2NRRA

Crystal structure of the c-terminal rnaseh endonuclase domain of uvrc
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
139
Chain Sequence
MEALEELMKLLNMKDFPYRIEGIDISHLYTVASLVVFEDGFPKKGDYRRYKIDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLATVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 44
structure length 139
sequence length 151
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrrA00
2NRTA 2NRZA 2NRWA 2NRXA 2NRVA 3C65A 2NRRA
chains in the Genus database with same CATH superfamily
3HO1A 4BROA 4IG0A 3AA2A 3THYA 4XH5A 3H1VX 4E7LA 4M3YA 2R7YA 1SKWA 3L6QA 1ZBHA 1UAXA 3K5NA 3SUNA 4CHZA 5C25A 4B1WB 2FLOA 1UOCA 1Z6RA 1RT4A 1X3MA 4E7IA 4JKFA 3ATUA 4R79A 3VF2A 2RE2A 4BDZA 3TPQA 4A61A 4YDUC 4WFBL 1YITN 2O8FB 4JI0K 2RF2A 2WBNA 4DTOA 3LP1A 4KHWA 4CI6A 3U8XA 2QA4N 1WN7A 1S1VA 1OVQA 4MDBA 5KRTA 2HHTA 1ZC6A 4CK1A 3LZJA 3IMXA 3SMSA 4BREA 4GY2B 1HKCA 3IFRA 3SI6A 3ZSRA 3RR8A 5BR9A 4B3SK 5AFUA 5CYQA 2D0BA 4QCLA 5FPNA 4FWKA 3VENA 3DI6A 2XHBA 1HRHA 3VA3A 1SKRA 4DCHA 2I5JA 3NVKA 4FWQA 3SPZA 2FC0A 3CQYA 3CI5A 4RW4A 3TARA 4CZLA 3H6EA 4PL8A 3UKRB 4PL7A 2ZWHA 1XHXA 5M1PA 3EN9A 3MCPA 1U45A 4CEBA 1BIUA 1HJOA 2BANA 3K5OA 4NLCA 2F9TA 4LF6K 2E1YA 3NF6A 3IS9A 2RHKA 4E7HA 1MU2A 1EO1A 4G1QA 3EY1A 2BUPA 4KV8A 4M45A 2YX6A 5F1XA 1U49A 4KHNA 3BUZB 2NRTA 1N34K 2UXCK 3BZCA 4BG9A 4JI2K 1NGAA 3HT3A 2HNDA 3S3NA 1RGIA 2OPSA 4CD1A 4KH5A 3VQ9A 1D4XA 4K42A 1IKWA 3SZ2A 4JN4A 4A2BA 1NGHA 3T19A 4X65K 1QSSA 3O80A 2VG5A 1BCMA 5AQHA 4CESA 3AAQA 2D5RA 3K5LA 4YFUA 1FJGK 2E6LA 3VQAA 5CHIA 1W7AA 3JS6A 3HJFA 2DFHA 1S1WA 1DTTA 1NNEA 3RWUA 1BA0A 4M63C 1U48A 5ADXH 1Q81O 4FSVA 3JYTA 1A5XA 1LWFA 4BR0A 4CE9A 1XI1A 1VQKN 3OTOK 4H5TA 3PIPL 3MCAB 1JLBA 3LDQA 4JI8K 2UYTA 5KQ8A 1DEJA 3I33A 4H0YB 1VK0A 4KAZA 4EFHA 3RTVA 1BHLA 4CZMA 5AZIA 5CZ2A 1O13A 4NO7A 3FZKA 3OJUA 4E19A 4PHTX 2ZQBA 2A40A 4IJAA 2X74A 4JD2A 4ELUA 4JK7A 2PBDA 1VQ4N 4O5BA 4NCAA 3ID8A 3NE6A 3AV9A 4CVNE 3U4LA 1C0MA 4J2DA 3O5BA 3ZSZA 1TKXA 3TWHA 1BCOA 1KQSM 5GAEP 3JSMA 3CCVN 2ZJQL 2O8CA 2QK9A 2YNGA 3M6GA 1Z26A 5AQFA 4BE2A 1KVAA 2OCEA 2Q36A 3AAPA 2IGIA 3CCJN 3LDSA 1HR0K 1NOYA 5KQDA 3TSUA 4F3TA 4FCYA 1GLJO 3ENOA 3BEXA 3C6TA 4W5OA 5IT9O 1OH8A 1X9JA 2NNWA 4OPKA 3B6PA 4FJHA 2E1ZA 4H0PA 1A5VA 5LJVA 3KHYA 1SL1A 2IS3A 2YNFA 4O0JA 1TK0A 1TK5A 3H45C 1EX4A 3PO5A 3OYBA 4DU4A 1EKEA 1QQMA 4FJGA 5HBMA 4H4OA 4BDPA 4JS4A 2E4LA 2A41A 4MDAA 4O8UA 2PYJA 1OKJA 2NRHA 3DXMB 1FW6A 3UKUA 2ZJRL 3DLGA 4F2SA 4CJLA 4DSEA 4B9SA 1BDGA 3KJVA 3CFRA 2O8DB 3EZ5A 2I7PA 3P83D 4JAXA 5AQMA 4CZEA 4RWTA 4CF2A 5SZTA 3FFKB 3HI0A 4GVEA 4Y1CA 3CQ8A 1NK8A 5CY4A 4CEZA 3VQCA 4HHTA 5FLXO 1S72N 2E2OA 3O6WA 1S9GA 4BE1A 1KRPA 4Q0BA 3ZSYA 1RBVA 4AHSA 1BQMA 1T8EA 3E9PA 3QBWA 4BRGA 5C2DA 2GTDA 2XY6A 5C15A 3QINA 3A0IX 4HWIA 3MK6A 3WXKA 1Q86O 3WUHA 1YTAA 2OANA 2BDPA 2HOEA 1QVGM 1GOBA 1RTDA 3MXJA 4NYFA 1MA9B 5C12A 4UQGA 1XMQK 1ILYA 3TI0A 1YVUA 3WXJA 1VQ8N 3CJ7A 1NBWA 4IOCL 3KD5E 2O8FA 3ZETB 3CFOA 4DUZK 1VHXA 4EZ6A 4IBNA 4BGBA 4DU1A 1TAUA 3HM9A 3VGMA 3CPEA 3WXMB 1SQKA 1GLLO 2A3ZA 4HTLA 1VSHA 2D0CA 2PYLA 1HJRA 1KD1O 3AVAA 1RT1A 4JKCA 3THXB 4A5BA 4M3UA 4ELTA 3VQPA 2PZSA 4BC4A 3SV3A 1C1BA 3SPYA 4IOXA 3NHGA 3PUFA 4PA1A 4DR5K 4UY8O 3AO2A 4M3ZA 4OVLA 1L3VA 1RTHA 3FZHA 3F73A 1RT2A 4CJSA 4J2BA 1EP4A 2V52B 3AO3A 3I0RA 1BUPA 4F8RA 1DLOA 1REVA 5AZJB 4ICLA 3UKRA 3DLHA 5EY4A 4OKJA 3LAMA 5BR8K 4JEPA 2W6LA 4KHPK 3QEWA 4CFCA 3QNOA 3AVJA 3SMPA 1GLFO 4IO9L 2DFFA 3SJHA 5JVHL 1X9WA 1K8AO 1DKGD 1QQOA 4PWDA 3UIQA 3FR0A 4KPYA 2P5OA 2W41A 4BQLA 1NWKA 4E0DA 3C6UA 3WQUA 3PSIA 5CR4A 3ZT4A 5KGXA 4DKWA 4B8AB 1G15A 5SWMA 3K57A 3P5JA 4FXDA 1ZBFA 1HYZA 4FL9A 3SBGA 3TANA 5JS2A 1YF5L 2A1SA 4JNEA 2HW3A 2GBZA 4PUOA 3GOIA 3DLLL 1TKDA 3L2WA 3I56N 4DTRA 5HRSA 4CFAA 1MWKA 3P31A 4BWJA 4B1ZA 2D4WA 4NLBA 3G10A 3M5RA 3WQTA 4CZHA 1RT3A 4RTFD 4LY7A 3FZMA 4AM7A 4OGEA 1VQON 3TSPA 3BP8A 3VF6A 3J7YP 4Z4FA 1RDDA 3F9KA 3PLAA 2KFNA 1NGBA 2G8IA 4B9UA 3VEOA 2VYPA 3OYLA 3QFPA 2ZF5O 4BRMA 4M3RA 4CJQA 4RG8A 3SLCA 2DTUA 2UXBK 1L3SA 2ZGZA 2IAJA 5C42A 3SUOA 1U47A 1YTUA 4G9ZA 4FVMA 3BF1A 1JLFA 3S41A 2QI2A 4LH4A 4LF9K 1HPZA 2O4GA 4DSKA 3PX0A 4J8FA 4CGDA 1CLQA 1G99A 3NVMA 4FLTA 2VWKA 3CJAA 4QS9A 2P9SB 1C0TA 1B92A 4ZTJA 1TYQA 5AQVA 4KREA 3TAGA 2HMIA 5GAGP 4ISEA 3LANA 4O44A 1M90O 1LAWA 4LH5A 1NGDA 4BG8A 3H08A 3NFAA 3PX4A 2YJFA 4F9OA 1U4BA 1YVNA 3DRRA 4C8OA 1JL2A 4GV9A 3WNHA 3LDLA 4XH1A 3DMJA 2W42A 3PSFA 4FWSA 3AVHA 1Y64A 4JLHA 4KTZA 4A62A 1NGEA 1LW0A 3EZWA 3MN7A 4ILGB 3VEVA 4DV2K 1EXQA 4PKHA 2D0PA 1OH7A 3CCEN 5CZ1A 4KH6A 2ZGYA 1NK6A 2WTUA 1NJXA 3I8BA 1BOTO 4K8XA 5AQOA 4CF9A 1HPMA 3CC4N 4CECA 4FVUA 3QIPA 2P9PB 4LSLA 5DK5A 3ZT3A 3AA5X 3SUQA 4LF5K 4HCCA 1IKYA 5KI6A 3RMBA 4ISGA 2X78A 4HCBA 2P9IB 3DXMA 4NYNA 4FWOA 3NGYA 2JWLA 4KBOA 2VGMA 2A6AA 3U9ZA 4HVJA 5KRSA 1EQYA 4CIFA 4HUFA 1ITGA 3AGRA 4DSFA 3V9WA 3HP6A 4DQRA 1VSFA 4LC9B 3J7AP 1NK4A 3QBXA 1NGIA 5LL6Z 4YY3K 1J9AA 3MMVA 2HMPA 4CJ7A 1YJNN 5LMNK 2VQEK 4DB3A 4EHTA 2OA8A 2D1KA 2NUBA 4N5SA 3T1HK 1KXPA 3LPTA 5HP1A 3J81O 4FLZA 1RILA 4BR9A 2QM1A 3SBTA 2F8SA 4FK2A 4JI7K 3LP3A 3WNFA 4DV5K 3VMFB 1X1PA 2Q2RA 1YIJN 3AVMA 4LD0A 1BA1A 5FPDA 3ZSXA 4Z4GA 1IG8A 4DR7K 1KAZA 3AARA 3ZETA 2HBLA 3QETA 3CCLN 2Q0UA 3SQ4A 4B1UB 3MDQA 1YUWA 3OYAA 1N5YA 4RW8A 2BGGA 4OPHA 5KPRA 4CD3A 1JLAA 3G71N 3MECA 1NJWA 1VSDA 1E3MA 2RN2A 1RBTA 3QLHA 1RBSA 3K59A 3IDHA 1ATNA 2QTDA 1YXQA 3G0ZA 3TAEA 1KSPA 5CYMA 1C6VA 1VSJA 3A5NC 1WUAA 1W97L 3ZT0A 1GLEG 5KGWA 2OYQA 2CGKA 1SV5A 2DFEA 2Q97A 1RTJA 4LF7K 3P38A 3DYAA 3TAMA 2HF4A 4E1NA 3SNNA 2QKBA 1IKXA 5J2NA 5C10A 1NOZA 4DTMA 4F3OA 4YOTA 5BPMA 4AHVA 4JKEA 5LJWA 1JLGA 3HYFA 3H3NO 4LF8K 4BRKA 3O4NA 1C0GA 3OVNA 1NM1A 4FJNA 3NBPA 4CFBA 3NH2A 4CFDA 3AVLA 3E9LA 4FW1A 4QAGA 1L5UA 4BGAA 1NJZA 4FZZA 1XMOK 1GLAG 2V7ZA 1LWEA 3FZFA 4CZGA 3L4QA 2X6SA 4KFBA 4CEEA 4LF4K 3D2FA 2W6KA 3L8BA 3FGUA 1TUYA 1IKVA 3HSTB 4DHYA 1NGCA 4QS8A 1XHZA 1K73O 4H0OA 4C23A 3AVFA 4XEIA 4DFPA 2WOMA 4K0KK 3SJJA 4NXNK 1Z05A 4KRFA 4BVPA 2ZM6K 4DUYK 2HVHA 4FLUA 4CJ5A 4FZYA 5AQJA 4AILC 4FJ5A 4NXMK 4CGIA 3VESA 2HSTA 2QW9A 3LL3A 2A42A 4BRCA 4DLGA 2GV9A 1R0AA 1S6QA 4GW6A 4X62K 4O0IA 1SAZA 2CGJA 1B9FA 1XC9A 5JICA 2VWJA 3V1OA 4BRDA 1HKBA 3L2VA 4CJRA 1K6YA 5J1EA 5AQUA 4Z4HA 3A5LC 3O9TA 5HRPA 5AFUH 2Q1NA 5DM6L 4N47A 1HQUA 3LWLA 3LM9A 4F2RA 3O4WA 3KZBA 3VQ5A 3MXMA 2I7NA 2Q31A 1MDUB 2EWSA 2P9SA 3HVRA 2HHWA 3O4QA 1IBKK 1N6QA 2OPQA 1VSIA 1EETA 3AO1A 4JS5A 1TKZA 4DR6K 1N32K 3VERA 