2NRRA

Crystal structure of the c-terminal rnaseh endonuclase domain of uvrc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
139
Chain Sequence
MEALEELMKLLNMKDFPYRIEGIDISHLYTVASLVVFEDGFPKKGDYRRYKIDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLATVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 44
structure length 139
sequence length 151
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrrA00
2NRZA 2NRTA 3C65A 2NRWA 2NRVA 2NRXA 2NRRA
chains in the Genus database with same CATH superfamily
2BE2A 3QBWA 2YNIA 1IG8A 3QEIA 1RBTA 4DLGA 2OANA 2YNHA 4IDHA 3NH2A 3PX6A 3K0SA 4I2QA 2NZTA 1BIUA 2OZMA 3C6TA 4GVMA 4E1NA 2B5JA 3ZEUB 4IBNA 1KLNA 3VTHA 3PLAA 4K43A 3J81O 4JI7K 5AQGA 3HP9A 4KTQA 4BR2A 4IFVA 3IMXA 3PO4A 4JHDA 1HPZA 1YTAA 4CECA 3EYZA 4HTLA 4B8AB 3M1FA 3L3VA 1WNSA 1KQSM 4B9NA 4BC5A 3MWPA 4YFUA 4CF0A 4BR4A 4DF4A 5KRSA 1TUUA 1NKEA 4AHTA 2XY7A 4O8KA 4BRFA 3V4IA 1X9SA 2ZJRL 4I9LA 1D4XA 3IFRA 4IEIA 3JSMA 3SBGA 5AQJA 3C0BA 3QMLA 4LY7A 2QKKA 2E88A 3NVKA 4FJ7A 3I56N 4H5VA 4OPHA 3CPWM 3LDLA 4DFMA 2P5OA 1NG9A 2DFEA 1C0UA 2Q31A 1X1PA 3RVCA 1HR0K 3NGYA 3SPYA 3MN5A 2HHHK 2GUPA 4JKGA 1NJZA 4FZXC 2OZSA 4CZKA 4PKHA 4MLHA 3V9XA 4JD2B 2ZM6K 1RCHA 3NF6A 4CHQA 3O9RA 4FLUA 5KTQA 3RRGA 3K2PA 4C8NA 3LP0A 3BUZB 1K6YA 5CZ2A 3ZEUA 2NRXA 5C2FA 1HPMA 4FWPA 3OBWA 3CF5L 1HYVA 3C7NA 3OS1A 4FCYA 2PYLA 4M3ZA 2PZSA 3K5OA 4E7JA 3WXMB 4BRGA 3P83D 4DCHA 3NBPA 2P9PA 4B9LA 2Q3SA 3PSIA 5C12A 3A2FA 1Y97A 3FZKA 2ZE2A 3PIPL 2HW3A 5C42A 3E9OA 2A1SA 3ZSRA 4FVUA 4NCBA 3HPOA 3DLHA 1JLCA 2F8SA 1R59O 1VRTA 5IWAK 5J2PA 2W40A 2RE2A 3BY5A 2NRHA 4FZYA 3QLHA 1LWEA 3IG1A 3O9SA 3EL2A 1GLCG 4KTZA 4RWTA 3K9JA 3H46O 4ISEA 2VCPA 4DTRA 2KFNA 3UKUA 3QIPA 3PX0A 4LSLA 3RRHA 4CZHA 3GE1A 1SUQA 5E84A 1NKCA 4CJVA 5JMVA 3WXKA 2NLXA 5AQHA 3HZ6A 3K5LA 4RW8A 3OYKA 1VSJA 4HCBA 3EE9A 4CHOA 3LM9A 1N8RO 2WONA 1RDUA 4C8KA 3L8BA 4MLEA 4YOVA 3AVLA 2ITMA 2QK9A 2JGUA 3O4NA 1KD1O 1XC9A 2VQFK 1TK8A 4CJ5A 3ZLJA 2VG7A 3CCEN 4KHNA 4KH5A 1EKEA 2VWJA 3B6OA 5BRFA 2IIRA 4ZTFA 5IT9O 4CF1A 3H45C 2ZJPL 4IO9L 4ID1A 4FJLA 1RTDA 1K8KA 4C8LA 3VESA 3CQYA 4OLBA 5C15A 5GAGP 4FWSA 5AQUA 1TKTA 2XY8A 2E6MA 1WSEA 3E66A 1DKGD 2P51A 2HOEA 1BHLA 1HNIA 5AQOA 3ZCMA 3HPHA 4CK3A 3OYGA 1TVRA 3A8YA 4A2BA 3KTQA 2IOCA 2IVOA 3V1RA 3WT0A 3J7ZO 3V1OA 4O5BA 4YDUC 1YUWA 4DQQA 2YI1A 4BR0A 5I9EB 3D2EA 4A5AA 2Y1JA 3O08A 4I6MB 1D5AA 3L2UA 3ZSQA 2E20A 4FJ5A 4O8UA 1MDUB 1NGIA 2Q0RA 3VQPA 3VQCA 5AQLA 3SJHA 4FM0A 3KHYA 2Q1NA 1SZ2A 3SNNA 3LAMA 5BPLA 3P4IA 3VQEA 3ASMA 4BE2A 1KFSA 1QSLA 4ILJA 1RTJA 3OYJA 2HHXA 4CEBA 4E89A 3M8QA 2HF3A 3MCPA 3SMPA 5C0YA 1JLFA 3H3NO 4B1UB 4BGBA 2O8FA 1NK9A 2QWOA 1YF5L 4CE9A 1RBVA 4DR7K 3CC2N 3C6UA 4O44A 1REVA 5LY3A 3MEDA 1FJGK 1ASUA 3DWLA 4XH5A 2QWNA 2QWRA 5CYQA 4RW7A 3OYCA 4V19S 4DLEA 1VQLN 2P9UB 3HP6A 3ZX2A 3MK6A 2R7YA 1NBWA 3V9SA 3WQTA 1ZC6A 2A3ZA 1TL3A 3TTCA 5FPEA 3TWHA 3LP3A 3J7AP 1RGIA 3ENOA 4HUFA 4DV0K 3MXMA 4U67L 5LJWA 1XUPO 5KRTA 4M41A 2DPNA 4CGDA 2A5XA 1VAZA 4RW6A 1TKDA 4FWLA 4GMJB 3ZX3A 1KCFA 3LDPA 3UKRB 3LWLA 3OTOK 1Q7YO 3DOLA 3ZSWA 3VGLA 4KI6A 4LFCK 2GWKA 3M5RA 4DR1K 4I6MA 4CJ7A 3W3DA 3SI6A 1RTHA 3V6DA 1WOQA 1TKXA 1QVFM 3HPGA 3LPUA 3NDKA 4KHQA 4E7KA 4KHPK 4FJXA 1VSMA 1IKXA 2YV0X 1DTTA 3TI0A 1RT5A 3PUFA 4R5PA 5AQXA 4KB1A 2QWQA 4N76A 1BL3A 3JXUA 5C2DA 3PV8A 2G8VA 3VQ4A 4G9ZA 1ATNA 3HK2A 1T6CA 1Q82O 5KI6A 4H5TA 4YOYA 3CPEA 3H1VX 2QWPA 4BQZA 2HF4A 4NCAA 4WCEL 2GTDA 3V81A 1K8AO 3H3OB 5AFUA 2NRRA 2P9NB 1J53A 3AO5A 1DEJA 5SZTA 1U2VB 2BANA 4NYNA 5KPRA 4B3MK 3KLGA 3ZSOA 4M45A 3IUCA 4PY5A 3LALA 3L0QA 3LAKA 3OYEA 3O9TA 2P9UA 2G8KA 1UA0A 1IBMK 4DV5K 4K8XA 4FJHA 3MX2A 4BRKA 4M42A 1IBKK 3U8XA 3LP1A 4FJ9A 3L2RA 4E7HA 4CJQA 3FGUA 4HTUA 4Z94A 1WSHA 1EWRA 2FBXA 3CJ1A 1NLVA 3FFIA 5DM6L 4A57A 1HJOA 2KHOA 2CGLA 2HBJA 1QQNA 3AA3A 2YNGA 3NF7A 3IS9A 1KVCA 1S1VA 4W5TA 2QEXN 5AQPA 1C1AA 3G0ZA 2WOMA 1P8ZA 2HVHA 3HSCA 5I42A 4IDKA 3DXMA 1NJIO 2Y1IA 4HCCA 4PKIA 2FBVA 3J8AA 1X9WA 4JKDA 1W97L 3DOKA 4FVMA 2E5LK 2YHWA 4O0JA 1EP4A 3SQ0A 1RBUA 3MXJA 1QHTA 3VERA 4CZJA 2OCEA 5AR0A 4DTNA 2G8HA 4IJAA 1GLDG 4B3RK 3SBTA 2QI2A 2CGJA 2YJFA 3T69A 4BR5A 3DRRA 4H4OA 4DFPA 4E1MA 4FWKA 3Q7BA 4PA1A 2NRVA 3LDNA 1OH8A 3KLIA 1TKZA 1JCGA 4C8MA 2EHGA 1VSHA 3O3FA 4DFJA 3L3UA 3KD5E 1BQMA 5AQMA 1W9HA 3HYFA 4W5NA 5GAHP 4J2AA 3N4PA 3CIPA 4FJMA 2E4LA 1RDDA 3K59A 3S3MA 4LH4A 1EXQA 4JKAA 4DV3K 3CG7A 4DHYA 4GVEA 2P9KA 2E2NA 4B3OA 2ETJA 1ZXOA 1KXPA 3MECA 3NFAA 4FZZA 1EETA 5FROA 1XHZA 3O6WA 4LF6K 2F7TA 3VA3A 4ISGA 1T8EA 2NRZA 4JN4A 4DU1A 1DTQA 5LMUK 3OYLA 1T03A 4EHUA 4CJEA 1ITGA 3R9PA 4BC2A 3BGRA 4FLXA 1XQSC 2WBNA 4OO1J 1IH7A 4UQGA 3AVFA 4KHYA 4FL9A 4IWVA 3AAQA 5M1OA 2H3GX 2WFBA 4BACA 1QTMA 2OA8A 1RT4A 3B6PA 1VHXA 3FLCO 3D45A 3ZT2A 3VEOA 1NGAA 4TSXA 4DSEA 1ZBIA 3CCSN 1E4GT 4CJSA 4FW2A 4BVOA 1ZBSA 1NGCA 1XNQK 2OPQA 1KC8O 3ISNC 1ZBFA 1T6DA 1BA1A 4YOTA 2FLOA 1HNXK 1VSFA 1BOTO 3VENA 2PFUA 4OGCA 2VQEK 4FYDA 5JS2A 2LSNA 3AVMA 4DSKA 4DV4K 3AV9A 1UA1A 2ZJQL 4E0DA 3KKSA 3OJSA 4JI8K 4FPAA 1BI4B 2P9SA 3AVCA 1WAFA 3BF1A 4BRLA 2O8EA 3K57A 3KWIA 1TL1A 2UUAK 2A1RA 3U9DA 1LAWA 2V51B 3VEYA 1JXBA 2YHBA 4FOIA 2RKIA 4CZGA 4FJGA 4BQLA 1D9FA 4CGIA 5HP1A 3VQ5A 3I8BA 4K41A 1Q8IA 2E1YA 2QXLA 3TR8A 4CGJA 3KVGA 4I9QA 1TYQB 3PY8A 2ZGZA 4XEIA 2D0PA 3FR0A 3S41A 3OYDA 3SUQA 3NF8A 4IOXA 4PUOA 4DUYK 2BDPA 1IKVA 1NK5A 2O8BB 3LZJA 1BISA 4W5RA 1RNHA 1HJRA 4DTUA 3ID8A 4LH5A 2KFZA 2D0BA 1VQMN 3EKUA 2JWKA 5ELZA 4JRQA 4N5SA 2P1JA 3TSPA 4M3TA 3AAPA 5J1EA 4WQ5A 5CYMA 3AVKA 5EY4A 4I7FA 2I7NA 4JKHA 2F4VK 1N5YA 1C1CA 1CZ9A 4IOCL 4YOXA 1NM1A 1JL1A 3KK3A 2I5JA 1DGKN 4J8FA 4LFBK 3AO4A 1ATRA 5JS1A 4MO4A 3K5NA 2VGMA 2D5RA 1UAXA 1S5JA 1ASWA 1T3VA 4CD1A 4DTPA 2FC0A 1NJXA 3P38A 4FM1A 4CGHA 3IKMA 3FZFA 3GG4A 1NMNA 4FWMA 1NKBA 1OH5A 2G8UA 3CFPA 3CCLN 3HJFA 2O8CA 4H8KA 5AQTA 1NGEA 1RDWX 2YNFA 2QWMA 3THYB 3HBTA 3HRGA 2ZD1A 3AA4A 3VF6A 4CIGA 3WXJA 3TAGA 1HKBA 3QBXA 5AQKA 1G99A 1K9MO 4B9QA 3KLEA 3RTVA 5HBMA 3C6AA 2UYTA 3EKSA 4CCHA 1S1UA 2O4IA 2HMIA 3PX4A 3DXKA 1BO5O 4NO7A 4BRNA 4JS4A 3ALYA 4BC3A 4BRPA 3VA0A 2F9WA 4CBUA 1Q18A 3THWB 5AQRA 3SV4A 2OTLN 1O1WA 3AVBA 4RW9A 3CJ9A 4Z4HA 3V9UA 3ZT1A 4Q5VA 3KD1E 4Q0BA 1HMVA 2EX3A 4HUGA 4JI1K 4PHTX 1YJ9N 4ZTJA 1FKOA 4RTFD 4CIFA 3NGIA 3BP8A 3SUPA 1A5XA 2O8BA 3QESA 1C6VA 2D1KA 1J9AA 3E9PA 1V4SA 2IVPA 4QCLA 5JVHL 3GOIA 4CF2A 4JKCA 1QQCA 3OYHA 1N6QA 3U4LA 3HL8A 3T1YK 4LF5K 2HNYA 5A2QO 4M7XA 4KH6A 4AM7A 2CH6A 2O8DB 3RSEB 3SAHA 3AVHA 