2NRTA

Crystal structure of the c-terminal half of uvrc
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrtA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrtA01
3PW0A 4UAWA 1ZQMA 4K4GA 4KLOA 3BJYA 7ICKA 1XSLA 8ICQA 5KFZA 3GDXA 2ASDA 7ICEA 1RPLA 8ICRA 5KFMA 4EYHB 1B22A 5KFWA 4YMNA 4F5NA 1U48A 3RR7A 3KHLA 4O5KA 8ICIA 4DL7A 5HP4A 4UAZA 3M8RA 3Q8LA 1BGXT 3RTVA 7ICNA 3PW2A 3RB4A 4JUZA 3V7LA 4F4KA 5KG2A 5DBAA 4PHAA 1ZETA 4FBUA 4IRDA 4RQ7A 3UXNA 4K4IA 5CWRA 3C21A 2W9CA 2KN7A 1JN3A 1B43A 4MEYA 2FPKA 3FYHA 9ICVA 3PY8A 4TQSA 5KFPA 5DGAA 2XY6A 2UVWA 4GLXA 1T3NA 5DB7A 3RJKA 1DGSA 3PR5B 5L1LA 2JEFA 1H38A 4I2IA 3PV8A 1ZQSA 3H40A 4BWJA 4DSKA 9ICHA 5J0YA 4ED0A 5CA7A 1KDHA 1NK6A 2HHSA 4DOAA 4B9UA 4P4MA 2C22A 1MQ3A 1X9WA 2BDPA 4DQQA 1JMSA 3C5FA 2JEJA 3RR8A 3RB3A 5DLFA 3C2KA 1ZQGA 4CCHA 4C8OA 4DSJA 4M9GA 4Q45A 2BPCA 4QZ9A 5KTQA 4F5PA 4IRKA 2ZTCA 4PGXA 2I9GA 4I28A 3BQ2A 3RAXA 3SZ2A 4FBTA 4QZFA 9ICRA 3GV5B 5J2HA 2BQ3A 4F91B 1TV9A 3C2MA 2BCUA 8ICLA 5J2FA 2W9MA 3B0YA 3HP6A 4NY8A 4KLGA 1V9PA 1T4GA 3M8SA 4B9TA 4YN4A 5IIJA 5HMMA 2AGOA 4NM2A 4O3PA 2ALZA 4Q8EA 1Z00A 4EBCA 5DB9A 4B9VA 5KG0A 1BPYA 1AROP 3H8SA 4RQ8A 4RQ6A 2XC9A 4DL2A 5KT3A 5J2CA 1KFSA 5IIIA 2PFNA 4B9NA 4F8RA 9ICCA 4O3OA 3SYZA 8ICTA 2BPFA 4M2YA 5EWFA 1BPZA 4O3NA 4NM1A 4E0DA 3UXPA 1IXRA 1ZQVA 3QZ8A 2HHTA 4F5OA 4LZDA 4C8NA 4EYIB 2J6SA 3C1YA 1SL2A 2W9BA 1QSLA 3PVXA 8ICGA 3Q8PB 5KFFA 5KFQA 2ZUBA 4DSLA 3AU2A 3JPRA 3V7JA 3M9OB 3MR3A 2AGQA 4XUSA 1QSSA 4O3QA 1T7PA 8ICOA 4BXOB 5DBCA 4ELTA 5KT6A 1UT8A 3MFIA 9ICWA 3LK9A 4ECXA 5KFLA 5J2GA 4KLTA 9ICKA 1ZQYA 5L1JA 4DQSA 5J2JA 3RAQA 4TUQA 4DQPA 5KT5A 8ICPA 2F1JA 3M9MB 2RDIA 3RH4A 4GC6A 1S9FA 7ICFA 4PPXA 4DF4A 5KG5A 1KTQA 4YMMA 4RPZA 1NK9A 3GFKB 3PW7A 4O3SA 2ASJA 1HUZA 4YMOA 2HHQA 8ICHA 5KT2A 3T3FA 8ICNA 3MFHA 4RNMA 1ZQPA 3E2EA 2HHWA 4M6WB 7ICMA 3OSNA 4YR3A 4QWEA 7ICUA 4RQ1A 2ZJ5A 4YFKA 1BPEA 3M9NB 3EZ5A 2B21A 1ZQDA 3K4GA 3ZDBA 1NOMA 4UAYA 3LWMA 4ECWA 4GXIA 9ICPA 1U47A 2BGWA 3ETLA 3MDCA 3JPOA 3V6JA 5DQGA 2J6UA 1L3SA 2KTQA 4F4WA 2C28A 1XC9A 4QWBA 4QWCA 1UA1A 2BCRA 1U45A 3GIKA 2JEIA 4P4OA 1UT5A 1JXLA 1NJYA 4PGQA 2ATLA 1SL1A 4I2CA 3EW9A 2VA3A 2NRZA 3K75D 4RQ2A 4QZCA 3BQTA 3ISBA 2NRXA 4NLZA 4DQIA 4MF2A 3TAPA 2W8LA 4GXKA 8ICAA 5KFJA 2ZJ8A 2BCSA 5KFHA 3PO4A 2W9CB 4YG2A 4TUSA 3THVA 4ED3A 8ICYA 8ICZA 1JXEA 3KHHA 4TURA 3EYZA 2KZZA 3RBEA 5J0UA 4Z6FA 5DDMA 3Q8QB 2VANA 1S10A 4ED8A 5KFRA 4FS2A 3JPPA 2BCVA 5J0XA 4IR9A 5BOLA 2BQRA 4J9KA 1SL0A 4XQ8A 5KFTA 5J29A 4IQUA 4J9SA 3RB0A 3MR2A 1ZQQA 5KT4A 3LWLA 2NRRA 4BXOA 1SKRA 4UB2A 2NRTA 1HUOA 4QZHA 1CUKA 5J2BA 4KN4A 4R8UA 1ZQLA 4GXJA 4KLMA 2HW3A 2H5XA 2XCAA 2V4QA 1S0OA 9ICIA 8ICJA 4KLDA 2RDJA 3KTQA 1D9FA 5KFBA 4FO6A 1NK4A 1ZQRA 8ICWA 3V6KA 2PFOA 4M9HA 5J2DA 4YD1A 3H4DA 1JX4A 3MDAA 4NLNA 5J0WA 1ZQXA 4RQ4A 2HHXA 1KFDA 4KMUA 2NRVA 3TQ1A 1S0MA 3PW5A 5KG7A 4DL6A 4I2BA 4O5EA 3HWTA 4ELVA 4K4HA 2XGPA 4KLJA 4M9LA 7ICRA 2P6UA 5EWEA 2P66A 1RXWA 3EPGA 4I2HA 2VA8A 1NK0A 1ZQAA 1K1SA 3RJHA 2I1QA 4QZBA 4YQWA 5KG4A 4G3IA 1D9DA 5CP2A 4HYKA 2XY7A 1K1QA 1TFRA 4R64A 5EOZA 2KZ3A 4UB3A 4R66A 3JPQA 3GV7B 4NXZA 3HX0A 3RJFA 5KFEA 4B9MA 4I2AA 2Y1IA 2F1IA 5IIOA 5J2EA 2PI4A 2JZBA 1ZQEA 2KZMA 3RH6A 2A1JB 2C2RA 3BQ1A 4KLEA 4QZIA 3BQ0A 9ICBA 1RYSA 4DLGA 3UQ2A 4XA5A 3UQ0A 5DKWA 5J2AA 4UBCA 7ICTA 3OHAA 1ZQZA 5DB8A 1RZTA 2AJQA 3V6HA 2MUTB 4BDPA 2MUTA 4C8KA 4JWNA 4KLSA 4MFFA 3PW4A 4DL5A 3MABA 3TANA 5F9LA 3AUOA 1IM4A 9ICTA 3RB6A 2BKEA 4QZEA 4F3OA 1BPDA 9ICMA 1N56A 1JIHA 5KFVA 3PNCA 3H8JA 3Q8SB 4JK1A 3HW8A 9ICXA 4FS1A 2KFZA 1A77A 2BCQA 4I2JA 4F4ZA 5KFIA 3UXOA 5KFSA 4RU9A 2BQUA 4JV0A 3GIIA 1ZYQA 4DEZA 4KLLA 4P2HA 4RPXA 3N97B 3OHBA 4QWDA 3RJJA 4O3RA 1BPXA 2DFLA 1KEJA 2ZJAA 5J0TA 5L1IA 4EBEA 1QTMA 1MSWD 8ICMA 3GIMA 5L1KA 5IIKA 3V7KA 4KLIA 2R8HA 5KG1A 1S76D 2FPLA 4QZGA 5CJ7A 3RJEA 4LZGA 4BWMA 1MQ2A 2DPIA 4PH5A 1ZJNA 1ZQTA 4ED1A 3V72A 4RQ3A 3TFSA 1ZQJA 1QSYA 4F2RA 4I2FA 1ZQWA 1ZQBA 2ZTDA 2FPMA 3MR5A 3ISDA 4UB5A 4O5CA 5KFOA 2BHNA 5DQIA 1TKDA 4F4YA 9ICFA 2XGQA 1RYRA 5J0RA 4MF8A 2FLNA 5CR0A 