2QEXN 3LAKA 3C7NB 1HKGA 2HNYA 5AJ3K 2IVOA 3T7ZA 3CIPA 3L2QA 2IVPA 1FKOA 5ELZA 3O3HA 4BE0A 2P9NB 2HHVA 4CZIA 4WQ5C 4ILHA 4FO0A 2HHXA 1RT7A 1C1CA 1QVFM 5C0YA 3B6OA 3LALA 3OYHA 1RDBA 2QKKA 4N56A 1K8KA 1JXEA 3U3YA 1RDAA 4FJKA 4FWLA 3EKUA 1S3XA 5HROA 1Q9XA 3KK3A 4DR4K 3AO5A 4ID1A 1H1VA 1HNVA 2P9PA 3ZYYX 4IOAL 1IJJA 4CBWA 2HB5A 5BPLA 3PIOL 2QXFA 3WXLA 2UU9K 1WBDA 4JKGB 3RSEB 1ATRA 3CD6N 4HTUA 2HBJA 4AHRA 2P9IA 4K43A 4L8RB 1HQEA 4IFYA 1KLMA 1I94K 2Z1HA 1VQMN 1QZ5A 1TKTA 4YOYA 4B1VA 4YNQA 3OHRA 2KTQA 3CCUN 4BC2A 1RDUA 3CCSN 2YHAA 4FLVA 3VQ6A 3S9HA 3VA0A 4H5VA 4CW7B 5BN9A 1K9MO 1ZBLA 4B3RK 5J2PA 3C65A 3VTIA 3N4PA 3TTCA 5T7BA 3C6HA 4BRNA 2EX3A 3AA4A 2B4JA 1X9SA 4JRPA 4FJIA 3M3ZA 4ILJA 5J2MA 5JLHA 5GADP 4WQ4C 3OBWA 3RR7A 3ID6A 3MWPA 3OS2A 4AM6A 2ZJPL 2NRRA 3R8EA 2OPPA 4Z4CA 4H0TB 4N76A 1O1WA 4NCGA 3OS1A 3T69A 3I0SA 3HRGA 2HVIA 4NCBA 2XY5A 1NG9A 4A57A 1KC8O 3CXCM 1HUXA 4FZXC 5FDLA 3OYFA 1NGGA 3HVTA 4FPBA 3E9OA 5KPTA 4AH9A 4FM1A 3LDOA 3Q7BA 4I9LA 4BR5A 4DF8A 2ASMA 3EEQA 4IFVA 3GL1A 4CHOA 3AVIA 3DM2A 5GIOA 2KW4A 4M3WA 1NKBA 4B8CA 4BR4A 4CGGA 1LWCA 1NK0A 2A5XA 3CERA 3ZLJA 1T3VA 4IXCA 3V9XA 4Z4EA 3C0BA 2CH6A 3SCXA 3AVGA 3QIOA 4H4MA 2HNZA 4OGCA 4CJTA 1HX1A 3S3MA 1R59O 5AQGA 1L3UA 3AVNA 4IDHA 1KVBA 3MWTA 1ZBSA 1JXBA 3DRPA 4CJFA 2Y1IA 4A2AA 3V9SA 3K9JA 4B9TA 3AY9A 4AF1A 1ZYQA 4BACA 2XRIA 3P1GA 2XY7A 3ENHA 1C0FA 3O9UA 4GNIA 1LCUA 4PKIA 1ZBIA 5HLFA 3CC7N 3CM6A 4XIUA 3L0QA 1A5WA 1SKSA 4M7XA 2NRXA 4FJ8A 3THYB 4JKDA 3C6AA 3HM8A 2CGLA 4FLXA 3V9UA 3DXKB 1KLNA 4GKKK 1VQNN 3LM2A 3OYKA 3KKSA 1JLEA 3VQEA 3D2EB 3NF8A 3VEZA 2IVNA 1UA0A 3UB5A 1TUUA 1E4FT 1UWBA 2WC9A 3OY9A 4FJMA 2AA4A 2FSKA 1GLBG 4A59A 3I55N 5FROA 4CBXA 3TAQA 1QQNA 1RT6A 4DV6K 2OTLN 3MX5A 4CK3A 5GIPA 5AR0A 3NGZA 2FBVA 4PKGA 1WSGA 1IG9A 1QSLA 5GAHP 1S6PA 3CF5L 3G4SN 1NMNA 1J6ZA 4KHQA 3ZSOA 1ASWA 2EHGA 1TAQA 4DV7K 1WSIA 4RW6A 3KIOA 3N4QA 3HBTA 3WEEB 2Z1GA 3BDPA 4DTXA 1IBMK 2VQFK 4I9QA 2ZE2A 3LPUA 3A5OC 3OYCA 4DF4A 3QEVA 1NJYA 4B1XB 1KFDA 3ALYA 3T3FA 3W3DA 3DOKA 4CZJA 4CF0A 5B8HA 3WT0A 3TAFA 1QS4A 4NB4A 4FJ9A 4B1YB 3C7NA 1VSMA 2UUBK 3BGRA 4LFBK 2O8EB 2ETJA 3DLRA 2IOCA 1NJIO 5AQTA 4M3TA 3RMAA 2P9NA 3TTFA 3A8YA 2QWMA 3OYNA 1DTQA 3U6FA 5I3UA 1S1TA 4BVOA 3HPGA 1S1XA 3CETA 4H03B 1D5AA 4DTNA 3HPOA 1SZ2A 4GV6A 1KVCA 4KHSA 3MEGA 4CIEA 3EKSA 1RDCA 1VSEA 3WXIA 4CJKA 4TSXA 1D9FA 4DQSA 3AA3A 4FOIA 1IV0A 3H3OB 2D0OA 3MN5A 5AQKA 3RRHA 5EU7A 3NH1A 5FRNA 5C2FA 5E26A 2GWKA 4JKGA 3ASMA 4IDKA 5DMRA 1VRTA 2QWRA 3ZX2A 1W0HA 2VG6A 4Z0UA 3KTQA 4JK9A 3WNGA 1XQSC 3ZX3A 4CHNA 3VQQA 3OA9A 4B3MK 4IKFA 5BPNA 1VRUA 1NKCA 3AVCA 3VOVA 4MFBA 4CIGA 1EWQA 5AZIB 1U2VB 1HYVA 1RT5A 2AP1A 4YOWA 2KZZA 1Q18A 1RBUA 4LFCK 4CEQA 1ASVA 5A2QO 1T6CA 3P39A 4BR2A 2DPNA 5HRNA 1HNXK 2QWPA 2CH5A 2WUSA 3IKMA 1NKEA 1T6DA 3TSQA 3O08A 1JJ2M 2O8DA 5M1FA 4FJXA 4GKJK 3TTDA 3FE1A 3KWIA 3EO3A 4BQZA 1HNIA 3OYIA 4AHTA 3M1FA 3W0LA 4FWPA 1CXUA 4PQUA 4H8KA 3ULDA 1BIZA 3KWGA 5F0XA 2G8VA 5CE3A 1FXXA 2P9KB 4BR7A 4B3OA 4OLBA 5EVZA 4GVMA 4FLWA 5JMVA 1E4GT 3TR8A 2X6NA 1Q8IA 3R1XA 4CEAA 4FWRA 2YJEA 4Y1DA 4MQ3A 3FLCO 4B9NA 2AJQA 4Z94A 3GBTA 2Q0RA 1IO2A 2G8UA 3HPHA 4U67L 3IG1A 3HXMA 1YJWN 4ZTFA 3AO4A 1GLDG 4IEEA 4WFAL 1FKPA 1JL1A 1WSHA 3E1YA 3NDKA 1QHAA 3GDQA 3MAQA 4LFAK 1I3AA 3ZSQA 2QWOA 2HBMA 2HHHK 3C95A 1YT3A 3J7ZO 3VTHA 3THXA 1C0UA 3CJCA 1WLJA 1NU0A 4CGJA 3VEXA 3PX6A 1T03A 4OKKA 4BRIA 4YORA 3HK2A 2E6MA 3V4IA 4DSLA 3HSCA 4BRLA 5JS1A 5FPMA 1TV6A 5K14A 2KQ2A 3S3OA 4CERA 3QB0A 4CF8A 2YNHA 4C8NA 3KK2A 3MN6A 5AZJA 3RVCA 2G8HA 2VGNA 3QESA 3NF7A 4E89A 4FJJA 2HHUA 1VQ5N 3KLHA 3DXKA 4DS5A 1F21A 3MN9A 4C1NI 4CK2A 5BN8A 4W5TA 4ELVA 2FBTA 3KD1E 4W5RA 4W5NA 2GEMA 4Y0WA 4JI6K 3VQBA 2ATQA 3E66A 3D2EA 4CJVA 4CJUA 4DQ8A 3LWMA 3R3LA 4DR2K 2E88A 1HNWK 3BF3A 3CPWM 4FWNA 5AQLA 3IAYA 4E1JA 2QWNA 2NRZA 3DOLA 3EYZA 1KTQA 4C8MA 3R6MA 1LOTB 4CCHA 1S1UA 4J2AA 3M8RA 2NZTA 3M8PA 3VQDA 3THWB 4H5NA 3R9PA 3HTVA 3KLEA 4E7JA 4R5PA 4CGHA 4DQIA 3JAMO 4WFNL 3OBYA 1BI4B 3OYEA 2P51A 3SQ0A 5ADXA 3WEEA 3CCQN 1D8YA 3AVKA 3RMCA 2G8WA 1W2BM 4DFKA 1IH7A 4IZ9A 4I7FA 4HUGA 3G6EN 4B9MA 2F96A 3NMUA 3ENBA 4CJWA 3KLIA 4H5WA 3OS0A 3ISNC 4CJPA 4IO8A 1NK9A 3HP9A 3MX2A 2BTFA 2E8AA 5MLCQ 4OPJA 1VAZA 1FK9A 1W9HA 3K58A 1S5JA 4KHYA 3L2RA 2VCPA 2OTJN 3CG7A 1BGXT 2IC3A 2O8EA 1HLUA 1P90A 3ZSVA 3OYJA 3CCMN 2FBYA 1RNHA 1S9EA 4E3SA 1TL1A 1WAJA 4FOEA 3DLEA 3KLFA 1EWRA 3U9DA 3O9QA 2B6AA 2BE2A 1TGOA 4FM0A 2YHXA 3DRSA 1VQ9N 4CZKA 1I39A 2XO7A 3NCIA 3EE9A 1SUQA 2G8FA 1J5OA 4DFMA 4FJLA 5FRMA 4HUEA 4FK0A 4DQPA 2D0AA 4M42A 3LDPA 3O1BA 5LY3A 4FLYA 1B9DA 4B3TK 4CHPA 4DV4K 2HHQA 2P9UB 5C24A 2HBKA 2YHWA 1BO5O 4KI4A 2O8BB 5E84A 1HNZK 1N8RO 4FWMA 2JGUA 4H0VB 4KTWA 5TKWA 3RMDA 1Q82O 3P4IA 1LAVA 3O1WA 2RPIA 3SYZA 2P9LB 1NLVA 4EAHD 3SAHA 2FSJA 1WB9A 1OVYA 3L4IA 2Z1JA 1U2VA 4DQQA 4RW7A 3NGIA 5E41A 3O8MA 1QTMA 5EXWA 2V51B 2FXUA 3CCRN 2P5GA 4FYDA 3VEWA 1TYQB 2FF3B 2UUCK 1VQPN 1JCFA 4DTUA 4KI6A 4IJNA 3KKRA 3FFIA 1NMDA 3KK7A 2WFBA 3K2PA 1SS6A 3ZEUB 1RTIA 3OYDA 4ZHRA 3J8AA 3HOSA 3V81A 1V4TA 3AVBA 2F4VK 5KPZA 3NAEA 3HZ6A 5BRFA 1GLCG 5BREA 4V19S 1VQ6N 4KO0A 3VPZA 3QO9A 1TK8A 2F7TA 4JI5K 2RKIA 3CC2N 1YAGA 2P9KA 5M1NA 1M1KO 4CHYA 4QOZB 2Q3SA 2UUAK 4CJEA 1BG3A 1RDWX 3DLKA 2KZMA 3CJ9A 3E01A 4B9QA 2YHYA 4I6MB 3T1AA 3QEIA 3OW2M 1BISA 3O3FA 1NGJA 1P8ZA 1WSJA 1RBRA 2P1JA 4O4GA 4W5QA 1L3TA 4BRAA 4DV0K 4JHDB 3VETA 3VN5A 4EZ9A 4JV5K 1WAFA 4IWVA 4YDUA 2G8KA 1JLQA 2YKMA 4DG1A 4OKEA 3KK1A 4FM2A 1XNQK 3LP0A 4JI3K 4CBUA 4DTPA 2ITMA 3OYMA 4O55A 3MXIA 1U04A 3D6RA 4YOVA 1JCGA 4MLHA 4CHQA 4ISFA 2KLAA 3EL2A 5D3GA 1Q9YA 4JKBA 4KH4A 5M1KA 3THVA 5I9EB 4Z4IA 1J5EK 1J53A 1KAYA 3CMEN 4ID5A 3ULEB 1YJ9N 1QSYA 3CJ1A 4H5RA 3KLGA 1QE1A 3ITHA 5AQXA 1YHQN 1SL2A 3OYGA 2F9WA 3QICA 2ITGA 4U7BA 4IFEA 2XY8A 1TVRA 4GMJB 2QXLA 3CJBA 5AQWA 3G25A 4KTQA 3M8QA 4DTJA 3J80O 1IBLK 5M1QA 4OJRA 4OX9K 2ASPA 2NLXA 3A5MC 2A1RA 3O3GA 5AQQA 3V1QA 3VQ4A 3BZKA 1KFSA 3M8SA 3ZCMA 3L3VA 2Z1IA 4C1NK 4E1MA 3GG4A 3LP2A 5AQIA 4X66K 3F9MA 4YOXA 1YI2N 4YHHK 3RRGA 4E7KA 3LZIA 3THWA 3WNEA 2UXDK 5BRHA 1DGKN 1QQCA 5DM7L 1T7PA 4KB0A 1BWFO 2FBXA 2KHOA 3LDNA 5M1OA 1ASUA 1BI4A 4M7YA 4BC3A 1J54A 3SAGA 4OPAA 3D7EO 3B8AX 4IEIA 3VGLA 2ASOA 3K5MA 3D45A 2GWJA 1S22A 2W40A 2F8TA 1NK5A 3UE5A 3Q7CA 4K25A 2YI1A 3QFUA 4CZFA 2JWKA 4JYAK 3EE8A 4FJ7A 2E20A 1VSKA 2FF6A 3SK3A 3ZX0A 4PY5A 1N33K 4I2QA 4K8ZA 1D9DA 4DMNA 4DLEA 3VQ7A 3SQ2A 4O5FA 4X64K 1NK7A 5H1SQ 2J4RA 4WCEL 4O8KA 1JKHA 3GE1A 