4OGEA 2HMPA 2ZGYA 3MWTA 2A40A 3QEPA 1L3VA 2Z1IA 3MN7A 1I94K 4B1XB 1QZ5A 4B1WB 4CJKA 1GLJO 1SKWA 4KB0A 5EVZA 4K42A 1KVAA 3NH1A 4Z4FA 1YXQA 3AO3A 3RR7A 1H1VA 4F8RA 2DTUA 1LOTB 3BZCA 4EZ6A 1SL2A 3UIQA 4C8OA 3V9WA 2FSJA 1TGOA 1KRPA 4OKKA 2A41A 3AA5X 4N56A 4DTSA 1RT1A 1X9JA 4JD2A 4EP4A 3L4QA 3TSQA 5E26A 2VWKA 3NCIA 1I3AA 1UOCA 3D2FB 3OYNA 1L3TA 1HLUA 3QFPA 1CZBA 4JRPA 3FFKB 1BQNA 3U6FA 1JLEA 4JI2K 4HHTA 1OVQA 3WNHA 1G15A 4BRAA 4JV5K 1NGGA 4YNQA 2HNZA 3VQ6A 3OYMA 3PO5A 1GOBA 1HKGA 1VSLA 5HRNA 4CF9A 4IOAL 4B9TA 4A61A 4E3SA 1EQYA 4M7YA 4YORA 3AARA 2ASOA 1ATSA 2Q0UA 3AVGA 4KH4A 1X3MA 5KQDA 3OVNA 3F2KA 4EP5A 4FWRA 3DRPA 3F5TA 4WF9L 3FZHA 5CY4A 4BWJA 4DV1K 4BRHA 3SAFA 3LP2A 3QB0A 4H0VB 4X65K 4HWIA 5KGWA 4IJNA 1UWBA 3KJVA 4DSJA 4LF9K 3T3FA 3G25A 4AM6A 4GW6A 5AQWA 3RSEA 4E1JA 1SKSA 1JLAA 3IDHA 5EXWA 3O1BA 3HI0A 4KKOA 5FRNA 3VQDA 2J4RA 4LSNA 2HHTA 1FKPA 2E8AA 2RPIA 1U6ZA 3A5NC 3MAQA 4NXMK 3MX5A 2HHWA 1Y64A 3EZ5A 3T19A 2B4JA 1YT3A 5F1XA 1C0FA 4KREA 3D7EO 4FOEA 2FF6A 3C65A 3LM2A 3R8EA 4FM2A 1HUXA 4YDUA 1GLAG 4CD3A 5AZJB 5B8HA 1VSIA 4MQ3A 4BR9A 1Z6RA 3DLBA 2ASPA 1C0TA 3CERA 2A42A 5KQ8A 2HHVA 4M3YA 4FJ8A 3T7ZA 3VMFB 3C94A 5CZ1A 2Q97A 3LPTA 4KPYA 1DT9A 3U9ZA 4QOZB 2IC3A 1GLEG 3OJUA 3CCQN 3KKRA 2CH5A 4FWOA 1QS4A 3L2WA 1JKHA 3HM8A 1MWKA 5ADXA 3JS6A 4DQSA 5LJVA 1W0HA 3J80O 5M1FA 2HBKA 3C95A 2GUIA 3CCJN 4IEEA 2G8FA 4CJFA 4F3TA 2UUBK 1F21A 2FSKA 5C24A 3NHGA 2KTQA 5KGXA 5HL7L 1IBLK 2X78A 1S3XA 3G71N 2PAVA 1BG3A 4QS7A 4CEEA 1HQEA 4CJTA 3CJAA 4EAHD 3G4SN 4FLZA 1QE1A 1IKWA 2UXCK 4GY2B 1IKYA 3QFUA 2PBDA 3VQ9A 3SAGA 4F2SA 5FPDA 3ZSXA 3SQ1A 2P9IB 3DJCA 4Z4EA 3CETA 2E6LA 3DRSA 1FXXA 3V1QA 1SQKA 2PY5A 3WNEA 4BGAA 4CFCA 3WUHA 2ITGA 2P9LB 4JKEA 5AZJA 4C1NK 3DYAA 4NYFA 4C1NI 4BE0A 1NGJA 4A5BA 2GELA 1LW0A 3QERA 3I33A 3OBYA 2ZQBA 3QIOA 1YAGA 3UE5A 5CHIA 1I39A 2HNDA 4JKBA 5SWMA 4DFKA 3ZSYA 1WUAA 2OTJN 1LV5A 3KK1A 2NUBA 1Q81O 4OPKA 4RG8A 2IS3A 5AQSA 4CGGA 4AF1A 1VQ6N 1NK8A 1Z25A 3MXIA 4FK4A 4LFAK 3E9LA 3DLRA 3M6GA 4CZEA 4CFBA 4E7LA 2X6NA 1WBBA 1WSJA 1NK6A 4H0YB 3QNOA 1OVYA 3OYAA 1IV0A 5T7BA 3CQXA 4CHYA 3BF3A 4FO0A 1VQ4N 3DMJA 3UKRA 4JI0K 3OHRA 4CGFA 3JYTA 4CZFA 4FWNA 4PKGA 3E1YA 3L2QA 1WSGA 2HVIA 3SMSA 3QEVA 2B6AA 4O55A 1XWLA 5BRDA 3VEVA 3ZX0A 3OS0A 2FSNA 3TAFA 4H03B 3A5OC 4JNEA 1OH7A 3NGZA 3R6MA 3ULEB 3SQ2A 4X62K 1HNZK 4BE1A 2F8TA 1Z05A 4FLTA 1HX1A 4DR2K 1VQNN 4DR6K 1NWKA 4Y1CA 2KZZA 5AQNA 4QAGA 2P9LA 2V7ZA 3SUOA 5FLXO 3S9HA 3TAMA 4BDYA 3VF2A 3HO1A 2DFFA 1C0MA 3TARA 4IZ9A 2P9NA 1JCFA 4DTXA 3F9KA 1U2VA 3DM2A 4MO5A 5C10A 4DS4A 3OA9A 4J2BA 1V4TA 3WEEB 3HOSA 4K8ZA 4BG8A 3ID6A 4BVPA 1KTQA 5F0XA 4AHCA 2IVNA 4N47A 3QEXA 3HXMA 3RMBA 1HKCA 3VEWA 3O80A 1NU0A 4NLBA 2Z1JA 5TKYA 4OKJA 5M1PA 4CFDA 3EEQA 4XIUA 3DI6A 5J2NA 4FSVA 3O3HA 4GKKK 2GBZA 2D4WA 3TAPA 1EO1A 4WQ4C 4JS5A 4PQUA 2NRTA 2WTUA 3EY1A 2OPPA 4DU4A 3SCXA 3JAMO 1KVBA 4F2RA 1KAZA 4GV3A 4KI4A 1YJNN 3IRXA 2VYPA 2D0CA 1A5VA 3HM9A 1YI2N 3I8DA 4DSLA 3CC4N 1M1KO 4JI5K 2Z1GA 2PYJA 3CD6N 3NMUA 4O5FA 4E19A 1LAVA 4IG0A 5HRPA 4BRQA 3P1GA 4MFBA 2YX6A 3SYZA 4XH4A 4CJWA 1IG9A 3DLEA 1VQ8N 1SS6A 3QINA 1RFQA 2UXDK 4HUEA 1C1BA 1BCOA 3KK7A 4FLVA 5HLFA 2Q36A 4IG3A 3WNGA 1RDCA 4PWDA 1VQKN 3N4QA 4Z0UA 2ASMA 4CEZA 5J2MA 3VQAA 4AHVA 2F96A 3D0PA 4H4MA 3ZYYX 3THXB 3ITHA 5FRMA 1JCEA 2W41A 4KHSA 4KBOA 4JI3K 2QA4N 4NB4A 3VQ7A 1N33K 3V9ZA 1QVGM 5AQVA 4AILC 4B9UA 4JK9A 1E4FT 2A6AA 2E2QA 4O0IA 1TK5A 3EO3A 5MLCQ 1HQUA 1NGDA 3QDKA 4CZLA 3QNNA 3SZ2A 4YHHK 1A5WA 1CLQA 3TSUA 4DTOA 2GV9A 3EZWA 4B9VA 5FDLA 1WBDA 2HHQA 1RTIA 4Y0WA 4WQ5C 3CM5A 3PIOL 4I2PA 1LWFA 1HNWK 4Z4CA 3MMVA 4B9SA 2QXFA 3AA2A 1D8YA 1QQMA 3SQ4A 3R3LA 3CFRA 4A59A 4O4GA 3C7NB 5J2QA 5CE3A 4DKWA 4CBWA 3J7YP 1WSIA 2YHAA 2CGKA 3AO2A 1P90A 5AFUH 3ZT4A 1X3NA 1VSKA 2P9PB 2HSTA 1KSPA 1HYSA 3VETA 1GLBG 1YHQN 3GDQA 4CF8A 4DQRA 3AGRA 3O8MA 1NJWA 3AO1A 2BH1A 3TTDA 3CCUN 3BZKA 4M3UA 2KLAA 1RT6A 1W2BM 4EFHA 1U4BA 2RN2A 1BI4A 2O4GA 2X74A 5DK5A 5LL6Z 4DUZK 1VQ5N 3LWMA 3W0LA 2IGIA 4FJKA 3UKUB 4FK0A 1N36K 4CK1A 4WYBA 3H1QA 2HB5A 5JLHA 3I55N 1NJYA 4KO0A 5HRSA 4FJIA 5M1KA 4F9OA 3KWGA 1RT3A 3RMCA 3R1XA 3THXA 3LDOA 3EE8A 4M63C 4DG1A 3RWUA 3FE1A 1TV6A 3VQBA 2I7PA 2NRWA 3KLHA 1VQPN 3DLGA 4QS9A 1TYQA 1GLLO 4LC9B 2WUSA 4CI6A 1BIZA 3U3YA 4CJLA 1RILA 4Z4IA 3QETA 2NNWA 3K5MA 4OJRA 1S9EA 3ATVA 2FF3B 3AVJA 2FBTA 4H0TB 4WFNL 1U49A 4H0OA 1S22A 4KHUA 4CHZA 3QO9A 1RT7A 3F73A 4M3XA 3TAQA 2IDOA 2E2OA 3CMEN 4CJRA 3OYIA 4GV9A 4DQPA 1LWCA 3O4QA 3BEXA 4NLCA 3VOVA 4LF7K 4B9MA 3SJJA 1K8KB 2FXUA 1E3MA 3L6QA 1XC3A 2JWLA 4CEDA 4U7BA 1N34K 5C25A 5FPMA 4BG9A 2XRIA 4H5NA 1NGBA 1GLFO 3H08A 4DWIA 4GKJK 3AVIA 4A62A 2E2PA 4LD0A 4WFBL 3HSTB 2BUPA 4W5QA 3THYA 4EIAA 3VTIA 4DMNA 1W7AA 1XMQK 3D2EB 3O1WA 5KPTA 1BDGA 4NXNK 4JI4K 1U04A 4ELTA 2XHBA 4B1ZA 4UY8O 2DY4A 4DTMA 4WE1A 3D6RA 4CIEA 4DR3K 1BCMA 4QS8A 5BN9A 3WXLA 1T7PA 5EX5A 2YHYA 1SL1A 1L5UA 1NGHA 2ATQA 3DLKA 4K25A 3NH0A 4MDBA 1TK0A 1ILYA 2BTFA 3CMAN 3BDPA 3THWA 3A5MC 4JYAK 1GOAA 1ESVA 5BR9A 4CHNA 2D0OA 4ILGB 1BU6O 1S1WA 1WLJA 4OPAA 4CEQA 1TUYA 4JAXA 2O8FB 3TAEA 4CZMA 2GX9A 3FZLA 1KLMA 4F3OA 4N41A 1C0GA 5GIPA 2RHKA 2F9TA 4J2DA 1R0AA 4JK8A 4X64K 1BWFO 3OYFA 3ZETB 2D0AA 5HOOA 4EZ9A 4EHTA 5DM7L 1NNEA 3C6HA 2FBYA 4FXDA 3S3NA 1VSDA 2UXBK 1NOYA 2KQ2A 1S1XA 4R79A 5TKWA 3DAWA 4IXCA 3MEGA 3SUNA 5HRRA 1WAJA 3CJBA 3AVAA 4KFBA 2UUCK 1S6QA 4J2EA 3HVTA 5F2RA 2YKNA 5FPNA 1JLQA 3AVNA 4C23A 2AA4A 5GADP 2O8DA 4CZIA 1NK0A 2GWJA 4FJJA 4M3WA 5EOYA 3ENBA 3L2VA 1J5OA 4PL8A 2G8IA 1O13A 5HROA 2OPRA 3OS2A 1CXUA 1RBSA 1VQ7N 1B9DA 3A0IX 1VQON 2KKZA 1MWMA 3VQ8A 1Q9XA 3KK2A 1VSEA 3LDQA 1J6ZA 1MA9B 1L3UA 2KW4A 1JLGA 2BGGA 1QZ6A 3KIOA 1M90O 1QSSA 3AGKA 1J5EK 1XHXA 3CM6A 4FK2A 1RDAA 4CERA 1U47A 2JLEA 3WXIA 4AQYK 2VG6A 4RCHA 2HHUA 1NOZA 3D2FA 4OKEA 1OKJA 2Z1HA 1BA0A 4CJ4A 4ISFA 1EX4A 3VGKA 4H0XB 3HTVA 4NCGA 4IO8A 2IAJA 2AP1A 3F9MA 4X66K 2QTDA 1FW6A 2E1ZA 3U3GA 1S1TA 4JEPA 4RW4A 4CESA 1N32K 2HHSA 2KZMA 4Z4GA 1S6PA 4B8CA 5AQYA 4FJNA 3G6EN 4CK2A 4BRDA 1X9MA 4CHPA 5I3UA 5M1NA 3ZETA 4B3SK 1NK7A 4FPBA 4B1YB 3THVA 4JI6K 2YKMA 3SK3A 3CXCM 3B8AX 4OX9K 3CYMA 3LZIA 5M1QA 3TANA 4L8RB 1YJWN 4CW7B 3ULDA 3CFOA 4BWMA 1JL2A 1XNRK 3HVRA 4CFAA 1J54A 1NGFA 3S3OA 1HRHA 1TAUA 2YJEA 4H5WA 4ILHA 4ELUA 2W6LA 2X6SA 5AQQA 1ZBLA 4B08A 3IAYA 2EWSA 3CHWA 5GINA 4OLAA 4BREA 4DV7K 5H1SQ 4PL7A 4DF8A 3VEZA 4CJPA 3MN9A 1ZBUA 2YCHA 3DXMB 1KAYA 4KHWA 4DV6K 2HBMA 4KAZA 3A5LC 3RMAA 2WC9A 2YHXA 3O9QA 4ZHRA 4BC4A 3I0RA 