2NRRA

Crystal structure of the c-terminal rnaseh endonuclase domain of uvrc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
139
Chain Sequence
b'MEALEELMKLLNMKDFPYRIEGIDISHLYTVASLVVFEDGFPKKGDYRRYKIDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLATVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 44
structure length 139
sequence length 151
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrrA00
2NRRA 3C65A 2NRXA 2NRZA 2NRVA 2NRWA 2NRTA
chains in the Genus database with same CATH superfamily
4EP4A 2VGMA 3A5OC 1WUAA 3VQPA 4H5VA 1HYSA 3A5LC 2GELA 2W6LA 2NZTA 1ZBIA 3BDPA 2F9TA 1LAVA 1X9MA 1JLBA 2VCPA 4DTPA 4GY2B 1N34K 5H1SQ 4BR7A 1IG8A 1O13A 4E1JA 4FLWA 1BI4B 3W3DA 3UE5A 3KLEA 3HO1A 1E3MA 3D0PA 4CJPA 2ITMA 3ATVA 2DPNA 3ASMA 1NWKA 4O5FA 3TSQA 1JKHA 1T44A 2P9SA 3O3FA 4JK7A 3ALYA 4FW2A 1NK9A 2HNDA 3WNHA 4PY5A 3SUNA 4BR4A 1Y64A 1QQOA 5AQLA 1TAQA 3O9SA 5AJ3K 4CJ3A 3KVGA 4BE2A 4JI5K 4J8FA 1KQSM 1T3VA 3CCVN 4X66K 4FVMA 3FZLA 1FJGK 4DR7K 4IEIA 4BWMA 5HRNA 2YJEA 3PO5A 3CIPA 3VQ7A 2P1JA 1QSSA 1OH7A 4FYDA 2E6MA 2NRHA 3H08A 3EKUA 4J2AA 1S1VA 4DUYK 5A2QO 3BF3A 4FVUA 2BH1A 3ENBA 4M3RA 4IOXA 2ZM6K 3MEEA 4GMJB 1NGCA 3RWUA 3CM5A 4FJ5A 2GWKA 3G71N 4LFBK 4K8ZA 3EY1A 3TTFA 5LJWA 3ZX2A 1IKXA 1HKGA 3F9KA 3VQ8A 3L2UA 1WBDA 4M3TA 3BGRA 2F4VK 3ULEA 3DJCA 4CIEA 3NFAA 3GE1A 4FLZA 3CQ8A 1NM1A 3VENA 2QWOA 3OS2A 5MLCQ 2P9UA 4JKHA 4GKJK 1CXQA 1EX4A 4LF8K 4O8UA 3ID6A 4F9OA 4PUOA 3LDLA 1UAXA 3AA3A 3SAHA 2O8CA 2VG7A 2YI1A 3MDQA 3CFPA 2V7YA 3ZT0A 1YT3A 4CHOA 3J81O 3AVHA 4NLCA 4A2AA 3TAGA 1B92A 4O4GA 4H0PA 4DV4K 1RTJA 3V9UA 3DXMA 3HXMA 1JXBA 3R9PA 4JI6K 4YOTA 4JI3K 2YKMA 4KI4A 3G25A 1YIJN 1KLMA 2A5XA 3ZT2A 1N33K 3AO2A 5KPRA 5AR0A 5DM6L 4AILC 3GG4A 3F9MA 1KVCA 2P9IA 1D9DA 1ATRA 5AQWA 5KPTA 4KO0A 4BG8A 4CECA 3UKRA 2KFNA 4KHSA 3TAQA 3QLHA 1S9GA 1RCHA 2HVHA 4A62A 3PSIA 1VQ6N 1BIUA 2HHXA 3SBTA 3CCUN 5C25A 2ZGZA 4H5NA 3CJCA 4B9QA 4KFBA 3I0RA 3FR0A 4OLAA 3FZMA 1HUXA 2KW4A 3LDNA 3O1WA 4IZ9A 5FLXO 4EFHA 3KK3A 4M7XA 2O8DB 3CCLN 3V9XA 1I94K 3AY9A 4DR6K 3VGLA 1SL1A 1D5AA 3K59A 2JWLA 4DTNA 2P9LA 2ZF5O 4JHDA 4AM7A 2KKZA 1RFQA 4CEOA 1J5OA 5HBMA 2G8FA 3C7NB 4H8KA 3TANA 5KGWA 4GVEA 1BOTO 4CEFA 1RDAA 3H1QA 1NJZA 4DLGA 4FM0A 4L3QA 2QWQA 1L3TA 2O4GA 5AQGA 3FFKB 4PL8A 4B08A 3QETA 4CJ5A 4IFVA 4A2BA 1VSEA 2ZJRL 4A5AA 5AQMA 4FK0A 3SPYA 1EWQA 4E0DA 3H1VX 4BE1A 3BP8A 2PY5A 2BE2A 1KC8O 1BHLA 1C1AA 4A61A 4KB0A 4DFMA 1VQ4N 2HF3A 2E8AA 3DXKB 4EHTA 1GLAG 2NRTA 5AQOA 2CGLA 2YJFA 3SQ2A 4FLYA 4B1ZA 3ZSWA 3KD1E 1TGOA 2FSKA 4KHYA 2CGKA 4JKEA 3SK3A 4JS5A 4O55A 3HI0A 4FSVA 4GVMA 2OPRA 2Z1JA 3NGIA 4K25A 1XHXA 3L4QA 4CBXA 1JLAA 3O4WA 1BA1A 4CD1A 1NMDA 4FWMA 1BA0A 2GWJA 3QESA 3LP2A 3THXB 4EZ6A 2HHWA 1LW0A 1EXQA 4AH9A 1NJWA 3LL3A 3V9ZA 3PY8A 1DTQA 5BRFA 3NH1A 1DLOA 3THYA 2QKKA 5AFUA 3KWGA 1NMNA 4B8AB 3GOIA 4UY8O 2D0CA 3E1YA 3K9KA 1JCEA 4KHWA 4H0XB 3VEXA 4M3YA 4N47A 4GKKK 4H0YB 3LDQA 3GL1A 1C0GA 4WE1A 3B6PA 1CZBA 3VTIA 4RTFD 2YNGA 3KKSA 1TUUA 4GV9A 5AQKA 4CEEA 4E1NA 1A5XA 4YORA 5CY4A 2P9PB 1VQNN 1XWLA 4DSEA 2YHYA 4OGCA 1K6YA 3V6DA 2IVNA 1WNSA 1XMOK 3SMPA 2KHOA 2IDOA 2HBKA 3AVIA 4X65K 4U67L 1YTAA 5F2RA 1S1XA 1YTUA 4FWKA 3LDSA 5LJVA 3K58A 4CZHA 1IJJA 2HHTA 4AHSA 3QMLA 1GOBA 5GIOA 3O9TA 2G8VA 3T1AA 3S3NA 3DRRA 4JKAA 3ENOA 3IUCA 2OTJN 1VQ5N 1BWFO 5JS1A 2P9NA 3VQ6A 4CESA 4CEAA 4F8RA 1DKGD 4MFBA 4C8NA 2E1YA 1NJXA 2FXUA 4DU3A 3EEQA 3ZLJA 1ZBUA 3IKMA 4NO7A 3OYLA 4KREA 4JD2B 3WXJA 3QEPA 5EXWA 4BVOA 3CCMN 3H3OB 5DK5A 1HKBA 1HYVA 1RT4A 1VRTA 2WFBA 4BRLA 4CEDA 1VRUA 4B1XB 3VMFB 4IFEA 1TKTA 3JAMO 1RDUA 2ZJQL 1GOAA 3CXCM 3RRGA 2QK9A 4DHYA 1M90O 4H0TB 1ZYQA 3IG1A 4BRIA 3KD5E 1L3UA 5HRRA 3NF9A 4BRMA 1Z26A 3LDOA 3KIOA 2B5JA 1RNHA 3SBGA 1S1UA 1YHQN 3ULDA 3LALA 1SKRA 4BG9A 3G4SN 3M8QA 1HMVA 3RSEA 1QZ6A 3HVRA 3SQ1A 1C6VA 3A8YA 4YNQA 2P5OA 1KFSA 1S5JA 2FBYA 4KHPK 4HCBA 2NRXA 3MN7A 4JI0K 3ISNC 4DFKA 2JWKA 1RBVA 4CW7B 4YOYA 4B9NA 2ZWHA 3I8DA 1W7AA 2O4IA 3P5JA 3VGMA 3MXMA 3OS1A 1ZC6A 4Z94A 4X62K 3J8AA 4PKHA 4FJMA 1DT9A 2D0AA 4JKDA 3KJVA 1WN7A 5EU7A 1LV5A 4IO8A 5EX5A 4CHZA 1NK8A 2BTFA 3ZT4A 3EE9A 5HP1A 3MEDA 4AHUA 3SCXA 3AVKA 3EL2A 3O1BA 2NLXA 4GW6A 1H1VA 4DQQA 3U9DA 3ZYYX 3LDPA 1XC3A 2ATQA 2FF6A 1IO2A 3CYMA 5LY3A 5J2PA 3F2KA 5AZIA 2A42A 4MDBA 4HTLA 3HP6A 1N36K 1NGDA 4KBOA 1QSYA 4M45A 1ZBSA 3AO4A 1R0AA 3QICA 3HOTA 1X9SA 3OYEA 2VWKA 4CE9A 1E4FT 3TTCA 4CIGA 4QS9A 1NGIA 1Q7YO 3WXKA 4CJWA 4AM6A 4DTSA 3UIQA 3O08A 3C65A 3WNGA 3AVCA 4FJIA 2XRIA 5BPMA 3SJJA 3WEEA 4CK2A 4KHNA 2BANA 1HX1A 1RT3A 2QXFA 3IMXA 4CZJA 4I6MB 2BDPA 2Q0RA 1BG3A 2O8BA 4AHCA 4IOCL 3CJ7A 5AQVA 3T7ZA 2QTDA 4IG3A 3D2FB 3VQCA 3K0SA 3SZ2A 3MN5A 4OGEA 1HPMA 1UA1A 5KQ8A 1A5VA 4JI4K 3ZSQA 5KI6A 2FF3B 1YF5L 3AAQA 3V9SA 1N5YA 1NK6A 1J6ZA 4CGDA 3CCSN 1VQMN 1C0TA 2UU9K 1U04A 2GTDA 3AGKA 4ELTA 2IAJA 2HHQA 3RRHA 4CGJA 2EWSA 3MK6A 4FO0A 4DV7K 4DMNA 5FRMA 1VSIA 4NYFA 1GLEG 1KTQA 4FXDA 3THWB 4FWSA 2V51B 1D4XA 1JCFA 4KTQA 2F8TA 3AVLA 2Q3SA 3T69A 3MCPA 1VHXA 3J80O 4BC4A 2VWJA 4Z0UA 1K8AO 3C6HA 5CYQA 3TI0A 4DV0K 4CFCA 3I33A 4BRCA 1NOZA 5C12A 2OCEA 1WSGA 1IBMK 1VK0A 3AO5A 4LF7K 2OANA 1FKOA 2YHWA 4BR2A 1RT1A 3C7NA 1ILYA 3VQ9A 2HF4A 3ZSVA 4MLHA 3M8PA 3OS0A 1ATNA 4OX9K 5D3GA 1IBKK 1VSFA 4KHQA 3V1RA 2ZGYA 2IC3A 4DLEA 1CZ9A 3K5MA 1NK5A 4ELUA 4LD0A 1S1WA 1HR0K 4ID1A 1VQLN 4LH4A 5J2MA 3DLKA 3RR7A 1KFDA 1RGIA 5AQIA 4FK4A 1T7PA 1QE1A 4DQIA 4JN4A 4LF6K 1HPZA 3LPTA 3TSPA 1U6ZA 5M1OA 2QA4N 4WFNL 4OVLA 1K8KA 3ZETA 4Z4FA 3M6GA 2O8FB 3CC4N 4QS7A 3QEXA 1HNZK 4JS4A 4B1VA 3JSMA 1VSHA 4CGFA 4I9QA 4DQRA 3UKUB 1XUPO 2HBJA 2UUAK 3KLGA 1YVUA 3R6MA 1WBBA 1S6QA 3BUZB 2G8UA 5HL7L 4CJUA 3VQDA 4KPYA 4CJFA 3QIPA 3CJBA 3KTQA 3KLFA 3OA9A 2HNZA 1TUYA 4DV3K 1U2VA 1TKXA 1J54A 4DCHA 3EZ5A 1G15A 2YNHA 3ZSYA 1L3VA 4NB4A 2HBMA 4IJNA 4BRDA 3A0IX 4M3UA 5FPDA 4MO5A 3OYMA 2P9PA 4Y0WA 3OBWA 5AQQA 1HKCA 4CGHA 5BN8A 4ICLA 4RW9A 3B8AX 2O8EB 3OHRA 4BE0A 4B9UA 4IEEA 2D1KA 3E9LA 4JI2K 3NDKA 2IVPA 4JKBA 2QXLA 3OBYA 4LC9B 2NUBA 3VEVA 2HMPA 4J2EA 1SQKA 4FPAA 2VWBA 4BRPA 3P31A 3U6FA 3HT3A 4CZKA 3ATUA 4IJAA 3AGRA 4K0KK 4F3TA 4DR3K 2G8KA 4H4MA 3LWMA 4LFCK 4M63C 1GLCG 3SAGA 2JLEA 4K41A 4A59A 4CF2A 3VQ4A 1OH5A 4Y1CA 1WSJA 2RPIA 1T6DA 3WXIA 3AO3A 3FZHA 1BGXT 2OZSA 4KB1A 3VEZA 4BRNA 1BQNA 4RW6A 1WSIA 3FE1A 1N32K 3OY9A 1SV5A 5E26A 4IKFA 1U48A 3KK7A 2FBXA 4KHUA 1SL0A 3J7AP 5CZ2A 4JRPA 3OYGA 3ZT3A 4KKOA 1W0HA 3SLCA 5ADXA 1WOQA 4K42A 3G6EN 3QINA 2G8IA 4J2BA 4FWQA 1K9MO 3GBTA 3LP3A 