9ICJA 1LB2B 3FDSA 2PFQA 4M04A 2AQ0A 2F1HA 4DFPA 4YXJA 4UB4A 8ICXA 3HPOA 4ED6A 2R8JA 3MBYA 3Q8MA 4NLGA 1U4BA 4IRCA 4MEXA 2Q0ZX 2Y1JA 3ZDAA 4EEYA 3B0XA 1NJXA 5CHGA 4C8MA 5D49A 9ICNA 4ELUA 5D4BA 4QW9A 3RH5A 4UB1A 4Z6EA 3PR4A 3SV3A 1PZNA 1NKBA 4Z6CA 4JWMA 8ICUA 1XU4A 4DSEA 3JPSA 1L5UA 3H8WA 5KFNA 1T8EA 2HVIA 1WCLA 2FLPA 1L3TA 4YR2A 4DWIA 1D8LA 4F50A 4ECYA 3GQCA 1ZQUA 7ICIA 3PO5A 1SZPA 4MFAA 2ZUDA 1U9LA 4ECQA 3H4BA 4DL4A 2W8KA 2UVRA 2FLLA 8ICKA 2LYHA 4R63A 2FMPA 5J2IA 4DOBA 5KFCA 4QWAA 2BPGA 9ICEA 5KFDA 2AGPA 2PFPA 5BOMA 3G6VA 2GWSA 5DQHA 8ICEA 2JZBB 4DS4A 3OJSA 5BPCA 1TK0A 1BPBA 4QW8A 4RQ0A 4LVSA 1S97A 1SKSA 1S0VA 4J9QA 2IBKA 4J9PA 1L3UA 3TFRA 2V9WA 2UVVA 7ICOA 3OGUA 2MAXA 3MGIA 4QZDA 1COOA 5KT7A 5J2KA 5IILA 1NKCA 7ICSA 2W9AA 1N48A 3T5LA 5DG9A 4F93B 3T5KA 5J0PA 1UA0A 4EZ9A 3EWAA 3NTUA 5HMLA 4PHEA 3Q8RB 1WCNA 3PX4A 1ZQNA 4RT3A 7ICHA 3PMLA 4QZ8A 3OSPA 5KFUA 7ICGA 4F2SA 1XO1A 4BGDA 3IHQB 4P4PA 9ICOA 4RNOA 3MR6A 4J9MA 1LV5A 4PHDA 4I2EA 3QEBZ 3TARA 4EZ6A 4M47A 5DGBA 3GV8B 4Q44A 2XCPA 4I29A 5KG6A 3UPQA 2V4RA 4R8UB 4F5RA 2IA6A 2J6TA 2A1JA 5C5JA 4YXMA 3IM1A 2IMWP 3C65A 3EPIA 4IR1A 1BVSA 7ICPA 3H7IA 1Y88A 9ICAA 4YD2A 3ZDCA 3GILA 9ICQA 5HHIA 7ICVA 2WTFA 4TUPA 4ECUA 1NK8A 3C23A 3SV4A 1C7YA 2W9BB 4DQRA 9ICSA 2ISOA 3PMNA 2IHMA 4DSFA 1TK8A 5J0SA 1ZQHA 4KLUA 3ZD9A 2ZTEA 1X9MA 5HHHA 1KFTA 5J0OA 4ECZA 2OWOA 3T5HA 3RJIA 4J9NA 2R8KA 1TK5A 2JEGA 8ICFA 2HVHA 2IHNA 1TVAA 1ZQOA 4YP3A 2ZUCA 4ECRA 5D46A 1NK7A 1ZQIA 8ICCA 1ZJMA 2FMQA 4DF8A 1Z00B 3PX0A 1X2IA 3GIJA 5TZVA 3G6YA 2AU0A 1U49A 3ISCA 4Q8FA 4RZRA 1MC8A 3JPTA 4RUCA 4EBDA 4IQWA 3QEAZ 1TAUA 4J9RA 4DSIA 2NRWA 2DPJA 4PGYA 4RT2A 7ICLA 3C1ZA 4IQVA 3RRGA 2AQ4A 1ZQCA 4KLQA 4J9LA 3Q8KA 4DFKA 2UVUA 7ICQA 2ASLA 4ZH4A 5JUMA 4M6WA 5KFAA 5F9NA 1XSPA 4UBBA 1XSNA 5KFGA 8ICSA 2FMSA 2M9NA 4PHPA 4DO9A 3TAQA 3KHRA 3AU6A 2VA2A 4NLKA 9ICLA 2KFNA 5IIMA 1X9SA 1NKEA 3RRHA 4KLFA 2R8GA 1S0NA 5DG8A 5KG3A 4Q43A 4DFJA 9ICUA 4DL3A 4I2GA 3QE9Y 2ISPA 8ICBA 4I2DA 4DS5A 4ED7A 5L9XA 7ICJA 4ED2A 1NJWA 3NGDA 5HNKA 4B9LA 4YR0A 4DFMA 1S77D 4Z6DA 1L3VA 5DBBA 1XWLA 4RPYA 2P6RA 4MFCA 1Z3EB 3ORYA 4KITB 4UQGA 1QLNA 5KFYA 4O9MA 4ECSA 4ECVA 3C5GA 1KSPA 4YVZA 4DOCA 3ZDEA 4F5QA 1RXVA 4YCXA 3C2LA 4J9OA 3QZ7A 3TI0A 5DG7A 4C8LA 4M9NA 1TAQA 2HHUA 2R8IA 3PX6A 3OJUA 4GC7A 4JV1A 5J0QA 4RUAA 1KRPA 2XO7A 3JPNA 5DB6A 8ICVA 4X5VA 1NK5A 4O0IA 5CB1A 4RNNA 3HT3A 5IINA 4M0AA 1KLNA 1A76A 4IQTA 4QZAA 2C2EA 1XS9D 3ZDDA 3BDPA 1CEZA 9ICGA 4F92B 3RBDA 1ZQKA 2XY5A 2PI5A 1DOQA 1HJPA 5EWGA 4JV2A 5DLGA 3MGHA 3N4MB 2BR0A 5KFKA 3LDAA 4ECTA 1D8YA 5DDYA 1NJZA 4I27A 1ZQFA 3T5JA 1SKWA 3G6XA 2HHVA 3ZD8A 2PXIA 3SI8A 4TQRA 4M9JA 1EXNA 3RJGA 4KLHA 4KN7A 4KTQA 4DLEA 4XRHA 2C2DA 4B9SA 4R65A 3KHGA 5KFXA 4F4XA 4RQ5A
chains in the Genus database with same CATH superfamily
5AQLA 2PFUA 4K4GA 4X66K 4G1QA 4JV5K 4DV7K 2P1JA 8ICQA 2ZIXA 2KVCA 3P1GA 1JLGA 3V1RA 1RPLA 2K4EA 3ID8A 4CEQA 5KFWA 4F5NA 4O5KA 2Q97A 8ICIA 3L3UA 3Q8LA 3SJHA 4AHSA 3RTVA 1AQ6A 2QXLA 1JLEA 4JUZA 3V7LA 2EDUA 4FBUA 5DM6L 1ZETA 5KGXA 4M3UA 2F77X 2QARB 1RTHA 2W9CA 4HTLA 2K4IA 4FVMA 1CI4A 4MEYA 5ALRA 9ICVA 4KFBA 3PY8A 4PHTX 4TQSA 3ZX0A 4IFVA 4E1JA 4B6JA 2BDUA 1UAXA 2LYAA 2WF5A 3FZFA 2KV2A 3NVMA 4DTOA 5E26A 3VEVA 4DSKA 5AIBA 2D6FC 1XNQK 5LL6Z 2BANA 3CCVN 3DXKB 1NK6A 2HHSA 1H1VA 4DOAA 4JHDB 3ETRA 3WK7A 1X9WA 1ZQGA 3NVVA 3C2KA 2KW4A 4K43A 3V6DA 3M8PA 1K6YA 2FBVA 2YKMA 3OA9A 4WJ3B 4H5TA 2O8CA 4QZ9A 5KTQA 3VESA 4F5PA 2P51A 2IVPA 3ZSVA 3DXMA 4JI7K 2JGUA 1HYSA 2A5XA 4BG9A 4PUOA 4PGXA 3EN9A 3BS5B 2MSNA 3KZXA 3OYMA 3HRDD 3SZ2A 4BR9A 9ICRA 1LWEA 3AO2A 3RSEA 2LBOA 1ILYA 3KIOA 1ITGA 4OPHA 3C2MA 3E9LA 2BCUA 2KSOB 3TACB 3AAPA 2W9MA 2P9LB 3HP6A 1IO2A 4QIWC 1I94K 3DRRA 3PIPL 3CI5A 4YN4A 5IIJA 5HMMA 3T19A 3SUQA 3V1OA 4LF4K 3VEXA 2MRLA 1VSKA 5CR4A 1AROP 3H8SA 4DL2A 5TKYA 4H0OA 3QEWA 2EAMA 1KFSA 4WFAL 3PSTA 5FPDA 4FK4A 4H5RA 4O5FA 3TR8A 4A5AA 3CM5A 5EWFA 2GTDA 1BPZA 3SJJA 3KVGA 1WAFA 1S1VA 1IXRA 1GOBA 1NOZA 2HHTA 1B9DA 2WHEA 3F5TA 2JRZA 4PJ0U 1K8KB 4I7FA 5EE3A 3DLKA 2A41A 3KD5E 