15 A;  4RB0 A;  2H27 A;  1FNN A;  3IKT A;  4WCG A;  3TO6 A;  2GIV A;  2R3S A;  4CHU A;  3SXY A;  3WTW C;  3V8J A;  1OMI A;  2M1B A;  5L3F A;  5L3G A;  2ACJ A;  3L2C A;  3EYI A;  4EQQ A;  4O3M A;  4U0Y A;  5K5Q A;  1W7P D;  1YYV A;  2GQQ A;  3F8B A;  3GUD A;  2YX7 A;  3WTZ A;  4L9V A;  3VOD A;  5CVR A;  3VEP A;  3ABT A;  3WOD F;  4S04 A;  2ADU A;  4RB3 C;  4M6Y A;  2UWM A;  1F9N A;  3T8T A;  2ESH A;  1HSJ A;  3HOT A;  3ZMV A;  1ZRE A;  1PDN C;  1E2X A;  3WU0 A;  3TO7 A;  4OMY A;  4JBA A;  4MTE A;  1RNL A;  1PUE E;  4PGH A;  3BY6 A;  5EEH A;  3E5X A;  1UHM A;  4BQA A;  5ICG A;  4ZYE A;  1L3L A;  3CTA A;  2HYG D;  3CUQ B;  2EFN A;  3R6S A;  4L9N A;  5ICC A;  2KIU A;  2DFI A;  2EFO A;  2STW A;  2HWV A;  4HX7 A;  2XIG A;  1CF7 B;  4ASN A;  4RAZ A;  2Y48 A;  2RQP A;  4ZZL A;  2DQL A;  3DV8 A;  3ZMZ A;  5AON A;  1T39 A;  2VON A;  1B59 A;  4HW0 A;  3WE2 A;  2EV5 A;  2IVM A;  1F5T A;  4L0Z B;  4KIC A;  1EH7 A;  4Z2Y A;  5K5O A;  1O3T A;  3HTS B;  1B9M A;  1JHF A;  2JTV A;  4K2E A;  3I5U A;  3L09 A;  4A0Y A;  1L0O C;  3Q5F A;  1JXS A;  2PG4 A;  2FML A;  3TDU C;  4A6D A;  3DPL C;  3N97 A;  5DV5 A;  4D0P A;  1KQ9 A;  2RV8 A;  1SFE A;  4M72 A;  3E6M A;  3FWE A;  3SHF A;  4AIK A;  1SD6 A;  2P6S A;  2DO7 A;  2JRT A;  4QLC U;  2A6E F;  2CG4 A;  4O6J A;  4XSZ F;  2QQB A;  3IC7 A;  1R5G A;  1O7F A;  3TOB A;  5HDK A;  3MZH A;  4G7Z F;  4S05 A;  3EQL F;  1OR7 A;  2HQN A;  1WSU A;  2HQR A;  1S7A A;  2DPU A;  2VC0 A;  4RB2 C;  4MGR A;  2EFQ A;  1FBS A;  3FM3 A;  1XMA A;  2YX4 A;  2DLL A;  3WU1 B;  2XHK A;  1FOK A;  1RZ4 A;  4ZYD A;  2RKH A;  4HLX A;  1X3U A;  1S7O A;  2O61 A;  1T0F A;  1Z6T A;  3QAH A;  4G94 A;  4GO1 A;  4MQ9 F;  2DK8 A;  1ZLJ A;  4KT5 C;  5BQT A;  3O6B B;  4PZJ A;  1QPM A;  5AIQ A;  1U5T B;  4N9I A;  2R7D A;  4UVA A;  2D45 A;  4CIC A;  2D1V A;  1JE8 A;  4Q4Z F;  2RVC A;  1YW9 A;  2XRN A;  5HDG A;  1FYK A;  2F2E A;  1BIB A;  4B8X A;  4FHT A;  1YS6 A;  2Z3Y A;  1REP C;  5D5W B;  1KU3 A;  3CUQ C;  1HKS A;  3F8M A;  4LG0 B;  1LEA A;  1R23 A;  5LHH A;  2KIF A;  2VT2 A;  4LGW A;  2CW0 F;  4HF0 A;  2CSO A;  2VBX A;  4LFU A;  3JAM Z;  3IL2 A;  4ZH4 F;  4UVC A;  2QEN A;  4HBL A;  5LHI A;  2IPQ X;  1QNT A;  3O3K A;  5D5U B;  1HQC A;  1P4W A;  2NNY A;  2VT3 A;  3ABU A;  2K27 A;  2IW5 A;  1R1U A;  4EJW A;  4UUV A;  3VOE A;  4Y17 A;  4LB5 A;  2E1N A;  5F64 A;  2XRO A;  4IPA A;  1H9G A;  3F3X A;  2VOP A;  2FNP A;  4YFN