1JLCA 4WQ5A 1EETA 4W5OA 1QZ5A 3EE8A 1L5UA 3CCRN 1JXEA 4FW1A 4CFBA 3H46O 5BRHA 5E84A 1C0FA 2RKIA 1QQNA 3CM6A 1SKWA 4WCEL 5C24A 1RBSA 3NE6A 2WONA 1ITGA 4E7KA 4CZGA 3CETA 4BREA 2YHXA 1C1BA 5AQXA 3S9HA 2WUSA 1VSKA 3OYDA 1TYQA 2HOEA 4FWOA 1Y97A 4DTUA 3NMUA 2FBTA 2WC9A 4WFBL 4B3SK 3N4QA 1NJYA 3CF5L 2FBVA 3CJ1A 4FJLA 4RW7A 4WQ5C 4FOIA 3KLHA 1Q86O 1KSPA 4GV6A 2PYLA 3QERA 1TV6A 2IIRA 2OTLN 4CK1A 4DS4A 4I2QA 5ADXH 3IS9A 3VGKA 2IOCA 3OW2M 1KCFA 1TKDA 4BDYA 3IDHA 3E9PA 1WSFA 3HRGA 3ZSRA 4DF8A 1WSEA 2GUIA 3WT0A 5KGXA 1X3MA 3U9ZA 3SNNA 5AZJA 4HHTA 3K5LA 3WQUA 4PWDA 3DI6A 3I56N 3ZSXA 3KK1A 3NAEA 4BRQA 3I0SA 3V1QA 4BVPA 3OTOK 2UUCK 4FWPA 4BRKA 2E2NA 1ASVA 2V7ZA 3JYTA 1KAXA 2W6KA 5JVHL 3PX4A 1C1CA 1NJIO 3MEGA 1VQ9N 3M5RA 5GADP 4O44A 1BUPA 3HSTB 4CJKA 4RW8A 4CGGA 5FPNA 5CE3A 2VG6A 1WAFA 3C6UA 2YNIA 4H4OA 4CERA 4OPJA 4C8LA 2E4LA 2DFHA 2YHBA 4B3RK 4UQGA 4PL7A 2QM1A 1VQPN 5AQYA 2EHGA 4Z4EA 4BGBA 3AVFA 3KHYA 1XHZA 3DMJA 2W40A 1CZAN 3THWA 1JLQA 4GNIA 5J1EA 1RDCA 3MAQA 3AARA 2WOMA 3TSUA 2HHSA 1ASWA 2QW9A 3HK2A 2P9SB 1BL3A 2KQ2A 3LWLA 5K14A 4DU1A 2NNWA 4M3WA 1QVFM 4CJLA 3C0BA 1U47A 3KLIA 2Q36A 1QQMA 3AVAA 3A2FA 4EP5A 1YJNN 4CF0A 4KV8A 3FLCO 4YHHK 3VTHA 4YDUC 1GLDG 1F21A 2UYTA 3DAWA 5FRNA 1LAWA 2P9KA 4A5BA 1ZXOA 4CZLA 5AQPA 1NK7A 4Y1DA 2F9WA 2AP1A 2PBDA 1HNXK 3PIPL 5CYMA 3T1YK 4JEPA 3V81A 1NK0A 3WNEA 3HM9A 4AHRA 1XNQK 2PYJA 1NGEA 4B1UB 4R5PA 4FJ9A 4FJXA 5AFUH 1RT6A 3NF7A 1NKCA 4QCLA 4DV6K 4CJSA 3CQXA 3KK2A 3PLAA 1A5WA 2RHKA 4FLUA 2Q97A 1NGHA 4M42A 3DLGA 3ULEB 2PZSA 4F2SA 3P38A 4W5QA 4E1MA 2A1SA 2CGJA 4DSJA 4B3OA 2ZQBA 2VQFK 4MDAA 3QFUA 3O9UA 4KRFA 4JI7K 3OYNA 1BI4A 4HTUA 2XY8A 2O8FA 2E1ZA 1BISA 1E4GT 1HNWK 4OO1J 4OLBA 4WYBA 3P83D 3DM2A 3T3FA 1D9FA 3VOVA 3L4IA 1HJRA 3LZJA 4HVJA 3HVTA 4CD3A 2O8CB 2D4WA 3WXLA 1QS4A 3HM8A 1RBUA 4I2PA 3MWTA 3M8SA 1ZBFA 3J7YP 3QEIA 5C10A 1L3SA 4LSNA 3VF4A 2OPQA 2B6AA 3L2QA 2HVIA 3LPUA 1JLEA 3DXMB 1VSLA 3CQYA 1NBWA 2XY7A 4RG8A 1JL2A 4WQ4C 3E66A 5EY4A 4CHQA 4Q5VA 1JLGA 2PAVA 5IWAK 4FOEA 4M3ZA 1QHAA 2NRZA 3SV3A 1SZ2A 1TL1A 4E19A 1SKSA 1W97L 1KLNA 4DTJA 2O8EA 4CZMA 3RMDA 2GV9A 2I5JA 3F5TA 5TKWA 4H0OA 3TAEA 2W42A 4IFYA 4IWVA 3K57A 4WF9L 3NVMA 3EKSA 4CJVA 3P4IA 3AVNA 1C0UA 4BWJA 3TAMA 3V9WA 3M1FA 1NKBA 2P9LB 3AV9A 4EIAA 4JHDB 3QO9A 4Z4HA 3QB0A 4NXMK 2X6SA 3L0QA 2E2PA 2QEXN 3T19A 4DSFA 3F73A 3QNOA 3VERA 5J2NA 4E7IA 3H6EA 1YI2N 4A57A 4BACA 4LY7A 3PUFA 2Q1NA 2FC0A 1RT2A 5E41A 3Q7BA 1P8ZA 4FM2A 4ILHA 4ILJA 3ZSOA 4F2RA 3CJ9A 1VQON 5SWMA 4DV5K 4OPHA 3DLRA 2FLOA 3VQ5A 1ESVA 3DOLA 3L3UA 1J53A 4FCYA 3MECA 4H5RA 3MCAB 1KAYA 3FZFA 1O1WA 2HB5A 1YAGA 4JK9A 3THVA 5M1NA 3O8MA 4ZHRA 3RVCA 2QI2A 4JKFA 2ZJPL 4DV1K 4OKEA 2HHUA 4B9VA 3AAPA 1NLVA 3LANA 1JLFA 2Y1JA 3A5NC 4H5WA 4B9SA 4BDPA 2A1RA 2GBZA 4O5BA 3ID8A 3TAFA 1XMQK 3K2PA 1NGJA 4LSLA 2YKNA 3R3LA 3VN5A 4NCBA 4OPKA 4JLHA 1WB9A 4B9MA 4DR1K 5JS2A 5HRSA 2O8DA 3O4NA 5EVZA 2ASOA 2D0PA 5FPEA 3THYB 2ASPA 4QS8A 1RTIA 4DUZK 3NF6A 4BC5A 4IDKA 4YY3K 4B8CA 4TSXA 4Z4IA 3C95A 2NRRA 4BR5A 3VQQA 3SUPA 4YOUA 4CZFA 2F8SA 2BUPA 5HROA 1VQKN 1IV0A 3QIOA 3I55N 3CFOA 3D45A 3NGZA 3CPEA 5ELZA 4F4KA 4N56A 4O8KA 4FPBA 1JCGA 1VSMA 3NH2A 2GEMA 4BQLA 3U3GA 3DLLL 2D5RA 5AQHA 5CZ1A 2QWRA 3P39A 3VPZA 3HYFA 3NGYA 3QBXA 1KRPA 4FJJA 3VESA 3L2WA 4B9LA 4O0JA 1LCUA 2FSJA 5LL6Z 2V52B 4M3XA 1MA9B 2EX3A 3TU5A 3CFRA 3DXKA 3C6TA 1ATSA 4CGIA 1EQYA 1X3NA 4G1QA 2ASMA 3TWHA 4Z4GA 2KTQA 1OVQA 2QWLA 1TVRA 3SYZA 3VF2A 2E88A 2YX6A 3HZ6A 3SAFA 4ELVA 2P9NB 4OPAA 2OZMA 3K5OA 5GAEP 1RT7A 3H45C 1N6QA 4FL9A 4N41A 3CCQN 3TTDA 3O5BA 3ZSZA 4DFPA 3THXA 2KZZA 1B9DA 1NG9A 5M1PA 1HNIA 3QNNA 1KAZA 5AQUA 4B9TA 1IH7A 3OJUA 4E89A 4B1YB 4CZEA 1KVAA 4FLVA 4I9LA 3OYJA 1LWFA 4DSLA 2RE2A 2E20A 3BZCA 2QWMA 4CF1A 1RBTA 1TK0A 4JK8A 3QBWA 4HWIA 2XO7A 3SQ0A 1RBRA 3Q7CA 1YITN 5SZTA 4AHVA 1RILA 3ZX0A 2OPPA 3G0ZA 2ZE2A 5LMUK 3RSEB 3BF1A 3PX0A 1P90A 3RR8A 4PHTX 5C2FA 1OKJA 2ETJA 3ZX3A 2VG5A 2YV0X 1FXXA 3K5NA 3HPHA 4LF5K 4NXNK 4XH1A 4HUGA 4L8RB 4AQYK 4CK3A 4DWIA 4ILGB 4LF4K 2B4JA 4DKWA 5KTQA 3NVKA 3BZKA 1BCMA 3W0LA 1IKYA 5TKYA 3C6AA 1VSJA 1HQUA 4X64K 3TPQA 3I8BA 5B8HA 2E2QA 1K73O 3UB5A 1I3AA 5JVGL 4KI6A 5AQRA 3KZBA 3O4QA 1UA0A 3VQBA 5M1KA 4KTWA 4XH4A 1Q82O 5KQDA 1ZBLA 3AVJA 4DTRA 1WSHA 2RN2A 3DRSA 1HQEA 3L2RA 1FW6A 5CR4A 4FWLA 3PIOL 4CEBA 4JD2A 5AZIB 5C0YA 1IKVA 4JKGB 3IAYA 3VEYA 2G8WA 3EN9A 3QEWA 4FZZA 4RW4A 1TAUA 4XH5A 4FLTA 1OH8A 3HL8A 3M3ZA 1T8EA 4DG1A 4WFAL 3WNFA 4LF9K 5AQZA 4NLBA 1Z25A 3O3GA 4BRGA 1XI1A 4DSIA 5EOYA 1CXUA 4PKGA 1QHTA 4BQZA 3RMAA 3B6OA 3LAKA 5C42A 1RDDA 3WEEB 4CF8A 4N5SA 1GOCA 1V4SA 3VA0A 1T6CA 4H03B 5KPZA 2R7YA 3P1GA 5BR8K 2Q0UA 3L3VA 4W5TA 1VQ7N 3LAMA 2O8BB 3S3MA 2KLAA 3MN6A 3D6RA 4XEIA 1LW2A 3HBTA 4CCHA 4CHPA 2YCHA 3DLBA 3AA4A 5AQFA 4EZ9A 1TL3A 3WXMB 3U3YA 1V4TA 3LP0A 1S72N 4W5RA 2VQEK 5LMNK 3SV4A 1DTTA 5IT9O 5BPNA 5AQSA 3M8RA 1JL1A 2D0OA 2ZD1A 3NF8A 3HOSA 1IKWA 3OYFA 2X6NA 3CHWA 1W2BM 2I7NA 2OA8A 2GX9A 2E6LA 4AF1A 1GLBG 4CVNE 3OYAA 1T03A 3FFIA 2YNFA 3TABA 3JXUA 3HPOA 1Q8IA 4CZIA 1LOTB 4DR2K 2Z1IA 4N76A 4LFAK 4DU4A 5FROA 1SL2A 2JGUA 1BCOA 1J5EK 3CC2N 1GLJO 4HUEA 1TK8A 2FSNA 5KRSA 3CC7N 2Q2RA 4PA1A 3ZEUB 2QWNA 2HW3A 3HP9A 1REVA 3VEWA 1S9EA 2WTUA 4FJNA 3LM9A 1NU0A 2OPSA 3QEVA 4ID5A 5BREA 3AA2A 4CEZA 4CFDA 4B1WB 3CMEN 3NHGA 4IXCA 3L2VA 2KZMA 4I6MA 1YJ9N 3D2EB 2IS3A 5F1XA 1FKPA 1BIZA 3U8XA 4YOVA 3WUHA 3RMCA 3D2FA 3JS6A 4C8OA 4JKCA 3CERA 4BRFA 1NOYA 3ITHA 4BRAA 4DS5A 2XHBA 1I39A 2HSTA 2KFZA 4ISGA 1EKEA 4M7YA 5HRPA 2E2OA 1EO1A 1BO5O 5DM7L 3VQAA 4YDUA 2A3ZA 2WBNA 1K8KB 3AO1A 3OYIA 3ZETB 4E7HA 1RDWX 1RT5A 1MWKA 4H5TA 3S41A 4DTMA 3CCEN 1NGAA 5BR9A 3HSCA 1B9FA 1S1TA 1VSDA 4CF9A 4CBWA 4ZTJA 4CBUA 4IDHA 3SUOA 5AQNA 4FZYA 1VAZA 3VETA 1KVBA 1UWBA 4MQ3A 3SPZA 1IG9A 4BR9A 4E7JA 3RMBA 3QDKA 5BPLA 4CJQA 5GAGP 4BC2A 1HJOA 4RWTA 1U49A 2QKBA 1RDBA 3FGUA 2GUPA 3ZT1A 4MO4A 1KD1O 2D0BA 3SMSA 3BEXA 1U2VB 4HUFA 1XC9A 4XIUA 3CMAN 3MMVA 4C8MA 3VA3A 5HLFA 2E5LK 2P5GA 1SAZA 2AA4A 4DQ8A 4Z4CA 1OH6A 3MX2A 3GDQA 1GLLO 3VF6A 4DF4A 1CLQA 4BGAA 1Q9YA 2OYQA 1JJ2M 1OVYA 5KRTA 4DV2K 3AVGA 4C23A 4C1NK 3WQTA 3EO3A 3O9RA 1BU6O 3MXIA 1S3XA 4FK2A 4JYAK 1HRHA 3VEOA 5I42A 1YVNA 4CFAA 1MU2A 2Q31A 3MWPA 1G99A 1SUQA 4KH4A 2X78A 1N8RO 1M1KO 3J7ZO 1Q81O 4FLXA 4DTOA 2DY4A 2RF2A 4MLEA 1EP4A 3S3OA 2W41A 4BROA 3IFRA 1NKEA 4WQ4A 2P9UB 1DEJA 3D7EO 1LWEA 3KWIA 3V4IA 2PFUA 4JNEA 4OJRA 3OVNA 5CHIA 4BC3A 1QVGM 3G10A 5BN9A 2ITGA 5AQJA 3EZWA 2HHVA 2F7TA 1FK9A 