3MEEA 4KAZA 2KKPA 3PVXA 5ALPA 4BRLA 4AYBC 2UU9K 3Q8PB 3CP8A 4EIAA 3KLFA 4A8EA 2XICA 1K9MO 4QS9A 5GTIU 2JGAA 3NH0A 4BQZA 3JPRA 3M9OB 2AGQA 1T3QA 1MWKA 2IOFK 3KD1E 1T03A 5DBCA 1U2VB 5KT6A 1J54A 3C0BA 3DLRA 5ADXA 4BRGA 3L3FX 3LK9A 4ECXA 1ZQYA 3CNHA 2UXDK 4IOAL 3O0FA 5EE1A 3SMPA 3BS5A 4GC6A 4RTFD 4DF4A 5KG5A 3GZFA 4IOXA 3DXMB 3J7ZO 2EZYA 2ASJA 3C7NA 3T3FA 2FJ6A 3E2EA 2IGIA 4M6WB 4GV6A 4QWEA 4RW4A 1VSHA 3L2QA 4IJAA 4RQ1A 2H3GX 3F9KA 2CGJA 4CESA 2B21A 3K4GA 1IIPA 2F7TA 4UATA 4CJQA 1VDVA 3F2CA 2GV9A 4RQMA 4UW9A 1L3SA 2KTQA 2ZM6K 2C28A 3Q7BA 1JROA 2VCPA 2BCRA 1U45A 2JEIA 4LFBK 3FZKA 3ICXA 1JXLA 2YMQA 5J2NA 2ATLA 1SL1A 3K9JA 4FWRA 1SWWA 2PZSA 2W03A 2VA3A 3K59A 2D4WA 4JS5A 4P0QB 5ALHA 4MF2A 3QLHA 3ASMA 3C94A 2Q0RA 4Y2XA 5KFJA 2P9KA 5LJVA 1VRUA 4ICAA 4QS7A 1Q86O 4P0PA 3HOTA 2RPIA 3VA3A 4UB6U 3RBEA 2NUBA 1RGIA 3VEWA 4RCHA 1S10A 2QLTA 5KI6A 4IR9A 3VOVA 5KFRA 4Z4EA 5AI5A 1HYZA 2EHGA 3OVNA 3THYB 4UARA 4DR3K 5D3GA 4FJKA 3NF6A 3UIQA 4C4SA 3E9PA 2YTUA 2KKZA 5C12A 1NGHA 1Q18A 3AA2A 4IO8A 4J03A 2V4QA 9ICIA 4M41A 4BRHA 3G4SN 4F72A 2RDJA 1VQ6N 2UUAK 2ZQBA 4FJMA 4YOXA 3H1VX 1V38A 3SLCA 1ZQ1C 2LI6A 2QWRA 2D1KA 3CC4N 1S1WA 3WXKA 1MN8A 2NRHA 4JKGB 2HHXA 1TE2A 1KFDA 1R59O 3TQ1A 4P0PB 4JKCA 2GLEA 3T1HK 1FFVA 4KLJA 2P6UA 5EWEA 2P66A 1YJ9N 3D2EB 1ZQAA 2NNWA 1J6ZA 4YQWA 3CJCA 2A1AA 3F9MA 4G3IA 4DU4A 4HYKA 2XY7A 4CF0A 3ZT1A 1K1QA 2C2DA 4UB3A 8ICPA 3JPQA 2Q31A 4B9MA 5AQSA 2F1IA 1RFQA 4BDYA 3RH6A 3T69A 3O9TA 2YNFA 3I0RA 3ATUA 3NS1A 1ED1A 1EP4A 1RYSA 1KQSM 1S3XA 4DLGA 4XA5A 3UQ0A 3LP3A 5J2AA 5BR8K 4KHWA 1HPMA 1ZQZA 3N7SC 4FWNA 2MUTA 5AQNA 5FRNA 4DUYK 4JI5K 3MABA 4BY9C 5F9LA 3OBWA 3LDSA 5AKHA 2EANA 1QVFM 5EXWA 3KKRA 1BPDA 1QQNA 2FSJA 4IFEA 5KFVA 5EX5A 3PNCA 3H8JA 3WEEB 2UUCK 4DFDA 3CYMA 2KFZA 5E41A 1FJGK 3L8BA 2BCQA 4PQUA 4I2JA 3UXOA 5KFSA 2CRXA 1Q7YO 3GIIA 4KLLA 2YHYA 5E79U 2I6XA 3N97B 1TL1A 5J0TA 1JUDA 2A3ZA 4FJGA 3KOOA 2P9UA 4KLIA 3GBTA 3TSUA 5KG1A 5I9EB 4QZGA 3WK5A 5CJ7A 1COKA 1MQ2A 3FFIA 2AH5A 5F3XB 4ED1A 3V72A 3D45A 5AQYA 4CJSA 5GAEP 2IC3A 2HBJA 4KHQA 2YMPA 2ZTDA 5HRPA 3DV9A 4BRQA 3M1YA 3ISDA 1JJ2M 3BF3A 4UB5A 3K9KA 1EO1A 2DPNA 3DJCA 3ZLJA 2BHNA 1V97A 2Y9UA 5DQIA 2PY5A 4Y2JA 5CR0A 1SV4A 1VSDA 1LB2B 4B1ZA 1SZHA 4YXJA 1C1BA 1VQ7N 5AM2A 8ICXA 4R5PA 4DR6K 3HPOA 3OTOK 5AQGA 1D8BA 4Y2VA 4RWTA 3ZDAA 2OH2A 5F2RA 4CJ7A 3HSCA 3CMEN 3J8AA 3P5JA 4ELUA 1KQQA 4QW9A 5ALQA 5HRRA 1VQ5N 1ZXIA 3SK3A 2K60A 3NF9A 1XU4A 4RW9A 1QQ5A 4FOEA 3VERA 3BF1A 2QKBA 1JLCA 5BPLA 1WCLA 3QBXA 5CY4A 3QNMA 1BI4A 4IG3A 4YOYA 3GQCA 7ICIA 3PO5A 1SZPA 4MFAA 3SBTA 1U9LA 3G10A 3H4BA 2W8KA 8ICKA 2FLLA 4K8XA 5JU5A 2WUSA 4R63A 3TTCA 3WNHA 3CFOA 3DXKA 4FWOA 4DOBA 5C42A 1WSGA 5LMUK 3SPYA 3FZHA 2F8LA 5FLXO 2NV3A 5KFDA 5H2FU 2AGPA 5DK5A 4O4GA 2G8KA 3OJSA 2G0AA 1RYUA 4O3MA 2W42A 3KK7A 1RDAA 1S0VA 4QW8A 3VQ4A 1SKSA 3SAGA 3PIOL 1J2MA 1VLBA 3D2QA 2IBKA 3TFRA 4M45A 3P83D 3WNFA 5IILA 5KT7A 1MU2A 2B4JA 1VQMN 1HR0K 1N34K 5DG9A 3FM9A 4GKKK 3T5KA 5J0PA 4K41A 3EWAA 1X3MA 3PMLA 3AV9A 5KFUA 3OS2A 4EHUA 1XO1A 3CCEN 4CF4A 3U26A 3O80A 5ALDA 4B1VA 1HIWA 1TAMA 4J9MA 1S5JA 4MLEA 3O3FA 4FLTA 1NGCA 3VTIA 3UKUB 1GLEG 5DGBA 4Q44A 5KG6A 2Y9TA 2CN1A 4OGEA 2J6TA 3S3NA 2PMZF 2DFHA 3IUCA 2FF6A 1LW0A 3K57A 1T3VA 2ODGA 5AQFA 1GLJO 3S3OA 4OCZA 3ZDCA 3L2VA 4Y1CA 1NGDA 1SV5A 2G09A 4HCBA 5AICA 4DR5K 3O1BA 4DSFA 2GELA 1GOAA 4CZHA 3ZD9A 1QVGM 3CF5L 1ZD2P 2JR5A 5HHHA 3THWA 2EAOA 2D0OA 1KFTA 2ETJA 5J0OA 4KH4A 2R8KA 3HO1A 3CD6N 8ICFA 4FJ5A 1HQUA 1VQ8N 4YP3A 2ZUCA 3QB0A 5D46A 5AZIB 3TSQA 4ILJA 2LM4A 5FDLA 3IMXA 3F53A 3LM9A 3E1YA 5KNIA 3PX0A 1NGAA 4A61A 3G6YA 5G5HA 4GIBA 4B1WB 1PUZA 2H3IA 1G15A 1S6QA 4Q8FA 4MO4A 4C80A 5M1FA 5L1MA 4RUCA 2E1FA 4MDAA 4DSIA 3ZEUA 2DPJA 1WSHA 4LSNA 5BN9A 3EKSA 3C1ZA 4O55A 4IQVA 1ZQCA 1JCGA 3RSEB 4YY3K 4DFKA 3D6RA 1OKJA 4WFBL 3THYA 4PY5A 4FPAA 5JUMA 2N1RA 3KD3A 3M5RA 4XH4A 4CFBA 3PSIA 4FPBA 5ALWA 2VA2A 5IWAK 9ICLA 1O03A 4CBXA 3IV6A 4IEIA 1S0NA 4Q43A 5AQJA 3ENOA 3NUQA 3I8BA 5KRTA 5GINA 3QE9Y 3O4WA 4NCAA 1NLVA 1Z05A 1RDDA 1C0UA 2A1SA 1NJWA 3AVLA 3NGDA 