4BRHA 4K41A 1OH6A 5AQYA 5JVGL 1WSEA 5KTQA 4GV3A 4J2EA 1KAXA 4B08A 1WOQA 3OJSA 1CXQA 4BY9C 3D2FB 3SAFA 3TABA 3L3UA 4EP5A 1HMVA 4WQ5A 4M3XA 3ZT1A 3CHWA 2KFZA 4WE1A 1OH5A 4FW2A 1X9MA 3CMAN 3AGKA 4BC5A 2E2NA 3IUCA 3F5TA 4RW9A 2NRWA 3VQ8A 5AQRA 3ZSWA 2E5LK 2GUIA 1Y97A 2IDOA 1Z25A 4KKOA 4DTSA 2NRVA 3F2KA 2P9UA 2KKZA 2O4IA 1GOAA 2VG7A 3CFPA 4CF1A 4CJ3A 3DWLA 2IIRA 3C94A 1QZ6A 3K0SA 2O8BA 4BRFA 5JLFA 1T44A 2QWQA 3V6DA 4L3QA 1VSLA 2Y1JA 2GELA 4BRQA 2P9LA 3CM5A 5AQZA 1VQ7N 4C8KA 1KCFA 1X3NA 2DY4A 1MWMA 2HHSA 3FZLA 3ATVA 3VF4A 1BQNA 1CZ9A 3MEDA 4WYBA 3SV4A 3PO4A 4KB1A 2E2QA 4MO5A 5TKYA 4JI4K 3JXUA 4BWMA 1C1AA 2GUPA 3K9KA 3U3GA 1ATSA 2B5JA 2VWBA 4IG3A 4C8LA 3NH0A 4XH4A 1ESVA 3RSEA 2HF3A 4H0XB 1LV5A 3ZEUA 5BRDA 5J2QA 4N41A 1ZXOA 3QDKA 5HOOA 1CZAN 3CYMA 4QS7A 3HOTA 4RCHA 1SL0A 5GINA 3O9SA 3VEYA 4DR1K 1LW2A 3TAPA 1XWLA 4OO1J 4WQ4A 4DU3A 3SUPA 3MEEA 4A5AA 4JRQA 3ZT2A 2OZMA 3NF9A 1JLCA 4WF9L 2BH1A 4DV1K 5LMUK 1DT9A 1BL3A 4CEDA 4M41A 4DR3K 4AQYK 2OPRA 1K8KB 2JLEA 4JD2B 1GOCA 2YCHA 3H1QA 5AQPA 1XUPO 2PAVA 4AHCA 4Q5VA 4CEFA 1CZBA 4I6MA 4AHUA 4LSNA 1WNSA 2O8CB 3O9RA 4JHDA 4DFJA 3V1RA 4JI1K 2YV0X 1ZBUA 4BRPA 3DJCA 5AQNA 2YKNA 2PY5A 5AQSA 1BU6O 2QWLA 4CGFA 3KVGA 1JCEA 5F2RA 4F4KA 2E2PA 2FSNA 1T05A 2GX9A 2ZD1A 2YNIA 4MO4A 4YOUA 1HYSA 4KHUA 2WONA 2LSNA 4CJ4A 2PFUA 3PY8A 4OLAA 3SQ1A 1XC3A 3QNNA 4JKHA 1NGFA 3VGKA 3L2UA 1WBBA 1N36K 3QEPA 4DSJA 3CQXA 1RCHA 4B9LA 4EIAA 4EP4A 3ULEA 1QHTA 3T1YK 1TL3A 4FK4A 3DAWA 2OZSA 3PV8A 3V9ZA 4CEOA 3UKUB 5HL7L 2V7YA 4DWIA 5EOYA 3A2FA 3IRXA 3I8DA 4MLEA 5FPEA 5I42A 4DS4A 4JKAA 1WSFA 4FPAA 1Q7YO 1XNRK 4DV3K 5HRRA 1UA1A 4EHUA 1V4SA 3TU5A 4I2PA 4BDYA 1RFQA 2H3GX 3QMLA 3HL8A 1U6ZA 3D0PA 3H46O 4DSIA 4JK8A 3QERA 3DLBA 4B9VA 2YHBA 3BY5A 5IWAK 3QEXA 1VQLN 5EX5A
chains in the Genus database with same CATH topology
2OTLN 4BROA 2P9UB 1HX1A 5GAGP 2HBKA 4ISEA 1M90O 1R59O 4XH5A 3H1VX 5AQGA 2YHWA 1BO5O 4IDHA 3MWTA 1ZBSA 5E84A 1NGDA 1N8RO 4FWMA 4BG8A 4A2AA 3L6QA 2YJFA 4H0VB 4F9OA 5TKWA 3K9JA 1YVNA 1Q82O 3P4IA 3AY9A 4AF1A 2FLOA 3O1WA 4B1WB 4GV9A 1Z6RA 3LDLA 1X3MA 4XH1A 2P9LB 1NLVA 4EAHD 4JKFA 3ATUA 4R79A 2FSJA 2RE2A 3VF2A 1OVYA 3L4IA 3ENHA 3SAHA 1C0FA 1U2VA 1Y64A 3O9UA 4FWSA 3TPQA 4GNIA 4YDUC 4A61A 1LCUA 1NGEA 4PKIA 4A62A 3EZWA 3O8MA 4WFBL 5EXWA 2V51B 1YITN 2FXUA 3MN7A 4ILGB 3CCRN 2WBNA 3CC7N 3VEWA 3VEVA 1TYQB 2FF3B 3L0QA 4CI6A 4M7XA 4PKHA 3U8XA 2NRXA 2QA4N 2D0PA 4MDBA 1VQPN 3CCEN 1JCFA 4JKDA 1ZC6A 3C6AA 4IJNA 3IMXA 4KH6A 2ZGYA 1NMDA 3KK7A 3HM8A 2WFBA 3SMSA 4BREA 1SS6A 4GY2B 3I8BA 1BOTO 1HKCA 2CGLA 3IFRA 3ZEUB 5BR9A 5AFUA 5AQOA 3DXKB 3J8AA 1HPMA 5FPNA 3HOSA 3CC4N 1VQNN 4FWKA 3LM2A 3VENA 1V4TA 4DCHA 4FVUA 5KPZA 2P9PB 3HZ6A 5BRFA 3D2EB 1GLCG 3VEZA 3NVKA 2IVNA 5BREA 4FWQA 1VQ6N 3VPZA 3UB5A 1TUUA 1E4FT 3CQYA 3CI5A 2F7TA 2WC9A 2AA4A 4ISGA 2FSKA 1GLBG 4A59A 3I55N 4CZLA 3CC2N 3H6EA 4PL8A 1YAGA 3UKRB 1QQNA 2P9KA 4CBXA 4PL7A 2P9IB 5M1NA 3DXMA 2ZWHA 3MX5A 1M1KO 5GIPA 5AR0A 4FWOA 4PKGA 2JWLA 4KBOA 5M1PA 3EN9A 5GAHP 1BG3A 2A6AA 1RDWX 2VGMA 3MCPA 3U9ZA 4RWTA 3CJ9A 1EQYA 4B9QA 2YHYA 4I6MB 3G4SN 3CF5L 3AGRA 1J6ZA 1HJOA 3OW2M 4NLCA 1NGJA 4LC9B 2F9TA 2E1YA 3QBXA 1NGIA 2RHKA 1P8ZA 1EO1A 3MMVA 2HMPA 4BRAA 4CJ7A 1YJNN 3N4QA 2BUPA 4JHDB 3HBTA 4DB3A 2YX6A 3VETA 3WEEB 4EHTA 5F1XA 2D1KA 3BUZB 2NRTA 1KXPA 4BG9A 4IWVA 1NGAA 4YDUA 3A5OC 4BR9A 2QM1A 1RGIA 3SBTA 4CD1A 4B1XB 4KH5A 1D4XA 4K42A 3VMFB 2Q2RA 4JN4A 3W3DA 4A2BA 4CBUA 4CZJA 1YIJN 5B8HA 1NGHA 3WT0A 2ITMA 1BA1A 3O80A 4NB4A 5FPDA 5AQHA 3AAQA 4B1YB 3C7NA 5CHIA 3D6RA 4YOVA 1JCGA 1IG8A 1KAZA 3AARA 3ZETA 4MLHA 3JS6A 4ISFA 2KLAA 3EL2A 1NJIO 5AQTA 4JKBA 4KH4A 2HBLA 5M1KA 2P9NA 2Q0UA 3CCLN 5I9EB 3TTFA 1KAYA 4B1UB 1BA0A 3A8YA 4M63C 3ULEB 3CMEN 2QWMA 5ADXH 3MDQA 1YUWA 4BVOA 1YJ9N 1Q81O 4FSVA 3CJ1A 4H5RA 4BR0A 3CETA 4H03B 1VQKN 4OPHA 4H5TA 5KPRA 5AQXA 1SZ2A 4CD3A 4GV6A 3PIPL 1YHQN 3MCAB 2F9WA 3QICA 3G71N 3EKSA 3LDQA 4U7BA 4IFEA 3WXIA 2UYTA 2QXLA 3CJBA 5AQWA 3G25A 5KQ8A 1DEJA 1ATNA 2QTDA 1YXQA 3I33A 3IDHA 4FOIA 4H0YB 3H3OB 5M1QA 2D0OA 4EFHA 3A5NC 2ASPA 1WUAA 2NLXA 3A5MC 1W97L 5AZIA 4CZMA 3MN5A 1GLEG 1O13A 5AQKA 5AQQA 2CGKA 2Q97A 4NO7A 3P38A 3FZKA 5C2FA 2HF4A 5E26A 4PHTX 2GWKA 4JKGA 2A40A 4IJAA 2QWRA 3ZX2A 5C10A 4C1NK 4YOTA 4JD2A 3GG4A 5BPMA 5AQIA 3F9MA 2PBDA 4JK9A 4JK7A 4YOXA 1YI2N 1VQ4N 1XQSC 3ZX3A 4JKEA 5LJWA 3ID8A 3H3NO 3OA9A 4BRKA 5BRHA 1DGKN 1C0GA 3U4LA 5DM7L 5BPNA 3VOVA 1NM1A 3O5BA 1BWFO 1KQSM 2KHOA 1U2VB 3LDNA 5AZIB 5M1OA 5GAEP 2ZJQL 3CCVN 3M6GA 4M7YA 4BC3A 3SAGA 5AQFA 4OPAA 3D7EO 3B8AX 4IEIA 3VGLA 3E9LA 2AP1A 4YOWA 2ASOA 2Q36A 4BGAA 1Q18A 3AAPA 2GWJA 1S22A 1GLAG 2V7ZA 2W40A 3FZFA 3UE5A 3CCJN 4CZGA 1T6CA 3L4QA 3P39A 3Q7CA 4K25A 4BR2A 2DPNA 2YI1A 3QFUA 4CZFA 5KQDA 2JWKA 3TSUA 3EE8A 2E20A 1GLJO 3D2FA 3BEXA 3ENOA 3FGUA 1TUYA 2FF6A 3SK3A 2QWPA 3ZX0A 4DHYA 1NGCA 2CH5A 2WUSA 4QS8A 3IKMA 1K73O 5EX5A 1T6DA 4H0OA 4XEIA 3O08A 3TSQA 4C23A 1X9JA 2NNWA 1JJ2M 2E1ZA 5M1FA 4H0PA 1Z05A 4O5FA 3TTDA 3FE1A 4BVPA 3KWIA 3EO3A 4BQZA 5H1SQ 3M1FA 2J4RA 4WCEL 5LJVA 3KHYA 4O8KA 3GE1A 5AQJA 4BRHA 4K41A 3W0LA 3H45C 4FWPA 3VESA 5AQYA 5JVGL 3KWGA 2HSTA 4GV3A 2QW9A 1QQMA 3LL3A 1KAXA 2A42A 1WOQA 4BRCA 5F0XA 4BY9C 5CE3A 3D2FB 2A41A 3SAFA 2P9KB 4MDAA 4O8UA 4BR7A 1OKJA 2NRHA 3DXMB 5EVZA 1SAZA 2CGJA 3UKUA 2ZJRL 4WQ5A 3CHWA 1E4GT 5JMVA 5JICA 1BDGA 4BRDA 3R1XA 1HKBA 3CMAN 3AGKA 4FWRA 2I7PA 2YJEA 5AQUA 4BC5A 2E2NA 3A5LC 3IUCA 3O9TA 3F5TA 3FLCO 4JAXA 5AQMA 5AFUH 4CZEA 2Q1NA 3GBTA 4Z94A 2NRWA 2Q0RA 3FFKB 3HI0A 4GVEA 5DM6L 5AQRA 4U67L 3LM9A 1YJWN 1S72N 2E2OA 3O4WA 1GLDG 3KZBA 4IEEA 2I7NA 4WFAL 3O6WA 2Q31A 1MDUB 3E1YA 2EWSA 2P9SA 3E9PA 3QBWA 4BRGA 5C2DA 2GTDA 1QHAA 2NRVA 3GDQA 5C15A 3F2KA 2P9UA 2KKZA 3A0IX 2QWOA 4HWIA 3MK6A 3DWLA 2IIRA 2HBMA 1QZ6A 3WXKA 4BRFA 3J7ZO 5JLFA 1T44A 1Q86O 3WUHA 2QWQA 3VTHA 2OANA 2HOEA 3CJCA 4L3QA 1QVGM 3VEXA 2GELA 1MA9B 4BRQA 2P9LA 5C12A 1ILYA 3VERA 5AQZA 2QEXN 3WXJA 1VQ8N 1VQ7N 3C7NB 1HKGA 4BRIA 4YORA 1X3NA 3CJ7A 1NBWA 4IOCL 1MWMA 3FZLA 3ZETB 2IVOA 3ATVA 3T7ZA 3CIPA 3VF4A 2IVPA 5ELZA 4BGBA 3HSCA 4WYBA 2P9NB 2E2QA 4BRLA 5FPMA 4MO5A 4CZIA 3VGMA 4WQ5C 5TKYA 4ILHA 3CPEA 4FO0A 3WXMB 1SQKA 3JXUA 3QB0A 2GUPA 1GLLO 1ATSA 2A3ZA 2VWBA 3K9KA 4HTLA 3MN6A 4XH4A 5AZJA 1ESVA 3RSEA 3RVCA 1QVFM 5C0YA 2HF3A 1KD1O 2VGNA 4H0XB 4JKCA 3ZEUA 4A5BA 5BRDA 1ZXOA 3QDKA 1K8KA 5HOOA 1VQ5N 1CZAN 3DXKA 4QS7A 4BC4A 3MN9A 4C1NI 5BN8A 4FWLA 4IOXA 3EKUA 4RCHA 3HOTA 5GINA 3O9SA 1S3XA 3VEYA 2GEMA 4Y0WA 4UY8O 3ZYYX 