4JAXA 4IG0A 3PO4A 3TR8A 3L6QA 3UKUA 3H3NO 3LM2A 4RCHA 3R8EA 3CG7A 5JMVA 1NNEA 2P51A 4DB3A 1DGKN 3U4LA 4FM1A 4E3SA 3HTVA 4DQSA 1QQCA 1XQSC 2IGIA 2HMIA 4Q0BA 4NYNA 4KTZA 4IO9L 3SUQA 2CH5A 3E9OA 1YXQA 1LWCA 1X9WA 1NK4A 1RTHA 4EHUA 4B3TK 4PKIA 4OKKA 2UXCK 3DWLA 2CH6A 2X74A 4ZTFA 4CJEA 2HBLA 2P9IB 3MXJA 4GV3A 4DR5K 2DFEA 4IOAL 5BRDA 4E7LA 5JLFA 3UKRB 4K8XA 3O80A 1BQMA 4YFUA 5GIPA 4YOWA 4F3OA 4DR4K 3R1XA 1UOCA 4ISFA 5I3UA 4CI6A 3AA5X 3KKRA 5HOOA 2LSNA 4CJ4A 2XY5A 4CIFA 3DLEA 3MN9A 3EYZA 1KXPA 3A5MC 3O6WA 1YUWA 2VGNA 2F96A 1D8YA 5C2DA 1QTMA 4B3MK 5AQTA 4CJTA 2XY6A 3NBPA 1TYQB 3OYHA 4EAHD 4JRQA 2HNYA 2UXDK 3PX6A 4HCCA 5GAHP 1RTDA 4I7FA 1X1PA 4OKJA 3O3HA 4FWRA 2BGGA 1ASUA 4LH5A 4BR0A 3SJHA 4FWNA 2H3GX 4FJHA 4YOXA 2HHHK 1VQ8N 4JKGA 3NH0A 4JI8K 5C15A 4KAZA 4W5NA 2DFFA 5GINA 4FJKA 3OYBA 1XNRK 1NGBA 4JI1K 3N4PA 2Y1IA 2QWPA 3OJSA 5AZJB 2A41A 1WLJA 1Z05A 3TAPA 4FZXC 2J4RA 1NGGA 4CEQA 1C0MA 3O9QA 3CD6N 2NRVA 1X9JA 1SS6A 4U7BA 3CPWM 4JV5K 1Q9XA 4NCGA 1Q18A 3PV8A 2AJQA 3CI5A 5JLHA 1HYZA 3HPGA 1U4BA 1EWRA 4C8KA 3LP1A 2A40A 3FZKA 4DSKA 1ZBHA 3SQ4A 2NRWA 4ISEA 2Z1HA 3DYAA 1IBLK 3ENHA 3NCIA 4M41A 4CJ7A 2DTUA 5M1FA 4O0IA 5JICA 3T1HK 4KH5A 3HJFA 1R59O 4CHYA 2A6AA 1J9AA 5M1QA 4CHNA 4DFJA 1TK5A 3LZIA 2I7PA 5F0XA 1QSLA 1YJWN 3BY5A 3MX5A 3L8BA 4KH6A 3CCJN 2YHAA 5I9EB 3QFPA 4K43A 1NGFA 3VQEA 3OYKA 1HLUA 3E01A 1MDUB 4C1NI 4J2DA 3SI6A 1Z6RA 5DMRA 4QAGA 4AHTA 3AVBA 3AVMA 3DLHA 3TARA 4NCAA 5FPMA 4DTXA 3OYCA 2G8HA 1GLFO 3ZCMA 1WAJA 2IVOA 3V1OA 4QOZB 2UUBK 3IRXA 4DQPA 5T7BA 4BY9C 1T05A 4PQUA 4BRHA 1TKZA 2P9KB 4V19S 3RTVA 3ZEUA 1HNVA 2VYPA 4FJ7A 3C94A 4CJRA 4FJGA 3CJAA 3DOKA 5FDLA 1S22A 3PSFA 4BDZA 1S6PA 4R79A 5J2QA 4FJ8A 4G9ZA 2UXBK 1U45A 3DRPA 3D2EA 1BDGA 3K9JA 1MWMA 1W9HA 4IBNA 2Z1GA 4H0VB
chains in the Genus database with same CATH topology
2Q36A 1XC3A 2VGMA 3A5OC 2KLAA 3MN6A 2FF6A 1WUAA 3D6RA 1QQMA 4XEIA 4H5VA 3HBTA 1YJNN 5LY3A 3A5LC 2GELA 3ZYYX 2NZTA 3F2KA 5AZIA 2A42A 3FLCO 2F9TA 4MDBA 2YCHA 4HTLA 3VTHA 4YDUC 2VCPA 1GLDG 5AQFA 2UYTA 1NGDA 4KBOA 4GY2B 3WXMB 3DAWA 1ZBSA 5H1SQ 3QICA 3HOTA 1V4TA 2P9KA 4A5BA 4BR7A 1IG8A 1O13A 1S72N 4E1JA 1ZXOA 1E4FT 4CZLA 5AQPA 3TTCA 3W3DA 4QS9A 1NGIA 3UE5A 1Q7YO 3WXKA 2F9WA 4AM6A 5BPNA 5AQSA 2AP1A 2PBDA 3PIPL 3O08A 3C65A 2D0OA 2ITMA 3HOSA 4JEPA 3ATVA 3CHWA 2DPNA 5BPMA 1NWKA 2I7NA 4O5FA 1T44A 2P9SA 2GX9A 3TSQA 3WEEA 4AF1A 4JK7A 1GLBG 1HX1A 4BR4A 1Y64A 1NGEA 1QQOA 3IMXA 4CZJA 5AQLA 4B1UB 4I6MB 3JXUA 3O9SA 2Q0RA 1BG3A 5AFUH 4IOCL 4CZIA 3CJ7A 5AQVA 1LOTB 2QTDA 3CQXA 3KVGA 3T7ZA 3D2FB 3PLAA 2RHKA 3MN5A 2Q97A 1NGHA 1HPMA 3ULEB 4J8FA 5KQ8A 1KQSM 1T3VA 3P38A 3CCVN 2CGJA 3FZLA 2FF3B 1YF5L 3AAQA 4IEIA 4MDAA 2YJEA 3CC2N 1GLJO 3QFUA 1J6ZA 3O9UA 3CCSN 1VQMN 3CIPA 2GTDA 2FSNA 3CC7N 2Q2RA 3AGKA 3ZEUB 2QWNA 2E1ZA 2EWSA 3MK6A 1E4GT 2NRHA 3EKUA 4FO0A 3VEWA 4OO1J 3LM9A 4WYBA 5BREA 3BF3A 3L4IA 3VOVA 1GLEG 4FWSA 4FVUA 2BH1A 2V51B 2D4WA 3ENBA 4CD3A 4IOXA 3WXLA 1D4XA 3HM8A 1JCFA 4B1WB 1NGCA 3CMEN 3T69A 3MWTA 2GWKA 3MCPA 4IXCA 3G71N 5C10A 3TTFA 4I6MA 3VF4A 4BC4A 1YJ9N 1K8AO 3D2EB 3C6HA 5LJWA 3ZX2A 1HKGA 5F1XA 3U8XA 4YOVA 3WUHA 3DXMB 3D2FA 3JS6A 3CQYA 1NBWA 3CERA 4JKCA 3I33A 4BRFA 4BRCA 5C12A 3ULEA 3DJCA 4WQ4C 3E66A 3GE1A 5EY4A 4BRAA 1NM1A 3VENA 2OANA 2YHWA 2QWOA 4BR2A 5MLCQ 2HSTA 2PAVA 2P9UA 3C7NA 4ISGA 4JKHA 4M7YA 4FOEA 2E2OA 1EO1A 1BO5O 5DM7L 4YDUA 1ILYA 2A3ZA 2WBNA 2HF4A 1K8KB 1QHAA 2NRZA 4O8UA 1SZ2A 3ID6A 3ZETB 4MLHA 1RDWX 1ATNA 1MWKA 4F9OA 4H5TA 1W97L 3LDLA 3S41A 3SAHA 3CCEN 1NGAA 2ZGYA 5BR9A 3HSCA 2YI1A 3MDQA 2V7YA 4CZMA 3F5TA 5TKWA 4H0OA 4CBWA 4CBUA 4IDHA 4NLCA 5AQNA 4A2AA 1VAZA 3VETA 4IWVA 4BR9A 4WF9L 3NVMA 3EKSA 3QDKA 4H0PA 5BPLA 3DXMA 5GAGP 4BC2A 1VQLN 3R9PA 1HJOA 4YOTA 3P4IA 4RWTA 3G25A 1RGIA 3M1FA 5AQIA 1YIJN 2A5XA 3FGUA 2GUPA 4MO4A 1KD1O 2P9LB 4JN4A 4EIAA 4JHDB 3SMSA 3BEXA 1U2VB 3TSPA 5KPRA 3QB0A 1U6ZA 5AR0A 5M1OA 4WFNL 5DM6L 3CMAN 3L0QA 2QA4N 3MMVA 2E2PA 3GG4A 3F9MA 2QEXN 1K8KA 2P9IA 1ATRA 5AQWA 3VERA 3ZETA 1SAZA 4BG8A 5KPTA 2AA4A 3M6GA 4DQ8A 3UKRA 3H6EA 3MX2A 3GDQA 1GLLO 4QS7A 3CC4N 1YI2N 4A57A 3VF6A 4BGAA 4A62A 2Q1NA 1VQ6N 3SBTA 4B1VA 3CCUN 1JJ2M 3Q7BA 2ZGZA 4H5NA 1OVYA 1P8ZA 3CJCA 4B9QA 4ILHA 4ILJA 3FR0A 3UKUB 3FZMA 4C23A 4C1NK 1XUPO 3CJ9A 3WQTA 1VQON 2HBJA 1HUXA 3EO3A 3O9RA 1BU6O 1S3XA 3R6MA 3LDNA 3O1WA 4IZ9A 3VEOA 4EFHA 3BUZB 4OPHA 4M7XA 2FLOA 3CCLN 1ESVA 1YVNA 3AY9A 5HL7L 2Q31A 3MCAB 3MWPA 1G99A 4H5RA 1KAYA 4KH4A 3FZFA 3VGLA 1YAGA 1N8RO 1M1KO 3J7ZO 1Q81O 3CJBA 4JK9A 3OA9A 2JWLA 1TUYA 2P9LA 2ZF5O 5M1NA 3O8MA 3RVCA 4JHDA 4MLEA 1U2VA 2QI2A 4JKFA 2ZJPL 2W41A 4AM7A 4BROA 2KKZA 1RFQA 3IFRA 4DCHA 4WQ4A 3AAPA 2P9UB 3C7NB 1NLVA 1DEJA 4NB4A 3D7EO 2HBMA 4IJNA 4BRDA 3KWIA 3A0IX 3A5NC 4H5WA 4MO5A 5FPDA 2PFUA 2P9PA 4JNEA 4GVEA 1BOTO 4Y0WA 5CHIA 3H1QA 3OBWA 5AQQA 1HKCA 5BN8A 4L3QA 4BC3A 3ID8A 1QVGM 5BN9A 1NGJA 5AQGA 3B8AX 5AQJA 3EZWA 2F7TA 3R3LA 3OHRA 4JAXA 3FFKB 3L6QA 4IEEA 3H3NO 3LM2A 4PL8A 4RCHA 3R8EA 3UKUA 5JMVA 4A2BA 4DB3A 1DGKN 2D1KA 3E9LA 4A5AA 3U4LA 2ZJRL 5AQMA 3HTVA 2IVPA 4JKBA 3H1VX 2QXLA 3OBYA 4LC9B 5EVZA 3BP8A 2ASOA 2D0PA 5FPEA 1XQSC 1KC8O 3VEVA 4A61A 2HMPA 1VQ4N 2ASPA 4QS8A 2HF3A 4BC5A 1SQKA 2E8AA 3DXKB 4FPAA 4IO9L 2CH5A 3E9OA 4EHTA 2VWBA 4BRPA 1GLAG 1YXQA 2NRTA 5AQOA 2NRRA 4BR5A 3P31A 2CGLA 2YJFA 4CZKA 3ATUA 4IJAA 3AGRA 4PKIA 4YOUA 4B1ZA 4CZFA 4EHUA 2BUPA 2FSKA 2CGKA 1VQKN 4JKEA 3SK3A 3I55N 3DWLA 4M63C 1GLCG 2CH6A 3HI0A 4FSVA 2HBLA 3SAGA 2P9IB 3CPEA 4GV3A 5ELZA 4K41A 4K25A 4A59A 4IOAL 3L4QA 4O8KA 5BRDA 4CBXA 5JLFA 3O4WA 3UKRB 4FPBA 1BA1A 1JCGA 4CD1A 1T6DA 1NMDA 4FWMA 3O80A 3WXIA 1BA0A 2GEMA 3FZHA 4BQLA 5GIPA 2GWJA 4YOWA 3R1XA 3DLLL 3VEZA 4ISFA 5AQHA 4BRNA 2QWRA 4CI6A 3P39A 5HOOA 3VPZA 3QBXA 3FE1A 3VESA 3LL3A 5E26A 1LCUA 2FSJA 5BRFA 3MN9A 2V52B 1KXPA 1MA9B 3A5MC 3O6WA 3KK7A 3TU5A 5AFUA 1YUWA 2VGNA 3KWGA 3DXKA 4UY8O 3GOIA 5C2DA 3E1YA 3K9KA 1JCEA 5AQTA 4H0XB 3VEXA 1ATSA 1TYQB 1EQYA 1X3NA 4EAHD 3SLCA 2ASMA 5ADXA 4H0YB 3LDQA 3GL1A 1C0GA 5GAHP 2QWLA 1WOQA 4K42A 3VF2A 2E88A 2YX6A 3HZ6A 3VTIA 3G6EN 4RTFD 3SAFA 4FWRA 1TUUA 2P9NB 4FWQA 4OPAA 4GV9A 5AQKA 1K9MO 3GBTA 4YORA 4BR0A 5GAEP 3H45C 3SJHA 2P9PB 4FL9A 3CCQN 1VQNN 4FWNA 3TTDA 4WQ5A 2H3GX 4YOXA 1QZ5A 3O5BA 1VQ8N 3EE8A 2YHYA 4JKGA 3CCRN 5C15A 2IVNA 3H46O 5BRHA 5E84A 3SMPA 1C0FA 5GINA 2KHOA 5M1PA 1KAZA 1NGBA 1QQNA 5AQUA 2HBKA 3N4PA 4B1YB 4U67L 4CZEA 4WCEL 2QWPA 5F2RA 4FWKA 4CZGA 5LJVA 3CETA 4BREA 1IJJA 2YHXA 5AZJB 5AQXA 4CZHA 2A41A 1Z05A 