2NYVA 1FXXA 5HNKA 1VJ5A 4NL9A 4YR0A 5AI4A 4DFMA 1TUYA 2RQ5A 2ZJRL 4MFCA 3EO3A 3VN5A 5MLCQ 1QLNA 4KITB 4UQGA 4F3TA 4C7YA 4YORA 3MCPA 3ZDEA 4F5QA 4BJQA 1N36K 2XRIA 3QZ7A 4JNEA 4K8ZA 5CRXA 3VQPA 1YF5L 1RT6A 2QW9A 5AZIA 1TAQA 3BEXA 3KLIA 3PX6A 1X40A 3AO5A 2WB1C 5EE9A 3JPNA 3QIPA 3CC2N 1ZRMA 3CPWM 4RNNA 3OW2M 2E2OA 1Q3VA 9ICGA 1SAZA 1XS9D 4CFAA 1A5WA 2JH7A 1CRXA 1DOQA 4CJWA 3MCAB 3CG7A 2JHDA 4ECTA 3O6WA 1D8YA 2EX3A 3G0ZA 3QUTA 2HHVA 3SI8A 4TQRA 1NM1A 1EXNA 2HOIA 5AI6A 1X66A 2XIDA 4KLHA 4DLEA 5AQOA 3MWPA 4BRAA 1RBUA 5FROA 3KHGA 4FJNA 3M7DA 4A5BA 1YZ7A 1DKGD 1QQCA 1ZQMA 5AFUH 4KX3A 1TKXA 4JI6K 1XSLA 2BUPA 3WUHA 5KFZA 5KPRA 4EX7A 2ASDA 3EE8A 2HMPA 4DV4K 1B22A 2O8FB 1HKBA 1U48A 3RR7A 3SQ2A 3THXA 4PKHA 2BGGA 3VQ6A 4DL7A 5HP4A 4UAZA 3WKAA 1BGXT 4CHQA 1N63A 3VQDA 3RB4A 4F4KA 2B0CA 5J2PA 4GKJK 4FO0A 4QS8A 1SS6A 1F5SA 2F8TA 2KN7A 2JWKA 1JN3A 4O8UA 4BVPA 2KVSA 5AJ3K 1JRPA 2G5HB 4Y2UA 4JEPA 2I7PA 4CI6A 2VQEK 5KFPA 2XY6A 4FW1A 2UVWA 4GLXA 1Z6RA 5LY3A 1T3NA 2BTFA 3RJKA 1DGSA 2JEFA 4CRXA 5JS2A 3HRGA 5KRSA 1ECWA 1YT3A 4I2IA 1F21A 2YI1A 5ALNA 2ZGYA 1RT2A 3QUQA 4BWJA 3WEEA 3VQQA 1KDHA 2OCEA 3QU4A 1YZ6A 3OYNA 2P9PA 1BCOA 3RR8A 4I28A 4CCHA 2K8BB 3RB3A 4DTRA 5ALOA 1B9FA 3ALRA 4E7IA 3OYJA 4M9GA 3AA4A 3U6FA 1UHUA 3QINA 2BPCA 1YXQA 3HP9A 3TABA 4FWQA 5GTHU 3U3YA 4BGBA 4QCLA 1KAYA 4H4MA 4TSXA 3NHGA 1TKZA 2LKYA 3GV5B 2QTDA 5ALXA 3ZT4A 4CVNE 5CYQA 2OA8A 8ICLA 3AVAA 2WB1F 3B0YA 5CYMA 4F9OA 4BRNA 4CJUA 3KLGA 2IVNA 3MXMA 3F2BA 4O3PA 3AO1A 5DB9A 4FWLA 1NU0A 3VPZA 2XC9A 2EAPA 2PFNA 5M1QA 2GEMA 5J2CA 5IIIA 2K8AA 4CE6A 3A5NC 5EE0A 4B1XB 4W5OA 3R9KA 1J5OA 2BPFA 1BQMA 3J80O 1VK0A 4E0DA 4IOCL 3QZ8A 4DR1K 4LZDA 2Q1NA 1T44A 5JS1A 4O0JA 1A5XA 5HRSA 3B6PA 3VETA 2G8IA 2YY6A 1OH6A 5KFQA 1BCMA 3M8QA 2I5JA 4NYNA 2X6NA 4OPAA 1XQSC 3R3LA 3MR3A 1QSSA 2KHQA 5AR0A 1JCFA 5CEHA 3MWTA 4Y2RA 4OJ5A 1TGOA 4M3WA 5C25A 3SAFA 3I55N 1LWCA 9ICKA 1JL2A 2VGMA 4DQSA 3RAQA 3M9MB 2RDIA 1OVQA 3ZSQA 1S9FA 3N28A 1CXUA 4JK7A 3D7EO 3PW7A 2E8PA 2W3SA 5KT2A 4U7CA 8ICHA 4V19S 4N41A 1ZQPA 1IBMK 5BPNA 2HHWA 4FFDA 1BPEA 4FE3A 3E66A 4CK2A 2UUBK 2O4IA 4IFYA 4FLYA 1NOMA 3LWMA 9ICPA 1Q8IA 4GXIA 2HB5A 2P9PB 3E0FA 1IKYA 3KKAA 1U47A 1BNPA 3MDCA 4OKJA 3V4IA 1TYQB 2VWBA 3FLCO 3JPOA 5CZ2A 3QU9A 2J6UA 1C0FA 4H0YB 3K0SA 1HUXA 1O13A 4EAHD 2V7YA 5C0YA 4ZHRA 5JTIA 1BOTO 4FWMA 4CF9A 1NJYA 4CK1A 5TISU 3ONNA 3P39A 3EW9A 3B6OA 4YDUA 4RQ2A 4QZCA 3BQTA 3ISBA 4WQ4C 3TAPA 4DG1A 1TYQA 4FZNA 4GXKA 4CGHA 1RBRA 4WE1A 3PO4A 4BR0A 1RT3A 4YG2A 2YX8A 3THVA 1U04A 2K4PA 4FJJA 2OTJN 4C7ZA 1EWRA 3Q7CA 8ICZA 5ALIA 3H08A 1JXEA 2KZZA 3O9UA 2ZIVA 3CJ9A 4CJRA 4UB8U 1XHXA 2VJ4A 5DDMA 3Q8QB 2RKIA 4LC9B 4ED8A 3AQEA 4FS2A 2CGKA 5BOLA 2FSNA 5GAHP 4N5SA 3ZSYA 4W5RA 4J9KA 2O8FA 4DR7K 5JMVA 3LWLA 3CCLN 1XC3A 4UB2A 1S1XA 1FO4A 4QZHA 2GO7A 1XMOK 1CUKA 3TKAA 5EU7A 2YV0X 1HNXK 5J2BA 2O8BA 3PSFA 3JYTA 2VJ5A 4BRMA 2E1ZA 1ZQLA 3QFPA 2XCAA 5AQMA 4F71A 3KTQA 1D9FA 3UKUA 1SV0A 4AHCA 2E1EA 3LP2A 4FXDA 4M9HA 1YITN 4NB4A 1KC8O 4AF1A 1JX4A 3MDAA 4NLNA 3DOLA 4H5WA 1ZQXA 2D8CA 3O9RA 3ZSWA 2NRVA 4NWIA 2HSZA 4DL6A 3HWTA 1S1UA 2GBZA 4M9LA 4ILHA 2GH1A 3EPGA 4FLZA 2VA8A 1NK0A 2I1QA 4CJ4A 4QZBA 3EZWA 3MECA 3H0MB 3VEYA 5KG4A 1S1TA 1IG9A 2FC0A 5CP2A 2VQFK 1TFRA 1YVUA 3VC8A 1IBKK 2KZ3A 4AHRA 4LF8K 2Y1IA 1FIQA 5J2EA 4IXCA 4C1NK 1L7PA 2RHKA 1NWKA 4DTUA 1HKCA 4UASA 3AVGA 5F0XA 5KQDA 3QYPA 4KLEA 1HJRA 4QZIA 9ICBA 3ENHA 3HVTA 2WC9A 3LAMA 4IO9L 5AM3A 1VQ4N 3OHAA 4JK9A 4HWIA 3QMLA 3K2PA 1SZ2A 2AJQA 5BRHA 4JWNA 4C8KA 1XHZA 3WU2U 2DBYA 3LPTA 3TADA 1QH9A 3TANA 4XEIA 4BRFA 2FBXA 3V9SA 1IM4A 1FW6A 4BR7A 4WQ5C 3T1AA 4QZEA 1VSJA 9ICMA 1JIHA 3OS1A 4CJ3A 4L8RB 4JK1A 4NLCA 3SR6A 3HW8A 1RDFA 1QQOA 5J2QA 3WT0A 3D2SA 3UB5A 3DRPA 1IV8A 5AKKA 2BQUA 3SBGA 4LY7A 1EXQA 3ALYA 4P2HA 1IH7A 1V85A 4DEZA 2VWJA 3ZYYX 2Y0SF 3NASA 1KEJA 5L1IA 4EBEA 2W6KA 3S41A 1Z4NA 2P9IB 8ICMA 1G99A 3GIMA 2G8WA 5L1KA 5IIKA 3CIPA 3U4LA 2R8HA 1N6QA 3L4PA 2YX6A 3ISNC 3LVVA 1HPZA 3VF4A 1ZQTA 3TFSA 1FK9A 1ZQJA 1BUPA 1ATRA 1K8KA 1ZQWA 1VSFA 5HL7L 5I42A 3LANA 3L4QA 