1HYZA 1U45A 3CCRN 3CJ7A 3CQ8A 3VPZA 5GAEP 4DS5A 4K0KK 3NE6A 1HNVA 5JVGL 2AJQA 4DB3A 3I0SA 4FW1A 4AHSA 3M8SA 3TU5A 1YIJN 3MEEA 3Q7CA 5BR8K 3VF4A 1ASVA 4BROA 4LF4K 3KZBA 4KV8A 1BUPA 1VRUA 4JLHA 1S72N 1B9FA 3OYBA 4DTJA 1QSYA 4ELVA 4WFAL 3CCVN 1YVNA 2ZF5O 2P9KB 3LANA 2W6KA 3NF9A 2V52B 4DR4K 2QW9A 4DSFA 1TAQA 3EN9A 3M3ZA 3SPZA 3MDQA 4BR7A 1QHAA 4JKFA 3CCMN 5BPMA 1WB9A 4L3QA 4CJ3A 4DR5K 4B3TK 4IFYA 5BREA 3OY9A 3NAEA 1SKRA 1SL0A 2OYQA 1B92A 2P9IA 4BDZA 4DSIA 1WSFA 3SLCA 2G8WA 1IJJA 1DLOA 4KTWA 3P5JA 4CEAA 4ID5A 2QKBA 3L4IA 5AZIB 2GEMA 5D3GA 4E7IA 2QM1A 4FLYA 3ENHA 1NMDA 1XI1A 4FWQA 5AQZA 3OW2M 3P31A 4A2AA 1JXEA 4BRIA 1BGXT 4KRFA 4DU3A 3K58A 5BN8A 4YOWA 4W5OA 4BRMA 5GIOA 3ZT0A 3RR8A 1U48A 1SV5A 3K9KA 4IKFA 3ZSVA 3QICA 2P9SB 1CXQA 2OPSA 4H0PA 5JLFA 3HOTA 1JLBA 5AJ3K 2O8EB 1L3SA 3LDSA 1QQOA 3LL3A 1RBRA 3WNFA 4IFEA 1Z26A 3M8PA 3NVMA 3O4WA 1WN7A 1S9GA 3CI5A 4CBXA 1KFDA 2W42A 2XO7A 4MDAA 3VQQA 4CJUA 4AHRA 1JJ2M 4XH1A 2VG5A 2QWLA 5AQIA 4HVJA 1YITN 1ZYQA 4BDPA 4DQ8A 1YTUA 3VN5A 1T05A 1MU2A 3KLFA 2UU9K 4OPJA 2VGNA 5E41A 4H5RA 3M8RA 4Y1DA 3DLLL 3T1HK 1Q9YA 2Q2RA 3CC7N 3MCAB 3T1AA 4YOUA 4F4KA 4CEOA 3O5BA 1OH6A 1RDBA 1ZBHA 4JHDB 5K14A 4JK7A 3E01A 1LW2A 5KPZA 3O3GA 1CZAN 3G10A 3VGMA 3TTFA 3ZT3A 4BY9C 3GL1A 4FLWA 4WQ4A 3ULEA 1XMOK 5AQFA 3UB5A 2XY6A 1KAXA 4G1QA 4LF8K 3ZSZA 2ZWHA 3H6EA 5AZIA 1VK0A 3RMDA 4M3RA 4AH9A 5ADXH 3QEWA 1IO2A 1GOCA 2VWBA 4B1VA 4GNIA 1FK9A 1VQ9N 1SAZA 1D9DA 1T44A 4GV6A 4AHUA 2RF2A 3FZMA 3P39A 3AY9A 5BPNA 2V7YA 4OVLA 3PSFA 1EWQA 3HT3A 2HBLA 3TPQA 2O8CB 4YY3K 5BRHA 3WEEA 3ATUA 3SV3A 1LCUA 5DMRA 4CVNE 4CEFA 4DQIA 3GBTA 5CR4A 1YVUA 3TABA 5EU7A 2P5GA 4BRCA 3VEXA 2DFHA 4DV2K 1RT2A 5LMNK 4JKGB 3CJCA 1Q86O 3MN6A 2XY5A 1K73O 1NK4A 3WQUA 3O9UA 5JICA 3DXKB 4ICLA
chains in the Genus database with same CATH topology
1W97L 3QBWA 5ADXA 1IG8A 4WFBL 3JS6A 2OANA 4IDHA 2BUPA 2YHWA 5LJVA 4EIAA 3VTIA 5M1FA 2HBKA 2NZTA 3D2EB 3O1WA 3VERA 4CZJA 5AR0A 5KPTA 1BDGA 1GLDG 4IJAA 3SBTA 2QI2A 3ZEUB 3CCJN 2CGJA 2YJFA 3T69A 3VTHA 4BR5A 4IEEA 3PLAA 4B1ZA 4K43A 4FWKA 4UY8O 3Q7BA 3D6RA 5AQGA 2FSKA 2NRVA 3LDNA 4BR2A 1JCGA 4QS8A 5HL7L 3IMXA 5BN9A 3WXLA 4JHDA 1S3XA 2YHYA 5EX5A 3G71N 2PAVA 1BG3A 5AQMA 1NGHA 4HTLA 4K25A 4QS7A 4MDBA 5GAHP 3M1FA 1ILYA 2BTFA 3CJAA 4EAHD 3CMAN 1KQSM 3G4SN 3N4PA 3CIPA 3A5MC 4BC5A 3MWPA 1ESVA 5BR9A 2D0OA 4ILGB 1BU6O 4BR4A 4OPAA 1TUYA 4JKAA 4JAXA 4CZMA 2GX9A 1TUUA 4GVEA 2P9KA 3FZLA 2E2NA 2PBDA 3QFUA 4GY2B 3SAGA 5FPDA 2P9IB 1C0GA 3DJCA 5GIPA 1ZXOA 2RHKA 1KXPA 3CETA 4O8KA 4BRFA 2F9TA 2ZJRL 4JK8A 1BWFO 3ZETB 1D4XA 1SQKA 5HOOA 3IFRA 4IEIA 4EHTA 5DM7L 3O6WA 2F7TA 4ISGA 2NRZA 4JN4A 3C6HA 4BGAA 3SBGA 3WUHA 5AQJA 3C0BA 2P9LB 4JKEA 4EHUA 3QMLA 5AZJA 4C1NK 4R79A 3R9PA 4BC2A 5TKWA 4C1NI 3DAWA 4IXCA 1NGJA 2E88A 4A5BA 2GELA 3NVKA 3CJBA 3I56N 1XQSC 4H5VA 2WBNA 4OPHA 3CPWM 4OO1J 3LDLA 3I33A 5F2RA 5FPNA 3OBYA 1YAGA 4C23A 2Q31A 2AA4A 3UE5A 5CHIA 3RVCA 4JKBA 5GADP 4CZIA 2GWJA 1WUAA 5EOYA 2OTJN 3ENBA 4FL9A 4IWVA 3AAQA 3MN5A 5M1OA 2GUPA 2H3GX 2WFBA 4JKGA 4PL8A 1O13A 4CZKA 4PKHA 4MLHA 3FLCO 4JD2B 1VQ7N 1Q81O 3A0IX 1VQON 3VEOA 1NGAA 5AQSA 2KKZA 3O9RA 4AF1A 1MWMA 3CCSN 1E4GT 1VQ6N 4BVOA 3LDQA 1ZBSA 1NGCA 1J6ZA 1MA9B 3E9LA 1KC8O 3M6GA 3BUZB 4CZEA 1T6DA 1BA1A 4YOTA 2FLOA 1BOTO 1QZ6A 1M90O 3ZEUA 2NRXA 5C2FA 1HPMA 3VENA 2PFUA 4H0YB 4FWPA 3OBWA 3AGKA 1OVYA 2ZJQL 3CF5L 3CQXA 3C7NA 4FPAA 3BF3A 2P9SA 4FO0A 3WXIA 1VQ4N 4RCHA 3UKRA 3OHRA 3BF1A 3WXMB 4BRGA 3D2FA 4DCHA 1OKJA 4BRLA 1BA0A 2P9PA 3KWIA 4FWNA 4CZFA 5C12A 4PKGA 3E1YA 4ISFA 3FZKA 3VGKA 3U9DA 4H0XB 3HTVA 3PIPL 2V51B 3E9OA 4IO8A 3VEYA 2AP1A 4FVUA 3F9MA 4FOIA 3SMSA 2QTDA 4CZGA 1R59O 4BQLA 2E1ZA 2W40A 4JEPA 2RE2A 5BRDA 3VEVA 2NRHA 3ZX0A 2FSNA 3I8BA 3O9SA 3EL2A 1GLCG 4RWTA 4H03B 4K41A 3A5OC 3K9JA 4JNEA 2E1YA 2QXLA 5AQYA 4DHYA 3G6EN 3R6MA 3KVGA 3ULEB 3H46O 4BRDA 4ISEA 2VCPA 1TYQB 5M1NA 3ZETA 3UKUA 1Z05A 4FPBA 4B1YB 2ZGZA 1HX1A 4XEIA 2D0PA 3FR0A 3S41A 4CZHA 1VQNN 1NWKA 3GE1A 3SK3A 5AQNA 5E84A 2P9LA 2V7ZA 3CXCM 5JMVA 4IOXA 3B8AX 3WXKA 2NLXA 5AQHA 5M1QA 3HZ6A 3VF2A 1YJWN 4IZ9A 2P9NA 1JCFA 3ID8A 3EE9A 1VQMN 3LM9A 3EKUA 1U2VA 4MO5A 2JWKA 5ELZA 5C10A 1N8RO 3TSPA 3AAPA 1NGFA 3OA9A 4WQ5A 1RDUA 5EY4A 2I7NA 1V4TA 3WEEB 4JKHA 2YJEA 3HOSA 4BG8A 3ID6A 4BVPA 5F0XA 4IOCL 4H5WA 4ILHA 4MLEA 5AQQA 2IVNA 4YOXA 4YOVA 1NM1A 1HKCA 2EWSA 3CHWA 2ITMA 5GINA 1VQPN 1DGKN 4J8FA 3VEWA 1ATRA 4BREA 4MO4A 5H1SQ 1KD1O 4PL7A 2VGMA 3O80A 3VEZA 4NLBA 3MN9A 5TKYA 5M1PA 2YCHA 3DXMB 1T3VA 4CD1A 3CCEN 1KAYA 4KH5A 3P38A 3IKMA 3FZFA 2HBMA 3GG4A 4FSVA 4FWMA 5BRFA 2D4WA 2IIRA 3A5LC 3CCLN 1EO1A 4WQ4C 2WC9A 2YHXA 3O9QA 5AQTA 1NGEA 1RDWX 3H45C 2QWMA 4BC4A 2ZJPL 4IO9L 2NRTA 3HBTA 3HRGA 1K8KA 3VF6A 3VESA 3CQYA 3WXJA 5C15A 5GAGP 4FWSA 3CCRN 1HKBA 3QBXA 1KAZA 5AQUA 5AQKA 4GV3A 3CJ7A 1YJNN 1G99A 3VPZA 4B9QA 1K9MO 2VYPA 3E66A 1DKGD 3C6AA 2UYTA 3EKSA 5GAEP 1YI2N 2HOEA 5JVGL 5AQOA 3A8YA 3DXKA 3CC4N 4A2BA 4DB3A 1M1KO 1BO5O 2IVOA 4NO7A 3WT0A 4BRNA 3J7ZO 3TU5A 1YIJN 4YDUC 3Q7CA 1YUWA 2YI1A 3VF4A 4BROA 4BR0A 4BC3A 4BRPA 5I9EB 4O5FA 3CD6N 3D2EA 4A5AA 3NMUA 3KZBA 2F9WA 4BRQA 4CBUA 3O08A 4I6MB 1BUPA 1Q18A 1S72N 5AQRA 2OTLN 2YX6A 4XH4A 3CJ9A 2E20A 4WFAL 4O8UA 1MDUB 3CCVN 1YVNA 2ZF5O 1VQ8N 2P9KB 1SS6A 4PHTX 1NGIA 1RFQA 1YJ9N 4RTFD 2Q0RA 2V52B 2QW9A 5AQLA 3BP8A 3SJHA 3KK7A 3EN9A 3KHYA 2Q1NA 1SZ2A 2D1KA 2Q36A 3M3ZA 3P4IA 5BPLA 3E9PA 1V4SA 2IVPA 3MDQA 5JVHL 4ILJA 3GOIA 4BR7A 3N4QA 1VQKN 1QHAA 2ASMA 4JKCA 4JKFA 3CCMN 2HF3A 5BPMA 3MCPA 4L3QA 3U4LA 3SMPA 5C0YA 3ZYYX 5BREA 3H3NO 1JCEA 4B1UB 2W41A 4BGBA 4KBOA 4M7XA 2QA4N 2QWOA 4NB4A 4KH6A 4AM7A 2CH6A 1YF5L 2P9IA 1QVGM 5AQVA 3SLCA 3CC2N 4JK9A 1E4FT 3RSEB 1IJJA 3SAHA 5LY3A 2A6AA 2HMPA 2E2QA 2ZGYA 3MWTA 3DWLA 2A40A 4XH5A 3L4IA 5AZIB 3EO3A 5MLCQ 1NGDA 2GEMA 2QWNA 2QWRA 3QDKA 4CZLA 2QM1A 3MN7A 1VQLN 2P9UB 1NMDA 3ENHA 3ZX2A 3MK6A 4B1XB 1QZ5A 4B1WB 4FWQA 5AQZA 3OW2M 1GLJO 3P31A 3TSUA 4A2AA 1NBWA 4BRIA 5EVZA 4K42A 3EZWA 3WQTA 1ZC6A 2A3ZA 1YXQA 3TTCA 5FPEA 5BN8A 1H1VA 4Y0WA 4YOWA 4BRMA 4WQ5C 1LOTB 1RGIA 3ENOA 5GIOA 3PIOL 3MMVA 4U67L 5LJWA 1XUPO 2FSJA 2DPNA 3K9KA 1QQMA 3R3LA 2A5XA 2A41A 1VAZA 4A59A 3C7NB 5CE3A 3QICA 4DKWA 2P9SB 4FWLA 4CBWA 1X9JA 4JD2A 3ZX3A 3LDPA 2CGKA 3L4QA 4H0PA 5E26A 3TSQA 3UKRB 5JLFA 3HOTA 1P90A 5AFUH 1Q7YO 3D2FB 3VGLA 1HLUA 1X3NA 2P9PB 3QFPA 2HSTA 3FFKB 1QQOA 3LL3A 3VETA 4IFEA 1GLBG 1YHQN 2GWKA 3GDQA 3M5RA 4BRAA 1NGGA 3NVMA 4I6MA 3O4WA 3AGRA 3O8MA 3W3DA 4CJ7A 1WOQA 1HKGA 