2WUSA 2RE2A 2E20A 3QMLA 2J4RA 2QWMA 1NGGA 1TYQA 2HOEA 4FWOA 3O9QA 4JK8A 5GIOA 3O9TA 3CD6N 3NMUA 2NRVA 1X9JA 1SS6A 2WC9A 3QBWA 4HWIA 4WFBL 4JKAA 3ENOA 3IUCA 4U7BA 3CPWM 3N4QA 2OTJN 1Q18A 3CF5L 3CJ1A 1BWFO 1VQ5N 3CI5A 5JLHA 3Q7CA 2P9NA 1YITN 4WQ5C 3ZX0A 4FOIA 1Q86O 1DKGD 2A40A 3FZKA 3BF1A 3RSEB 4GV6A 1P90A 2NRWA 4ISEA 4PHTX 2E1YA 2FXUA 5C2FA 2IIRA 2OTLN 1OKJA 3IKMA 4NO7A 3ZX3A 4JD2B 3WXJA 3ENHA 5EXWA 4BVOA 5ADXH 4CJ7A 3H3OB 3VGKA 1HKBA 5M1FA 3CCMN 4XH1A 5JICA 3OW2M 2WFBA 4KH5A 1R59O 3E9PA 3HRGA 3IDHA 4BRLA 4B1XB 3VMFB 4IFEA 4ILGB 2A6AA 4DKWA 3WT0A 1RDUA 2ZJQL 1X3MA 3NVKA 3U9ZA 3CXCM 5M1QA 2I7PA 5AZJA 5F0XA 4DHYA 3W0LA 1M90O 3WQUA 4H0TB 1YJWN 3I56N 5TKYA 3C6AA 4BRIA 3MX5A 4BRQA 4KH6A 3CCJN 4BRMA 3LDOA 3TPQA 5I9EB 3QFPA 4BVPA 3I8BA 5B8HA 2E2QA 4K43A 1K73O 1NGFA 3UB5A 5JVGL 3SBGA 4FWPA 4BRKA 1HLUA 2E2NA 1MDUB 3KZBA 2V7ZA 5AQRA 4C1NI 1YHQN 1KAXA 5JVHL 1NJIO 1VQ9N 1Z6RA 5M1KA 3M5RA 5GADP 4XH4A 4BG9A 3G4SN 1BUPA 5KQDA 1Q82O 3RSEA 1QZ6A 5FPNA 5CE3A 5FPMA 1GLFO 3A8YA 5CR4A 4FWLA 3PIOL 4JD2A 5AZIB 2IVOA 2NRXA 5C0YA 3MN7A 4JKGB 2JWKA 4YOYA 3VEYA 2ZWHA 4BY9C 3EN9A 4BRHA 4XH5A 3VGMA 4PL7A 2QM1A 3M3ZA 2P9KB 1ZC6A 1VQPN 4Z94A 3ZEUA 2VYPA 5AQYA 4WFAL 3J8AA 5AQZA 4BGBA 3KHYA 4PKHA 4NLBA 1DT9A 4JKDA 3CJAA 4BRGA 2W40A 1CZAN 4GNIA 4IO8A 5EOYA 4PKGA 4BQZA 3AARA 5EX5A 2BTFA 3TSUA 2QW9A 3EE9A 2P9SB 3WEEB 1S22A 4R79A 1V4SA 1W2BM 1T6CA 4H03B 1QVFM 2NNWA 3EL2A 4G9ZA 3O1BA 2NLXA 5KPZA 3D2EA 1BDGA 3K9JA 1MWMA 1H1VA 3U9DA 3C0BA 2Q0UA 3LDPA 2QWQA 1VQ7N 4H0VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRR A;  3C65 A;  2NRX A;  2NRZ A;  2NRV A;  2NRW A;  2NRT A; 
#chains in the Genus database with same CATH topology
 4EP4 A;  2VGM A;  3A5O C;  1WUA A;  3VQP A;  4H5V A;  1HYS A;  3A5L C;  2GEL A;  2W6L A;  2NZT A;  1ZBI A;  3BDP A;  2F9T A;  1LAV A;  1X9M A;  1JLB A;  2VCP A;  4DTP A;  4GY2 B;  1N34 K;  5H1S Q;  4BR7 A;  1IG8 A;  1O13 A;  4E1J A;  4FLW A;  1BI4 B;  3W3D A;  3UE5 A;  3KLE A;  3HO1 A;  1E3M A;  3D0P A;  4CJP A;  2ITM A;  3ATV A;  2DPN A;  3ASM A;  1NWK A;  4O5F A;  3TSQ A;  1JKH A;  1T44 A;  2P9S A;  3O3F A;  4JK7 A;  3ALY A;  4FW2 A;  1NK9 A;  2HND A;  3WNH A;  4PY5 A;  3SUN A;  4BR4 A;  1Y64 A;  1QQO A;  5AQL A;  1TAQ A;  3O9S A;  5AJ3 K;  4CJ3 A;  3KVG A;  4BE2 A;  4JI5 K;  4J8F A;  1KQS M;  1T3V A;  3CCV N;  4X66 K;  4FVM A;  3FZL A;  1FJG K;  4DR7 K;  4IEI A;  4BWM A;  5HRN A;  2YJE A;  3PO5 A;  3CIP A;  3VQ7 A;  2P1J A;  1QSS A;  1OH7 A;  4FYD A;  2E6M A;  2NRH A;  3H08 A;  3EKU A;  4J2A A;  1S1V A;  4DUY K;  5A2Q O;  3BF3 A;  4FVU A;  2BH1 A;  3ENB A;  4M3R A;  4IOX A;  2ZM6 K;  3MEE A;  4GMJ B;  1NGC A;  3RWU A;  3CM5 A;  4FJ5 A;  2GWK A;  3G71 N;  4LFB K;  4K8Z A;  3EY1 A;  3TTF A;  5LJW A;  3ZX2 A;  1IKX A;  1HKG A;  3F9K A;  3VQ8 A;  3L2U A;  1WBD A;  4M3T A;  3BGR A;  2F4V K;  3ULE A;  3DJC A;  4CIE A;  3NFA A;  3GE1 A;  4FLZ A;  3CQ8 A;  1NM1 A;  3VEN A;  2QWO A;  3OS2 A;  5MLC Q;  2P9U A;  4JKH A;  4GKJ K;  1CXQ A;  1EX4 A;  4LF8 K;  4O8U A;  3ID6 A;  4F9O A;  4PUO A;  3LDL A;  1UAX A;  3AA3 A;  3SAH A;  2O8C A;  2VG7 A;  2YI1 A;  3MDQ A;  3CFP A;  2V7Y A;  3ZT0 A;  1YT3 A;  4CHO A;  3J81 O;  3AVH A;  4NLC A;  4A2A A;  3TAG A;  1B92 A;  4O4G A;  4H0P A;  4DV4 K;  1RTJ A;  3V9U A;  3DXM A;  3HXM A;  1JXB A;  3R9P A;  4JI6 K;  4YOT A;  4JI3 K;  2YKM A;  4KI4 A;  3G25 A;  1YIJ N;  1KLM A;  2A5X A;  3ZT2 A;  1N33 K;  3AO2 A;  5KPR A;  5AR0 A;  5DM6 L;  4AIL C;  3GG4 A;  3F9M A;  1KVC A;  2P9I A;  1D9D A;  1ATR A;  5AQW A;  5KPT A;  4KO0 A;  4BG8 A;  4CEC A;  3UKR A;  2KFN A;  4KHS A;  3TAQ A;  3QLH A;  1S9G A;  1RCH A;  2HVH A;  4A62 A;  3PSI A;  1VQ6 N;  1BIU A;  2HHX A;  3SBT A;  3CCU N;  5C25 A;  2ZGZ A;  4H5N A;  3CJC A;  4B9Q A;  4KFB A;  3I0R A;  3FR0 A;  4OLA A;  3FZM A;  1HUX A;  2KW4 A;  3LDN A;  3O1W A;  4IZ9 A;  5FLX O;  4EFH A;  3KK3 A;  4M7X A;  2O8D B;  3CCL N;  3V9X A;  1I94 K;  3AY9 A;  4DR6 K;  3VGL A;  1SL1 A;  1D5A A;  3K59 A;  2JWL A;  4DTN A;  2P9L A;  2ZF5 O;  4JHD A;  4AM7 A;  2KKZ A;  1RFQ A;  4CEO A;  1J5O A;  5HBM A;  2G8F A;  3C7N B;  4H8K A;  3TAN A;  5KGW A;  4GVE A;  1BOT O;  4CEF A;  1RDA A;  3H1Q A;  1NJZ A;  4DLG A;  4FM0 A;  4L3Q A;  2QWQ A;  1L3T A;  2O4G A;  5AQG A;  3FFK B;  4PL8 A;  4B08 A;  3QET A;  4CJ5 A;  4IFV A;  4A2B A;  1VSE A;  2ZJR L;  4A5A A;  5AQM A;  4FK0 A;  3SPY A;  1EWQ A;  4E0D A;  3H1V X;  4BE1 A;  3BP8 A;  2PY5 A;  2BE2 A;  1KC8 O;  1BHL A;  1C1A A;  4A61 A;  4KB0 A;  4DFM A;  1VQ4 N;  2HF3 A;  2E8A A;  3DXK B;  4EHT A;  1GLA G;  2NRT A;  5AQO A;  2CGL A;  2YJF A;  3SQ2 A;  4FLY A;  4B1Z A;  3ZSW A;  3KD1 E;  1TGO A;  2FSK A;  4KHY A;  2CGK A;  4JKE A;  3SK3 A;  4JS5 A;  4O55 A;  3HI0 A;  4FSV A;  4GVM A;  2OPR A;  2Z1J A;  3NGI A;  4K25 A;  1XHX A;  3L4Q A;  4CBX A;  1JLA A;  3O4W A;  1BA1 A;  4CD1 A;  1NMD A;  4FWM A;  1BA0 A;  2GWJ A;  3QES A;  3LP2 A;  3THX B;  4EZ6 A;  2HHW A;  1LW0 A;  1EXQ A;  4AH9 A;  1NJW A;  3LL3 A;  3V9Z A;  3PY8 A;  1DTQ A;  5BRF A;  3NH1 A;  1DLO A;  3THY A;  2QKK A;  5AFU A;  3KWG A;  1NMN A;  4B8A B;  3GOI A;  4UY8 O;  2D0C A;  3E1Y A;  3K9K A;  1JCE A;  4KHW A;  4H0X B;  3VEX A;  4M3Y A;  4N47 A;  4GKK K;  4H0Y B;  3LDQ A;  3GL1 A;  1C0G A;  4WE1 A;  3B6P A;  1CZB A;  3VTI A;  4RTF D;  2YNG A;  3KKS A;  1TUU A;  4GV9 A;  5AQK A;  4CEE A;  4E1N A;  1A5X A;  4YOR A;  5CY4 A;  2P9P B;  1VQN N;  1XWL A;  4DSE A;  2YHY A;  4OGC A;  1K6Y A;  3V6D A;  2IVN A;  1WNS A;  1XMO K;  3SMP A;  2KHO A;  2IDO A;  2HBK A;  3AVI A;  4X65 K;  4U67 L;  1YTA A;  5F2R A;  1S1X A;  1YTU A;  4FWK A;  3LDS A;  5LJV A;  3K58 A;  4CZH A;  1IJJ A;  2HHT A;  4AHS A;  3QML A;  1GOB A;  5GIO A;  3O9T A;  2G8V A;  3T1A A;  3S3N A;  3DRR A;  4JKA A;  3ENO A;  3IUC A;  2OTJ N;  1VQ5 N;  1BWF O;  5JS1 A;  2P9N A;  3VQ6 A;  4CES A;  4CEA A;  4F8R A;  1DKG D;  4MFB A;  4C8N A;  2E1Y A;  1NJX A;  2FXU A;  4DU3 A;  3EEQ A;  3ZLJ A;  1ZBU A;  3IKM A;  4NO7 A;  3OYL A;  4KRE A;  4JD2 B;  3WXJ A;  3QEP A;  5EXW A;  4BVO A;  3CCM N;  3H3O B;  5DK5 A;  1HKB A;  1HYV A;  1RT4 A;  1VRT A;  2WFB A;  4BRL A;  4CED A;  1VRU A;  4B1X B;  3VMF B;  4IFE A;  1TKT A;  3JAM O;  1RDU A;  2ZJQ L;  1GOA A;  3CXC M;  3RRG A;  2QK9 A;  4DHY A;  1M90 O;  4H0T B;  1ZYQ A;  3IG1 A;  4BRI A;  3KD5 E;  1L3U A;  5HRR A;  3NF9 A;  4BRM A;  1Z26 A;  3LDO A;  