4IOAL 1H1VA 2P9PA 4OO1J 4WQ4A 3E66A 1IJJA 3D2EA 3FZHA 4CBWA 5BPLA 4A5AA 3PIOL 4DQ8A 3R3LA 2V52B 3WXLA 4WF9L 2BH1A 2E88A 1BUPA 5AZJB 4JKGB 3BF3A 3RSEB 1ATRA 1DT9A 3CPWM 3UKRA 3CD6N 2HBJA 4FWNA 5EY4A 5AQLA 2P9IA 4K43A 4E1JA 4JEPA 2QWNA 1K8KB 2NRZA 4JD2B 1VQMN 2YCHA 3H1QA 3R6MA 5AQPA 1XUPO 2PAVA 1LOTB 1QZ5A 2NZTA 4I6MA 4YOYA 4H5NA 3SMPA 4B1VA 3R9PA 3HTVA 3OHRA 1GLFO 4IO9L 3SJHA 3CCUN 4BC2A 5JVHL 1RDUA 3CCSN 1K8AO 4WFNL 1DKGD 1QQOA 3FR0A 3O9RA 3OBYA 4H5VA 4JHDA 5BN9A 2W41A 4BQLA 1NWKA 3WEEA 5ADXA 3CCQN 1K9MO 3WQUA 5CR4A 4BRPA 3C65A 3VTIA 1W2BM 4DKWA 4IZ9A 3DJCA 3N4PA 5AQNA 3G6EN 3TTCA 5AQSA 3NMUA 3ENBA 1BU6O 3C6HA 4BRNA 2QWLA 4FL9A 4H5WA 3SBGA 4IO8A 3KVGA 1JCEA 5F2RA 2E2PA 1YF5L 2FSNA 4JNEA 2GX9A 3MX2A 2BTFA 2E8AA 3GOIA 5MLCQ 3M3ZA 4ILJA 4MO4A 3DLLL 5JLHA 4YOUA 5GADP 4WQ4C 3I56N 3OBWA 1VAZA 3ID6A 3MWPA 4AM6A 2ZJPL 1MWKA 2NRRA 3P31A 3R8EA 4B1ZA 2PFUA 2VCPA 2D4WA 2OTJN 4H0TB 4NLBA 3M5RA 1XC3A 1HLUA 3WQTA 4JKHA 1NGFA 4CZHA 4RTFD 1P90A 3VGKA 3T69A 3FZMA 4AM7A 3HRGA 1VQON 3TSPA 3BP8A 3CQXA 3VF6A 4A57A 1KC8O 3CXCM 3CCMN 1NGBA 1HUXA 3PLAA 4EIAA 3ULEA 3VEOA 1NGGA 2VYPA 3DAWA 4FPBA 3QFPA 2ZF5O 4BRMA 3E9OA 4FOEA 3UKUB 5KPTA 3SLCA 5HL7L 2V7YA 5EOYA 3LDOA 3Q7BA 2ZGZA 3U9DA 3O9QA 4BR5A 2ASMA 3GL1A 4MLEA 5FPEA 4JKAA 1Q7YO 4FPAA 2YHXA 5GIOA 1VQ9N 4G9ZA 4CZKA 3BF1A 3S41A 3EE9A 2QI2A 4BR4A 4EHUA 1V4SA 3TU5A 4J8FA 1RFQA 2H3GX 3QMLA 1G99A 1U6ZA 3H46O 4JK8A 2A5XA 3CERA 1T3VA 3NVMA 4IXCA 4QS9A 3CJAA 1VQLN 3C0BA 2CH6A 3LDPA 2P9SB 3O1BA 5LY3A 1TYQA 5AQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRT A;  2NRZ A;  2NRW A;  2NRX A;  2NRV A;  3C65 A;  2NRR A; 
#chains in the Genus database with same CATH topology
 3HO1 A;  4BRO A;  4IG0 A;  3AA2 A;  3THY A;  4XH5 A;  3H1V X;  4E7L A;  4M3Y A;  2R7Y A;  1SKW A;  3L6Q A;  1ZBH A;  1UAX A;  3K5N A;  3SUN A;  4CHZ A;  5C25 A;  4B1W B;  2FLO A;  1UOC A;  1Z6R A;  1RT4 A;  1X3M A;  4E7I A;  4JKF A;  3ATU A;  4R79 A;  3VF2 A;  2RE2 A;  4BDZ A;  3TPQ A;  4A61 A;  4YDU C;  4WFB L;  1YIT N;  2O8F B;  4JI0 K;  2RF2 A;  2WBN A;  4DTO A;  3LP1 A;  4KHW A;  4CI6 A;  3U8X A;  2QA4 N;  1WN7 A;  1S1V A;  1OVQ A;  4MDB A;  5KRT A;  2HHT A;  1ZC6 A;  4CK1 A;  3LZJ A;  3IMX A;  3SMS A;  4BRE A;  4GY2 B;  1HKC A;  3IFR A;  3SI6 A;  3ZSR A;  3RR8 A;  5BR9 A;  4B3S K;  5AFU A;  5CYQ A;  2D0B A;  4QCL A;  5FPN A;  4FWK A;  3VEN A;  3DI6 A;  2XHB A;  1HRH A;  3VA3 A;  1SKR A;  4DCH A;  2I5J A;  3NVK A;  4FWQ A;  3SPZ A;  2FC0 A;  3CQY A;  3CI5 A;  4RW4 A;  3TAR A;  4CZL A;  3H6E A;  4PL8 A;  3UKR B;  4PL7 A;  2ZWH A;  1XHX A;  5M1P A;  3EN9 A;  3MCP A;  1U45 A;  4CEB A;  1BIU A;  1HJO A;  2BAN A;  3K5O A;  4NLC A;  2F9T A;  4LF6 K;  2E1Y A;  3NF6 A;  3IS9 A;  2RHK A;  4E7H A;  1MU2 A;  1EO1 A;  4G1Q A;  3EY1 A;  2BUP A;  4KV8 A;  4M45 A;  2YX6 A;  5F1X A;  1U49 A;  4KHN A;  3BUZ B;  2NRT A;  1N34 K;  2UXC K;  3BZC A;  4BG9 A;  4JI2 K;  1NGA A;  3HT3 A;  2HND A;  3S3N A;  1RGI A;  2OPS A;  4CD1 A;  4KH5 A;  3VQ9 A;  1D4X A;  4K42 A;  1IKW A;  3SZ2 A;  4JN4 A;  4A2B A;  1NGH A;  3T19 A;  4X65 K;  1QSS A;  3O80 A;  2VG5 A;  1BCM A;  5AQH A;  4CES A;  3AAQ A;  2D5R A;  3K5L A;  4YFU A;  1FJG K;  2E6L A;  3VQA A;  5CHI A;  1W7A A;  3JS6 A;  3HJF A;  2DFH A;  1S1W A;  1DTT A;  1NNE A;  3RWU A;  1BA0 A;  4M63 C;  1U48 A;  5ADX H;  1Q81 O;  4FSV A;  3JYT A;  1A5X A;  1LWF A;  4BR0 A;  4CE9 A;  1XI1 A;  1VQK N;  3OTO K;  4H5T A;  3PIP L;  3MCA B;  1JLB A;  3LDQ A;  4JI8 K;  2UYT A;  5KQ8 A;  1DEJ A;  3I33 A;  4H0Y B;  1VK0 A;  4KAZ A;  4EFH A;  3RTV A;  1BHL A;  4CZM A;  5AZI A;  5CZ2 A;  1O13 A;  4NO7 A;  3FZK A;  3OJU A;  4E19 A;  4PHT X;  2ZQB A;  2A40 A;  4IJA A;  2X74 A;  4JD2 A;  4ELU A;  4JK7 A;  2PBD A;  1VQ4 N;  4O5B A;  4NCA A;  3ID8 A;  3NE6 A;  3AV9 A;  4CVN E;  3U4L A;  1C0M A;  4J2D A;  3O5B A;  3ZSZ A;  1TKX A;  3TWH A;  1BCO A;  1KQS M;  5GAE P;  3JSM A;  3CCV N;  2ZJQ L;  2O8C A;  2QK9 A;  2YNG A;  3M6G A;  1Z26 A;  5AQF A;  4BE2 A;  1KVA A;  2OCE A;  2Q36 A;  3AAP A;  2IGI A;  3CCJ N;  3LDS A;  1HR0 K;  1NOY A;  5KQD A;  3TSU A;  4F3T A;  4FCY A;  1GLJ O;  3ENO A;  3BEX A;  3C6T A;  4W5O A;  5IT9 O;  1OH8 A;  1X9J A;  2NNW A;  4OPK A;  3B6P A;  4FJH A;  2E1Z A;  4H0P A;  1A5V A;  5LJV A;  3KHY A;  1SL1 A;  2IS3 A;  2YNF A;  4O0J A;  1TK0 A;  1TK5 A;  3H45 C;  1EX4 A;  3PO5 A;  3OYB A;  4DU4 A;  1EKE A;  1QQM A;  4FJG A;  5HBM A;  4H4O A;  4BDP A;  4JS4 A;  2E4L A;  2A41 A;  4MDA A;  4O8U A;  2PYJ A;  1OKJ A;  2NRH A;  3DXM B;  1FW6 A;  3UKU A;  2ZJR L;  3DLG A;  4F2S A;  4CJL A;  4DSE A;  4B9S A;  1BDG A;  3KJV A;  3CFR A;  2O8D B;  3EZ5 A;  2I7P A;  3P83 D;  4JAX A;  5AQM A;  4CZE A;  4RWT A;  4CF2 A;  5SZT A;  3FFK B;  3HI0 A;  4GVE A;  4Y1C A;  3CQ8 A;  1NK8 A;  5CY4 A;  4CEZ A;  3VQC A;  4HHT A;  5FLX O;  1S72 N;  2E2O A;  3O6W A;  1S9G A;  4BE1 A;  1KRP A;  4Q0B A;  3ZSY A;  1RBV A;  4AHS A;  1BQM A;  1T8E A;  3E9P A;  3QBW A;  4BRG A;  5C2D A;  2GTD A;  2XY6 A;  5C15 A;  3QIN A;  3A0I X;  4HWI A;  3MK6 A;  3WXK A;  1Q86 O;  3WUH A;  1YTA A;  2OAN A;  2BDP A;  2HOE A;  1QVG M;  1GOB A;  1RTD A;  3MXJ A;  4NYF A;  1MA9 B;  5C12 A;  4UQG A;  1XMQ K;  1ILY A;  3TI0 A;  1YVU A;  3WXJ A;  1VQ8 N;  3CJ7 A;  1NBW A;  4IOC L;  3KD5 E;  2O8F A;  3ZET B;  3CFO A;  4DUZ K;  1VHX A;  4EZ6 A;  4IBN A;  4BGB A;  4DU1 A;  1TAU A;  3HM9 A;  3VGM A;  3CPE A;  3WXM B;  1SQK A;  1GLL O;  2A3Z A;  4HTL A;  1VSH A;  2D0C A;  2PYL A;  1HJR A;  1KD1 O;  3AVA A;  1RT1 A;  4JKC A;  3THX B;  4A5B A;  4M3U A;  4ELT A;  3VQP A;  2PZS A;  4BC4 A;  3SV3 A;  1C1B A;  3SPY A;  4IOX A;  3NHG A;  3PUF A;  4PA1 A;  4DR5 K;  4UY8 O;  3AO2 A;  4M3Z A;  4OVL A;  1L3V A;  1RTH A;  3FZH A;  3F73 A;  1RT2 A;  4CJS A;  4J2B A;  1EP4 A;  2V52 B;  3AO3 A;  3I0R A;  1BUP A;  4F8R A;  1DLO A;  1REV A;  5AZJ B;  4ICL A;  3UKR A;  3DLH A;  5EY4 A;  4OKJ A;  3LAM A;  5BR8 K;  4JEP A;  2W6L A;  4KHP K;  3QEW A;  4CFC A;  3QNO A;  3AVJ A;  3SMP A;  1GLF O;  4IO9 L;  2DFF A;  3SJH A;  5JVH L;  1X9W A;  1K8A O;  1DKG D;  1QQO A;  4PWD A;  3UIQ A;  3FR0 A;  4KPY A;  2P5O A;  2W41 A;  4BQL A;  1NWK A;  4E0D A;  3C6U A;  3WQU A;  3PSI A;  5CR4 A;  3ZT4 A;  5KGX A;  4DKW A;  4B8A B;  1G15 A;  5SWM A;  3K57 A;  3P5J A;  4FXD A;  1ZBF A;  1HYZ A;  4FL9 A;  3SBG A;  3TAN A;  5JS2 A;  1YF5 L;  2A1S A;  4JNE A;  2HW3 A;  