2BH1A 3TTDA 3CCUN 3CI5A 1QVFM 4CBXA 2KLAA 4IOAL 1W2BM 4A61A 1EQYA 4EFHA 4M7YA 4MDAA 4YORA 3AARA 2ASOA 1JJ2M 4XH1A 1ATSA 2QWLA 5AQIA 1YITN 1VQ5N 5AQXA 2Q0UA 4DQ8A 2QWQA 3JXUA 3W0LA 3UKUB 5C2DA 4KH4A 1X3MA 4G9ZA 1ATNA 2VGNA 4WYBA 3H1QA 4H5RA 3DLLL 1T6CA 5JLHA 5KQDA 3I55N 1Q82O 3F2KA 4H5TA 2Q2RA 4FWRA 4YOYA 3CC7N 3CPEA 3MCAB 3F5TA 3H1VX 2QWPA 3FZHA 4BQZA 4YOUA 3KWGA 4F9OA 5M1KA 4WF9L 4BRHA 2HF4A 3R1XA 3SAFA 3QB0A 3O5BA 4H0VB 3LDOA 3EE8A 4HWIA 4M63C 4WCEL 4JHDB 4IJNA 2GTDA 3FE1A 4JK7A 1K8AO 3H3OB 5AFUA 2NRRA 2P9NB 5KPZA 1CZAN 2I7PA 2NRWA 3VGMA 4BY9C 3TTFA 3GL1A 1DEJA 4WQ4A 3G25A 3ULEA 1U2VB 4AM6A 5AQWA 3RSEA 4QS9A 5AQFA 3UB5A 4E1JA 5KPRA 1TYQA 1KAXA 1GLLO 3IDHA 5EXWA 3IUCA 2ZWHA 3H6EA 4LC9B 3L0QA 3O1BA 5AZIA 3HI0A 2J4RA 2WUSA 3O9TA 2P9UA 4CI6A 5ADXH 2VWBA 4B1VA 2NNWA 2E8AA 3A5NC 1U6ZA 4GNIA 3MX2A 3ATVA 4BRKA 1VQ9N 2FF3B 3MX5A 1SAZA 1Y64A 3U8XA 4H0TB 4WFNL 5F1XA 4H0OA 1S22A 1T44A 1C0FA 3FGUA 3D7EO 4GV6A 4FOEA 2FF6A 3C65A 3FZMA 3LM2A 4Z94A 3R8EA 3P39A 1HUXA 4YDUA 3AY9A 1GLAG 3CJ1A 4CD3A 2V7YA 5AZJB 5B8HA 5BPNA 2E2OA 3CMEN 1NLVA 5DM6L 2HBLA 3TPQA 4GV9A 4BR9A 1Z6RA 3WEEA 5BRHA 3ATUA 4A57A 3BEXA 4NLCA 1HJOA 3VOVA 1LCUA 2ASPA 3CERA 2A42A 5KQ8A 2KHOA 1K8KB 2CGLA 2FXUA 1QQNA 2HBJA 3T7ZA 3GBTA 3VMFB 5CR4A 3L6QA 4BRCA 1XC3A 2Q97A 3VEXA 2QEXN 2JWLA 4U7BA 5AQPA 1DT9A 3U9ZA 1P8ZA 4JKGB 1GLEG 3CJCA 3HSCA 3MN6A 3CCQN 5FPMA 2CH5A 4BG9A 4FWOA 1Q86O 3DXMA 4H5NA 1K73O 1NGBA 1NJIO 3WQUA 3O9UA 5JICA 3DXKB 4PKIA 1GLFO 3J8AA 3HM8A 4A62A 1MWKA 4JKDA 2E2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRZ A;  2NRT A;  3C65 A;  2NRW A;  2NRV A;  2NRX A;  2NRR A; 
#chains in the Genus database with same CATH topology
 2BE2 A;  3QBW A;  2YNI A;  1IG8 A;  3QEI A;  1RBT A;  4DLG A;  2OAN A;  2YNH A;  4IDH A;  3NH2 A;  3PX6 A;  3K0S A;  4I2Q A;  2NZT A;  1BIU A;  2OZM A;  3C6T A;  4GVM A;  4E1N A;  2B5J A;  3ZEU B;  4IBN A;  1KLN A;  3VTH A;  3PLA A;  4K43 A;  3J81 O;  4JI7 K;  5AQG A;  3HP9 A;  4KTQ A;  4BR2 A;  4IFV A;  3IMX A;  3PO4 A;  4JHD A;  1HPZ A;  1YTA A;  4CEC A;  3EYZ A;  4HTL A;  4B8A B;  3M1F A;  3L3V A;  1WNS A;  1KQS M;  4B9N A;  4BC5 A;  3MWP A;  4YFU A;  4CF0 A;  4BR4 A;  4DF4 A;  5KRS A;  1TUU A;  1NKE A;  4AHT A;  2XY7 A;  4O8K A;  4BRF A;  3V4I A;  1X9S A;  2ZJR L;  4I9L A;  1D4X A;  3IFR A;  4IEI A;  3JSM A;  3SBG A;  5AQJ A;  3C0B A;  3QML A;  4LY7 A;  2QKK A;  2E88 A;  3NVK A;  4FJ7 A;  3I56 N;  4H5V A;  4OPH A;  3CPW M;  3LDL A;  4DFM A;  2P5O A;  1NG9 A;  2DFE A;  1C0U A;  2Q31 A;  1X1P A;  3RVC A;  1HR0 K;  3NGY A;  3SPY A;  3MN5 A;  2HHH K;  2GUP A;  4JKG A;  1NJZ A;  4FZX C;  2OZS A;  4CZK A;  4PKH A;  4MLH A;  3V9X A;  4JD2 B;  2ZM6 K;  1RCH A;  3NF6 A;  4CHQ A;  3O9R A;  4FLU A;  5KTQ A;  3RRG A;  3K2P A;  4C8N A;  3LP0 A;  3BUZ B;  1K6Y A;  5CZ2 A;  3ZEU A;  2NRX A;  5C2F A;  1HPM A;  4FWP A;  3OBW A;  3CF5 L;  1HYV A;  3C7N A;  3OS1 A;  4FCY A;  2PYL A;  4M3Z A;  2PZS A;  3K5O A;  4E7J A;  3WXM B;  4BRG A;  3P83 D;  4DCH A;  3NBP A;  2P9P A;  4B9L A;  2Q3S A;  3PSI A;  5C12 A;  3A2F A;  1Y97 A;  3FZK A;  2ZE2 A;  3PIP L;  2HW3 A;  5C42 A;  3E9O A;  2A1S A;  3ZSR A;  4FVU A;  4NCB A;  3HPO A;  3DLH A;  1JLC A;  2F8S A;  1R59 O;  1VRT A;  5IWA K;  5J2P A;  2W40 A;  2RE2 A;  3BY5 A;  2NRH A;  4FZY A;  3QLH A;  1LWE A;  3IG1 A;  3O9S A;  3EL2 A;  1GLC G;  4KTZ A;  4RWT A;  3K9J A;  3H46 O;  4ISE A;  2VCP A;  4DTR A;  2KFN A;  3UKU A;  3QIP A;  3PX0 A;  4LSL A;  3RRH A;  4CZH A;  3GE1 A;  1SUQ A;  5E84 A;  1NKC A;  4CJV A;  5JMV A;  3WXK A;  2NLX A;  5AQH A;  3HZ6 A;  3K5L A;  4RW8 A;  3OYK A;  1VSJ A;  4HCB A;  3EE9 A;  4CHO A;  3LM9 A;  1N8R O;  2WON A;  1RDU A;  4C8K A;  3L8B A;  4MLE A;  4YOV A;  3AVL A;  2ITM A;  2QK9 A;  2JGU A;  3O4N A;  1KD1 O;  1XC9 A;  2VQF K;  1TK8 A;  4CJ5 A;  3ZLJ A;  2VG7 A;  3CCE N;  4KHN A;  4KH5 A;  1EKE A;  2VWJ A;  3B6O A;  5BRF A;  2IIR A;  4ZTF A;  5IT9 O;  4CF1 A;  3H45 C;  2ZJP L;  4IO9 L;  4ID1 A;  4FJL A;  1RTD A;  1K8K A;  4C8L A;  3VES A;  3CQY A;  4OLB A;  5C15 A;  5GAG P;  4FWS A;  5AQU A;  1TKT A;  2XY8 A;  2E6M A;  1WSE A;  3E66 A;  1DKG D;  2P51 A;  2HOE A;  1BHL A;  1HNI A;  5AQO A;  3ZCM A;  3HPH A;  4CK3 A;  3OYG A;  1TVR A;  3A8Y A;  4A2B A;  3KTQ A;  2IOC A;  2IVO A;  3V1R A;  3WT0 A;  3J7Z O;  3V1O A;  4O5B A;  4YDU C;  1YUW A;  4DQQ A;  2YI1 A;  4BR0 A;  5I9E B;  3D2E A;  4A5A A;  2Y1J A;  3O08 A;  4I6M B;  1D5A A;  3L2U A;  3ZSQ A;  2E20 A;  4FJ5 A;  4O8U A;  1MDU B;  1NGI A;  2Q0R A;  3VQP A;  3VQC A;  5AQL A;  3SJH A;  4FM0 A;  3KHY A;  2Q1N A;  1SZ2 A;  3SNN A;  3LAM A;  5BPL A;  3P4I A;  3VQE A;  3ASM A;  4BE2 A;  1KFS A;  1QSL A;  4ILJ A;  1RTJ A;  3OYJ A;  2HHX A;  4CEB A;  4E89 A;  3M8Q A;  2HF3 A;  3MCP A;  3SMP A;  5C0Y A;  1JLF A;  3H3N O;  4B1U B;  4BGB A;  2O8F A;  1NK9 A;  2QWO A;  1YF5 L;  4CE9 A;  1RBV A;  4DR7 K;  3CC2 N;  3C6U A;  4O44 A;  1REV A;  5LY3 A;  3MED A;  1FJG K;  1ASU A;  3DWL A;  4XH5 A;  2QWN A;  2QWR A;  5CYQ A;  4RW7 A;  3OYC A;  4V19 S;  4DLE A;  1VQL N;  2P9U B;  3HP6 A;  3ZX2 A;  3MK6 A;  2R7Y A;  1NBW A;  3V9S A;  3WQT A;  1ZC6 A;  2A3Z A;  1TL3 A;  3TTC A;  5FPE A;  3TWH A;  3LP3 A;  3J7A P;  1RGI A;  3ENO A;  4HUF A;  4DV0 K;  3MXM A;  4U67 L;  5LJW A;  1XUP O;  5KRT A;  4M41 A;  2DPN A;  4CGD A;  2A5X A;  1VAZ A;  4RW6 A;  1TKD A;  4FWL A;  4GMJ B;  3ZX3 A;  1KCF A;  3LDP A;  3UKR B;  3LWL A;  3OTO K;  1Q7Y O;  3DOL A;  3ZSW A;  3VGL A;  4KI6 A;  4LFC K;  2GWK A;  3M5R A;  4DR1 K;  4I6M A;  4CJ7 A;  3W3D A;  3SI6 A;  1RTH A;  3V6D A;  1WOQ A;  1TKX A;  1QVF M;  3HPG A;  3LPU A;  3NDK A;  4KHQ A;  4E7K A;  4KHP K;  4FJX A;  1VSM A;  1IKX A;  2YV0 X;  1DTT A;  3TI0 A;  1RT5 A;  3PUF A;  4R5P A;  5AQX A;  4KB1 A;  2QWQ A;  4N76 A;  1BL3 A;  3JXU A;  5C2D A;  3PV8 A;  2G8V A;  3VQ4 A;  4G9Z A;  1ATN A;  3HK2 A;  1T6C A;  1Q82 O;  5KI6 A;  4H5T A;  4YOY A;  3CPE A;  3H1V X;  2QWP A;  4BQZ A;  2HF4 A;  4NCA A;  4WCE L;  2GTD A;  3V81 A;  1K8A O;  3H3O B;  5AFU A;  2NRR A;  2P9N B;  1J53 A;  3AO5 A;  1DEJ A;  5SZT A;  1U2V B;  2BAN A;  4NYN A;  5KPR A;  4B3M K;  3KLG A;  3ZSO A;  4M45 A;  3IUC A;  4PY5 A;  3LAL A;  3L0Q A;  3LAK A;  3OYE A;  3O9T A;  2P9U A;  2G8K A;  1UA0 A;  1IBM K;  4DV5 K;  4K8X A;  4FJH A;  3MX2 A;  4BRK A;  4M42 A;  1IBK K;  3U8X A;  3LP1 A;  4FJ9 A;  3L2R A;  4E7H A;  