3HOSA 2OTLN 4EEKA 5KFOA 5C24A 2E8OA 9ICFA 2FSKA 1DLOA 5JVGL 1RYRA 1N8RO 2FLNA 1DEJA 9ICJA 2YJEA 1E3MA 2PFQA 2ASPA 2HSTA 2AQ0A 2F1HA 4DFPA 2AP1A 4AHTA 2VWKA 2Q4TA 3Q8MA 2R8JA 4NLGA 3CJ1A 3TU5A 4AHUA 4CF2A 4YNQA 3LALA 4J2EA 3RMBA 1U4BA 3OBYA 4B3OA 3TAFA 3B0XA 1L7OA 1NJXA 4C8MA 1K8AO 1LOTB 3K5OA 2X74A 2Q0UA 3OYEA 3SV3A 1PZNA 2QB0A 5AQQA 3SCXA 4JWMA 8ICUA 4KHSA 2J4RA 4EX6A 5EVZA 2G07A 4FM1A 3E58A 3A0HU 3KLEA 1XI1A 3O9QA 4JRPA 2EZXA 2WF6A 1SB3C 2ZUDA 3R1XA 5JLHA 4DV3K 3RWUA 3SUNA 2Q2RA 4CJFA 4BACA 5CZ1A 5ALLA 1W7AA 1Q82O 2LYHA 3QO9A 4JKEA 4KBOA 5M1OA 4KHNA 5J2IA 2BPGA 5KFCA 4QWAA 2W04A 3M3ZA 9ICEA 1JLFA 2QWPA 2E1YA 2D0BA 4JI2K 3G6VA 3VQCA 5DQHA 8ICEA 2JZBB 3GU3A 4GMJB 3NVZA 3T1YK 4CEOA 3IKMA 4OO1J 4LVSA 5HR6A 4EHTA 4HTUA 2GOLA 2W41A 3OTQA 4J9PA 4FJIA 2HBLA 2WOMA 4AQYK 1YJWN 1UA0A 4CD1A 5HRNA 3NRWA 4RT3A 3KK1A 2KMDA 3OSPA 4WQ4A 7ICGA 4BX9C 2DWQA 3A2FA 3IHQB 2K8CB 4P4PA 1CZ9A 4RW6A 3IN5A 4RNOA 2E2PA 3OYKA 3QEBZ 4EZ6A 3ZSXA 1L6NA 1YI2N 3GV8B 1NGEA 5FPNA 2XCPA 4I29A 2WAQF 5IT9O 3HKZF 4BREA 2NO5A 2IA6A 1Q9YA 4GY2B 1WUDA 2IMWP 4EP5A 9ICAA 2Z1IA 3GILA 2YCHA 4LF9K 3VTHA 2E3TA 2ZGZA 4TUPA 4AYBF 4DHYA 3UKRB 1C7YA 3LVWA 3QDKA 2W9BB 3SQ4A 5AKYA 1TK8A 5J0SA 3IG8A 3CM6A 3QETA 3VEZA 2A40A 3NGIA 2KNJA 5AKJA 1KXPA 2ZTEA 3NH2A 1BL3A 4JD2A 3CCQN 4CBUA 4CJEA 2O6KA 4FM2A 4ECZA 2OWOA 1FKPA 3RJIA 2QM1A 3L6QA 4OPKA 1NJIO 1NG9A 4DR4K 3FFKB 4BRDA 1REVA 3S9HA 1NK7A 1ZQIA 8ICCA 2HCFA 5DMRA 1P8ZA 2KD1A 3CC7N 1NGJA 2AU0A 5TZVA 4R79A 3DLHA 4FYDA 4FW2A 1HEKA 3JPTA 4EBDA 3NCIA 2O8DA 1SUQA 4BRIA 4W5QA 2AQ4A 1WG8A 4J9LA 7ICQA 3R6MA 3VENA 1A0PA 4DCHA 2AHOB 2HOEA 1BNOA 4E89A 4AM6A 2JWLA 4BDZA 2WF8A 5F9NA 2KG5A 2KP7A 2P35A 2YQEA 4UBBA 8ICSA 1J5EK 5CHIA 2DUYA 2RE2A 4X65K 4DO9A 3TAQA 3KHRA 3VGKA 3OYFA 4CHYA 1WYGA 2OZMA 4JRQA 1KCFA 1A6SA 3IDHA 5GIOA 4KLFA 4FSVA 2YHXA 5KG3A 4DFJA 1XNRK 1N33K 4NXNK 2F9TA 1DGJA 1IG8A 4FLUA 3AN1A 1HQEA 3V1QA 4I2DA 4DS5A 2I7NA 4CZGA 1ZBSA 3ZSRA 3DLBA 5BRFA 1GLDG 2YB4A 2VG7A 2DFFA 4M7XA 5AQWA 2LMRA 3ED5A 4B9LA 3DYAA 1S9GA 5AM5A 4DU3A 1L3VA 1DK2A 5DBBA 1XWLA 2OPRA 3D2FA 3TTDA 2O8DB 4IBNA 5KFYA 4O9MA 3C5GA 5SWMA 1RXVA 4FL9A 3ZT2A 1TUUA 4GV3A 4YCXA 4J9OA 2QWNA 5HROA 3TI0A 1C1AA 5AZJB 2E8NA 3D2EA 1VSMA 4FJLA 4C8LA 4M9NA 2KK0A 2R8IA 4B08A 1XO0A 4JV1A 5J0QA 5M1NA 4RUAA 4E7JA 1RT7A 5AKXA 1NK5A 1IG6A 3K5LA 4O0IA 5CB1A 3HT3A 4L3QA 1KLNA 4IQTA 1K5OA 3ZDDA 1CEZA 1C20A 3HSTB 4PA1A 3OHRA 3CFRA 3RBDA 4JV2A 3MEDA 1OH8A 4J2AA 5EWGA 5K4LA 3MGHA 3N4MB 3LDAA 2JLEA 4JYAK 3F2KA 1ZQFA 4I6MB 2KKVA 5AI9A 3G6XA 1NZPA 3ZD8A 2PXIA 4M9JA 2KJ5A 3WXIA 1ZBIA 2FF3B 3AM9A 4KTQA 4H0TB 4YOWA 4YFUA 4B9SA 1Q3UA 1JALA 5AQIA 2DKXA 3KBBA 1NBWA 3N4PA 4CIEA 4FOIA 2KJ9A 4RQ5A 1KKXA 2OHFA 4BC2A 1RT4A 3VQ9A 3BJYA 4H8KA 4OJOA 2P5GA 3BUZB 3AY9A 7ICEA 8ICRA 3QEPA 4EYHB 2ZG6A 3KHLA 4Q0BA 3CCSN 3M8RA 2WONA 3BY5A 3PW2A 4KI6A 1HNVA 4NXMK 1N32K 3O5BA 5KG2A 4PHAA 4DTJA 5ALGA 4RQ7A 3OYAA 2FDRA 5CWRA 4JHDA 3C21A 2HF4A 4JS4A 5ALEA 2ZJQL 3O4NA 1LKYA 3FYHA 4JB3A 2KQ2A 1VQON 1VQKN 1RTDA 4B1YB 2P9UB 4IJNA 2BE2A 1TKTA 5DB7A 4DTXA 3HJEA 3P31A 1ASWA 1H38A 2A42A 5AQXA 4PZNA 1BG3A 1L7MA 1VQNN 1ZQSA 1XMQK 2UYTA 3H40A 4IC9A 1RQNA 4PL1A 2D3DA 5J0YA 9ICHA 1Q9XA 5ADXH 3O9SA 3TPQA 4B9UA 2Q3SA 5AK6A 4P4MA 2C22A 2D5RA 4BQLA 2DF4B 3C5FA 2JEJA 3ZI4A 4C8OA 5DLFA 3FZMA 3ULEA 2E5LK 4LFAK 2OPSA 4CEDA 1KW4A 4Q45A 1PK1B 1QZ5A 3C95A 4BRPA 4US8A 2I9GA 5BN8A 2ZIXB 3RAXA 4KH5A 1VRTA 3K1ZA 2BQ3A 1TV9A 1DT9A 4OD0A 3SMSA 5J2FA 3QUBA 1WSJA 3AVIA 4NY8A 1RG6A 4KLGA 3VQ5A 4KB0A 1YIJN 1T4GA 3M8SA 3AA3A 2KLAA 3V9WA 1QE1A 2YMLA 2ZE2A 2ALZA 4Q8EA 2YNGA 1L8LA 3U3GA 3LDOA 4B9VA 1QZ6A 4RQ6A 1YAGA 4B3SK 5KT3A 4B9NA 4F8RA 4Y1DA 4O3OA 4EFHA 2KE7A 4M2YA 3I76A 3RF9A 3S3MA 3OYHA 4Y2TA 1ZQVA 3UXPA 4Z0UA 1OH7A 3A0BU 4DV1K 4F5OA 4IEEA 1M90O 5AHXA 2HOQA 3WKCA 3F5AA 4EYIB 3QUCA 1SL2A 5JLFA 4JKGA 1J97A 1B4FA 1ASVA 1QSLA 2QWLA 3SQ1A 1NI3A 4OKEA 3AU2A 2Z1GA 3QEIA 2RLTA 3V7JA 4KRFA 4DV5K 2CXYA 1T7PA 2E20A 1W0HA 3LDLA 4BXOB 1Z19A 4ELTA 1UT8A 3MFIA 1RQLA 2LSNA 4M3XA 2DY4A 4B3RK 4MDBA 5HLFA 