2GBZ A;  4PUO A;  3GOI A;  3DLL L;  1TKD A;  3L2W A;  3I56 N;  4DTR A;  5HRS A;  4CFA A;  1MWK A;  3P31 A;  4BWJ A;  4B1Z A;  2D4W A;  4NLB A;  3G10 A;  3M5R A;  3WQT A;  4CZH A;  1RT3 A;  4RTF D;  4LY7 A;  3FZM A;  4AM7 A;  4OGE A;  1VQO N;  3TSP A;  3BP8 A;  3VF6 A;  3J7Y P;  4Z4F A;  1RDD A;  3F9K A;  3PLA A;  2KFN A;  1NGB A;  2G8I A;  4B9U A;  3VEO A;  2VYP A;  3OYL A;  3QFP A;  2ZF5 O;  4BRM A;  4M3R A;  4CJQ A;  4RG8 A;  3SLC A;  2DTU A;  2UXB K;  1L3S A;  2ZGZ A;  2IAJ A;  5C42 A;  3SUO A;  1U47 A;  1YTU A;  4G9Z A;  4FVM A;  3BF1 A;  1JLF A;  3S41 A;  2QI2 A;  4LH4 A;  4LF9 K;  1HPZ A;  2O4G A;  4DSK A;  3PX0 A;  4J8F A;  4CGD A;  1CLQ A;  1G99 A;  3NVM A;  4FLT A;  2VWK A;  3CJA A;  4QS9 A;  2P9S B;  1C0T A;  1B92 A;  4ZTJ A;  1TYQ A;  5AQV A;  4KRE A;  3TAG A;  2HMI A;  5GAG P;  4ISE A;  3LAN A;  4O44 A;  1M90 O;  1LAW A;  4LH5 A;  1NGD A;  4BG8 A;  3H08 A;  3NFA A;  3PX4 A;  2YJF A;  4F9O A;  1U4B A;  1YVN A;  3DRR A;  4C8O A;  1JL2 A;  4GV9 A;  3WNH A;  3LDL A;  4XH1 A;  3DMJ A;  2W42 A;  3PSF A;  4FWS A;  3AVH A;  1Y64 A;  4JLH A;  4KTZ A;  4A62 A;  1NGE A;  1LW0 A;  3EZW A;  3MN7 A;  4ILG B;  3VEV A;  4DV2 K;  1EXQ A;  4PKH A;  2D0P A;  1OH7 A;  3CCE N;  5CZ1 A;  4KH6 A;  2ZGY A;  1NK6 A;  2WTU A;  1NJX A;  3I8B A;  1BOT O;  4K8X A;  5AQO A;  4CF9 A;  1HPM A;  3CC4 N;  4CEC A;  4FVU A;  3QIP A;  2P9P B;  4LSL A;  5DK5 A;  3ZT3 A;  3AA5 X;  3SUQ A;  4LF5 K;  4HCC A;  1IKY A;  5KI6 A;  3RMB A;  4ISG A;  2X78 A;  4HCB A;  2P9I B;  3DXM A;  4NYN A;  4FWO A;  3NGY A;  2JWL A;  4KBO A;  2VGM A;  2A6A A;  3U9Z A;  4HVJ A;  5KRS A;  1EQY A;  4CIF A;  4HUF A;  1ITG A;  3AGR A;  4DSF A;  3V9W A;  3HP6 A;  4DQR A;  1VSF A;  4LC9 B;  3J7A P;  1NK4 A;  3QBX A;  1NGI A;  5LL6 Z;  4YY3 K;  1J9A A;  3MMV A;  2HMP A;  4CJ7 A;  1YJN N;  5LMN K;  2VQE K;  4DB3 A;  4EHT A;  2OA8 A;  2D1K A;  2NUB A;  4N5S A;  3T1H K;  1KXP A;  3LPT A;  5HP1 A;  3J81 O;  4FLZ A;  1RIL A;  4BR9 A;  2QM1 A;  3SBT A;  2F8S A;  4FK2 A;  4JI7 K;  3LP3 A;  3WNF A;  4DV5 K;  3VMF B;  1X1P A;  2Q2R A;  1YIJ N;  3AVM A;  4LD0 A;  1BA1 A;  5FPD A;  3ZSX A;  4Z4G A;  1IG8 A;  4DR7 K;  1KAZ A;  3AAR A;  3ZET A;  2HBL A;  3QET A;  3CCL N;  2Q0U A;  3SQ4 A;  4B1U B;  3MDQ A;  1YUW A;  3OYA A;  1N5Y A;  4RW8 A;  2BGG A;  4OPH A;  5KPR A;  4CD3 A;  1JLA A;  3G71 N;  3MEC A;  1NJW A;  1VSD A;  1E3M A;  2RN2 A;  1RBT A;  3QLH A;  1RBS A;  3K59 A;  3IDH A;  1ATN A;  2QTD A;  1YXQ A;  3G0Z A;  3TAE A;  1KSP A;  5CYM A;  1C6V A;  1VSJ A;  3A5N C;  1WUA A;  1W97 L;  3ZT0 A;  1GLE G;  5KGW A;  2OYQ A;  2CGK A;  1SV5 A;  2DFE A;  2Q97 A;  1RTJ A;  4LF7 K;  3P38 A;  3DYA A;  3TAM A;  2HF4 A;  4E1N A;  3SNN A;  2QKB A;  1IKX A;  5J2N A;  5C10 A;  1NOZ A;  4DTM A;  4F3O A;  4YOT A;  5BPM A;  4AHV A;  4JKE A;  5LJW A;  1JLG A;  3HYF A;  3H3N O;  4LF8 K;  4BRK A;  3O4N A;  1C0G A;  3OVN A;  1NM1 A;  4FJN A;  3NBP A;  4CFB A;  3NH2 A;  4CFD A;  3AVL A;  3E9L A;  4FW1 A;  4QAG A;  1L5U A;  4BGA A;  1NJZ A;  4FZZ A;  1XMO K;  1GLA G;  2V7Z A;  1LWE A;  3FZF A;  4CZG A;  3L4Q A;  2X6S A;  4KFB A;  4CEE A;  4LF4 K;  3D2F A;  2W6K A;  3L8B A;  3FGU A;  1TUY A;  1IKV A;  3HST B;  4DHY A;  1NGC A;  4QS8 A;  1XHZ A;  1K73 O;  4H0O A;  4C23 A;  3AVF A;  4XEI A;  4DFP A;  2WOM A;  4K0K K;  3SJJ A;  4NXN K;  1Z05 A;  4KRF A;  4BVP A;  2ZM6 K;  4DUY K;  2HVH A;  4FLU A;  4CJ5 A;  4FZY A;  5AQJ A;  4AIL C;  4FJ5 A;  4NXM K;  4CGI A;  3VES A;  2HST A;  2QW9 A;  3LL3 A;  2A42 A;  4BRC A;  4DLG A;  2GV9 A;  1R0A A;  1S6Q A;  4GW6 A;  4X62 K;  4O0I A;  1SAZ A;  2CGJ A;  1B9F A;  1XC9 A;  5JIC A;  2VWJ A;  3V1O A;  4BRD A;  1HKB A;  3L2V A;  4CJR A;  1K6Y A;  5J1E A;  5AQU A;  4Z4H A;  3A5L C;  3O9T A;  5HRP A;  5AFU H;  2Q1N A;  5DM6 L;  4N47 A;  1HQU A;  3LWL A;  3LM9 A;  4F2R A;  3O4W A;  3KZB A;  3VQ5 A;  3MXM A;  2I7N A;  2Q31 A;  1MDU B;  2EWS A;  2P9S A;  3HVR A;  2HHW A;  3O4Q A;  1IBK K;  1N6Q A;  2OPQ A;  1VSI A;  1EET A;  3AO1 A;  4JS5 A;  1TKZ A;  4DR6 K;  1N32 K;  3VER A;  2QEX N;  3LAK A;  3C7N B;  1HKG A;  2HNY A;  5AJ3 K;  2IVO A;  3T7Z A;  3CIP A;  3L2Q A;  2IVP A;  1FKO A;  5ELZ A;  3O3H A;  4BE0 A;  2P9N B;  2HHV A;  4CZI A;  4WQ5 C;  4ILH A;  4FO0 A;  2HHX A;  1RT7 A;  1C1C A;  1QVF M;  5C0Y A;  3B6O A;  3LAL A;  3OYH A;  1RDB A;  2QKK A;  4N56 A;  1K8K A;  1JXE A;  3U3Y A;  1RDA A;  4FJK A;  4FWL A;  3EKU A;  1S3X A;  5HRO A;  1Q9X A;  3KK3 A;  4DR4 K;  3AO5 A;  4ID1 A;  1H1V A;  1HNV A;  2P9P A;  3ZYY X;  4IOA L;  1IJJ A;  4CBW A;  2HB5 A;  5BPL A;  3PIO L;  2QXF A;  3WXL A;  2UU9 K;  1WBD A;  4JKG B;  3RSE B;  1ATR A;  3CD6 N;  4HTU A;  2HBJ A;  4AHR A;  2P9I A;  4K43 A;  4L8R B;  1HQE A;  4IFY A;  1KLM A;  1I94 K;  2Z1H A;  1VQM N;  1QZ5 A;  1TKT A;  4YOY A;  4B1V A;  4YNQ A;  3OHR A;  2KTQ A;  3CCU N;  4BC2 A;  1RDU A;  3CCS N;  2YHA A;  4FLV A;  3VQ6 A;  3S9H A;  3VA0 A;  4H5V A;  4CW7 B;  5BN9 A;  1K9M O;  1ZBL A;  4B3R K;  5J2P A;  3C65 A;  3VTI A;  3N4P A;  3TTC A;  5T7B A;  3C6H A;  4BRN A;  2EX3 A;  3AA4 A;  2B4J A;  1X9S A;  4JRP A;  4FJI A;  3M3Z A;  4ILJ A;  5J2M A;  5JLH A;  5GAD P;  4WQ4 C;  3OBW A;  3RR7 A;  3ID6 A;  3MWP A;  3OS2 A;  4AM6 A;  2ZJP L;  2NRR A;  3R8E A;  2OPP A;  4Z4C A;  4H0T B;  4N76 A;  1O1W A;  4NCG A;  3OS1 A;  3T69 A;  3I0S A;  3HRG A;  2HVI A;  4NCB A;  2XY5 A;  1NG9 A;  4A57 A;  1KC8 O;  3CXC M;  1HUX A;  4FZX C;  5FDL A;  3OYF A;  1NGG A;  3HVT A;  4FPB A;  3E9O A;  5KPT A;  4AH9 A;  4FM1 A;  3LDO A;  3Q7B A;  4I9L A;  4BR5 A;  4DF8 A;  2ASM A;  3EEQ A;  4IFV A;  3GL1 A;  4CHO A;  3AVI A;  3DM2 A;  5GIO A;  2KW4 A;  4M3W A;  1NKB A;  4B8C A;  4BR4 A;  4CGG A;  1LWC A;  1NK0 A;  2A5X A;  3CER A;  3ZLJ A;  1T3V A;  4IXC A;  3V9X A;  4Z4E A;  3C0B A;  2CH6 A;  3SCX A;  3AVG A;  3QIO A;  4H4M A;  2HNZ A;  4OGC A;  4CJT A;  1HX1 A;  3S3M A;  1R59 O;  5AQG A;  1L3U A;  3AVN A;  4IDH A;  1KVB A;  3MWT A;  1ZBS A;  1JXB A;  3DRP A;  4CJF A;  2Y1I A;  4A2A A;  3V9S A;  3K9J A;  4B9T A;  3AY9 A;  4AF1 A;  1ZYQ A;  4BAC A;  2XRI A;  3P1G A;  2XY7 A;  3ENH A;  1C0F A;  3O9U A;  4GNI A;  1LCU A;  4PKI A;  1ZBI A;  5HLF A;  3CC7 N;  3CM6 A;  4XIU A;  3L0Q A;  1A5W A;  1SKS A;  4M7X A;  2NRX A;  4FJ8 A;  3THY B;  4JKD A;  3C6A A;  3HM8 A;  2CGL A;  4FLX A;  3V9U A;  3DXK B;  1KLN A;  4GKK K;  1VQN