F;  2X0L A;  4LLN A;  3QRF F;  4ENN A;  2YU3 A;  4KMF A;  1XSV A;  1E17 A;  2QQA A;  1YS7 A;  3J81 Z;  5IT9 Z;  1YW7 A;  2DU9 A;  3R60 A;  1IN6 A;  2QYO A;  1YG2 A;  2JPC A;  3U1D A;  1KA8 A;  4XLP F;  3OOP A;  2VBZ A;  3JAM K;  1D3Y A;  1LQ1 A;  2FE3 A;  2HOE A;  1G6N A;  1ZRC A;  1DP7 P;  3GFI A;  3WTS C;  4HF1 A;  2A69 F;  3EET A;  1LDJ A;  2K4J A;  5CJ9 A;  4LK1 F;  4M9X A;  3ZMS A;  2V79 A;  1WKM A;  3HOS A;  3BZ6 A;  3HRT A;  2O0Y A;  3HSR A;  1HW5 A;  2F5C A;  3V7C A;  3G73 A;  3QU3 A;  1XGN A;  4LLL A;  1FPQ A;  1Y0U A;  5FD5 A;  1USS A;  2RGV A;  4WWC A;  3N4M A;  1I1G A;  5LRR A;  1U78 A;  2EA4 A;  2QBY A;  4LK0 F;  2QVO A;  5ERI A;  1IXS B;  3MEX A;  2M45 A;  1ZGJ A;  4I2O A;  2MA3 A;  3J81 K;  1HW1 A;  5IT9 K;  2GZW A;  2J5O A;  5TJJ A;  2ZNY A;  3J7A O;  3F21 A;  5ED4 A;  1KQ8 A;  3G3Z A;  4M9S A;  4FT8 A;  4B09 A;  1MJ9 A;  4CXF A;  4OU0 A;  2OA4 A;  3KET A;  3I0T A;  1KQ0 A;  4DNC A;  1TQI A;  3O2P E;  3OV8 A;  3FM5 A;  2FNA A;  1TQM A;  2BGC A;  3M9A A;  1TNT A;  3R0J A;  5LHG A;  2DAO A;  1PP7 U;  3DEU A;  1EV7 A;  1K79 A;  1V4R A;  2CFX A;  5L3C A;  1FX7 A;  4BH9 A;  1XGM A;  5CVV A;  2A61 A;  2KRF A;  1VTN C;  1GXQ A;  4M6X A;  2STT A;  2GXB A;  4BHP A;  1HKQ A;  4HQE A;  2Q0O A;  3FXU A;  2LF7 A;  3ECH A;  4U0V A;  3IWF A;  2IA1 A;  4OIQ F;  1SFX A;  4JK1 X;  4IRI A;  2GWR A;  4BHB A;  1TTY A;  3BWG A;  3DPT A;  3LAP A;  2K02 A;  4KIB A;  4G7H F;  5HLI A;  3HUG A;  4CZZ A;  3QP5 A;  3ERE D;  2FU4 A;  5LLQ A;  3LWF A;  1SAX A;  5HOO A;  2LF8 A;  4M73 A;  5FFX A;  1R1V A;  4WXH A;  1LNW A;  3LA2 A;  3DXJ F;  2CO5 A;  4KIG A;  1IUY A;  2OBP A;  4EGY A;  4PCQ A;  2CQK A;  5DDG A;  5HDN A;  4LJZ F;  3F72 A;  2XKO A;  3RKX A;  2BEO A;  1SMY F;  4IRH A;  4I98 B;  5KVR A;  2NAZ A;  3F6O A;  2A5Y B;  2OQG A;  1DDN A;  2FEZ A;  2MH9 A;  3NRV A;  3F23 A;  1Z6R A;  3L00 A;  2EV6 A;  4L5J A;  5DUK A;  3WTX C;  1XN7 A;  4OIR F;  2O6G E;  1B1B A;  5BPD A;  2MC3 A;  3JW4 A;  3D0S A;  3QPH A;  4AWX B;  1MKM A;  3CJN A;  3F22 A;  4L18 B;  3FXR A;  4HYE A;  3IWZ A;  4GYG A;  4IHT A;  1KU2 A;  2M87 A;  4TV7 A;  5F6F A;  4EM2 A;  2RN7 A;  4IVN A;  4HLY A;  1YW8 A;  3LQR A;  1T2K A;  3RPU A;  3I64 A;  1FC3 A;  1G3W A;  3B73 A;  1LJ9 A;  4IJA A;  2XAQ A;  4CGZ A;  1BIA A;  4CO8 A;  2A68 F;  4ZYG A;  4OIP F;  4M74 A;  2H6C A;  1LEB A;  2KIM A;  4BXU A;  2E1C A;  2AS5 F;  4U0W A;  2XV4 S;  4XSX F;  2HTJ A;  