5KFLA 5J2GA 4KLTA 3MX2A 2G8VA 3LDPA 1QCKA 4GNIA 3A5MC 1WNSA 5J2JA 4TUQA 4DQPA 1UWBA 2OPPA 4GVMA 7ICFA 4PPXA 5KAFU 3GOIA 4O3SA 1KTQA 3KJVA 3GFKB 1FFUA 1HUZA 4NLBA 1KD1O 3IG5A 8ICNA 1ZRNA 3MFHA 7ICMA 3OSNA 4YR3A 3F73A 4NV0A 2ZJ5A 4YFKA 1ZQDA 3ULEB 4RG8A 4C23A 3QEVA 4ECWA 2E88A 1SQKA 2BGWA 3ETLA 4MFBA 3VGLA 3VMFB 2YHBA 1GOCA 4QWBA 4JLHA 1Z4OA 3AQFA 1UA1A 1WWUA 4P4OA 4PGQA 3M6ZA 3CFPA 4I2CA 1W97L 2L5YA 3K75D 3L5KA 3H8MA 5A0LA 2NRXA 4UAUA 4NLZA 4DQIA 2YJFA 4FVUA 4E7KA 4M7YA 2ZJ8A 3QBWA 4QIWF 2BCSA 5KFHA 2W9CB 4ED3A 1WUAA 5CE3A 1DRGA 3EYZA 2D0CA 3J7AP 4Z6FA 1EWQA 3UMCA 2VANA 2BCVA 3JPPA 1ZD3A 5J0XA 1YUWA 3CQ8A 5FP0A 4KKOA 3MGVA 1SL0A 5KFTA 5J29A 4IQUA 3RB0A 3MR2A 1ZQQA 1X1PA 2PYJA 4KHPK 1MA7A 2KICA 4JI4K 2NRRA 4YOUA 2OXOA 1HUOA 3JSMA 2G06A 1BA0A 4KN4A 4R8UA 2HW3A 4GXJA 4KLMA 3IAYA 1S0OA 5J8YC 5KFBA 3NBPA 8ICWA 3ZCMA 5ALYA 3V6KA 2KIVA 3DAWA 2HHHK 5J2DA 4YD1A 1DK3A 1FKOA 4YOVA 1ESVA 4RQ4A 1VHXA 5G5GA 1S0MA 3K1RB 3WK8A 5KG7A 4E7LA 2D0PA 4K4HA 1W2BM 2XGPA 3ULDA 4B3MK 4IDHA 3AMZA 1RXWA 2BH1A 4OJRA 3R8EA 3VF2A 1S72N 4BRCA 4FLWA 1SWVA 1K1SA 5AZJA 1WOQA 2RHFA 5C2FA 4CNQA 3CHWA 3MEGA 4CIFA 1D9DA 2O8EA 2F2AB 4WF9L 2P5OA 2KOBA 4R64A 1WWVA 1N2XA 5EOZA 1WSEA 5AQZA 2PI4A 2JZBA 4CK3A 3EY1A 2PBDA 1IJJA 2KJ8A 3QICA 4JN4A 2WTUA 2A19A 2A1JB 2C2RA 4BVOA 3BQ1A 3MXJA 4IWVA 3BQ0A 3VGMA 4BR4A 1J2NA 4ID1A 3CJAA 3MN5A 3OYDA 3AO4A 3N7PD 3IFRA 7ICTA 3SENA 1X9JA 3AGRA 3F5EA 5DB8A 1LAVA 2ITMA 3T7ZA 1ZBHA 1GLBG 3V6HA 2MUTB 4BDPA 4KLSA 1D5AA 2IDOA 3FR0A 1PK1A 2Y0SC 3PW4A 4MFFA 3AA5X 1BQNA 3NVYA 2R18A 1OH5A 3CQXA 3QX7A 4F3OA 1UOCA 1N56A 4FWSA 9ICXA 2YMMA 1QS4A 2ZXIA 3OYIA 1LWFA 2GUIA 1O1WA 3CQYA 5BREA 1A77A 2EWSA 4RU9A 3UM9A 4H0PA 3RFAA 1RM6C 1ZYQA 4CZEA 4E1MA 3OHBA 4QWDA 4US9A 4O3RA 2O8EB 1MSWD 1X6IA 1PVQA 4OLBA 2DGZA 2ZIUB 1QTMA 1WAJA 3WK4A 3K5NA 3WXMB 1J53A 3N7RC 3EKUA 2XVTA 3HPHA 1TV6A 1ZC6A 1URJA 3RJEA 4BWMA 2FBYA 5KQ8A 4PH5A 1ZJNA 3OYBA 1WLJA 4RQ3A 2E6MA 2QARA 4I2FA 1ZQBA 3KK3A 2OYYA 3MR5A 4KH6A 5EY4A 4ACOA 1TKDA 1BI4B 2JXJA 5AK3A 3UMGA 2XHBA 3HILA 4KREA 3FDSA 1M1KO 4M04A 1BISA 1KVBA 3QU7A 4UB4A 3NGZA 4E19A 3SQIA 2HBMA 4MEXA 3FE1A 2Q0ZX 2F3NA 4EELA 2Y1JA 1CZBA 4EEYA 3LDNA 5JVHL 5D49A 2KSOA 3RH5A 2HF3A 4UB1A 3P4IA 4Z6EA 3PR4A 4FZMA 1NKBA 4LD0A 4DSEA 1NGFA 2MU2A 3JPSA 1L5UA 3EE9A 4MLHA 5FPMA 2HVIA 5BPMA 2FLPA 1L3TA 3O8MA 4FWKA 2W54A 3OYGA 3NVKA 1D8LA 4F50A 4ECYA 1L7NA 1SXEA 3W0LA 1LVHA 4CZKA 2UVRA 4C4RA 2LHTA 4FJ7A 1IV0A 2NO4A 3BQ7A 3DOKA 4Q5VA 2FMPA 3LP1A 4BG8A 1T6CA 3H0RB 4DCCA 3O1WA 3B8AX 4H0XB 3NRZA 4CFCA 3WNGA 2PFPA 4XIUA 4CJKA 3PSPA 4FJHA 3BZCA 2NLXA 3AEVA 1TK0A 1JLQA 3HKZC 4RQ0A 2P9SA 3NVWA 4J9QA 4BRKA 3WXLA 2WF7A 4FZYA 2V9WA 4X62K 2MAXA 3WK9A 3MGIA 1BU6O 5ALSA 1COOA 1NKCA 3AARA 1BIUA 5C10A 3T5LA 4F93B 3NAEA 4OPJA 2CH6A 5BRDA 4KTWA 2OEHA 4EZ9A 4PHEA 4CHOA 3CXCM 3PX4A 7ICHA 3V81A 2KEYA 1PVRA 3RMCA 4K25A 4QZ8A 5M1KA 1Z1VA 3KWGA 4F2SA 4B8CA 4BGDA 2DQNB 2I5HA 1P90A 4IS7A 4HCCA 2A6AA 3U9ZA 5KPZA 4M3YA 2FI1A 5E84A 3MR6A 1LV5A 4K42A 4OX9K 4I2EA 3ATVA 4DR2K 2F9WA 4A62A 4LSLA 4CZJA 3UPQA 4CJ5A 2V4RA 2E8MA 1NGBA 2QB0B 1U2VA 1HNIA 2A1JA 5C5JA 3IM1A 5GIPA 3C65A 3OS0A 3EPIA 1ASUA 4B3TK 4DTPA 1Y64A 3H7IA 1Y88A 1RBVA 3OY9A 4JI0K 9ICQA 5HHIA 3BZKA 1RDBA 2WTFA 4ECUA 4KV8A 3NE6A 3I0SA 3AVHA 4C1NI 3HVRA 3IDWA 3JAMO 1WBDA 2ISOA 3ZETB 2P9NB 1GLFO 5HR7A 4MHVA 2E2NA 1S9EA 3W3DA 4O44A 2QWOA 1RILA 1X9MA 1IKXA 3THWB 4LJXA 1D4XA 3T5HA 2UXBK 1C0TA 2JEGA 5ALTA 2P9NA 2HVHA 2IHNA 1TVAA 3ID6A 1ZQOA 4BC4A 1VQPN 1R0AA 4JI3K 4CECA 3NMUA 4CGDA 3MN9A 3AVCA 3CJBA 2FMQA 4A2BA 1CZAN 3UE5A 1T6DA 1X2IA 3GIJA 3DWLA 3DLEA 1GO3F 3H45C 1U49A 2P9IA 3ISCA 4JKHA 4LH5A 1MC8A 5AQVA 3J81j 2YHAA 4IL6U 1TAUA 2DTUA 4J9RA 3MX5A 7ICLA 3MN7A 4RT2A 3QIOA 1Q81O 1MA9B 2X78A 1T05A 1DTQA 2X6SA 3RRGA 4AILC 5AM1A 2ZJPL 3MXIA 2ASLA 5JRTA 4ZH4A 1YHQN 4CD3A 1SV0C 1S6PA 5KFAA 1HX1A 4U7BA 1XSPA 5KFGA 4K0KK 4G9ZA 1Z1BA 2FMSA 4GVEA 2M9NA 1K73O 3AU6A 3P38A 3LYSA 1X9SA 1NKEA 2IOCA 3I33A 2R8GA 4I2GA 3QXGA 5C2DA 2OZSA 2K4HA 4BUGA 2A3VA 2ISPA 3MN6A 8ICBA 2QB1A 