3KIO A;  2B5J A;  1RNH A;  3SBG A;  1S1U A;  1YHQ N;  3ULD A;  3LAL A;  1SKR A;  4BG9 A;  3G4S N;  3M8Q A;  1HMV A;  3RSE A;  1QZ6 A;  3HVR A;  3SQ1 A;  1C6V A;  3A8Y A;  4YNQ A;  2P5O A;  1KFS A;  1S5J A;  2FBY A;  4KHP K;  4HCB A;  2NRX A;  3MN7 A;  4JI0 K;  3ISN C;  4DFK A;  2JWK A;  1RBV A;  4CW7 B;  4YOY A;  4B9N A;  2ZWH A;  3I8D A;  1W7A A;  2O4I A;  3P5J A;  3VGM A;  3MXM A;  3OS1 A;  1ZC6 A;  4Z94 A;  4X62 K;  3J8A A;  4PKH A;  4FJM A;  1DT9 A;  2D0A A;  4JKD A;  3KJV A;  1WN7 A;  5EU7 A;  1LV5 A;  4IO8 A;  5EX5 A;  4CHZ A;  1NK8 A;  2BTF A;  3ZT4 A;  3EE9 A;  5HP1 A;  3MED A;  4AHU A;  3SCX A;  3AVK A;  3EL2 A;  3O1B A;  2NLX A;  4GW6 A;  1H1V A;  4DQQ A;  3U9D A;  3ZYY X;  3LDP A;  1XC3 A;  2ATQ A;  2FF6 A;  1IO2 A;  3CYM A;  5LY3 A;  5J2P A;  3F2K A;  5AZI A;  2A42 A;  4MDB A;  4HTL A;  3HP6 A;  1N36 K;  1NGD A;  4KBO A;  1QSY A;  4M45 A;  1ZBS A;  3AO4 A;  1R0A A;  3QIC A;  3HOT A;  1X9S A;  3OYE A;  2VWK A;  4CE9 A;  1E4F T;  3TTC A;  4CIG A;  4QS9 A;  1NGI A;  1Q7Y O;  3WXK A;  4CJW A;  4AM6 A;  4DTS A;  3UIQ A;  3O08 A;  3C65 A;  3WNG A;  3AVC A;  4FJI A;  2XRI A;  5BPM A;  3SJJ A;  3WEE A;  4CK2 A;  4KHN A;  2BAN A;  1HX1 A;  1RT3 A;  2QXF A;  3IMX A;  4CZJ A;  4I6M B;  2BDP A;  2Q0R A;  1BG3 A;  2O8B A;  4AHC A;  4IOC L;  3CJ7 A;  5AQV A;  3T7Z A;  2QTD A;  4IG3 A;  3D2F B;  3VQC A;  3K0S A;  3SZ2 A;  3MN5 A;  4OGE A;  1HPM A;  1UA1 A;  5KQ8 A;  1A5V A;  4JI4 K;  3ZSQ A;  5KI6 A;  2FF3 B;  1YF5 L;  3AAQ A;  3V9S A;  1N5Y A;  1NK6 A;  1J6Z A;  4CGD A;  3CCS N;  1VQM N;  1C0T A;  2UU9 K;  1U04 A;  2GTD A;  3AGK A;  4ELT A;  2IAJ A;  2HHQ A;  3RRH A;  4CGJ A;  2EWS A;  3MK6 A;  4FO0 A;  4DV7 K;  4DMN A;  5FRM A;  1VSI A;  4NYF A;  1GLE G;  1KTQ A;  4FXD A;  3THW B;  4FWS A;  2V51 B;  1D4X A;  1JCF A;  4KTQ A;  2F8T A;  3AVL A;  2Q3S A;  3T69 A;  3MCP A;  1VHX A;  3J80 O;  4BC4 A;  2VWJ A;  4Z0U A;  1K8A O;  3C6H A;  5CYQ A;  3TI0 A;  4DV0 K;  4CFC A;  3I33 A;  4BRC A;  1NOZ A;  5C12 A;  2OCE A;  1WSG A;  1IBM K;  1VK0 A;  3AO5 A;  4LF7 K;  2OAN A;  1FKO A;  2YHW A;  4BR2 A;  1RT1 A;  3C7N A;  1ILY A;  3VQ9 A;  2HF4 A;  3ZSV A;  4MLH A;  3M8P A;  3OS0 A;  1ATN A;  4OX9 K;  5D3G A;  1IBK K;  1VSF A;  4KHQ A;  3V1R A;  2ZGY A;  2IC3 A;  4DLE A;  1CZ9 A;  3K5M A;  1NK5 A;  4ELU A;  4LD0 A;  1S1W A;  1HR0 K;  4ID1 A;  1VQL N;  4LH4 A;  5J2M A;  3DLK A;  3RR7 A;  1KFD A;  1RGI A;  5AQI A;  4FK4 A;  1T7P A;  1QE1 A;  4DQI A;  4JN4 A;  4LF6 K;  1HPZ A;  3LPT A;  3TSP A;  1U6Z A;  5M1O A;  2QA4 N;  4WFN L;  4OVL A;  1K8K A;  3ZET A;  4Z4F A;  3M6G A;  2O8F B;  3CC4 N;  4QS7 A;  3QEX A;  1HNZ K;  4JS4 A;  4B1V A;  3JSM A;  1VSH A;  4CGF A;  4I9Q A;  4DQR A;  3UKU B;  1XUP O;  2HBJ A;  2UUA K;  3KLG A;  1YVU A;  3R6M A;  1WBB A;  1S6Q A;  3BUZ B;  2G8U A;  5HL7 L;  4CJU A;  3VQD A;  4KPY A;  4CJF A;  3QIP A;  3CJB A;  3KTQ A;  3KLF A;  3OA9 A;  2HNZ A;  1TUY A;  4DV3 K;  1U2V A;  1TKX A;  1J54 A;  4DCH A;  3EZ5 A;  1G15 A;  2YNH A;  3ZSY A;  1L3V A;  4NB4 A;  2HBM A;  4IJN A;  4BRD A;  3A0I X;  4M3U A;  5FPD A;  4MO5 A;  3OYM A;  2P9P A;  4Y0W A;  3OBW A;  5AQQ A;  1HKC A;  4CGH A;  5BN8 A;  4ICL A;  4RW9 A;  3B8A X;  2O8E B;  3OHR A;  4BE0 A;  4B9U A;  4IEE A;  2D1K A;  3E9L A;  4JI2 K;  3NDK A;  2IVP A;  4JKB A;  2QXL A;  3OBY A;  4LC9 B;  2NUB A;  3VEV A;  2HMP A;  4J2E A;  1SQK A;  4FPA A;  2VWB A;  4BRP A;  3P31 A;  3U6F A;  3HT3 A;  4CZK A;  3ATU A;  4IJA A;  3AGR A;  4K0K K;  4F3T A;  4DR3 K;  2G8K A;  4H4M A;  3LWM A;  4LFC K;  4M63 C;  1GLC G;  3SAG A;  2JLE A;  4K41 A;  4A59 A;  4CF2 A;  3VQ4 A;  1OH5 A;  4Y1C A;  1WSJ A;  2RPI A;  1T6D A;  3WXI A;  3AO3 A;  3FZH A;  1BGX T;  2OZS A;  4KB1 A;  3VEZ A;  4BRN A;  1BQN A;  4RW6 A;  1WSI A;  3FE1 A;  1N32 K;  3OY9 A;  1SV5 A;  5E26 A;  4IKF A;  1U48 A;  3KK7 A;  2FBX A;  4KHU A;  1SL0 A;  3J7A P;  5CZ2 A;  4JRP A;  3OYG A;  3ZT3 A;  4KKO A;  1W0H A;  3SLC A;  5ADX A;  1WOQ A;  4K42 A;  3G6E N;  3QIN A;  2G8I A;  4J2B A;  4FWQ A;  1K9M O;  3GBT A;  3LP3 A;  1JLC A;  4WQ5 A;  1EET A;  4W5O A;  1QZ5 A;  3EE8 A;  1L5U A;  3CCR N;  1JXE A;  4FW1 A;  4CFB A;  3H46 O;  5BRH A;  5E84 A;  1C0F A;  2RKI A;  1QQN A;  3CM6 A;  1SKW A;  4WCE L;  5C24 A;  1RBS A;  3NE6 A;  2WON A;  1ITG A;  4E7K A;  4CZG A;  3CET A;  4BRE A;  2YHX A;  1C1B A;  5AQX A;  3S9H A;  2WUS A;  1VSK A;  3OYD A;  1TYQ A;  2HOE A;  4FWO A;  1Y97 A;  4DTU A;  3NMU A;  2FBT A;  2WC9 A;  4WFB L;  4B3S K;  3N4Q A;  1NJY A;  3CF5 L;  2FBV A;  3CJ1 A;  4FJL A;  4RW7 A;  4WQ5 C;  4FOI A;  3KLH A;  1Q86 O;  1KSP A;  4GV6 A;  2PYL A;  3QER A;  1TV6 A;  2IIR A;  2OTL N;  4CK1 A;  4DS4 A;  4I2Q A;  5ADX H;  3IS9 A;  3VGK A;  2IOC A;  3OW2 M;  1KCF A;  1TKD A;  4BDY A;  3IDH A;  3E9P A;  1WSF A;  3HRG A;  3ZSR A;  4DF8 A;  1WSE A;  2GUI A;  3WT0 A;  5KGX A;  1X3M A;  3U9Z A;  3SNN A;  5AZJ A;  4HHT A;  3K5L A;  3WQU A;  4PWD A;  3DI6 A;  3I56 N;  3ZSX A;  3KK1 A;  3NAE A;  4BRQ A;  3I0S A;  3V1Q A;  4BVP A;  3OTO K;  2UUC K;  4FWP A;  4BRK A;  2E2N A;  1ASV A;  2V7Z A;  3JYT A;  1KAX A;  2W6K A;  5JVH L;  3PX4 A;  1C1C A;  1NJI O;  3MEG A;  1VQ9 N;  3M5R A;  5GAD P;  4O44 A;  1BUP A;  3HST B;  4CJK A;  4RW8 A;  4CGG A;  5FPN A;  5CE3 A;  2VG6 A;  1WAF A;  3C6U A;  2YNI A;  4H4O A;  4CER A;  4OPJ A;  4C8L A;  2E4L A;  2DFH A;  2YHB A;  4B3R K;  4UQG A;  4PL7 A;  2QM1 A;  1VQP N;  5AQY A;  2EHG A;  4Z4E A;  4BGB A;  3AVF A;  3KHY A;  1XHZ A;  3DMJ A;  2W40 A;  1CZA N;  3THW A;  1JLQ A;  4GNI A;  5J1E A;  1RDC A;  3MAQ A;  3AAR A;  2WOM A;  3TSU A;  2HHS A;  1ASW A;  2QW9 A;  3HK2 A;  2P9S B;  1BL3 A;  2KQ2 A;  3LWL A;  5K14 A;  4DU1 A;  2NNW A;  4M3W A;  1QVF M;  4CJL A;  3C0B A;  1U47 A;  3KLI A;  2Q36 A;  1QQM A;  3AVA A;  3A2F A;  4EP5 A;  1YJN N;  4CF0 A;  4KV8 A;  3FLC O;  4YHH K;  3VTH A;  4YDU C;  1GLD G;  1F21 A;  2UYT A;  3DAW A;  5FRN A;  1LAW A;  2P9K A;  4A5B A;  1ZXO A;  4CZL A;  5AQP A;  1NK7 A;  4Y1D A;  2F9W A;  2AP1 A;  2PBD A;  1HNX K;  3PIP L;  5CYM A;  3T1Y K;  4JEP A;  3V81 A;  1NK0 A;  3WNE A;  3HM9 A;  4AHR A;  1XNQ K;  2PYJ A;  1NGE A;  4B1U B;  4R5P A;  4FJ9 A;  4FJX A;  5AFU H;  1RT6 A;  3NF7 A;  1NKC A;  4QCL A;  4DV6 K;  4CJS A;  3CQX A;  3KK2 A;  3PLA A;  1A5W A;  2RHK A;  4FLU A;  2Q97 A;  1NGH A;  4M42 A;  3DLG A;  3ULE B;  2PZS A;  4F2S