5FLX Z;  2IA2 A;  2OU2 A;  3RPQ A;  2UZK A;  4DQ2 A;  1SMT A;  2K7L A;  1FP2 A;  2XKP A;  3ZQ7 A;  2O03 A;  3F8C A;  1K78 B;  3H3Z A;  2QWW A;  3SQN A;  3MWM A;  1P2F A;  1BI3 A;  1ODD A;  2PJP A;  4GGG A;  5KK1 A;  1O3S A;  1ZYR F;  4IF4 A;  2MLG A;  2EFW A;  1KU7 A;  1YO5 C;  1F4K A;  2PMU A;  4IHS A;  2DT5 A;  3WTY C;  3CUQ A;  4XLN F;  5K5R A;  1J0R A;  3L9F A;  4G6D A;  2ZJ2 A;  1Z91 A;  2PLY A;  1B6A A;  3ZN0 A;  4NQW A;  3IHU A;  3ZP5 A;  3FMR A;  4L9T A;  5H20 A;  2OQR A;  1CF7 A;  2MLK A;  2COM A;  4KDP A;  5EEG A;  3LQQ A;  3JSO A;  1UB9 A;  4HZF A;  1U8R A;  2L01 A;  3C18 A;  5FLX K;  4OIN F;  2Q2E A;  3BJO A;  2DQR A;  3LAJ A;  1FY7 A;  2L4A A;  2QZ8 A;  1BC7 C;  1V3F A;  5CVJ A;  2A6H F;  4MNU A;  2FF4 A;  2FMY A;  2HKX A;  1O3Q A;  2ZKZ A;  2F5F A;  4WF2 A;  1QBJ A;  1QZZ A;  1SD5 A;  3C1D A;  1G3T A;  3GYH X;  5JHU A;  3P9I A;  2P7V B;  3J80 Z;  3KEO A;  1ZG5 A;  2L4M A;  3CLO A;  3ECO A;  5LGN A;  1FBQ A;  1MJB A;  1S8N A;  4AIH A;  1D8J A;  4H0E A;  4HV5 A;  3ZMD A;  2NRA C;  3Q9S A;  2W57 A;  2PMH A;  2E7W A;  3REO A;  1U2W A;  5H6Q A;  2MBF A;  4RGR A;  4ETS A;  3WG9 A;  2FQ3 A;  4GYI A;  2A07 F;  3K9T A;  5DCM B;  3R0A A;  3VB2 A;  4EV0 A;  5J8C A;  1R1T A;  1ZGA A;  4KN7 X;  1J2X A;  2P5V A;  1MDM B;  2GA1 A;  5CVI A;  1K6O A;  3HTU A;  2GXG A;  2VOD A;  3MQ0 A;  2DK5 A;  2Z99 A;  1BC8 C;  2TDX A;  1U5T A;  3GZ5 A;  1IZ1 A;  3J80 K;  5BMZ A;  2IP2 A;  1SD4 A;  3K1M A;  3DP7 A;  3NEU A;  3IRQ A;  2KJC A;  3RYP A;  2NNN A;  3U2R A;  3F8F A;  3F6V A;  3PQJ A;  1KGS A;  3E3V A;  2JZY A;  3M7G A;  5ILU A;  4I01 A;  1ZRF A;  2MD5 A;  1BM9 A;  4R1H A;  5JVT A;  1A04 A;  4LG0 A;  3RDI A;  3HRM A;  4BNC A;  1YQA A;  5J8F A;  2Z9O A;  2OZU A;  4EMS A;  1R36 A;  1HKT A;  2BV6 A;  1P4X A;  3BDD A;  1BJA A;  2WC2 A;  3M1E A;  4M71 A;  1R00 A;  5FD6 A;  4G6Q A;  1FZP B;  2F5D A;  4AVP A;  1PP8 F;  2XUB A;  1I5Z A;  2FOK A;  2HGC A;  1ONV A;  1XDS A;  2QUF A;  5DEQ A;  5TRD A;  2ZO4 A;  3KP5 A;  5IT3 A;  4G9Y A;  1OYI A;  4LMY A;  1MZB A;  3MZY A;  3BPV A;  3CO6 C;  5LEK A;  3BP8 A;  3RJP A;  4HQM A;  3HHG A;  2V1U A;  4KYW A;  4KN4 X;  4YFK F;  2H94 A;  3I59 B;  3CDH A;  1HST A;  1IN5 A;  4UVB A;  2XAH A;  3ZMT A;  4EJO A;  1J75 A;  2KKO A;  4LD5 A;  4ESF A;  2HTS A;  4HA8 A;  1C0W A;  1P6R A;  1NHA A;  2W84 A;  4A6E A;  3EUH A;  3ISP A;  3KP7 A;  1QGP A;  5E1X A;  3U9G A;  2VOO A;  2LKP A;  4ON0 