N;  3LM2 A;  3OYK A;  3KKS A;  1JLE A;  3VQE A;  3D2E B;  3NF8 A;  3VEZ A;  2IVN A;  1UA0 A;  3UB5 A;  1TUU A;  1E4F T;  1UWB A;  2WC9 A;  3OY9 A;  4FJM A;  2AA4 A;  2FSK A;  1GLB G;  4A59 A;  3I55 N;  5FRO A;  4CBX A;  3TAQ A;  1QQN A;  1RT6 A;  4DV6 K;  2OTL N;  3MX5 A;  4CK3 A;  5GIP A;  5AR0 A;  3NGZ A;  2FBV A;  4PKG A;  1WSG A;  1IG9 A;  1QSL A;  5GAH P;  1S6P A;  3CF5 L;  3G4S N;  1NMN A;  1J6Z A;  4KHQ A;  3ZSO A;  1ASW A;  2EHG A;  1TAQ A;  4DV7 K;  1WSI A;  4RW6 A;  3KIO A;  3N4Q A;  3HBT A;  3WEE B;  2Z1G A;  3BDP A;  4DTX A;  1IBM K;  2VQF K;  4I9Q A;  2ZE2 A;  3LPU A;  3A5O C;  3OYC A;  4DF4 A;  3QEV A;  1NJY A;  4B1X B;  1KFD A;  3ALY A;  3T3F A;  3W3D A;  3DOK A;  4CZJ A;  4CF0 A;  5B8H A;  3WT0 A;  3TAF A;  1QS4 A;  4NB4 A;  4FJ9 A;  4B1Y B;  3C7N A;  1VSM A;  2UUB K;  3BGR A;  4LFB K;  2O8E B;  2ETJ A;  3DLR A;  2IOC A;  1NJI O;  5AQT A;  4M3T A;  3RMA A;  2P9N A;  3TTF A;  3A8Y A;  2QWM A;  3OYN A;  1DTQ A;  3U6F A;  5I3U A;  1S1T A;  4BVO A;  3HPG A;  1S1X A;  3CET A;  4H03 B;  1D5A A;  4DTN A;  3HPO A;  1SZ2 A;  4GV6 A;  1KVC A;  4KHS A;  3MEG A;  4CIE A;  3EKS A;  1RDC A;  1VSE A;  3WXI A;  4CJK A;  4TSX A;  1D9F A;  4DQS A;  3AA3 A;  4FOI A;  1IV0 A;  3H3O B;  2D0O A;  3MN5 A;  5AQK A;  3RRH A;  5EU7 A;  3NH1 A;  5FRN A;  5C2F A;  5E26 A;  2GWK A;  4JKG A;  3ASM A;  4IDK A;  5DMR A;  1VRT A;  2QWR A;  3ZX2 A;  1W0H A;  2VG6 A;  4Z0U A;  3KTQ A;  4JK9 A;  3WNG A;  1XQS C;  3ZX3 A;  4CHN A;  3VQQ A;  3OA9 A;  4B3M K;  4IKF A;  5BPN A;  1VRU A;  1NKC A;  3AVC A;  3VOV A;  4MFB A;  4CIG A;  1EWQ A;  5AZI B;  1U2V B;  1HYV A;  1RT5 A;  2AP1 A;  4YOW A;  2KZZ A;  1Q18 A;  1RBU A;  4LFC K;  4CEQ A;  1ASV A;  5A2Q O;  1T6C A;  3P39 A;  4BR2 A;  2DPN A;  5HRN A;  1HNX K;  2QWP A;  2CH5 A;  2WUS A;  3IKM A;  1NKE A;  1T6D A;  3TSQ A;  3O08 A;  1JJ2 M;  2O8D A;  5M1F A;  4FJX A;  4GKJ K;  3TTD A;  3FE1 A;  3KWI A;  3EO3 A;  4BQZ A;  1HNI A;  3OYI A;  4AHT A;  3M1F A;  3W0L A;  4FWP A;  1CXU A;  4PQU A;  4H8K A;  3ULD A;  1BIZ A;  3KWG A;  5F0X A;  2G8V A;  5CE3 A;  1FXX A;  2P9K B;  4BR7 A;  4B3O A;  4OLB A;  5EVZ A;  4GVM A;  4FLW A;  5JMV A;  1E4G T;  3TR8 A;  2X6N A;  1Q8I A;  3R1X A;  4CEA A;  4FWR A;  2YJE A;  4Y1D A;  4MQ3 A;  3FLC O;  4B9N A;  2AJQ A;  4Z94 A;  3GBT A;  2Q0R A;  1IO2 A;  2G8U A;  3HPH A;  4U67 L;  3IG1 A;  3HXM A;  1YJW N;  4ZTF A;  3AO4 A;  1GLD G;  4IEE A;  4WFA L;  1FKP A;  1JL1 A;  1WSH A;  3E1Y A;  3NDK A;  1QHA A;  3GDQ A;  3MAQ A;  4LFA K;  1I3A A;  3ZSQ A;  2QWO A;  2HBM A;  2HHH K;  3C95 A;  1YT3 A;  3J7Z O;  3VTH A;  3THX A;  1C0U A;  3CJC A;  1WLJ A;  1NU0 A;  4CGJ A;  3VEX A;  3PX6 A;  1T03 A;  4OKK A;  4BRI A;  4YOR A;  3HK2 A;  2E6M A;  3V4I A;  4DSL A;  3HSC A;  4BRL A;  5JS1 A;  5FPM A;  1TV6 A;  5K14 A;  2KQ2 A;  3S3O A;  4CER A;  3QB0 A;  4CF8 A;  2YNH A;  4C8N A;  3KK2 A;  3MN6 A;  5AZJ A;  3RVC A;  2G8H A;  2VGN A;  3QES A;  3NF7 A;  4E89 A;  4FJJ A;  2HHU A;  1VQ5 N;  3KLH A;  3DXK A;  4DS5 A;  1F21 A;  3MN9 A;  4C1N I;  4CK2 A;  5BN8 A;  4W5T A;  4ELV A;  2FBT A;  3KD1 E;  4W5R A;  4W5N A;  2GEM A;  4Y0W A;  4JI6 K;  3VQB A;  2ATQ A;  3E66 A;  3D2E A;  4CJV A;  4CJU A;  4DQ8 A;  3LWM A;  3R3L A;  4DR2 K;  2E88 A;  1HNW K;  3BF3 A;  3CPW M;  4FWN A;  5AQL A;  3IAY A;  4E1J A;  2QWN A;  2NRZ A;  3DOL A;  3EYZ A;  1KTQ A;  4C8M A;  3R6M A;  1LOT B;  4CCH A;  1S1U A;  4J2A A;  3M8R A;  2NZT A;  3M8P A;  3VQD A;  3THW B;  4H5N A;  3R9P A;  3HTV A;  3KLE A;  4E7J A;  4R5P A;  4CGH A;  4DQI A;  3JAM O;  4WFN L;  3OBY A;  1BI4 B;  3OYE A;  2P51 A;  3SQ0 A;  5ADX A;  3WEE A;  3CCQ N;  1D8Y A;  3AVK A;  3RMC A;  2G8W A;  1W2B M;  4DFK A;  1IH7 A;  4IZ9 A;  4I7F A;  4HUG A;  3G6E N;  4B9M A;  2F96 A;  3NMU A;  3ENB A;  4CJW A;  3KLI A;  4H5W A;  3OS0 A;  3ISN C;  4CJP A;  4IO8 A;  1NK9 A;  3HP9 A;  3MX2 A;  2BTF A;  2E8A A;  5MLC Q;  4OPJ A;  1VAZ A;  1FK9 A;  1W9H A;  3K58 A;  1S5J A;  4KHY A;  3L2R A;  2VCP A;  2OTJ N;  3CG7 A;  1BGX T;  2IC3 A;  2O8E A;  1HLU A;  1P90 A;  3ZSV A;  3OYJ A;  3CCM N;  2FBY A;  1RNH A;  1S9E A;  4E3S A;  1TL1 A;  1WAJ A;  4FOE A;  3DLE A;  3KLF A;  1EWR A;  3U9D A;  3O9Q A;  2B6A A;  2BE2 A;  1TGO A;  4FM0 A;  2YHX A;  3DRS A;  1VQ9 N;  4CZK A;  1I39 A;  2XO7 A;  3NCI A;  3EE9 A;  1SUQ A;  2G8F A;  1J5O A;  4DFM A;  4FJL A;  5FRM A;  4HUE A;  4FK0 A;  4DQP A;  2D0A A;  4M42 A;  3LDP A;  3O1B A;  5LY3 A;  4FLY A;  1B9D A;  4B3T K;  4CHP A;  4DV4 K;  2HHQ A;  2P9U B;  5C24 A;  2HBK A;  2YHW A;  1BO5 O;  4KI4 A;  2O8B B;  5E84 A;  1HNZ K;  1N8R O;  4FWM A;  2JGU A;  4H0V B;  4KTW A;  5TKW A;  3RMD A;  1Q82 O;  3P4I A;  1LAV A;  3O1W A;  2RPI A;  3SYZ A;  2P9L B;  1NLV A;  4EAH D;  3SAH A;  2FSJ A;  1WB9 A;  1OVY A;  3L4I A;  2Z1J A;  1U2V A;  4DQQ A;  4RW7 A;  3NGI A;  5E41 A;  3O8M A;  1QTM A;  5EXW A;  2V51 B;  2FXU A;  3CCR N;  2P5G A;  4FYD A;  3VEW A;  1TYQ B;  2FF3 B;  2UUC K;  1VQP N;  1JCF A;  4DTU A;  4KI6 A;  4IJN A;  3KKR A;  3FFI A;  1NMD A;  3KK7 A;  2WFB A;  3K2P A;  1SS6 A;  3ZEU B;  1RTI A;  3OYD A;  4ZHR A;  3J8A A;  3HOS A;  3V81 A;  1V4T A;  3AVB A;  2F4V K;  5KPZ A;  3NAE A;  3HZ6 A;  5BRF A;  1GLC G;  5BRE A;  4V19 S;  1VQ6 N;  4KO0 A;  3VPZ A;  3QO9 A;  1TK8 A;  2F7T A;  4JI5 K;  2RKI A;  3CC2 N;  1YAG A;  2P9K A;  5M1N A;  1M1K O;  4CHY A;  4QOZ B;  2Q3S A;  2UUA K;  4CJE A;  1BG3 A;  1RDW X;  3DLK A;  2KZM A;  3CJ9 A;  3E01 A;  4B9Q A;  2YHY A;  4I6M B;  3T1A A;  3QEI A;  3OW2 M;  1BIS A;  3O3F A;  1NGJ A;  1P8Z A;  1WSJ A;  1RBR A;  2P1J A;  4O4G A;  4W5Q A;  1L3T A;  4BRA A;  4DV0 K;  4JHD B;  3VET A;  3VN5 A;  4EZ9 A;  4JV5 K;  1WAF A;  4IWV A;  4YDU A;  2G8K A;  1JLQ A;  2YKM A;  4DG1 A;  4OKE A;  3KK1 A;  4FM2 A;  1XNQ K;  3LP0 A;  4JI3 K;  4CBU A;  4DTP A;  2ITM A;  3OYM A;  4O55 A;  3MXI A;  1U04 A;  3D6R A;  4YOV A;  1JCG A;  4MLH A;  4CHQ A;  4ISF A;  2KLA A;  3EL2 A;  5D3G A;  1Q9Y A;  4JKB A;  4KH4 A;  5M1K A;  3THV A;  5I9E B;  4Z4I A;  1J5E K;  1J53 A;  1KAY A;  3CME N;  4ID5 A;  3ULE B;  1YJ9 N;  1QSY A;  3CJ1 A;  4H5R A;  3KLG A;  1QE1 A;  3ITH A;  5AQX A;  1YHQ N;  1SL2 A;  3OYG A;  2F9W A;  3QIC A;  2ITG A;  4U7B A;  4IFE A;  2XY8 A;  1TVR A;  4GMJ B;  2QXL A;  3CJB A;  5AQW A;  3G25 A;  4KTQ A;  3M8Q A;  4DTJ A;  3J80 O;  1IBL K;  5M1Q A;  4OJR A;  4OX9 