4CJQ A;  3FGU A;  4HTU A;  4Z94 A;  1WSH A;  1EWR A;  2FBX A;  3CJ1 A;  1NLV A;  3FFI A;  5DM6 L;  4A57 A;  1HJO A;  2KHO A;  2CGL A;  2HBJ A;  1QQN A;  3AA3 A;  2YNG A;  3NF7 A;  3IS9 A;  1KVC A;  1S1V A;  4W5T A;  2QEX N;  5AQP A;  1C1A A;  3G0Z A;  2WOM A;  1P8Z A;  2HVH A;  3HSC A;  5I42 A;  4IDK A;  3DXM A;  1NJI O;  2Y1I A;  4HCC A;  4PKI A;  2FBV A;  3J8A A;  1X9W A;  4JKD A;  1W97 L;  3DOK A;  4FVM A;  2E5L K;  2YHW A;  4O0J A;  1EP4 A;  3SQ0 A;  1RBU A;  3MXJ A;  1QHT A;  3VER A;  4CZJ A;  2OCE A;  5AR0 A;  4DTN A;  2G8H A;  4IJA A;  1GLD G;  4B3R K;  3SBT A;  2QI2 A;  2CGJ A;  2YJF A;  3T69 A;  4BR5 A;  3DRR A;  4H4O A;  4DFP A;  4E1M A;  4FWK A;  3Q7B A;  4PA1 A;  2NRV A;  3LDN A;  1OH8 A;  3KLI A;  1TKZ A;  1JCG A;  4C8M A;  2EHG A;  1VSH A;  3O3F A;  4DFJ A;  3L3U A;  3KD5 E;  1BQM A;  5AQM A;  1W9H A;  3HYF A;  4W5N A;  5GAH P;  4J2A A;  3N4P A;  3CIP A;  4FJM A;  2E4L A;  1RDD A;  3K59 A;  3S3M A;  4LH4 A;  1EXQ A;  4JKA A;  4DV3 K;  3CG7 A;  4DHY A;  4GVE A;  2P9K A;  2E2N A;  4B3O A;  2ETJ A;  1ZXO A;  1KXP A;  3MEC A;  3NFA A;  4FZZ A;  1EET A;  5FRO A;  1XHZ A;  3O6W A;  4LF6 K;  2F7T A;  3VA3 A;  4ISG A;  1T8E A;  2NRZ A;  4JN4 A;  4DU1 A;  1DTQ A;  5LMU K;  3OYL A;  1T03 A;  4EHU A;  4CJE A;  1ITG A;  3R9P A;  4BC2 A;  3BGR A;  4FLX A;  1XQS C;  2WBN A;  4OO1 J;  1IH7 A;  4UQG A;  3AVF A;  4KHY A;  4FL9 A;  4IWV A;  3AAQ A;  5M1O A;  2H3G X;  2WFB A;  4BAC A;  1QTM A;  2OA8 A;  1RT4 A;  3B6P A;  1VHX A;  3FLC O;  3D45 A;  3ZT2 A;  3VEO A;  1NGA A;  4TSX A;  4DSE A;  1ZBI A;  3CCS N;  1E4G T;  4CJS A;  4FW2 A;  4BVO A;  1ZBS A;  1NGC A;  1XNQ K;  2OPQ A;  1KC8 O;  3ISN C;  1ZBF A;  1T6D A;  1BA1 A;  4YOT A;  2FLO A;  1HNX K;  1VSF A;  1BOT O;  3VEN A;  2PFU A;  4OGC A;  2VQE K;  4FYD A;  5JS2 A;  2LSN A;  3AVM A;  4DSK A;  4DV4 K;  3AV9 A;  1UA1 A;  2ZJQ L;  4E0D A;  3KKS A;  3OJS A;  4JI8 K;  4FPA A;  1BI4 B;  2P9S A;  3AVC A;  1WAF A;  3BF1 A;  4BRL A;  2O8E A;  3K57 A;  3KWI A;  1TL1 A;  2UUA K;  2A1R A;  3U9D A;  1LAW A;  2V51 B;  3VEY A;  1JXB A;  2YHB A;  4FOI A;  2RKI A;  4CZG A;  4FJG A;  4BQL A;  1D9F A;  4CGI A;  5HP1 A;  3VQ5 A;  3I8B A;  4K41 A;  1Q8I A;  2E1Y A;  2QXL A;  3TR8 A;  4CGJ A;  3KVG A;  4I9Q A;  1TYQ B;  3PY8 A;  2ZGZ A;  4XEI A;  2D0P A;  3FR0 A;  3S41 A;  3OYD A;  3SUQ A;  3NF8 A;  4IOX A;  4PUO A;  4DUY K;  2BDP A;  1IKV A;  1NK5 A;  2O8B B;  3LZJ A;  1BIS A;  4W5R A;  1RNH A;  1HJR A;  4DTU A;  3ID8 A;  4LH5 A;  2KFZ A;  2D0B A;  1VQM N;  3EKU A;  2JWK A;  5ELZ A;  4JRQ A;  4N5S A;  2P1J A;  3TSP A;  4M3T A;  3AAP A;  5J1E A;  4WQ5 A;  5CYM A;  3AVK A;  5EY4 A;  4I7F A;  2I7N A;  4JKH A;  2F4V K;  1N5Y A;  1C1C A;  1CZ9 A;  4IOC L;  4YOX A;  1NM1 A;  1JL1 A;  3KK3 A;  2I5J A;  1DGK N;  4J8F A;  4LFB K;  3AO4 A;  1ATR A;  5JS1 A;  4MO4 A;  3K5N A;  2VGM A;  2D5R A;  1UAX A;  1S5J A;  1ASW A;  1T3V A;  4CD1 A;  4DTP A;  2FC0 A;  1NJX A;  3P38 A;  4FM1 A;  4CGH A;  3IKM A;  3FZF A;  3GG4 A;  1NMN A;  4FWM A;  1NKB A;  1OH5 A;  2G8U A;  3CFP A;  3CCL N;  3HJF A;  2O8C A;  4H8K A;  5AQT A;  1NGE A;  1RDW X;  2YNF A;  2QWM A;  3THY B;  3HBT A;  3HRG A;  2ZD1 A;  3AA4 A;  3VF6 A;  4CIG A;  3WXJ A;  3TAG A;  1HKB A;  3QBX A;  5AQK A;  1G99 A;  1K9M O;  4B9Q A;  3KLE A;  3RTV A;  5HBM A;  3C6A A;  2UYT A;  3EKS A;  4CCH A;  1S1U A;  2O4I A;  2HMI A;  3PX4 A;  3DXK A;  1BO5 O;  4NO7 A;  4BRN A;  4JS4 A;  3ALY A;  4BC3 A;  4BRP A;  3VA0 A;  2F9W A;  4CBU A;  1Q18 A;  3THW B;  5AQR A;  3SV4 A;  2OTL N;  1O1W A;  3AVB A;  4RW9 A;  3CJ9 A;  4Z4H A;  3V9U A;  3ZT1 A;  4Q5V A;  3KD1 E;  4Q0B A;  1HMV A;  2EX3 A;  4HUG A;  4JI1 K;  4PHT X;  1YJ9 N;  4ZTJ A;  1FKO A;  4RTF D;  4CIF A;  3NGI A;  3BP8 A;  3SUP A;  1A5X A;  2O8B A;  3QES A;  1C6V A;  2D1K A;  1J9A A;  3E9P A;  1V4S A;  2IVP A;  4QCL A;  5JVH L;  3GOI A;  4CF2 A;  4JKC A;  1QQC A;  3OYH A;  1N6Q A;  3U4L A;  3HL8 A;  3T1Y K;  4LF5 K;  2HNY A;  5A2Q O;  4M7X A;  4KH6 A;  4AM7 A;  2CH6 A;  2O8D B;  3RSE B;  3SAH A;  3AVH A;  4OGE A;  2HMP A;  2ZGY A;  3MWT A;  2A40 A;  3QEP A;  1L3V A;  2Z1I A;  3MN7 A;  1I94 K;  4B1X B;  1QZ5 A;  4B1W B;  4CJK A;  1GLJ O;  1SKW A;  4KB0 A;  5EVZ A;  4K42 A;  1KVA A;  3NH1 A;  4Z4F A;  1YXQ A;  3AO3 A;  3RR7 A;  1H1V A;  4F8R A;  2DTU A;  1LOT B;  3BZC A;  4EZ6 A;  1SL2 A;  3UIQ A;  4C8O A;  3V9W A;  2FSJ A;  1TGO A;  1KRP A;  4OKK A;  2A41 A;  3AA5 X;  4N56 A;  4DTS A;  1RT1 A;  1X9J A;  4JD2 A;  4EP4 A;  3L4Q A;  3TSQ A;  5E26 A;  2VWK A;  3NCI A;  1I3A A;  1UOC A;  3D2F B;  3OYN A;  1L3T A;  1HLU A;  3QFP A;  1CZB A;  4JRP A;  3FFK B;  1BQN A;  3U6F A;  1JLE A;  4JI2 K;  4HHT A;  1OVQ A;  3WNH A;  1G15 A;  4BRA A;  4JV5 K;  1NGG A;  4YNQ A;  2HNZ A;  3VQ6 A;  3OYM A;  3PO5 A;  1GOB A;  1HKG A;  1VSL A;  5HRN A;  4CF9 A;  4IOA L;  4B9T A;  4A61 A;  4E3S A;  1EQY A;  4M7Y A;  4YOR A;  3AAR A;  2ASO A;  1ATS A;  2Q0U A;  3AVG A;  4KH4 A;  1X3M A;  5KQD A;  3OVN A;  3F2K A;  4EP5 A;  4FWR A;  3DRP A;  3F5T A;  4WF9 L;  3FZH A;  5CY4 A;  4BWJ A;  4DV1 K;  4BRH A;  3SAF A;  3LP2 A;  3QB0 A;  4H0V B;  4X65 K;  4HWI A;  5KGW A;  4IJN A;  1UWB A;  3KJV A;  4DSJ A;  4LF9 K;  3T3F A;  3G25 A;  4AM6 A;  4GW6 A;  5AQW A;  3RSE A;  4E1J A;  1SKS A;  1JLA A;  3IDH A;  5EXW A;  3O1B A;  3HI0 A;  4KKO A;  5FRN A;  3VQD A;  2J4R A;  4LSN A;  2HHT A;  1FKP A;  2E8A A;  2RPI A;  1U6Z A;  3A5N C;  3MAQ A;  4NXM K;  3MX5 A;  2HHW A;  1Y64 A;  3EZ5 A;  3T19 A;  2B4J A;  1YT3 A;  5F1X A;  1C0F A;  4KRE A;  3D7E O;  4FOE A;  2FF6 A;  3C65 A;  3LM2 A;  3R8E A;  4FM2 A;  1HUX A;  4YDU A;  1GLA G;  4CD3 A;  5AZJ B;  5B8H A;  1VSI A;  4MQ3 A;  4BR9 A;  1Z6R A;  3DLB A;  2ASP A;  1C0T A;  3CER A;  2A42 A;  5KQ8 A;  2HHV A;  4M3Y A;  4FJ8 A;  3T7Z A;  3VMF B;  3C94 A;  5CZ1 A;  2Q97 A;  3LPT A;  4KPY A;  1DT9 A;  3U9Z A;  4QOZ B;  2IC3 A;  1GLE G;  3OJU A;  3CCQ N;  3KKR A;  2CH5 A;  4FWO A;  1QS4 A;  3L2W A;  1JKH A;  3HM8 A;  1MWK A;  5ADX A;  3JS6 A;  4DQS A;  5LJV A;  1W0H A;  3J80 O;  5M1F A;  2HBK A;  3C95 A;  2GUI A;  3CCJ N;  4IEE A;  2G8F A;  4CJF A;  4F3T A;  2UUB K;  1F21 A;  2FSK A;  5C24 A;  3NHG A;  2KTQ A;  5KGX A;  5HL7 L;  1IBL K;  2X78 A;  1S3X A;  3G71 N;  2PAV A;  1BG3 A;  4QS7 A;  4CEE A;  1HQE A;  4CJT A;  3CJA A;  4EAH D;  3G4S N;  4FLZ A;  1QE1 A;  1IKW