A;  1MGT A;  5ILV A;  5AIP A;  5L3B A;  2ISZ A;  3HSF A;  2QLZ A;  3D5L A;  1S3J A;  3KCC A;  2V9V A;  2JSC A;  4P9F A;  2V6C A;  3DF8 A;  3B02 A;  3HSE A;  2G9W A;  4ENK A;  1XCB A;  3I53 A;  3I54 A;  2ZFW A;  2W25 A;  3DQV C;  1GHC A;  3E5U A;  3GX4 X;  4EM0 B;  2DI3 A;  1XDU A;  2RC4 A;  3E6D A;  3GFM A;  1RI7 A;  2O3F A;  2RDP A;  1W5T A;  1BI0 A;  5D5V B;  4YG2 F;  4WXD A;  4EJT A;  1W7P B;  3RYR A;  1O3R A;  3R61 A;  1TQP A;  1WQ2 A;  2P8T A;  2JT1 A;  4U88 A;  2HYF A;  2ZME B;  3KP3 A;  1TLH B;  3GW2 A;  2FRH A;  3KEQ A;  2BYV E;  1FYL A;  2EA2 A;  4HDU A;  2D2W A;  1RUO A;  3HHH A;  1YLF A;  4A0X A;  4WX9 A;  1XB4 A;  3AAF A;  2ELH A;  1S29 A;  1TBX A;  1FWZ A;  4A12 A;  1CGP A;  5D6E A;  1UCR A;  3PFI A;  4Q5S F;  4XBF A;  4BYY A;  3KZZ A;  2VBY A;  4A5M A;  3GF2 A;  1WRJ A;  5D4R A;  2VBW A;  1R5H A;  2XAF A;  4G8X A;  4A5N A;  1T6S A;  4YII A;  1ZAO A;  1UFM A;  2PEX A;  3COA C;  2L3D A;  4MEY F;  1FLI A;  4QWQ A;  1ZRD A;  3Q9V A;  2M30 A;  4RGU A;  1O57 A;  3GWZ A;  2P6T A;  1BBY A;  3IRR A;  3FF5 A;  3DFG A;  2F5E A;  2O8X A;  1BI2 A;  1H9T A;  2OAZ A;  3JTH A;  4P5O A;  5HS8 A;  1IN4 A;  1YIO A;  5DD4 A;  4EJV A;  1BI1 A;  5ILS A;  1XD7 A;  2ZXJ A;  1Q1H A;  5E18 F;  3SZT A;  3TQN A;  2AXL A;  1I1S A;  3P9K A;  5DD8 A;  3CO7 C;  2Z33 A;  3FMS A;  4GXO A;  2V1D A;  3M8F A;  3I71 A;  4FX0 A;  1IAW A;  2K4B A;  4L0Y B;  5BOX A;  5HVQ C;  1UST A;  2VXZ A;  1K7A A;  1H0M A;  3LA3 A;  4Q47 A;  1I6X A;  3H3U A;  2NYX A;  3GO5 A;  1W4M A;  4U7D A;  1BOA A;  1O7L A;  6PAX A;  3E5Q A;  5FB2 A;  3LA7 A;  4G7O F;  4I02 A;  2HFH A;  1OYY A;  1DPR A;  3BOQ A;  4A2U A;  2M8E A;  3F8N A;  2G7H A;  2XVC A;  4EVI A;  4JQF A;  2ZNZ A;  3KLO A;  5D8L B;  1ZHF A;  3GXO A;  2CYY A;  2HKO A;  3BJ6 A;  3S2W A;  4YFX F;  4EGZ A;  3JTG A;  2PQ8 A;  3NQO A;  2Q8K A;  3TGN A;  1FSH A;  1HW2 A;  1BN5 A;  2VN2 A;  3GFL A;  1P92 A;  4CDG A;  1SD7 A;  5HS7 A;  5BS6 A;  3R4K A;  1R58 A;  4KUM A;  5LRS A;  4MHG A;  1EH6 A;  5FGM A;  1TNS A;  2H09 A;  1G3Y A;  2XAS A;  4UV8 A;  3ZMU A;  1IXR C;  5LGT A;  2YSR A;  5JR3 A;  4HOB A;  3WGI A;  3IKV A;  2PI0 A;  1R7J A;  1MJA A;  2EK5 A;  4RB1 A;  4Q48 A;  3RKY A;  4GCV A;  2FBI A;  1I27 A;  4IRG A;  2UXX A;  3HIF A;  4R79 A;  5HLH A;  4WK8 F;  1IN8 A;  2LDU A;  3BRO A;  4E70 A;  3V4G A;  3WTV C;  4XRF A;  1S6L A;  2L02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...