K;  2ASP A;  2NLX A;  3A5M C;  2A1R A;  3O3G A;  5AQQ A;  3V1Q A;  3VQ4 A;  3BZK A;  1KFS A;  3M8S A;  3ZCM A;  3L3V A;  2Z1I A;  4C1N K;  4E1M A;  3GG4 A;  3LP2 A;  5AQI A;  4X66 K;  3F9M A;  4YOX A;  1YI2 N;  4YHH K;  3RRG A;  4E7K A;  3LZI A;  3THW A;  3WNE A;  2UXD K;  5BRH A;  1DGK N;  1QQC A;  5DM7 L;  1T7P A;  4KB0 A;  1BWF O;  2FBX A;  2KHO A;  3LDN A;  5M1O A;  1ASU A;  1BI4 A;  4M7Y A;  4BC3 A;  1J54 A;  3SAG A;  4OPA A;  3D7E O;  3B8A X;  4IEI A;  3VGL A;  2ASO A;  3K5M A;  3D45 A;  2GWJ A;  1S22 A;  2W40 A;  2F8T A;  1NK5 A;  3UE5 A;  3Q7C A;  4K25 A;  2YI1 A;  3QFU A;  4CZF A;  2JWK A;  4JYA K;  3EE8 A;  4FJ7 A;  2E20 A;  1VSK A;  2FF6 A;  3SK3 A;  3ZX0 A;  4PY5 A;  1N33 K;  4I2Q A;  4K8Z A;  1D9D A;  4DMN A;  4DLE A;  3VQ7 A;  3SQ2 A;  4O5F A;  4X64 K;  1NK7 A;  5H1S Q;  2J4R A;  4WCE L;  4O8K A;  1JKH A;  3GE1 A;  4BRH A;  4K41 A;  1OH6 A;  5AQY A;  5JVG L;  1WSE A;  5KTQ A;  4GV3 A;  4J2E A;  1KAX A;  4B08 A;  1WOQ A;  3OJS A;  1CXQ A;  4BY9 C;  3D2F B;  3SAF A;  3TAB A;  3L3U A;  4EP5 A;  1HMV A;  4WQ5 A;  4M3X A;  3ZT1 A;  3CHW A;  2KFZ A;  4WE1 A;  1OH5 A;  4FW2 A;  1X9M A;  3CMA N;  3AGK A;  4BC5 A;  2E2N A;  3IUC A;  3F5T A;  4RW9 A;  2NRW A;  3VQ8 A;  5AQR A;  3ZSW A;  2E5L K;  2GUI A;  1Y97 A;  2IDO A;  1Z25 A;  4KKO A;  4DTS A;  2NRV A;  3F2K A;  2P9U A;  2KKZ A;  2O4I A;  1GOA A;  2VG7 A;  3CFP A;  4CF1 A;  4CJ3 A;  3DWL A;  2IIR A;  3C94 A;  1QZ6 A;  3K0S A;  2O8B A;  4BRF A;  5JLF A;  1T44 A;  2QWQ A;  3V6D A;  4L3Q A;  1VSL A;  2Y1J A;  2GEL A;  4BRQ A;  2P9L A;  3CM5 A;  5AQZ A;  1VQ7 N;  4C8K A;  1KCF A;  1X3N A;  2DY4 A;  1MWM A;  2HHS A;  3FZL A;  3ATV A;  3VF4 A;  1BQN A;  1CZ9 A;  3MED A;  4WYB A;  3SV4 A;  3PO4 A;  4KB1 A;  2E2Q A;  4MO5 A;  5TKY A;  4JI4 K;  3JXU A;  4BWM A;  1C1A A;  2GUP A;  3K9K A;  3U3G A;  1ATS A;  2B5J A;  2VWB A;  4IG3 A;  4C8L A;  3NH0 A;  4XH4 A;  1ESV A;  3RSE A;  2HF3 A;  4H0X B;  1LV5 A;  3ZEU A;  5BRD A;  5J2Q A;  4N41 A;  1ZXO A;  3QDK A;  5HOO A;  1CZA N;  3CYM A;  4QS7 A;  3HOT A;  4RCH A;  1SL0 A;  5GIN A;  3O9S A;  3VEY A;  4DR1 K;  1LW2 A;  3TAP A;  1XWL A;  4OO1 J;  4WQ4 A;  4DU3 A;  3SUP A;  3MEE A;  4A5A A;  4JRQ A;  3ZT2 A;  2OZM A;  3NF9 A;  1JLC A;  4WF9 L;  2BH1 A;  4DV1 K;  5LMU K;  1DT9 A;  1BL3 A;  4CED A;  4M41 A;  4DR3 K;  4AQY K;  2OPR A;  1K8K B;  2JLE A;  4JD2 B;  1GOC A;  2YCH A;  3H1Q A;  5AQP A;  1XUP O;  2PAV A;  4AHC A;  4Q5V A;  4CEF A;  1CZB A;  4I6M A;  4AHU A;  4LSN A;  1WNS A;  2O8C B;  3O9R A;  4JHD A;  4DFJ A;  3V1R A;  4JI1 K;  2YV0 X;  1ZBU A;  4BRP A;  3DJC A;  5AQN A;  2YKN A;  2PY5 A;  5AQS A;  1BU6 O;  2QWL A;  4CGF A;  3KVG A;  1JCE A;  5F2R A;  4F4K A;  2E2P A;  2FSN A;  1T05 A;  2GX9 A;  2ZD1 A;  2YNI A;  4MO4 A;  4YOU A;  1HYS A;  4KHU A;  2WON A;  2LSN A;  4CJ4 A;  2PFU A;  3PY8 A;  4OLA A;  3SQ1 A;  1XC3 A;  3QNN A;  4JKH A;  1NGF A;  3VGK A;  3L2U A;  1WBB A;  1N36 K;  3QEP A;  4DSJ A;  3CQX A;  1RCH A;  4B9L A;  4EIA A;  4EP4 A;  3ULE A;  1QHT A;  3T1Y K;  1TL3 A;  4FK4 A;  3DAW A;  2OZS A;  3PV8 A;  3V9Z A;  4CEO A;  3UKU B;  5HL7 L;  2V7Y A;  4DWI A;  5EOY A;  3A2F A;  3IRX A;  3I8D A;  4MLE A;  5FPE A;  5I42 A;  4DS4 A;  4JKA A;  1WSF A;  4FPA A;  1Q7Y O;  1XNR K;  4DV3 K;  5HRR A;  1UA1 A;  4EHU A;  1V4S A;  3TU5 A;  4I2P A;  4BDY A;  1RFQ A;  2H3G X;  3QML A;  3HL8 A;  1U6Z A;  3D0P A;  3H46 O;  4DSI A;  4JK8 A;  3QER A;  3DLB A;  4B9V A;  2YHB A;  3BY5 A;  5IWA K;  3QEX A;  1VQL N;  5EX5 A; 
#chains in the Genus database with same CATH homology
 2OTL N;  4BRO A;  2P9U B;  1HX1 A;  5GAG P;  2HBK A;  4ISE A;  1M90 O;  1R59 O;  4XH5 A;  3H1V X;  5AQG A;  2YHW A;  1BO5 O;  4IDH A;  3MWT A;  1ZBS A;  5E84 A;  1NGD A;  1N8R O;  4FWM A;  4BG8 A;  4A2A A;  3L6Q A;  2YJF A;  4H0V B;  4F9O A;  5TKW A;  3K9J A;  1YVN A;  1Q82 O;  3P4I A;  3AY9 A;  4AF1 A;  2FLO A;  3O1W A;  4B1W B;  4GV9 A;  1Z6R A;  3LDL A;  1X3M A;  4XH1 A;  2P9L B;  1NLV A;  4EAH D;  4JKF A;  3ATU A;  4R79 A;  2FSJ A;  2RE2 A;  3VF2 A;  1OVY A;  3L4I A;  3ENH A;  3SAH A;  1C0F A;  1U2V A;  1Y64 A;  3O9U A;  4FWS A;  3TPQ A;  4GNI A;  4YDU C;  4A61 A;  1LCU A;  1NGE A;  4PKI A;  4A62 A;  3EZW A;  3O8M A;  4WFB L;  5EXW A;  2V51 B;  1YIT N;  2FXU A;  3MN7 A;  4ILG B;  3CCR N;  2WBN A;  3CC7 N;  3VEW A;  3VEV A;  1TYQ B;  2FF3 B;  3L0Q A;  4CI6 A;  4M7X A;  4PKH A;  3U8X A;  2NRX A;  2QA4 N;  2D0P A;  4MDB A;  1VQP N;  3CCE N;  1JCF A;  4JKD A;  1ZC6 A;  3C6A A;  4IJN A;  3IMX A;  4KH6 A;  2ZGY A;  1NMD A;  3KK7 A;  3HM8 A;  2WFB A;  3SMS A;  4BRE A;  1SS6 A;  4GY2 B;  3I8B A;  1BOT O;  1HKC A;  2CGL A;  3IFR A;  3ZEU B;  5BR9 A;  5AFU A;  5AQO A;  3DXK B;  3J8A A;  1HPM A;  5FPN A;  3HOS A;  3CC4 N;  1VQN N;  4FWK A;  3LM2 A;  3VEN A;  1V4T A;  4DCH A;  4FVU A;  5KPZ A;  2P9P B;  3HZ6 A;  5BRF A;  3D2E B;  1GLC G;  3VEZ A;  3NVK A;  2IVN A;  5BRE A;  4FWQ A;  1VQ6 N;  3VPZ A;  3UB5 A;  1TUU A;  1E4F T;  3CQY A;  3CI5 A;  2F7T A;  2WC9 A;  2AA4 A;  4ISG A;  2FSK A;  1GLB G;  4A59 A;  3I55 N;  4CZL A;  3CC2 N;  3H6E A;  4PL8 A;  1YAG A;  3UKR B;  1QQN A;  2P9K A;  4CBX A;  4PL7 A;  2P9I B;  5M1N A;  3DXM A;  2ZWH A;  3MX5 A;  1M1K O;  5GIP A;  5AR0 A;  4FWO A;  4PKG A;  2JWL A;  4KBO A;  5M1P A;  3EN9 A;  5GAH P;  1BG3 A;  2A6A A;  1RDW X;  2VGM A;  3MCP A;  3U9Z A;  4RWT A;  3CJ9 A;  1EQY A;  4B9Q A;  2YHY A;  4I6M B;  3G4S N;  3CF5 L;  3AGR A;  1J6Z A;  1HJO A;  3OW2 M;  4NLC A;  1NGJ A;  4LC9 B;  2F9T A;  2E1Y A;  3QBX A;  1NGI A;  2RHK A;  1P8Z A;  1EO1 A;  3MMV A;  2HMP A;  4BRA A;  4CJ7 A;  1YJN N;  3N4Q A;  2BUP A;  4JHD B;  3HBT A;  4DB3 A;  2YX6 A;  3VET A;  3WEE B;  4EHT A;  5F1X A;  2D1K A;  3BUZ B;  2NRT A;  1KXP A;  4BG9 A;  4IWV A;  1NGA A;  4YDU A;  3A5O C;  4BR9 A;  2QM1 A;  1RGI A;  3SBT A;  4CD1 A;  4B1X B;  4KH5 A;  1D4X A;  4K42 A;  3VMF B;  2Q2R A;  4JN4 A;  3W3D A;  4A2B A;  4CBU A;  4CZJ A;  1YIJ N;  5B8H A;  1NGH A;  3WT0 A;  2ITM A;  1BA1 A;  3O80 A;  4NB4 A;  5FPD A;  5AQH A;  3AAQ A;  4B1Y B;  3C7N A;  5CHI A;  3D6R A;  4YOV A;  1JCG A;  1IG8 A;  1KAZ A;  3AAR A;  3ZET A;  4MLH A;  3JS6 A;  4ISF A;  2KLA A;  3EL2 A;  1NJI O;  5AQT A;  4JKB A;  4KH4 A;  2HBL A;  5M1K A;  2P9N A;  2Q0U A;  3CCL N;  5I9E B;  3TTF A;  1KAY A;  4B1U B;  1BA0 A;  3A8Y A;  4M63 C;  3ULE B;  3CME N;  