A;  3P38 A;  4W5Q A;  4E1M A;  2A1S A;  2CGJ A;  4DSJ A;  4B3O A;  2ZQB A;  2VQF K;  4MDA A;  3QFU A;  3O9U A;  4KRF A;  4JI7 K;  3OYN A;  1BI4 A;  4HTU A;  2XY8 A;  2O8F A;  2E1Z A;  1BIS A;  1E4G T;  1HNW K;  4OO1 J;  4OLB A;  4WYB A;  3P83 D;  3DM2 A;  3T3F A;  1D9F A;  3VOV A;  3L4I A;  1HJR A;  3LZJ A;  4HVJ A;  3HVT A;  4CD3 A;  2O8C B;  2D4W A;  3WXL A;  1QS4 A;  3HM8 A;  1RBU A;  4I2P A;  3MWT A;  3M8S A;  1ZBF A;  3J7Y P;  3QEI A;  5C10 A;  1L3S A;  4LSN A;  3VF4 A;  2OPQ A;  2B6A A;  3L2Q A;  2HVI A;  3LPU A;  1JLE A;  3DXM B;  1VSL A;  3CQY A;  1NBW A;  2XY7 A;  4RG8 A;  1JL2 A;  4WQ4 C;  3E66 A;  5EY4 A;  4CHQ A;  4Q5V A;  1JLG A;  2PAV A;  5IWA K;  4FOE A;  4M3Z A;  1QHA A;  2NRZ A;  3SV3 A;  1SZ2 A;  1TL1 A;  4E19 A;  1SKS A;  1W97 L;  1KLN A;  4DTJ A;  2O8E A;  4CZM A;  3RMD A;  2GV9 A;  2I5J A;  3F5T A;  5TKW A;  4H0O A;  3TAE A;  2W42 A;  4IFY A;  4IWV A;  3K57 A;  4WF9 L;  3NVM A;  3EKS A;  4CJV A;  3P4I A;  3AVN A;  1C0U A;  4BWJ A;  3TAM A;  3V9W A;  3M1F A;  1NKB A;  2P9L B;  3AV9 A;  4EIA A;  4JHD B;  3QO9 A;  4Z4H A;  3QB0 A;  4NXM K;  2X6S A;  3L0Q A;  2E2P A;  2QEX N;  3T19 A;  4DSF A;  3F73 A;  3QNO A;  3VER A;  5J2N A;  4E7I A;  3H6E A;  1YI2 N;  4A57 A;  4BAC A;  4LY7 A;  3PUF A;  2Q1N A;  2FC0 A;  1RT2 A;  5E41 A;  3Q7B A;  1P8Z A;  4FM2 A;  4ILH A;  4ILJ A;  3ZSO A;  4F2R A;  3CJ9 A;  1VQO N;  5SWM A;  4DV5 K;  4OPH A;  3DLR A;  2FLO A;  3VQ5 A;  1ESV A;  3DOL A;  3L3U A;  1J53 A;  4FCY A;  3MEC A;  4H5R A;  3MCA B;  1KAY A;  3FZF A;  1O1W A;  2HB5 A;  1YAG A;  4JK9 A;  3THV A;  5M1N A;  3O8M A;  4ZHR A;  3RVC A;  2QI2 A;  4JKF A;  2ZJP L;  4DV1 K;  4OKE A;  2HHU A;  4B9V A;  3AAP A;  1NLV A;  3LAN A;  1JLF A;  2Y1J A;  3A5N C;  4H5W A;  4B9S A;  4BDP A;  2A1R A;  2GBZ A;  4O5B A;  3ID8 A;  3TAF A;  1XMQ K;  3K2P A;  1NGJ A;  4LSL A;  2YKN A;  3R3L A;  3VN5 A;  4NCB A;  4OPK A;  4JLH A;  1WB9 A;  4B9M A;  4DR1 K;  5JS2 A;  5HRS A;  2O8D A;  3O4N A;  5EVZ A;  2ASO A;  2D0P A;  5FPE A;  3THY B;  2ASP A;  4QS8 A;  1RTI A;  4DUZ K;  3NF6 A;  4BC5 A;  4IDK A;  4YY3 K;  4B8C A;  4TSX A;  4Z4I A;  3C95 A;  2NRR A;  4BR5 A;  3VQQ A;  3SUP A;  4YOU A;  4CZF A;  2F8S A;  2BUP A;  5HRO A;  1VQK N;  1IV0 A;  3QIO A;  3I55 N;  3CFO A;  3D45 A;  3NGZ A;  3CPE A;  5ELZ A;  4F4K A;  4N56 A;  4O8K A;  4FPB A;  1JCG A;  1VSM A;  3NH2 A;  2GEM A;  4BQL A;  3U3G A;  3DLL L;  2D5R A;  5AQH A;  5CZ1 A;  2QWR A;  3P39 A;  3VPZ A;  3HYF A;  3NGY A;  3QBX A;  1KRP A;  4FJJ A;  3VES A;  3L2W A;  4B9L A;  4O0J A;  1LCU A;  2FSJ A;  5LL6 Z;  2V52 B;  4M3X A;  1MA9 B;  2EX3 A;  3TU5 A;  3CFR A;  3DXK A;  3C6T A;  1ATS A;  4CGI A;  1EQY A;  1X3N A;  4G1Q A;  2ASM A;  3TWH A;  4Z4G A;  2KTQ A;  1OVQ A;  2QWL A;  1TVR A;  3SYZ A;  3VF2 A;  2E88 A;  2YX6 A;  3HZ6 A;  3SAF A;  4ELV A;  2P9N B;  4OPA A;  2OZM A;  3K5O A;  5GAE P;  1RT7 A;  3H45 C;  1N6Q A;  4FL9 A;  4N41 A;  3CCQ N;  3TTD A;  3O5B A;  3ZSZ A;  4DFP A;  3THX A;  2KZZ A;  1B9D A;  1NG9 A;  5M1P A;  1HNI A;  3QNN A;  1KAZ A;  5AQU A;  4B9T A;  1IH7 A;  3OJU A;  4E89 A;  4B1Y B;  4CZE A;  1KVA A;  4FLV A;  4I9L A;  3OYJ A;  1LWF A;  4DSL A;  2RE2 A;  2E20 A;  3BZC A;  2QWM A;  4CF1 A;  1RBT A;  1TK0 A;  4JK8 A;  3QBW A;  4HWI A;  2XO7 A;  3SQ0 A;  1RBR A;  3Q7C A;  1YIT N;  5SZT A;  4AHV A;  1RIL A;  3ZX0 A;  2OPP A;  3G0Z A;  2ZE2 A;  5LMU K;  3RSE B;  3BF1 A;  3PX0 A;  1P90 A;  3RR8 A;  4PHT X;  5C2F A;  1OKJ A;  2ETJ A;  3ZX3 A;  2VG5 A;  2YV0 X;  1FXX A;  3K5N A;  3HPH A;  4LF5 K;  4NXN K;  4XH1 A;  4HUG A;  4L8R B;  4AQY K;  4CK3 A;  4DWI A;  4ILG B;  4LF4 K;  2B4J A;  4DKW A;  5KTQ A;  3NVK A;  3BZK A;  1BCM A;  3W0L A;  1IKY A;  5TKY A;  3C6A A;  1VSJ A;  1HQU A;  4X64 K;  3TPQ A;  3I8B A;  5B8H A;  2E2Q A;  1K73 O;  3UB5 A;  1I3A A;  5JVG L;  4KI6 A;  5AQR A;  3KZB A;  3O4Q A;  1UA0 A;  3VQB A;  5M1K A;  4KTW A;  4XH4 A;  1Q82 O;  5KQD A;  1ZBL A;  3AVJ A;  4DTR A;  1WSH A;  2RN2 A;  3DRS A;  1HQE A;  3L2R A;  1FW6 A;  5CR4 A;  4FWL A;  3PIO L;  4CEB A;  4JD2 A;  5AZI B;  5C0Y A;  1IKV A;  4JKG B;  3IAY A;  3VEY A;  2G8W A;  3EN9 A;  3QEW A;  4FZZ A;  4RW4 A;  1TAU A;  4XH5 A;  4FLT A;  1OH8 A;  3HL8 A;  3M3Z A;  1T8E A;  4DG1 A;  4WFA L;  3WNF A;  4LF9 K;  5AQZ A;  4NLB A;  1Z25 A;  3O3G A;  4BRG A;  1XI1 A;  4DSI A;  5EOY A;  1CXU A;  4PKG A;  1QHT A;  4BQZ A;  3RMA A;  3B6O A;  3LAK A;  5C42 A;  1RDD A;  3WEE B;  4CF8 A;  4N5S A;  1GOC A;  1V4S A;  3VA0 A;  1T6C A;  4H03 B;  5KPZ A;  2R7Y A;  3P1G A;  5BR8 K;  2Q0U A;  3L3V A;  4W5T A;  1VQ7 N;  3LAM A;  2O8B B;  3S3M A;  2KLA A;  3MN6 A;  3D6R A;  4XEI A;  1LW2 A;  3HBT A;  4CCH A;  4CHP A;  2YCH A;  3DLB A;  3AA4 A;  5AQF A;  4EZ9 A;  1TL3 A;  3WXM B;  3U3Y A;  1V4T A;  3LP0 A;  1S72 N;  4W5R A;  2VQE K;  5LMN K;  3SV4 A;  1DTT A;  5IT9 O;  5BPN A;  5AQS A;  3M8R A;  1JL1 A;  2D0O A;  2ZD1 A;  3NF8 A;  3HOS A;  1IKW A;  3OYF A;  2X6N A;  3CHW A;  1W2B M;  2I7N A;  2OA8 A;  2GX9 A;  2E6L A;  4AF1 A;  1GLB G;  4CVN E;  3OYA A;  1T03 A;  3FFI A;  2YNF A;  3TAB A;  3JXU A;  3HPO A;  1Q8I A;  4CZI A;  1LOT B;  4DR2 K;  2Z1I A;  4N76 A;  4LFA K;  4DU4 A;  5FRO A;  1SL2 A;  2JGU A;  1BCO A;  1J5E K;  3CC2 N;  1GLJ O;  4HUE A;  1TK8 A;  2FSN A;  5KRS A;  3CC7 N;  2Q2R A;  4PA1 A;  3ZEU B;  2QWN A;  2HW3 A;  3HP9 A;  1REV A;  3VEW A;  1S9E A;  2WTU A;  4FJN A;  3LM9 A;  1NU0 A;  2OPS A;  3QEV A;  4ID5 A;  5BRE A;  3AA2 A;  4CEZ A;  4CFD A;  4B1W B;  3CME N;  3NHG A;  4IXC A;  3L2V A;  2KZM A;  4I6M A;  1YJ9 N;  3D2E B;  2IS3 A;  5F1X A;  1FKP A;  1BIZ A;  3U8X A;  4YOV A;  3WUH A;  3RMC A;  3D2F A;  3JS6 A;  4C8O A;  4JKC A;  3CER A;  4BRF A;  1NOY A;  3ITH A;  4BRA A;  4DS5 A;  2XHB A;  1I39 A;  2HST A;  2KFZ A;  4ISG A;  1EKE A;  4M7Y A;  5HRP A;  2E2O A;  1EO1 A;  1BO5 O;  5DM7 L;  3VQA A;  4YDU A;  2A3Z A;  2WBN A;  1K8K B;  3AO1 A;  3OYI A;  3ZET B;  4E7H A;  1RDW X;  1RT5 A;  1MWK A;  4H5T A;  3S41 A;  4DTM A;  3CCE N;  1NGA A;  5BR9 A;  3HSC A;  1B9F A;  1S1T A;  1VSD A;  4CF9 A;  4CBW A;  4ZTJ A;  4CBU A;  4IDH A;  3SUO A;  5AQN A;  4FZY A;  1VAZ A;  3VET A;  1KVB A;  1UWB A;  4MQ3 A;  3SPZ A;  1IG9 A;  4BR9 A;  4E7J A;  3RMB A;  3QDK A;  5BPL A;  4CJQ A;  5GAG P;  4BC2 A;  1HJO A;  4RWT A;  1U49 A;  2QKB A;  1RDB A;  3FGU A;  2GUP A;  3ZT1 A;  4MO4 A;  