4ED7A 3KFUF 2LPEA 4CF1A 4H0VB 2P9SB 4B9QA 5AKEA 3QU5A 1S77D 3ZEUB 3GG4A 3GDQA 4ECVA 4Y2SA 1KSPA 4NYFA 4DOCA 5B5EU 3C2LA 3IP4B 1HKGA 4UAVA 4U6PA 1V4SA 4GFJA 3RVCA 3CJ7A 3ZSZA 4KTZA 3WKEA 4YDUC 3OJUA 2WAQC 4USAA 1IBLK 1RTIA 4X5VA 2IIRA 2DFEA 4O5BA 5T14A 3H6EA 2G5IB 4CGFA 4HHTA 1A76A 4QZAA 2C2EA 4WYBA 1NNLA 4F92B 2XY5A 3UKRA 1NZBA 2B6AA 3IS9A 5DLGA 1OVYA 2BR0A 3ZETA 4Z4HA 1KLMA 3O3GA 1NJZA 4I27A 1ZBUA 2H3FA 2JV3A 2RF2A 1SXDA 4KX5A 4KN7A 5ALVA 4CBWA 3CCJN 2BZFA 4PKIA 1GLLO 4I2PA 5FRMA 1LCUA 2FBTA 4R65A 3GL1A 4RW7A 4F4XA 1ZD5A 4Z4CA 3PW0A 1MWMA 5AK5A 1BIZA 4UAWA 4KLOA 7ICKA 3HYFA 3BGRA 1IKVA 3L3VA 3GDXA 4QJFB 5KFMA 3VEOA 2JH1A 4OKKA 4YMNA 1YTAA 2ESEA 4JKAA 5KL8B 3OYLA 5J8YA 2PAVA 3G71N 3LZJA 2W7OA 7ICNA 2ZIVB 1S5LU 1VSIA 3JS6A 5EOYA 2K89A 5DBAA 4IRDA 1C1CA 4IZ9A 4CEEA 4CERA 4K4IA 3UXNA 3L2UA 4CJLA 3I1YA 4HUGA 3NF8A 5ALJA 1RDCA 1B43A 2FPKA 1JLBA 1IKWA 3AVFA 5DGAA 3LDQA 1J9AA 4AH9A 3D2FB 4AM7A 4DV0K 1Y97A 1RTJA 3PR5B 5L1LA 4CGZA 1EKEA 2V7ZA 3L2RA 4GV9A 3KZIU 2ATQA 4CGJA 4PL8A 4JI1K 3QERA 4LFCK 3PV8A 1KAXA 1ZOLA 4ED0A 5CA7A 3C28A 3M1FA 3MMVA 2DL0A 4FZXC 2WFAA 5AM4A 1MQ3A 2BDPA 4ISEA 3AVNA 4M3RA 4DQQA 1JMSA 1Q46A 3E9OA 4DSJA 4M63C 5GAGP 5GADP 4CGGA 3JXUA 4X64K 2B6GA 3C6TA 3MC1A 3LP0A 2XI9A 4IRKA 1X3NA 2H3ZA 2G8UA 2ZTCA 5KPTA 3BQ2A 2YHWA 3CCUN 3QNNA 1NNEA 4FBTA 3SI6A 4JKBA 1C0MA 4FJ9A 4QZFA 3L4IA 4ZOHC 3KZBA 5DM7L 5J2HA 4IDKA 4F91B 2ZXHA 4DU1A 1X6JA 2QK9A 4Y2PA 3SUOA 5AQPA 1V9PA 4KPYA 4DKWA 4B9TA 2AGOA 5AFUA 1VQ9N 4NM2A 1Z00A 4ISGA 4CFDA 4EBCA 3M6GA 5JICA 3LPUA 2A1RA 4LF7K 2PYLA 5KG0A 1HNWK 1ZD4A 1BPYA 2UXCK 1KL9A 4RQ8A 4DB3A 1HNZK 3BS7A 4AP9A 9ICCA 4RQNA 3SYZA 8ICTA 5AKGA 4CF8A 2YN4A 5AKLA 4O3NA 4NM1A 4B8AB 4CHNA 3IG1A 1JKHA 5B8HA 2J6SA 4C8NA 4OJLA 1U6ZA 2HOFA 3C1YA 1KBUA 3HBTA 1EX4A 3HL8A 4XH1A 2W9BA 3ZSOA 2OM6A 1UQVA 2QEXN 2YB1A 8ICGA 3L0QA 5KFFA 3T79A 3DI6A 1XNSA 3H3NO 2ZUBA 4NO7A 2G8HA 4DSLA 1ATSA 4N76A 4KB1A 4CZFA 5B66U 1KVAA 4XUSA 4O8KA 4O3QA 3SQ0A 2HBKA 1KN5A 2HNYA 3I28A 5AQUA 3TAEA 9ICWA 3HM8A 5F1XA 5L1JA 3VQ8A 4FZZA 2E5SA 5KT5A 2F1JA 3RH4A 4NJ8A 5KL1B 1N61A 3NF7A 4CEFA 4RPZA 4YMMA 1NK9A 4DTNA 4GW6A 2E6LA 2W3RA 4YMOA 2HHQA 4KHYA 1YVNA 4RNMA 5M1PA 4OVLA 4Z4GA 2ZD1A 5AI8A 7ICUA 4NL9C 1B0XA 3M9NB 3EZ5A 3VQEA 4IKFA 3ZDBA 4UAYA 4Z4FA 3KWIA 2ASOA 3DRSA 3V6JA 5DQGA 3NDKA 4F4WA 1XC9A 1ATNA 1UCVA 4QWCA 3ZT0A 1L8OA 5ALKA 1W9HA 3GIKA 3KHYA 3QNOA 1UT5A 1I39A 3A0IX 4BE1A 3G25A 4E1NA 3DEEA 2NRZA 2YKNA 2LM1A 3SAHA 3DDHA 1HYVA 3AVBA 2E8AA 3MDQA 4CJVA 4CW7B 3PUFA 1VQLN 2W8LA 1NMNA 4FLVA 8ICAA 2W43A 1Q8KA 3J7YP 1N5YA 4TUSA 3VF6A 3FGUA 1OW5A 8ICYA 4A59A 4U67L 1WBBA 3KHHA 4TURA 1E4GT 1C0GA 2HI0A 3D2NA 5J0UA 1I3AA 2GX9A 3HXMA 3FAHA 4W5TA 1QQ6A 2F8KA 3A8YA 3CETA 3THXB 3L2WA 3UMBA 3CW2C 2BQRA 4XQ8A 3QU2A 3TAMA 4HAIA 2W7PA 5KGWA 4J9SA 1BO5O 4BC3A 5KT4A 4A57A 4BXOA 1SKRA 1M6YA 2VG6A 2NRTA 3LZIA 3HTVA 2O8BB 3AO3A 3RMAA 3IRUA 1MDUB 2Z7JA 3CMAN 4FLXA 2VGNA 1OUQA 5AQTA 1QQ7A 2H5XA 4HUFA 8ICJA 4KLDA 1VAZA 4RW8A 4FO6A 1NK4A 1ZQRA 3EL2A 3HM9A 2PFOA 3H4DA 5SZTA 3B9JA 5J0WA 2IS3A 3CCMN 4PKGA 4FM0A 4DTMA 2AA4A 4DUZK 4KMUA 4KMOB 4C4TA 3CERA 4JK8A 3PW5A 4O5EA 2E2QA 4I2BA 2QWQA 2ES6A 4ELVA 5KAIU 5ALFA 2IOHA 3LL3A 7ICRA 2ASMA 3C6AA 4I2HA 2RN2A 4MQ3A 1HMVA 4CDGA 5J2MA 2W40A 4BR2A 2IAJA 4CZLA 3RJHA 1LAWA 2CGLA 2JMGA 1RBSA 1S8OA 2HNDA 5I3UA 4H5NA 1PVPA 5ALZA 3CCRN 1HRHA 3ZX3A 3QESA 3RJFA 3RMDA 4I2AA 4R66A 3GV7B 8ICOA 4OJPA 4NXZA 3HX0A 5KFEA 1RCHA 1V4TA 3LM2A 5IIOA 1ZBFA 2MA1A 1ZQEA 2KZMA 1S22A 3ITHA 3PLAA 1P7DA 4PL2A 4QNLA 4Y2QA 1C6VA 3A5OC 3C6HA 4KI4A 1WB9A 1WSFA 1YTUA 2E4LA 3UQ2A 5DKWA 3SEIA 4UBCA 3WKDA 3AVMA 2EQYA 4CF3A 1QQMA 1JCEA 1RZTA 4QOZB 3AVJA 1A5VA 3R9PA 3WK6A 4DL5A 3C7NB 3AUOA 4N56A 1DGKN 1GLAG 9ICTA 3RB6A 1QHAA 4FK0A 1XUPO 3H1QA 2BKEA 1DXSA 3Q8SB 5T7BA 1PK3A 4FS1A 1QHTA 1Z26A 3U8XA 4J8FA 2IVOA 4F4ZA 5KFIA 3O3HA 4JV0A 1ZBLA 4RPXA 1SGGA 3OPXA 3ENBA 4CEAA 3RJJA 4W5NA 5AI0A 1BPXA 2DFLA 1LKYB 2ZJAA 1BWFO 4FCYA 2AXTU 2ZWHA 3V7KA 4PZOA 4CZMA 2PMZC 1N62A 2FPLA 1S76D 3MAQA 3D0PA 4M42A 4FK2A 4LZGA 