2QWM A;  5ADX H;  3MDQ A;  1YUW A;  4BVO A;  1YJ9 N;  1Q81 O;  4FSV A;  3CJ1 A;  4H5R A;  4BR0 A;  3CET A;  4H03 B;  1VQK N;  4OPH A;  4H5T A;  5KPR A;  5AQX A;  1SZ2 A;  4CD3 A;  4GV6 A;  3PIP L;  1YHQ N;  3MCA B;  2F9W A;  3QIC A;  3G71 N;  3EKS A;  3LDQ A;  4U7B A;  4IFE A;  3WXI A;  2UYT A;  2QXL A;  3CJB A;  5AQW A;  3G25 A;  5KQ8 A;  1DEJ A;  1ATN A;  2QTD A;  1YXQ A;  3I33 A;  3IDH A;  4FOI A;  4H0Y B;  3H3O B;  5M1Q A;  2D0O A;  4EFH A;  3A5N C;  2ASP A;  1WUA A;  2NLX A;  3A5M C;  1W97 L;  5AZI A;  4CZM A;  3MN5 A;  1GLE G;  1O13 A;  5AQK A;  5AQQ A;  2CGK A;  2Q97 A;  4NO7 A;  3P38 A;  3FZK A;  5C2F A;  2HF4 A;  5E26 A;  4PHT X;  2GWK A;  4JKG A;  2A40 A;  4IJA A;  2QWR A;  3ZX2 A;  5C10 A;  4C1N K;  4YOT A;  4JD2 A;  3GG4 A;  5BPM A;  5AQI A;  3F9M A;  2PBD A;  4JK9 A;  4JK7 A;  4YOX A;  1YI2 N;  1VQ4 N;  1XQS C;  3ZX3 A;  4JKE A;  5LJW A;  3ID8 A;  3H3N O;  3OA9 A;  4BRK A;  5BRH A;  1DGK N;  1C0G A;  3U4L A;  5DM7 L;  5BPN A;  3VOV A;  1NM1 A;  3O5B A;  1BWF O;  1KQS M;  2KHO A;  1U2V B;  3LDN A;  5AZI B;  5M1O A;  5GAE P;  2ZJQ L;  3CCV N;  3M6G A;  4M7Y A;  4BC3 A;  3SAG A;  5AQF A;  4OPA A;  3D7E O;  3B8A X;  4IEI A;  3VGL A;  3E9L A;  2AP1 A;  4YOW A;  2ASO A;  2Q36 A;  4BGA A;  1Q18 A;  3AAP A;  2GWJ A;  1S22 A;  1GLA G;  2V7Z A;  2W40 A;  3FZF A;  3UE5 A;  3CCJ N;  4CZG A;  1T6C A;  3L4Q A;  3P39 A;  3Q7C A;  4K25 A;  4BR2 A;  2DPN A;  2YI1 A;  3QFU A;  4CZF A;  5KQD A;  2JWK A;  3TSU A;  3EE8 A;  2E20 A;  1GLJ O;  3D2F A;  3BEX A;  3ENO A;  3FGU A;  1TUY A;  2FF6 A;  3SK3 A;  2QWP A;  3ZX0 A;  4DHY A;  1NGC A;  2CH5 A;  2WUS A;  4QS8 A;  3IKM A;  1K73 O;  5EX5 A;  1T6D A;  4H0O A;  4XEI A;  3O08 A;  3TSQ A;  4C23 A;  1X9J A;  2NNW A;  1JJ2 M;  2E1Z A;  5M1F A;  4H0P A;  1Z05 A;  4O5F A;  3TTD A;  3FE1 A;  4BVP A;  3KWI A;  3EO3 A;  4BQZ A;  5H1S Q;  3M1F A;  2J4R A;  4WCE L;  5LJV A;  3KHY A;  4O8K A;  3GE1 A;  5AQJ A;  4BRH A;  4K41 A;  3W0L A;  3H45 C;  4FWP A;  3VES A;  5AQY A;  5JVG L;  3KWG A;  2HST A;  4GV3 A;  2QW9 A;  1QQM A;  3LL3 A;  1KAX A;  2A42 A;  1WOQ A;  4BRC A;  5F0X A;  4BY9 C;  5CE3 A;  3D2F B;  2A41 A;  3SAF A;  2P9K B;  4MDA A;  4O8U A;  4BR7 A;  1OKJ A;  2NRH A;  3DXM B;  5EVZ A;  1SAZ A;  2CGJ A;  3UKU A;  2ZJR L;  4WQ5 A;  3CHW A;  1E4G T;  5JMV A;  5JIC A;  1BDG A;  4BRD A;  3R1X A;  1HKB A;  3CMA N;  3AGK A;  4FWR A;  2I7P A;  2YJE A;  5AQU A;  4BC5 A;  2E2N A;  3A5L C;  3IUC A;  3O9T A;  3F5T A;  3FLC O;  4JAX A;  5AQM A;  5AFU H;  4CZE A;  2Q1N A;  3GBT A;  4Z94 A;  2NRW A;  2Q0R A;  3FFK B;  3HI0 A;  4GVE A;  5DM6 L;  5AQR A;  4U67 L;  3LM9 A;  1YJW N;  1S72 N;  2E2O A;  3O4W A;  1GLD G;  3KZB A;  4IEE A;  2I7N A;  4WFA L;  3O6W A;  2Q31 A;  1MDU B;  3E1Y A;  2EWS A;  2P9S A;  3E9P A;  3QBW A;  4BRG A;  5C2D A;  2GTD A;  1QHA A;  2NRV A;  3GDQ A;  5C15 A;  3F2K A;  2P9U A;  2KKZ A;  3A0I X;  2QWO A;  4HWI A;  3MK6 A;  3DWL A;  2IIR A;  2HBM A;  1QZ6 A;  3WXK A;  4BRF A;  3J7Z O;  5JLF A;  1T44 A;  1Q86 O;  3WUH A;  2QWQ A;  3VTH A;  2OAN A;  2HOE A;  3CJC A;  4L3Q A;  1QVG M;  3VEX A;  2GEL A;  1MA9 B;  4BRQ A;  2P9L A;  5C12 A;  1ILY A;  3VER A;  5AQZ A;  2QEX N;  3WXJ A;  1VQ8 N;  1VQ7 N;  3C7N B;  1HKG A;  4BRI A;  4YOR A;  1X3N A;  3CJ7 A;  1NBW A;  4IOC L;  1MWM A;  3FZL A;  3ZET B;  2IVO A;  3ATV A;  3T7Z A;  3CIP A;  3VF4 A;  2IVP A;  5ELZ A;  4BGB A;  3HSC A;  4WYB A;  2P9N B;  2E2Q A;  4BRL A;  5FPM A;  4MO5 A;  4CZI A;  3VGM A;  4WQ5 C;  5TKY A;  4ILH A;  3CPE A;  4FO0 A;  3WXM B;  1SQK A;  3JXU A;  3QB0 A;  2GUP A;  1GLL O;  1ATS A;  2A3Z A;  2VWB A;  3K9K A;  4HTL A;  3MN6 A;  4XH4 A;  5AZJ A;  1ESV A;  3RSE A;  3RVC A;  1QVF M;  5C0Y A;  2HF3 A;  1KD1 O;  2VGN A;  4H0X B;  4JKC A;  3ZEU A;  4A5B A;  5BRD A;  1ZXO A;  3QDK A;  1K8K A;  5HOO A;  1VQ5 N;  1CZA N;  3DXK A;  4QS7 A;  4BC4 A;  3MN9 A;  4C1N I;  5BN8 A;  4FWL A;  4IOX A;  3EKU A;  4RCH A;  3HOT A;  5GIN A;  3O9S A;  1S3X A;  3VEY A;  2GEM A;  4Y0W A;  4UY8 O;  3ZYY X;  4IOA L;  1H1V A;  2P9P A;  4OO1 J;  4WQ4 A;  3E66 A;  1IJJ A;  3D2E A;  3FZH A;  4CBW A;  5BPL A;  4A5A A;  3PIO L;  4DQ8 A;  3R3L A;  2V52 B;  3WXL A;  4WF9 L;  2BH1 A;  2E88 A;  1BUP A;  5AZJ B;  4JKG B;  3BF3 A;  3RSE B;  1ATR A;  1DT9 A;  3CPW M;  3UKR A;  3CD6 N;  2HBJ A;  4FWN A;  5EY4 A;  5AQL A;  2P9I A;  4K43 A;  4E1J A;  4JEP A;  2QWN A;  1K8K B;  2NRZ A;  4JD2 B;  1VQM N;  2YCH A;  3H1Q A;  3R6M A;  5AQP A;  1XUP O;  2PAV A;  1LOT B;  1QZ5 A;  2NZT A;  4I6M A;  4YOY A;  4H5N A;  3SMP A;  4B1V A;  3R9P A;  3HTV A;  3OHR A;  1GLF O;  4IO9 L;  3SJH A;  3CCU N;  4BC2 A;  5JVH L;  1RDU A;  3CCS N;  1K8A O;  4WFN L;  1DKG D;  1QQO A;  3FR0 A;  3O9R A;  3OBY A;  4H5V A;  4JHD A;  5BN9 A;  2W41 A;  4BQL A;  1NWK A;  3WEE A;  5ADX A;  3CCQ N;  1K9M O;  3WQU A;  5CR4 A;  4BRP A;  3C65 A;  3VTI A;  1W2B M;  4DKW A;  4IZ9 A;  3DJC A;  3N4P A;  5AQN A;  3G6E N;  3TTC A;  5AQS A;  3NMU A;  3ENB A;  1BU6 O;  3C6H A;  4BRN A;  2QWL A;  4FL9 A;  4H5W A;  3SBG A;  4IO8 A;  3KVG A;  1JCE A;  5F2R A;  2E2P A;  1YF5 L;  2FSN A;  4JNE A;  2GX9 A;  3MX2 A;  2BTF A;  2E8A A;  3GOI A;  5MLC Q;  3M3Z A;  4ILJ A;  4MO4 A;  3DLL L;  5JLH A;  4YOU A;  5GAD P;  4WQ4 C;  3I56 N;  3OBW A;  1VAZ A;  3ID6 A;  3MWP A;  4AM6 A;  2ZJP L;  1MWK A;  2NRR A;  3P31 A;  3R8E A;  4B1Z A;  2PFU A;  2VCP A;  2D4W A;  2OTJ N;  4H0T B;  4NLB A;  3M5R A;  1XC3 A;  1HLU A;  3WQT A;  4JKH A;  1NGF A;  4CZH A;  4RTF D;  1P90 A;  3VGK A;  3T69 A;  3FZM A;  4AM7 A;  3HRG A;  1VQO N;  3TSP A;  3BP8 A;  3CQX A;  3VF6 A;  4A57 A;  1KC8 O;  3CXC M;  3CCM N;  1NGB A;  1HUX A;  3PLA A;  4EIA A;  3ULE A;  3VEO A;  1NGG A;  2VYP A;  3DAW A;  4FPB A;  3QFP A;  2ZF5 O;  4BRM A;  3E9O A;  4FOE A;  3UKU B;  5KPT A;  3SLC A;  5HL7 L;  2V7Y A;  5EOY A;  3LDO A;  3Q7B A;  2ZGZ A;  3U9D A;  3O9Q A;  4BR5 A;  2ASM A;  3GL1 A;  4MLE A;  5FPE A;  4JKA A;  1Q7Y O;  4FPA A;  2YHX A;  5GIO A;  1VQ9 N;  4G9Z A;  4CZK A;  3BF1 A;  3S41 A;  3EE9 A;  2QI2 A;  4BR4 A;  4EHU A;  1V4S A;  3TU5 A;  4J8F A;  1RFQ A;  2H3G X;  3QML A;  1G99 A;  1U6Z A;  3H46 O;  4JK8 A;  2A5X A;  3CER A;  1T3V A;  3NVM A;  4IXC A;  4QS9 A;  3CJA A;  1VQL N;  3C0B A;  2CH6 A;  3LDP A;  2P9S B;  3O1B A;  5LY3 A;  1TYQ A;  5AQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...