1KD1 O;  2D0B A;  3SMS A;  3BEX A;  1U2V B;  4HUF A;  1XC9 A;  4XIU A;  3CMA N;  3MMV A;  4C8M A;  3VA3 A;  5HLF A;  2E5L K;  2P5G A;  1SAZ A;  2AA4 A;  4DQ8 A;  4Z4C A;  1OH6 A;  3MX2 A;  3GDQ A;  1GLL O;  3VF6 A;  4DF4 A;  1CLQ A;  4BGA A;  1Q9Y A;  2OYQ A;  1JJ2 M;  1OVY A;  5KRT A;  4DV2 K;  3AVG A;  4C23 A;  4C1N K;  3WQT A;  3EO3 A;  3O9R A;  1BU6 O;  3MXI A;  1S3X A;  4FK2 A;  4JYA K;  1HRH A;  3VEO A;  5I42 A;  1YVN A;  4CFA A;  1MU2 A;  2Q31 A;  3MWP A;  1G99 A;  1SUQ A;  4KH4 A;  2X78 A;  1N8R O;  1M1K O;  3J7Z O;  1Q81 O;  4FLX A;  4DTO A;  2DY4 A;  2RF2 A;  4MLE A;  1EP4 A;  3S3O A;  2W41 A;  4BRO A;  3IFR A;  1NKE A;  4WQ4 A;  2P9U B;  1DEJ A;  3D7E O;  1LWE A;  3KWI A;  3V4I A;  2PFU A;  4JNE A;  4OJR A;  3OVN A;  5CHI A;  4BC3 A;  1QVG M;  3G10 A;  5BN9 A;  2ITG A;  5AQJ A;  3EZW A;  2HHV A;  2F7T A;  1FK9 A;  4JAX A;  4IG0 A;  3PO4 A;  3TR8 A;  3L6Q A;  3UKU A;  3H3N O;  3LM2 A;  4RCH A;  3R8E A;  3CG7 A;  5JMV A;  1NNE A;  2P51 A;  4DB3 A;  1DGK N;  3U4L A;  4FM1 A;  4E3S A;  3HTV A;  4DQS A;  1QQC A;  1XQS C;  2IGI A;  2HMI A;  4Q0B A;  4NYN A;  4KTZ A;  4IO9 L;  3SUQ A;  2CH5 A;  3E9O A;  1YXQ A;  1LWC A;  1X9W A;  1NK4 A;  1RTH A;  4EHU A;  4B3T K;  4PKI A;  4OKK A;  2UXC K;  3DWL A;  2CH6 A;  2X74 A;  4ZTF A;  4CJE A;  2HBL A;  2P9I B;  3MXJ A;  4GV3 A;  4DR5 K;  2DFE A;  4IOA L;  5BRD A;  4E7L A;  5JLF A;  3UKR B;  4K8X A;  3O80 A;  1BQM A;  4YFU A;  5GIP A;  4YOW A;  4F3O A;  4DR4 K;  3R1X A;  1UOC A;  4ISF A;  5I3U A;  4CI6 A;  3AA5 X;  3KKR A;  5HOO A;  2LSN A;  4CJ4 A;  2XY5 A;  4CIF A;  3DLE A;  3MN9 A;  3EYZ A;  1KXP A;  3A5M C;  3O6W A;  1YUW A;  2VGN A;  2F96 A;  1D8Y A;  5C2D A;  1QTM A;  4B3M K;  5AQT A;  4CJT A;  2XY6 A;  3NBP A;  1TYQ B;  3OYH A;  4EAH D;  4JRQ A;  2HNY A;  2UXD K;  3PX6 A;  4HCC A;  5GAH P;  1RTD A;  4I7F A;  1X1P A;  4OKJ A;  3O3H A;  4FWR A;  2BGG A;  1ASU A;  4LH5 A;  4BR0 A;  3SJH A;  4FWN A;  2H3G X;  4FJH A;  4YOX A;  2HHH K;  1VQ8 N;  4JKG A;  3NH0 A;  4JI8 K;  5C15 A;  4KAZ A;  4W5N A;  2DFF A;  5GIN A;  4FJK A;  3OYB A;  1XNR K;  1NGB A;  4JI1 K;  3N4P A;  2Y1I A;  2QWP A;  3OJS A;  5AZJ B;  2A41 A;  1WLJ A;  1Z05 A;  3TAP A;  4FZX C;  2J4R A;  1NGG A;  4CEQ A;  1C0M A;  3O9Q A;  3CD6 N;  2NRV A;  1X9J A;  1SS6 A;  4U7B A;  3CPW M;  4JV5 K;  1Q9X A;  4NCG A;  1Q18 A;  3PV8 A;  2AJQ A;  3CI5 A;  5JLH A;  1HYZ A;  3HPG A;  1U4B A;  1EWR A;  4C8K A;  3LP1 A;  2A40 A;  3FZK A;  4DSK A;  1ZBH A;  3SQ4 A;  2NRW A;  4ISE A;  2Z1H A;  3DYA A;  1IBL K;  3ENH A;  3NCI A;  4M41 A;  4CJ7 A;  2DTU A;  5M1F A;  4O0I A;  5JIC A;  3T1H K;  4KH5 A;  3HJF A;  1R59 O;  4CHY A;  2A6A A;  1J9A A;  5M1Q A;  4CHN A;  4DFJ A;  1TK5 A;  3LZI A;  2I7P A;  5F0X A;  1QSL A;  1YJW N;  3BY5 A;  3MX5 A;  3L8B A;  4KH6 A;  3CCJ N;  2YHA A;  5I9E B;  3QFP A;  4K43 A;  1NGF A;  3VQE A;  3OYK A;  1HLU A;  3E01 A;  1MDU B;  4C1N I;  4J2D A;  3SI6 A;  1Z6R A;  5DMR A;  4QAG A;  4AHT A;  3AVB A;  3AVM A;  3DLH A;  3TAR A;  4NCA A;  5FPM A;  4DTX A;  3OYC A;  2G8H A;  1GLF O;  3ZCM A;  1WAJ A;  2IVO A;  3V1O A;  4QOZ B;  2UUB K;  3IRX A;  4DQP A;  5T7B A;  4BY9 C;  1T05 A;  4PQU A;  4BRH A;  1TKZ A;  2P9K B;  4V19 S;  3RTV A;  3ZEU A;  1HNV A;  2VYP A;  4FJ7 A;  3C94 A;  4CJR A;  4FJG A;  3CJA A;  3DOK A;  5FDL A;  1S22 A;  3PSF A;  4BDZ A;  1S6P A;  4R79 A;  5J2Q A;  4FJ8 A;  4G9Z A;  2UXB K;  1U45 A;  3DRP A;  3D2E A;  1BDG A;  3K9J A;  1MWM A;  1W9H A;  4IBN A;  2Z1G A;  4H0V B; 
#chains in the Genus database with same CATH homology
 2Q36 A;  1XC3 A;  2VGM A;  3A5O C;  2KLA A;  3MN6 A;  2FF6 A;  1WUA A;  3D6R A;  1QQM A;  4XEI A;  4H5V A;  3HBT A;  1YJN N;  5LY3 A;  3A5L C;  2GEL A;  3ZYY X;  2NZT A;  3F2K A;  5AZI A;  2A42 A;  3FLC O;  2F9T A;  4MDB A;  2YCH A;  4HTL A;  3VTH A;  4YDU C;  2VCP A;  1GLD G;  5AQF A;  2UYT A;  1NGD A;  4KBO A;  4GY2 B;  3WXM B;  3DAW A;  1ZBS A;  5H1S Q;  3QIC A;  3HOT A;  1V4T A;  2P9K A;  4A5B A;  4BR7 A;  1IG8 A;  1O13 A;  1S72 N;  4E1J A;  1ZXO A;  1E4F T;  4CZL A;  5AQP A;  3TTC A;  3W3D A;  4QS9 A;  1NGI A;  3UE5 A;  1Q7Y O;  3WXK A;  2F9W A;  4AM6 A;  5BPN A;  5AQS A;  2AP1 A;  2PBD A;  3PIP L;  3O08 A;  3C65 A;  2D0O A;  2ITM A;  3HOS A;  4JEP A;  3ATV A;  3CHW A;  2DPN A;  5BPM A;  1NWK A;  2I7N A;  4O5F A;  1T44 A;  2P9S A;  2GX9 A;  3TSQ A;  3WEE A;  4AF1 A;  4JK7 A;  1GLB G;  1HX1 A;  4BR4 A;  1Y64 A;  1NGE A;  1QQO A;  3IMX A;  4CZJ A;  5AQL A;  4B1U B;  4I6M B;  3JXU A;  3O9S A;  2Q0R A;  1BG3 A;  5AFU H;  4IOC L;  4CZI A;  3CJ7 A;  5AQV A;  1LOT B;  2QTD A;  3CQX A;  3KVG A;  3T7Z A;  3D2F B;  3PLA A;  2RHK A;  3MN5 A;  2Q97 A;  1NGH A;  1HPM A;  3ULE B;  4J8F A;  5KQ8 A;  1KQS M;  1T3V A;  3P38 A;  3CCV N;  2CGJ A;  3FZL A;  2FF3 B;  1YF5 L;  3AAQ A;  4IEI A;  4MDA A;  2YJE A;  3CC2 N;  1GLJ O;  3QFU A;  1J6Z A;  3O9U A;  3CCS N;  1VQM N;  3CIP A;  2GTD A;  2FSN A;  3CC7 N;  2Q2R A;  3AGK A;  3ZEU B;  2QWN A;  2E1Z A;  2EWS A;  3MK6 A;  1E4G T;  2NRH A;  3EKU A;  4FO0 A;  3VEW A;  4OO1 J;  3LM9 A;  4WYB A;  5BRE A;  3BF3 A;  3L4I A;  3VOV A;  1GLE G;  4FWS A;  4FVU A;  2BH1 A;  2V51 B;  2D4W A;  3ENB A;  4CD3 A;  4IOX A;  3WXL A;  1D4X A;  3HM8 A;  1JCF A;  4B1W B;  1NGC A;  3CME N;  3T69 A;  3MWT A;  2GWK A;  3MCP A;  4IXC A;  3G71 N;  5C10 A;  3TTF A;  4I6M A;  3VF4 A;  4BC4 A;  1YJ9 N;  1K8A O;  3D2E B;  3C6H A;  5LJW A;  3ZX2 A;  1HKG A;  5F1X A;  3U8X A;  4YOV A;  3WUH A;  3DXM B;  3D2F A;  3JS6 A;  3CQY A;  1NBW A;  3CER A;  4JKC A;  3I33 A;  4BRF A;  4BRC A;  5C12 A;  3ULE A;  3DJC A;  4WQ4 C;  3E66 A;  3GE1 A;  5EY4 A;  4BRA A;  1NM1 A;  3VEN A;  2OAN A;  2YHW A;  2QWO A;  4BR2 A;  5MLC Q;  2HST A;  2PAV A;  2P9U A;  3C7N A;  4ISG A;  4JKH A;  4M7Y A;  4FOE A;  2E2O A;  1EO1 A;  1BO5 O;  5DM7 L;  4YDU A;  1ILY A;  2A3Z A;  2WBN A;  2HF4 A;  1K8K B;  1QHA A;  2NRZ A;  4O8U A;  1SZ2 A;  3ID6 A;  3ZET B;  4MLH A;  1RDW X;  1ATN A;  1MWK A;  4F9O A;  4H5T A;  1W97 L;  3LDL A;  3S41 A;  3SAH A;  3CCE N;  1NGA A;  2ZGY A;  5BR9 A;  3HSC A;  2YI1 A;  3MDQ A;  2V7Y A;  4CZM A;  3F5T A;  5TKW A;  4H0O A;  4CBW A;  4CBU A;  4IDH A;  4NLC A;  5AQN A;  4A2A A;  1VAZ A;  3VET A;  4IWV A;  4BR9 A;  4WF9 L;  3NVM A;  3EKS A;  3QDK A;  4H0P A;  5BPL A;  3DXM A;  5GAG P;  4BC2 A;  1VQL N;  3R9P A;  1HJO A;  