A;  2UXC K;  4GY2 B;  1IKY A;  3QFU A;  2PBD A;  3VQ9 A;  3SAG A;  4F2S A;  5FPD A;  3ZSX A;  3SQ1 A;  2P9I B;  3DJC A;  4Z4E A;  3CET A;  2E6L A;  3DRS A;  1FXX A;  3V1Q A;  1SQK A;  2PY5 A;  3WNE A;  4BGA A;  4CFC A;  3WUH A;  2ITG A;  2P9L B;  4JKE A;  5AZJ A;  4C1N K;  3DYA A;  4NYF A;  4C1N I;  4BE0 A;  1NGJ A;  4A5B A;  2GEL A;  1LW0 A;  3QER A;  3I33 A;  3OBY A;  2ZQB A;  3QIO A;  1YAG A;  3UE5 A;  5CHI A;  1I39 A;  2HND A;  4JKB A;  5SWM A;  4DFK A;  3ZSY A;  1WUA A;  2OTJ N;  1LV5 A;  3KK1 A;  2NUB A;  1Q81 O;  4OPK A;  4RG8 A;  2IS3 A;  5AQS A;  4CGG A;  4AF1 A;  1VQ6 N;  1NK8 A;  1Z25 A;  3MXI A;  4FK4 A;  4LFA K;  3E9L A;  3DLR A;  3M6G A;  4CZE A;  4CFB A;  4E7L A;  2X6N A;  1WBB A;  1WSJ A;  1NK6 A;  4H0Y B;  3QNO A;  1OVY A;  3OYA A;  1IV0 A;  5T7B A;  3CQX A;  4CHY A;  3BF3 A;  4FO0 A;  1VQ4 N;  3DMJ A;  3UKR A;  4JI0 K;  3OHR A;  4CGF A;  3JYT A;  4CZF A;  4FWN A;  4PKG A;  3E1Y A;  3L2Q A;  1WSG A;  2HVI A;  3SMS A;  3QEV A;  2B6A A;  4O55 A;  1XWL A;  5BRD A;  3VEV A;  3ZX0 A;  3OS0 A;  2FSN A;  3TAF A;  4H03 B;  3A5O C;  4JNE A;  1OH7 A;  3NGZ A;  3R6M A;  3ULE B;  3SQ2 A;  4X62 K;  1HNZ K;  4BE1 A;  2F8T A;  1Z05 A;  4FLT A;  1HX1 A;  4DR2 K;  1VQN N;  4DR6 K;  1NWK A;  4Y1C A;  2KZZ A;  5AQN A;  4QAG A;  2P9L A;  2V7Z A;  3SUO A;  5FLX O;  3S9H A;  3TAM A;  4BDY A;  3VF2 A;  3HO1 A;  2DFF A;  1C0M A;  3TAR A;  4IZ9 A;  2P9N A;  1JCF A;  4DTX A;  3F9K A;  1U2V A;  3DM2 A;  4MO5 A;  5C10 A;  4DS4 A;  3OA9 A;  4J2B A;  1V4T A;  3WEE B;  3HOS A;  4K8Z A;  4BG8 A;  3ID6 A;  4BVP A;  1KTQ A;  5F0X A;  4AHC A;  2IVN A;  4N47 A;  3QEX A;  3HXM A;  3RMB A;  1HKC A;  3VEW A;  3O80 A;  1NU0 A;  4NLB A;  2Z1J A;  5TKY A;  4OKJ A;  5M1P A;  4CFD A;  3EEQ A;  4XIU A;  3DI6 A;  5J2N A;  4FSV A;  3O3H A;  4GKK K;  2GBZ A;  2D4W A;  3TAP A;  1EO1 A;  4WQ4 C;  4JS5 A;  4PQU A;  2NRT A;  2WTU A;  3EY1 A;  2OPP A;  4DU4 A;  3SCX A;  3JAM O;  1KVB A;  4F2R A;  1KAZ A;  4GV3 A;  4KI4 A;  1YJN N;  3IRX A;  2VYP A;  2D0C A;  1A5V A;  3HM9 A;  1YI2 N;  3I8D A;  4DSL A;  3CC4 N;  1M1K O;  4JI5 K;  2Z1G A;  2PYJ A;  3CD6 N;  3NMU A;  4O5F A;  4E19 A;  1LAV A;  4IG0 A;  5HRP A;  4BRQ A;  3P1G A;  4MFB A;  2YX6 A;  3SYZ A;  4XH4 A;  4CJW A;  1IG9 A;  3DLE A;  1VQ8 N;  1SS6 A;  3QIN A;  1RFQ A;  2UXD K;  4HUE A;  1C1B A;  1BCO A;  3KK7 A;  4FLV A;  5HLF A;  2Q36 A;  4IG3 A;  3WNG A;  1RDC A;  4PWD A;  1VQK N;  3N4Q A;  4Z0U A;  2ASM A;  4CEZ A;  5J2M A;  3VQA A;  4AHV A;  2F96 A;  3D0P A;  4H4M A;  3ZYY X;  3THX B;  3ITH A;  5FRM A;  1JCE A;  2W41 A;  4KHS A;  4KBO A;  4JI3 K;  2QA4 N;  4NB4 A;  3VQ7 A;  1N33 K;  3V9Z A;  1QVG M;  5AQV A;  4AIL C;  4B9U A;  4JK9 A;  1E4F T;  2A6A A;  2E2Q A;  4O0I A;  1TK5 A;  3EO3 A;  5MLC Q;  1HQU A;  1NGD A;  3QDK A;  4CZL A;  3QNN A;  3SZ2 A;  4YHH K;  1A5W A;  1CLQ A;  3TSU A;  4DTO A;  2GV9 A;  3EZW A;  4B9V A;  5FDL A;  1WBD A;  2HHQ A;  1RTI A;  4Y0W A;  4WQ5 C;  3CM5 A;  3PIO L;  4I2P A;  1LWF A;  1HNW K;  4Z4C A;  3MMV A;  4B9S A;  2QXF A;  3AA2 A;  1D8Y A;  1QQM A;  3SQ4 A;  3R3L A;  3CFR A;  4A59 A;  4O4G A;  3C7N B;  5J2Q A;  5CE3 A;  4DKW A;  4CBW A;  3J7Y P;  1WSI A;  2YHA A;  2CGK A;  3AO2 A;  1P90 A;  5AFU H;  3ZT4 A;  1X3N A;  1VSK A;  2P9P B;  2HST A;  1KSP A;  1HYS A;  3VET A;  1GLB G;  1YHQ N;  3GDQ A;  4CF8 A;  4DQR A;  3AGR A;  3O8M A;  1NJW A;  3AO1 A;  2BH1 A;  3TTD A;  3CCU N;  3BZK A;  4M3U A;  2KLA A;  1RT6 A;  1W2B M;  4EFH A;  1U4B A;  2RN2 A;  1BI4 A;  2O4G A;  2X74 A;  5DK5 A;  5LL6 Z;  4DUZ K;  1VQ5 N;  3LWM A;  3W0L A;  2IGI A;  4FJK A;  3UKU B;  4FK0 A;  1N36 K;  4CK1 A;  4WYB A;  3H1Q A;  2HB5 A;  5JLH A;  3I55 N;  1NJY A;  4KO0 A;  5HRS A;  4FJI A;  5M1K A;  4F9O A;  3KWG A;  1RT3 A;  3RMC A;  3R1X A;  3THX A;  3LDO A;  3EE8 A;  4M63 C;  4DG1 A;  3RWU A;  3FE1 A;  1TV6 A;  3VQB A;  2I7P A;  2NRW A;  3KLH A;  1VQP N;  3DLG A;  4QS9 A;  1TYQ A;  1GLL O;  4LC9 B;  2WUS A;  4CI6 A;  1BIZ A;  3U3Y A;  4CJL A;  1RIL A;  4Z4I A;  3QET A;  2NNW A;  3K5M A;  4OJR A;  1S9E A;  3ATV A;  2FF3 B;  3AVJ A;  2FBT A;  4H0T B;  4WFN L;  1U49 A;  4H0O A;  1S22 A;  4KHU A;  4CHZ A;  3QO9 A;  1RT7 A;  3F73 A;  4M3X A;  3TAQ A;  2IDO A;  2E2O A;  3CME N;  4CJR A;  3OYI A;  4GV9 A;  4DQP A;  1LWC A;  3O4Q A;  3BEX A;  4NLC A;  3VOV A;  4LF7 K;  4B9M A;  3SJJ A;  1K8K B;  2FXU A;  1E3M A;  3L6Q A;  1XC3 A;  2JWL A;  4CED A;  4U7B A;  1N34 K;  5C25 A;  5FPM A;  4BG9 A;  2XRI A;  4H5N A;  1NGB A;  1GLF O;  3H08 A;  4DWI A;  4GKJ K;  3AVI A;  4A62 A;  2E2P A;  4LD0 A;  4WFB L;  3HST B;  2BUP A;  4W5Q A;  3THY A;  4EIA A;  3VTI A;  4DMN A;  1W7A A;  1XMQ K;  3D2E B;  3O1W A;  5KPT A;  1BDG A;  4NXN K;  4JI4 K;  1U04 A;  4ELT A;  2XHB A;  4B1Z A;  4UY8 O;  2DY4 A;  4DTM A;  4WE1 A;  3D6R A;  4CIE A;  4DR3 K;  1BCM A;  4QS8 A;  5BN9 A;  3WXL A;  1T7P A;  5EX5 A;  2YHY A;  1SL1 A;  1L5U A;  1NGH A;  2ATQ A;  3DLK A;  4K25 A;  3NH0 A;  4MDB A;  1TK0 A;  1ILY A;  2BTF A;  3CMA N;  3BDP A;  3THW A;  3A5M C;  4JYA K;  1GOA A;  1ESV A;  5BR9 A;  4CHN A;  2D0O A;  4ILG B;  1BU6 O;  1S1W A;  1WLJ A;  4OPA A;  4CEQ A;  1TUY A;  4JAX A;  2O8F B;  3TAE A;  4CZM A;  2GX9 A;  3FZL A;  1KLM A;  4F3O A;  4N41 A;  1C0G A;  5GIP A;  2RHK A;  2F9T A;  4J2D A;  1R0A A;  4JK8 A;  4X64 K;  1BWF O;  3OYF A;  3ZET B;  2D0A A;  5HOO A;  4EZ9 A;  4EHT A;  5DM7 L;  1NNE A;  3C6H A;  2FBY A;  4FXD A;  3S3N A;  1VSD A;  2UXB K;  1NOY A;  2KQ2 A;  1S1X A;  4R79 A;  5TKW A;  3DAW A;  4IXC A;  3MEG A;  3SUN A;  5HRR A;  1WAJ A;  3CJB A;  3AVA A;  4KFB A;  2UUC K;  1S6Q A;  4J2E A;  3HVT A;  5F2R A;  2YKN A;  5FPN A;  1JLQ A;  3AVN A;  4C23 A;  2AA4 A;  5GAD P;  2O8D A;  4CZI A;  1NK0 A;  2GWJ A;  4FJJ A;  4M3W A;  5EOY A;  3ENB A;  3L2V A;  1J5O A;  4PL8 A;  2G8I A;  1O13 A;  5HRO A;  2OPR A;  3OS2 A;  1CXU A;  1RBS A;  1VQ7 N;  1B9D A;  3A0I X;  1VQO N;  2KKZ A;  1MWM A;  3VQ8 A;  1Q9X A;  3KK2 A;  1VSE A;  3LDQ A;  1J6Z A;  1MA9 B;  1L3U A;  2KW4 A;  1JLG A;  2BGG A;  1QZ6 A;  3KIO A;  1M90 O;  1QSS A;  3AGK A;  1J5E K;  1XHX A;  3CM6 A;  4FK2 A;  1RDA A;  4CER A;  1U47 A;  2JLE A;  3WXI A;  4AQY K;  2VG6 A;  4RCH A;  2HHU A;  1NOZ A;  3D2F A;  4OKE A;  1OKJ A;  2Z1H A;  1BA0 A;  4CJ4 A;  4ISF A;  1EX4 A;  3VGK A;  4H0X B;  3HTV A;  4NCG A;  4IO8 A;  2IAJ A;  2AP1 A;  3F9M A;  4X66 K;  2QTD A;  1FW6 A;  2E1Z A;  3U3G A;  1S1T A;  4JEP A;  4RW4 A;  4CES A;  1N32 K;  2HHS A;  2KZM A;  4Z4G A;  1S6P A;  4B8C A;  5AQY A;  4FJN A;  3G6E N;  4CK2 A;  4BRD A;  1X9M A;  4CHP A;  5I3U A;  5M1N A;  3ZET A;  4B3S K;  1NK7 A;  4FPB A;  4B1Y B;  3THV A;  4JI6 K;  2YKM A;  3SK3 A;  3CXC M;  3B8A X;  4OX9 K;  3CYM A;  3LZI A;  5M1Q A;  3TAN A;  4L8R B;  1YJW N;  4CW7 B;  3ULD A;  3CFO A;  4BWM A;  1JL2 A;  1XNR K;  3HVR A;  4CFA A;  1J54 A;  1NGF A;  3S3O A;  1HRH A;  1TAU A;  2YJE A;  4H5W A;  4ILH A;  4ELU A;  2W6L A;  2X6S A;  5AQQ A;  1ZBL A;  4B08 A;  3IAY A;  2EWS A;  3CHW A;  5GIN A;  4OLA A;  4BRE A;  4DV7 K;  5H1S Q;  4PL7 A;  4DF8 A;  3VEZ A;  4CJP A;  3MN9 A;  1ZBU A;  2YCH A;  3DXM B;  1KAY A;  4KHW A;  4DV6 K;  2HBM A;  4KAZ A;  3A5L C;  3RMA A;  2WC9 A;  2YHX A;  3O9Q A;  4ZHR A;  4BC4 A;  3I0R A;  1HYZ A;  1U45 A;  3CCR N;  3CJ7 A;  3CQ8 A;  3VPZ A;  5GAE P;  4DS5 A;  4K0K K;  3NE6 A;  1HNV A;  5JVG L;  2AJQ A;  4DB3 A;  3I0S A;  4FW1 A;  4AHS A;  3M8S A;  3TU5 A;  1YIJ N;  3MEE A;  3Q7C A;  5BR8 K;  3VF4 A;  1ASV A;  4BRO A;  4LF4 K;  3KZB A;  4KV8 A;  1BUP A;  1VRU A;  4JLH A;  1S72 N;  1B9F A;  3OYB A;  4DTJ A;  1QSY A;  4ELV A;  4WFA L;  3CCV N;  1YVN A;  2ZF5 O;  2P9K B;  3LAN A;  2W6K A;  3NF9 A;  2V52 B;  4DR4 K;  2QW9 A;  4DSF A;  1TAQ A;  3EN9 A;  3M3Z A;  3SPZ A;  3MDQ A;  4BR7 A;  1QHA A;  4JKF A;  3CCM N;  5BPM A;  1WB9 A;  4L3Q A;  4CJ3 A;  4DR5 K;  4B3T K;  4IFY A;  5BRE A;  3OY9 A;  3NAE A;  1SKR A;  1SL0 A;  2OYQ A;  1B92 A;  2P9I A;  4BDZ A;  4DSI A;  1WSF A;  3SLC A;  2G8W A;  1IJJ A;  1DLO A;  4KTW A;  3P5J A;  4CEA A;  4ID5 A;  2QKB A;  3L4I A;  5AZI B;  2GEM A;  5D3G A;  4E7I A;  2QM1 A;  4FLY A;  3ENH A;  1NMD A;  1XI1 A;  4FWQ A;  5AQZ A;  3OW2 M;  3P31 A;  4A2A A;  1JXE A;  4BRI A;  1BGX T;  4KRF A;  4DU3 A;  3K58 A;  5BN8 A;  4YOW A;  4W5O A;  4BRM A;  5GIO A;  3ZT0 A;  3RR8 A;  1U48 A;  1SV5 A;  3K9K A;  4IKF A;  3ZSV A;  3QIC A;  2P9S B;  1CXQ A;  2OPS A;  4H0P A;  5JLF A;  3HOT A;  1JLB A;  5AJ3 K;  2O8E B;  1L3S A;  3LDS A;  1QQO A;  3LL3 A;  1RBR A;  3WNF A;  4IFE A;  1Z26 A;  3M8P A;  3NVM A;  3O4W A;  1WN7 A;  1S9G A;  3CI5 A;  4CBX A;  1KFD A;  2W42 A;  2XO7 A;  4MDA A;  3VQQ A;  4CJU A;  4AHR A;  1JJ2 M;  4XH1 A;  2VG5 A;  2QWL A;  5AQI A;  4HVJ A;  1YIT N;  1ZYQ A;  4BDP A;  4DQ8 A;  1YTU A;  3VN5 A;  1T05 A;  1MU2 A;  3KLF A;  2UU9 K;  4OPJ A;  2VGN A;  5E41 A;  4H5R A;  3M8R A;  4Y1D A;  3DLL L;  3T1H K;  1Q9Y A;  2Q2R A;  3CC7 N;  3MCA B;  3T1A A;  4YOU A;  4F4K A;  4CEO A;  3O5B A;  1OH6 A;  1RDB A;  1ZBH A;  4JHD B;  5K14 A;  4JK7 A;  3E01 A;  1LW2 A;  5KPZ A;  3O3G A;  1CZA N;  3G10 A;  3VGM A;  3TTF A;  3ZT3 A;  4BY9 C;  3GL1 A;  4FLW A;  4WQ4 A;  3ULE A;  1XMO K;  5AQF A;  3UB5 A;  2XY6 A;  1KAX A;  4G1Q A;  4LF8 K;  3ZSZ A;  2ZWH A;  3H6E A;  5AZI A;  1VK0 A;  3RMD A;  4M3R A;  4AH9 A;  5ADX H;  3QEW A;  1IO2 A;  1GOC A;  2VWB A;  4B1V A;  4GNI A;  1FK9 A;  1VQ9 N;  1SAZ A;  1D9D A;  1T44 A;  4GV6 A;  4AHU A;  2RF2 A;  3FZM A;  3P39 A;  3AY9 A;  5BPN A;  2V7Y A;  4OVL A;  3PSF A;  1EWQ A;  3HT3 A;  2HBL A;  3TPQ A;  2O8C B;  4YY3 K;  5BRH A;  3WEE A;  3ATU A;  3SV3 A;  1LCU A;  5DMR A;  4CVN E;  4CEF A;  4DQI A;  3GBT A;  5CR4 A;  1YVU A;  3TAB A;  5EU7 A;  2P5G A;  4BRC A;  3VEX A;  2DFH A;  4DV2 K;  1RT2 A;  5LMN K;  4JKG B;  3CJC A;  1Q86 O;  3MN6 A;  2XY5 A;  1K73 O;  1NK4 A;  3WQU A;  3O9U A;  5JIC A;  3DXK B;  4ICL A; 
#chains in the Genus database with same CATH homology
 1W97 L;  3QBW A;  5ADX A;  1IG8 A;  4WFB L;  3JS6 A;  2OAN A;  4IDH A;  2BUP A;  2YHW A;  5LJV A;  4EIA A;  3VTI A;  5M1F A;  2HBK A;  2NZT A;  3D2E B;  3O1W A;  3VER A;  4CZJ A;  5AR0 A;  5KPT A;  1BDG A;  1GLD G;  4IJA A;  3SBT A;  2QI2 A;  3ZEU B;  3CCJ N;  2CGJ A;  2YJF A;  3T69 A;  3VTH A;  4BR5 A;  4IEE A;  3PLA A;  4B1Z A;  4K43 A;  4FWK A;  4UY8 O;  3Q7B A;  3D6R A;  5AQG A;  2FSK A;  2NRV A;  3LDN A;  4BR2 A;  1JCG A;  4QS8 A;  5HL7 L;  3IMX A;  5BN9 A;  3WXL A;  4JHD A;  1S3X A;  2YHY A;  5EX5 A;  3G71 N;  2PAV A;  1BG3 A;  5AQM A;  1NGH A;  4HTL A;  4K25 A;  4QS7 A;  4MDB A;  5GAH P;  3M1F A;  1ILY A;  2BTF A;  3CJA A;  4EAH D;  3CMA N;  1KQS M;  3G4S N;  3N4P A;  3CIP A;  3A5M C;  4BC5 A;  3MWP A;  1ESV A;  5BR9 A;  2D0O A;  4ILG B;  1BU6 O;  4BR4 A;  4OPA A;  1TUY A;  4JKA A;  4JAX A;  4CZM A;  2GX9 A;  1TUU A;  4GVE A;  2P9K A;  3FZL A;  2E2N A;  2PBD A;  3QFU A;  4GY2 B;  3SAG A;  5FPD A;  2P9I B;  1C0G A;  3DJC A;  5GIP A;  1ZXO A;  2RHK A;  1KXP A;  3CET A;  4O8K A;  4BRF A;  2F9T A;  2ZJR L;  4JK8 A;  1BWF O;  3ZET B;  1D4X A;  1SQK A;  5HOO A;  3IFR A;  4IEI A;  4EHT A;  5DM7 L;  3O6W A;  2F7T A;  4ISG A;  2NRZ A;  4JN4 A;  3C6H A;  4BGA A;  3SBG A;  3WUH A;  5AQJ A;  3C0B A;  2P9L B;  4JKE A;  4EHU A;  3QML A;  5AZJ A;  4C1N K;  4R79 A;  3R9P A;  4BC2 A;  5TKW A;  4C1N I;  3DAW A;  4IXC A;  1NGJ A;  2E88 A;  4A5B A;  2GEL A;  3NVK A;  3CJB A;  3I56 N;  1XQS C;  4H5V A;  2WBN A;  4OPH A;  3CPW M;  4OO1 J;  3LDL A;  3I33 A;  5F2R A;  5FPN A;  3OBY A;  1YAG A;  4C23 A;  2Q31 A;  2AA4 A;  3UE5 A;  5CHI A;  3RVC A;  4JKB A;  5GAD P;  4CZI A;  2GWJ A;  1WUA A;  5EOY A;  2OTJ N;  3ENB A;  4FL9 A;  4IWV A;  3AAQ A;  3MN5 A;  5M1O A;  2GUP A;  2H3G X;  2WFB A;  4JKG A;  4PL8 A;  1O13 A;  4CZK A;  4PKH A;  4MLH A;  3FLC O;  4JD2 B;  1VQ7 N;  1Q81 O;  3A0I X;  1VQO N;  3VEO A;  1NGA A;  5AQS A;  2KKZ A;  3O9R A;  4AF1 A;  1MWM A;  3CCS N;  1E4G T;  1VQ6 N;  4BVO A;  3LDQ A;  1ZBS A;  1NGC A;  1J6Z A;  1MA9 B;  3E9L A;  1KC8 O;  3M6G A;  3BUZ B;  4CZE A;  1T6D A;  1BA1 A;  4YOT A;  2FLO A;  1BOT O;  1QZ6 A;  1M90 O;  3ZEU A;  2NRX A;  5C2F A;  1HPM A;  3VEN A;  2PFU A;  4H0Y B;  4FWP A;  3OBW A;  3AGK A;  1OVY A;  2ZJQ L;  3CF5 L;  3CQX A;  3C7N A;  4FPA A;  3BF3 A;  2P9S A;  4FO0 A;  3WXI A;  1VQ4 N;  4RCH A;  3UKR A;  3OHR A;  3BF1 A;  3WXM B;  4BRG A;  3D2F A;  4DCH A;  1OKJ A;  4BRL A;  1BA0 A;  2P9P A;  3KWI A;  4FWN A;  4CZF A;  5C12 A;  4PKG A;  3E1Y A;  4ISF A;  3FZK A;  3VGK A;  3U9D A;  4H0X B;  3HTV A;  3PIP L;  2V51 B;  3E9O A;  4IO8 A;  3VEY A;  2AP1 A;  4FVU A;  3F9M A;  4FOI A;  3SMS A;  2QTD A;  4CZG A;  1R59 O;  4BQL A;  2E1Z A;  2W40 A;  4JEP A;  2RE2 A;  5BRD A;  3VEV A;  2NRH A;  3ZX0 A;  