4YOT A;  3P4I A;  4RWT A;  3G25 A;  1RGI A;  3M1F A;  5AQI A;  1YIJ N;  2A5X A;  3FGU A;  2GUP A;  4MO4 A;  1KD1 O;  2P9L B;  4JN4 A;  4EIA A;  4JHD B;  3SMS A;  3BEX A;  1U2V B;  3TSP A;  5KPR A;  3QB0 A;  1U6Z A;  5AR0 A;  5M1O A;  4WFN L;  5DM6 L;  3CMA N;  3L0Q A;  2QA4 N;  3MMV A;  2E2P A;  3GG4 A;  3F9M A;  2QEX N;  1K8K A;  2P9I A;  1ATR A;  5AQW A;  3VER A;  3ZET A;  1SAZ A;  4BG8 A;  5KPT A;  2AA4 A;  3M6G A;  4DQ8 A;  3UKR A;  3H6E A;  3MX2 A;  3GDQ A;  1GLL O;  4QS7 A;  3CC4 N;  1YI2 N;  4A57 A;  3VF6 A;  4BGA A;  4A62 A;  2Q1N A;  1VQ6 N;  3SBT A;  4B1V A;  3CCU N;  1JJ2 M;  3Q7B A;  2ZGZ A;  4H5N A;  1OVY A;  1P8Z A;  3CJC A;  4B9Q A;  4ILH A;  4ILJ A;  3FR0 A;  3UKU B;  3FZM A;  4C23 A;  4C1N K;  1XUP O;  3CJ9 A;  3WQT A;  1VQO N;  2HBJ A;  1HUX A;  3EO3 A;  3O9R A;  1BU6 O;  1S3X A;  3R6M A;  3LDN A;  3O1W A;  4IZ9 A;  3VEO A;  4EFH A;  3BUZ B;  4OPH A;  4M7X A;  2FLO A;  3CCL N;  1ESV A;  1YVN A;  3AY9 A;  5HL7 L;  2Q31 A;  3MCA B;  3MWP A;  1G99 A;  4H5R A;  1KAY A;  4KH4 A;  3FZF A;  3VGL A;  1YAG A;  1N8R O;  1M1K O;  3J7Z O;  1Q81 O;  3CJB A;  4JK9 A;  3OA9 A;  2JWL A;  1TUY A;  2P9L A;  2ZF5 O;  5M1N A;  3O8M A;  3RVC A;  4JHD A;  4MLE A;  1U2V A;  2QI2 A;  4JKF A;  2ZJP L;  2W41 A;  4AM7 A;  4BRO A;  2KKZ A;  1RFQ A;  3IFR A;  4DCH A;  4WQ4 A;  3AAP A;  2P9U B;  3C7N B;  1NLV A;  1DEJ A;  4NB4 A;  3D7E O;  2HBM A;  4IJN A;  4BRD A;  3KWI A;  3A0I X;  3A5N C;  4H5W A;  4MO5 A;  5FPD A;  2PFU A;  2P9P A;  4JNE A;  4GVE A;  1BOT O;  4Y0W A;  5CHI A;  3H1Q A;  3OBW A;  5AQQ A;  1HKC A;  5BN8 A;  4L3Q A;  4BC3 A;  3ID8 A;  1QVG M;  5BN9 A;  1NGJ A;  5AQG A;  3B8A X;  5AQJ A;  3EZW A;  2F7T A;  3R3L A;  3OHR A;  4JAX A;  3FFK B;  3L6Q A;  4IEE A;  3H3N O;  3LM2 A;  4PL8 A;  4RCH A;  3R8E A;  3UKU A;  5JMV A;  4A2B A;  4DB3 A;  1DGK N;  2D1K A;  3E9L A;  4A5A A;  3U4L A;  2ZJR L;  5AQM A;  3HTV A;  2IVP A;  4JKB A;  3H1V X;  2QXL A;  3OBY A;  4LC9 B;  5EVZ A;  3BP8 A;  2ASO A;  2D0P A;  5FPE A;  1XQS C;  1KC8 O;  3VEV A;  4A61 A;  2HMP A;  1VQ4 N;  2ASP A;  4QS8 A;  2HF3 A;  4BC5 A;  1SQK A;  2E8A A;  3DXK B;  4FPA A;  4IO9 L;  2CH5 A;  3E9O A;  4EHT A;  2VWB A;  4BRP A;  1GLA G;  1YXQ A;  2NRT A;  5AQO A;  2NRR A;  4BR5 A;  3P31 A;  2CGL A;  2YJF A;  4CZK A;  3ATU A;  4IJA A;  3AGR A;  4PKI A;  4YOU A;  4B1Z A;  4CZF A;  4EHU A;  2BUP A;  2FSK A;  2CGK A;  1VQK N;  4JKE A;  3SK3 A;  3I55 N;  3DWL A;  4M63 C;  1GLC G;  2CH6 A;  3HI0 A;  4FSV A;  2HBL A;  3SAG A;  2P9I B;  3CPE A;  4GV3 A;  5ELZ A;  4K41 A;  4K25 A;  4A59 A;  4IOA L;  3L4Q A;  4O8K A;  5BRD A;  4CBX A;  5JLF A;  3O4W A;  3UKR B;  4FPB A;  1BA1 A;  1JCG A;  4CD1 A;  1T6D A;  1NMD A;  4FWM A;  3O80 A;  3WXI A;  1BA0 A;  2GEM A;  3FZH A;  4BQL A;  5GIP A;  2GWJ A;  4YOW A;  3R1X A;  3DLL L;  3VEZ A;  4ISF A;  5AQH A;  4BRN A;  2QWR A;  4CI6 A;  3P39 A;  5HOO A;  3VPZ A;  3QBX A;  3FE1 A;  3VES A;  3LL3 A;  5E26 A;  1LCU A;  2FSJ A;  5BRF A;  3MN9 A;  2V52 B;  1KXP A;  1MA9 B;  3A5M C;  3O6W A;  3KK7 A;  3TU5 A;  5AFU A;  1YUW A;  2VGN A;  3KWG A;  3DXK A;  4UY8 O;  3GOI A;  5C2D A;  3E1Y A;  3K9K A;  1JCE A;  5AQT A;  4H0X B;  3VEX A;  1ATS A;  1TYQ B;  1EQY A;  1X3N A;  4EAH D;  3SLC A;  2ASM A;  5ADX A;  4H0Y B;  3LDQ A;  3GL1 A;  1C0G A;  5GAH P;  2QWL A;  1WOQ A;  4K42 A;  3VF2 A;  2E88 A;  2YX6 A;  3HZ6 A;  3VTI A;  3G6E N;  4RTF D;  3SAF A;  4FWR A;  1TUU A;  2P9N B;  4FWQ A;  4OPA A;  4GV9 A;  5AQK A;  1K9M O;  3GBT A;  4YOR A;  4BR0 A;  5GAE P;  3H45 C;  3SJH A;  2P9P B;  4FL9 A;  3CCQ N;  1VQN N;  4FWN A;  3TTD A;  4WQ5 A;  2H3G X;  4YOX A;  1QZ5 A;  3O5B A;  1VQ8 N;  3EE8 A;  2YHY A;  4JKG A;  3CCR N;  5C15 A;  2IVN A;  3H46 O;  5BRH A;  5E84 A;  3SMP A;  1C0F A;  5GIN A;  2KHO A;  5M1P A;  1KAZ A;  1NGB A;  1QQN A;  5AQU A;  2HBK A;  3N4P A;  4B1Y B;  4U67 L;  4CZE A;  4WCE L;  2QWP A;  5F2R A;  4FWK A;  4CZG A;  5LJV A;  3CET A;  4BRE A;  1IJJ A;  2YHX A;  5AZJ B;  5AQX A;  4CZH A;  2A41 A;  1Z05 A;  2WUS A;  2RE2 A;  2E20 A;  3QML A;  2J4R A;  2QWM A;  1NGG A;  1TYQ A;  2HOE A;  4FWO A;  3O9Q A;  4JK8 A;  5GIO A;  3O9T A;  3CD6 N;  3NMU A;  2NRV A;  1X9J A;  1SS6 A;  2WC9 A;  3QBW A;  4HWI A;  4WFB L;  4JKA A;  3ENO A;  3IUC A;  4U7B A;  3CPW M;  3N4Q A;  2OTJ N;  1Q18 A;  3CF5 L;  3CJ1 A;  1BWF O;  1VQ5 N;  3CI5 A;  5JLH A;  3Q7C A;  2P9N A;  1YIT N;  4WQ5 C;  3ZX0 A;  4FOI A;  1Q86 O;  1DKG D;  2A40 A;  3FZK A;  3BF1 A;  3RSE B;  4GV6 A;  1P90 A;  2NRW A;  4ISE A;  4PHT X;  2E1Y A;  2FXU A;  5C2F A;  2IIR A;  2OTL N;  1OKJ A;  3IKM A;  4NO7 A;  3ZX3 A;  4JD2 B;  3WXJ A;  3ENH A;  5EXW A;  4BVO A;  5ADX H;  4CJ7 A;  3H3O B;  3VGK A;  1HKB A;  5M1F A;  3CCM N;  4XH1 A;  5JIC A;  3OW2 M;  2WFB A;  4KH5 A;  1R59 O;  3E9P A;  3HRG A;  3IDH A;  4BRL A;  4B1X B;  3VMF B;  4IFE A;  4ILG B;  2A6A A;  4DKW A;  3WT0 A;  1RDU A;  2ZJQ L;  1X3M A;  3NVK A;  3U9Z A;  3CXC M;  5M1Q A;  2I7P A;  5AZJ A;  5F0X A;  4DHY A;  3W0L A;  1M90 O;  3WQU A;  4H0T B;  1YJW N;  3I56 N;  5TKY A;  3C6A A;  4BRI A;  3MX5 A;  4BRQ A;  4KH6 A;  3CCJ N;  4BRM A;  3LDO A;  3TPQ A;  5I9E B;  3QFP A;  4BVP A;  3I8B A;  5B8H A;  2E2Q A;  4K43 A;  1K73 O;  1NGF A;  3UB5 A;  5JVG L;  3SBG A;  4FWP A;  4BRK A;  1HLU A;  2E2N A;  1MDU B;  3KZB A;  2V7Z A;  5AQR A;  4C1N I;  1YHQ N;  1KAX A;  5JVH L;  1NJI O;  1VQ9 N;  1Z6R A;  5M1K A;  3M5R A;  5GAD P;  4XH4 A;  4BG9 A;  3G4S N;  1BUP A;  5KQD A;  1Q82 O;  3RSE A;  1QZ6 A;  5FPN A;  5CE3 A;  5FPM A;  1GLF O;  3A8Y A;  5CR4 A;  4FWL A;  3PIO L;  4JD2 A;  5AZI B;  2IVO A;  2NRX A;  5C0Y A;  3MN7 A;  4JKG B;  2JWK A;  4YOY A;  3VEY A;  2ZWH A;  4BY9 C;  3EN9 A;  4BRH A;  4XH5 A;  3VGM A;  4PL7 A;  2QM1 A;  3M3Z A;  2P9K B;  1ZC6 A;  1VQP N;  4Z94 A;  3ZEU A;  2VYP A;  5AQY A;  4WFA L;  3J8A A;  5AQZ A;  4BGB A;  3KHY A;  4PKH A;  4NLB A;  1DT9 A;  4JKD A;  3CJA A;  4BRG A;  2W40 A;  1CZA N;  4GNI A;  4IO8 A;  5EOY A;  4PKG A;  4BQZ A;  3AAR A;  5EX5 A;  2BTF A;  3TSU A;  2QW9 A;  3EE9 A;  2P9S B;  3WEE B;  1S22 A;  4R79 A;  1V4S A;  1W2B M;  1T6C A;  4H03 B;  1QVF M;  2NNW A;  3EL2 A;  4G9Z A;  3O1B A;  2NLX A;  5KPZ A;  3D2E A;  1BDG A;  3K9J A;  1MWM A;  1H1V A;  3U9D A;  3C0B A;  2Q0U A;  3LDP A;  2QWQ A;  1VQ7 N;  4H0V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...