2FSN A;  3I8B A;  3O9S A;  3EL2 A;  1GLC G;  4RWT A;  4H03 B;  4K41 A;  3A5O C;  3K9J A;  4JNE A;  2E1Y A;  2QXL A;  5AQY A;  4DHY A;  3G6E N;  3R6M A;  3KVG A;  3ULE B;  3H46 O;  4BRD A;  4ISE A;  2VCP A;  1TYQ B;  5M1N A;  3ZET A;  3UKU A;  1Z05 A;  4FPB A;  4B1Y B;  2ZGZ A;  1HX1 A;  4XEI A;  2D0P A;  3FR0 A;  3S41 A;  4CZH A;  1VQN N;  1NWK A;  3GE1 A;  3SK3 A;  5AQN A;  5E84 A;  2P9L A;  2V7Z A;  3CXC M;  5JMV A;  4IOX A;  3B8A X;  3WXK A;  2NLX A;  5AQH A;  5M1Q A;  3HZ6 A;  3VF2 A;  1YJW N;  4IZ9 A;  2P9N A;  1JCF A;  3ID8 A;  3EE9 A;  1VQM N;  3LM9 A;  3EKU A;  1U2V A;  4MO5 A;  2JWK A;  5ELZ A;  5C10 A;  1N8R O;  3TSP A;  3AAP A;  1NGF A;  3OA9 A;  4WQ5 A;  1RDU A;  5EY4 A;  2I7N A;  1V4T A;  3WEE B;  4JKH A;  2YJE A;  3HOS A;  4BG8 A;  3ID6 A;  4BVP A;  5F0X A;  4IOC L;  4H5W A;  4ILH A;  4MLE A;  5AQQ A;  2IVN A;  4YOX A;  4YOV A;  1NM1 A;  1HKC A;  2EWS A;  3CHW A;  2ITM A;  5GIN A;  1VQP N;  1DGK N;  4J8F A;  3VEW A;  1ATR A;  4BRE A;  4MO4 A;  5H1S Q;  1KD1 O;  4PL7 A;  2VGM A;  3O80 A;  3VEZ A;  4NLB A;  3MN9 A;  5TKY A;  5M1P A;  2YCH A;  3DXM B;  1T3V A;  4CD1 A;  3CCE N;  1KAY A;  4KH5 A;  3P38 A;  3IKM A;  3FZF A;  2HBM A;  3GG4 A;  4FSV A;  4FWM A;  5BRF A;  2D4W A;  2IIR A;  3A5L C;  3CCL N;  1EO1 A;  4WQ4 C;  2WC9 A;  2YHX A;  3O9Q A;  5AQT A;  1NGE A;  1RDW X;  3H45 C;  2QWM A;  4BC4 A;  2ZJP L;  4IO9 L;  2NRT A;  3HBT A;  3HRG A;  1K8K A;  3VF6 A;  3VES A;  3CQY A;  3WXJ A;  5C15 A;  5GAG P;  4FWS A;  3CCR N;  1HKB A;  3QBX A;  1KAZ A;  5AQU A;  5AQK A;  4GV3 A;  3CJ7 A;  1YJN N;  1G99 A;  3VPZ A;  4B9Q A;  1K9M O;  2VYP A;  3E66 A;  1DKG D;  3C6A A;  2UYT A;  3EKS A;  5GAE P;  1YI2 N;  2HOE A;  5JVG L;  5AQO A;  3A8Y A;  3DXK A;  3CC4 N;  4A2B A;  4DB3 A;  1M1K O;  1BO5 O;  2IVO A;  4NO7 A;  3WT0 A;  4BRN A;  3J7Z O;  3TU5 A;  1YIJ N;  4YDU C;  3Q7C A;  1YUW A;  2YI1 A;  3VF4 A;  4BRO A;  4BR0 A;  4BC3 A;  4BRP A;  5I9E B;  4O5F A;  3CD6 N;  3D2E A;  4A5A A;  3NMU A;  3KZB A;  2F9W A;  4BRQ A;  4CBU A;  3O08 A;  4I6M B;  1BUP A;  1Q18 A;  1S72 N;  5AQR A;  2OTL N;  2YX6 A;  4XH4 A;  3CJ9 A;  2E20 A;  4WFA L;  4O8U A;  1MDU B;  3CCV N;  1YVN A;  2ZF5 O;  1VQ8 N;  2P9K B;  1SS6 A;  4PHT X;  1NGI A;  1RFQ A;  1YJ9 N;  4RTF D;  2Q0R A;  2V52 B;  2QW9 A;  5AQL A;  3BP8 A;  3SJH A;  3KK7 A;  3EN9 A;  3KHY A;  2Q1N A;  1SZ2 A;  2D1K A;  2Q36 A;  3M3Z A;  3P4I A;  5BPL A;  3E9P A;  1V4S A;  2IVP A;  3MDQ A;  5JVH L;  4ILJ A;  3GOI A;  4BR7 A;  3N4Q A;  1VQK N;  1QHA A;  2ASM A;  4JKC A;  4JKF A;  3CCM N;  2HF3 A;  5BPM A;  3MCP A;  4L3Q A;  3U4L A;  3SMP A;  5C0Y A;  3ZYY X;  5BRE A;  3H3N O;  1JCE A;  4B1U B;  2W41 A;  4BGB A;  4KBO A;  4M7X A;  2QA4 N;  2QWO A;  4NB4 A;  4KH6 A;  4AM7 A;  2CH6 A;  1YF5 L;  2P9I A;  1QVG M;  5AQV A;  3SLC A;  3CC2 N;  4JK9 A;  1E4F T;  3RSE B;  1IJJ A;  3SAH A;  5LY3 A;  2A6A A;  2HMP A;  2E2Q A;  2ZGY A;  3MWT A;  3DWL A;  2A40 A;  4XH5 A;  3L4I A;  5AZI B;  3EO3 A;  5MLC Q;  1NGD A;  2GEM A;  2QWN A;  2QWR A;  3QDK A;  4CZL A;  2QM1 A;  3MN7 A;  1VQL N;  2P9U B;  1NMD A;  3ENH A;  3ZX2 A;  3MK6 A;  4B1X B;  1QZ5 A;  4B1W B;  4FWQ A;  5AQZ A;  3OW2 M;  1GLJ O;  3P31 A;  3TSU A;  4A2A A;  1NBW A;  4BRI A;  5EVZ A;  4K42 A;  3EZW A;  3WQT A;  1ZC6 A;  2A3Z A;  1YXQ A;  3TTC A;  5FPE A;  5BN8 A;  1H1V A;  4Y0W A;  4YOW A;  4BRM A;  4WQ5 C;  1LOT B;  1RGI A;  3ENO A;  5GIO A;  3PIO L;  3MMV A;  4U67 L;  5LJW A;  1XUP O;  2FSJ A;  2DPN A;  3K9K A;  1QQM A;  3R3L A;  2A5X A;  2A41 A;  1VAZ A;  4A59 A;  3C7N B;  5CE3 A;  3QIC A;  4DKW A;  2P9S B;  4FWL A;  4CBW A;  1X9J A;  4JD2 A;  3ZX3 A;  3LDP A;  2CGK A;  3L4Q A;  4H0P A;  5E26 A;  3TSQ A;  3UKR B;  5JLF A;  3HOT A;  1P90 A;  5AFU H;  1Q7Y O;  3D2F B;  3VGL A;  1HLU A;  1X3N A;  2P9P B;  3QFP A;  2HST A;  3FFK B;  1QQO A;  3LL3 A;  3VET A;  4IFE A;  1GLB G;  1YHQ N;  2GWK A;  3GDQ A;  3M5R A;  4BRA A;  1NGG A;  3NVM A;  4I6M A;  3O4W A;  3AGR A;  3O8M A;  3W3D A;  4CJ7 A;  1WOQ A;  1HKG A;  2BH1 A;  3TTD A;  3CCU N;  3CI5 A;  1QVF M;  4CBX A;  2KLA A;  4IOA L;  1W2B M;  4A61 A;  1EQY A;  4EFH A;  4M7Y A;  4MDA A;  4YOR A;  3AAR A;  2ASO A;  1JJ2 M;  4XH1 A;  1ATS A;  2QWL A;  5AQI A;  1YIT N;  1VQ5 N;  5AQX A;  2Q0U A;  4DQ8 A;  2QWQ A;  3JXU A;  3W0L A;  3UKU B;  5C2D A;  4KH4 A;  1X3M A;  4G9Z A;  1ATN A;  2VGN A;  4WYB A;  3H1Q A;  4H5R A;  3DLL L;  1T6C A;  5JLH A;  5KQD A;  3I55 N;  1Q82 O;  3F2K A;  4H5T A;  2Q2R A;  4FWR A;  4YOY A;  3CC7 N;  3CPE A;  3MCA B;  3F5T A;  3H1V X;  2QWP A;  3FZH A;  4BQZ A;  4YOU A;  3KWG A;  4F9O A;  5M1K A;  4WF9 L;  4BRH A;  2HF4 A;  3R1X A;  3SAF A;  3QB0 A;  3O5B A;  4H0V B;  3LDO A;  3EE8 A;  4HWI A;  4M63 C;  4WCE L;  4JHD B;  4IJN A;  2GTD A;  3FE1 A;  4JK7 A;  1K8A O;  3H3O B;  5AFU A;  2NRR A;  2P9N B;  5KPZ A;  1CZA N;  2I7P A;  2NRW A;  3VGM A;  4BY9 C;  3TTF A;  3GL1 A;  1DEJ A;  4WQ4 A;  3G25 A;  3ULE A;  1U2V B;  4AM6 A;  5AQW A;  3RSE A;  4QS9 A;  5AQF A;  3UB5 A;  4E1J A;  5KPR A;  1TYQ A;  1KAX A;  1GLL O;  3IDH A;  5EXW A;  3IUC A;  2ZWH A;  3H6E A;  4LC9 B;  3L0Q A;  3O1B A;  5AZI A;  3HI0 A;  2J4R A;  2WUS A;  3O9T A;  2P9U A;  4CI6 A;  5ADX H;  2VWB A;  4B1V A;  2NNW A;  2E8A A;  3A5N C;  1U6Z A;  4GNI A;  3MX2 A;  3ATV A;  4BRK A;  1VQ9 N;  2FF3 B;  3MX5 A;  1SAZ A;  1Y64 A;  3U8X A;  4H0T B;  4WFN L;  5F1X A;  4H0O A;  1S22 A;  1T44 A;  1C0F A;  3FGU A;  3D7E O;  4GV6 A;  4FOE A;  2FF6 A;  3C65 A;  3FZM A;  3LM2 A;  4Z94 A;  3R8E A;  3P39 A;  1HUX A;  4YDU A;  3AY9 A;  1GLA G;  3CJ1 A;  4CD3 A;  2V7Y A;  5AZJ B;  5B8H A;  5BPN A;  2E2O A;  3CME N;  1NLV A;  5DM6 L;  2HBL A;  3TPQ A;  4GV9 A;  4BR9 A;  1Z6R A;  3WEE A;  5BRH A;  3ATU A;  4A57 A;  3BEX A;  4NLC A;  1HJO A;  3VOV A;  1LCU A;  2ASP A;  3CER A;  2A42 A;  5KQ8 A;  2KHO A;  1K8K B;  2CGL A;  2FXU A;  1QQN A;  2HBJ A;  3T7Z A;  3GBT A;  3VMF B;  5CR4 A;  3L6Q A;  4BRC A;  1XC3 A;  2Q97 A;  3VEX A;  2QEX N;  2JWL A;  4U7B A;  5AQP A;  1DT9 A;  3U9Z A;  1P8Z A;  4JKG B;  1GLE G;  3CJC A;  3HSC A;  3MN6 A;  3CCQ N;  5FPM A;  2CH5 A;  4BG9 A;  4FWO A;  1Q86 O;  3DXM A;  4H5N A;  1K73 O;  1NGB A;  1NJI O;  3WQU A;  3O9U A;  5JIC A;  3DXK B;  4PKI A;  1GLF O;  3J8A A;  3HM8 A;  4A62 A;  1MWK A;  4JKD A;  2E2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...