2DPIA 2DKZA 3SMVA 2VIXA 1QSYA 4F2RA 1TL3A 3SPZA 5J1EA 2F96A 2B5JA 2KHVA 2FPMA 5AM0A 5TKWA 4CJTA 4PWDA 4O5CA 3VA0A 3AL0B 2G08A 2F44A 2ZIWA 4F4YA 2XGQA 4ILGB 4ICLA 5J0RA 4MF8A 5A2QO 4WQ5A 2ZF5O 3WQTA 2F76X 4ED6A 3MBYA 5AQHA 4IG0A 4IRCA 1NGGA 3CRXA 1F44A 1JLAA 4HUEA 4CHPA 1RT1A 5CHGA 3GE1A 4I6MA 9ICNA 4AHVA 5D4BA 3WKBA 3VQAA 4Z6CA 5AKZA 3H8WA 5KFNA 2M0NA 1T8EA 4DV2K 4PL7A 2QA4N 4CIGA 4OJ6A 1VSLA 4YR2A 4DWIA 3ZT3A 2ZIWB 5AK4A 1ZQUA 2IOFA 1RBTA 1VSEA 3AGKA 4FWPA 1YJNN 1GLCG 4ECQA 4LH4A 2O8CB 4DL4A 4CHZA 4BE2A 3AAQA 4CF5A 2QKQA 3SUPA 4LF6K 3TADC 3VQ7A 5BOMA 4DQ8A 2GWSA 3DLLL 1F0MA 2R7YA 4DS4A 5BPCA 4CEZA 1BPBA 3EUB2 1S97A 2FXUA 3A5LC 4H03B 3V9ZA 4FZLA 1L3UA 2UVVA 7ICOA 3OGUA 3HZ6A 4ISFA 4QZDA 5J2KA 3C29A 7ICSA 2W9AA 1N48A 2OANA 4NCGA 4E3SA 3SNNA 1BDGA 1T94A 3K58A 3NTUA 2LYBA 5HMLA 2EH9A 3Q8RB 1WCNA 1ZQNA 3N4QA 2RRDA 3WQUA 3TWHA 1OXJA 4DMNA 3WNEA 3KKSA 3PZPA 4EP4A 4BC5A 4CJPA 3H0LB 2GUPA 2YNHA 3EEQA 2HMIA 4DV6K 1N5XA 9ICOA 3TTFA 3DM2A 4Y0WA 4PHDA 3TARA 4M47A 4H4OA 4JI8K 2Z1HA 4HVJA 5FPEA 3K5MA 3TSPA 3V9XA 2G8FA 4F5RA 4R8UB 3J81O 4YXMA 2HDOA 4IR1A 1BVSA 2WBNA 7ICPA 1RT5A 2WFBA 1DTTA 4WCEL 4CZIA 4YD2A 5LJWA 1N60A 2F8SA 7ICVA 3H3OB 4KO0A 4I2QA 5AQKA 4ID5A 1NK8A 4YHHK 3C23A 3SV4A 4I9QA 3E01A 3I56N 2WF9A 2EZZA 4DQRA 9ICSA 4BROA 3PMNA 2IHMA 2W11A 1ZQHA 4JKFA 2W55A 1CXQA 4JMUA 4KLUA 2RP5A 4N47A 4JD2B 2Z1JA 3CPEA 2YNIA 3C6UA 2VG5A 1CLQA 2VKQA 4J9NA 4YOTA 1TK5A 4KHUA 3QEXA 5LMNK 2F4VK 1X9XA 4ECRA 2P9KB 4I9LA 5C15A 1FEZA 3VCBA 3M6KA 2GWKA 4P0QA 1EETA 1HLUA 4CE9A 1ZJMA 2Q36A 2VYPA 5K14A 4DF8A 1Z00B 1BHLA 4M3ZA 4Z4IA 5HP1A 1SIJA 2ZIUA 2QWMA 4RZRA 1LW2A 3QFUA 1NOYA 4IQWA 3QEAZ 4ZTFA 1KAZA 2W6LA 2O4GA 2H3VA 2NRWA 4PGYA 3KLHA 1O08A 3SD7A 2V52B 3IRXA 3U9DA 3TAGA 4XH5A 4KLQA 2UVUA 3Q8KA 2QI2A 3F2DA 2QKKA 2HMXA 5ALMA 3KK2A 4BGAA 4M6WA 4B1UB 4BR5A 4LF5K 3S6JA 1XSNA 3BP8A 1E4FT 3DLGA 3G6EN 1EQYA 4PHPA 4J2BA 4NLKA 1HJOA 2KFNA 5IIMA 3DMJA 3KKAC 3RRHA 1ZXOA 1WSIA 5DG8A 9ICUA 5BR9A 3VQBA 1Z25A 4DL3A 1JXBA 3HPGA 3WXJA 4MO5A 3I8DA 2HNZA 5L9XA 7ICJA 1X42A 4ED2A 1NGIA 3ZX2A 2CPRA 3HK2A 4UY8O 2NZTA 5AIAA 4CEBA 4G9BA 4E7HA 4Z6DA 4C0ZA 4RPYA 2P6RA 1Z3EB 5ELZA 3ORYA 4OGCA 1B92A 4ECSA 1TVRA 2FLOA 3NFAA 4H5VA 4FJXA 4YVZA 5HBMA 2H3QA 3LAKA 1JL1A 3O4QA 3OYCA 1JI7A 2QXFA 3O08A 5DG7A 3FZLA 3HJFA 1NMDA 3D6JA 2HHUA 2V51B 4M3TA 4Z94A 4WFNL 4GC7A 2KIWA 4EENA 1KRPA 2XY8A 3NGYA 2XO7A 1N5WA 5DB6A 8ICVA 2ITGA 4J2DA 1KVCA 4Y2YA 2KHOA 4M0AA 5IINA 1WN7A 5AQRA 4NCBA 3BDPA 4JAXA 1ZQKA 2PI5A 2GWJA 4QAGA 5ALUA 1HJPA 2PKEA 1RNHA 4CGIA 5HOOA 2OYQA 4OLAA 2CH5A 5KFKA 1RDWX 2OPQA 3MK6A 4JKDA 2FE9A 5DDYA 4A2AA 4BE0A 3AVKA 3T5JA 1SKWA 2D0AA 3V9UA 1RDUA 3H46O 3RJGA 4ZTJA 3NH1A 1UPHA 3FC4A 4XRHA 4DTSA 4FJ8A 2P9LA 1BA1A 3HI0A 5AKIA 5H1SQ 5KFXA
chains in the Genus database with same CATH topology
5AQLA 2PFUA 4K4GA 8ICQA 1RPLA 3ID8A 5KFWA 4F5NA 4O5KA 2Q97A 8ICIA 3Q8LA 3SJHA 3RTVA 2QXLA 4JUZA 3V7LA 4FBUA 5DM6L 1ZETA 2W9CA 4HTLA 4MEYA 9ICVA 3PY8A 4PHTX 4TQSA 3ZX0A 4E1JA 3FZFA 3NVMA 5E26A 3VEVA 4DSKA 3CCVN 3DXKB 1NK6A 2HHSA 1H1VA 4DOAA 4JHDB 1X9WA 1ZQGA 4K43A 3C2KA 3OA9A 4H5TA 4QZ9A 5KTQA 3VESA 4F5PA 2IVPA 3DXMA 2A5XA 4BG9A 4PGXA 3EN9A 3SZ2A 4BR9A 9ICRA 3RSEA 1ILYA 4OPHA 3C2MA 3E9LA 2BCUA 3AAPA 2W9MA 2P9LB 3HP6A 3PIPL 3CI5A 4YN4A 5IIJA 5HMMA 3VEXA 5CR4A 1AROP 3H8SA 4DL2A 5TKYA 4H0OA 1KFSA 4WFAL 5FPDA 4H5RA 4O5FA 4A5AA 5EWFA 2GTDA 1BPZA 3KVGA 1IXRA 2HHTA 3F5TA 1K8KB 2A41A 3PVXA 4BRLA 3Q8PB 4EIAA 1K9MO 4QS9A 4BQZA 3JPRA 3M9OB 2AGQA 1MWKA 5DBCA 1U2VB 5KT6A 3C0BA 5ADXA 4BRGA 3LK9A 4ECXA 1ZQYA 4IOAL 3SMPA 4GC6A 4RTFD 4DF4A 5KG5A 4IOXA 3DXMB 3J7ZO 2ASJA 3C7NA 3T3FA 3E2EA 4GV6A 4M6WB 4QWEA 4IJAA 4RQ1A 2H3GX 2CGJA 2B21A 3K4GA 2F7TA 1L3SA 2KTQA 2C28A 3Q7BA 2VCPA 2BCRA 1U45A 2JEIA 3FZKA 1JXLA 2ATLA 1SL1A 3K9JA 4FWRA 2VA3A 2D4WA 4MF2A 2Q0RA 5KFJA 2P9KA 5LJVA 4QS7A 1Q86O 3HOTA 3RBEA 1RGIA 3VEWA 4RCHA 1S10A 3VOVA 4IR9A 5KFRA 3E9PA 2KKZA 5C12A 1NGHA 1Q18A 4IO8A 2V4QA 9ICIA 4BRHA 3G4SN 2RDJA 1VQ6N 4YOXA 3H1VX 3SLCA 2QWRA 2D1KA 3CC4N 3WXKA 2NRHA 4JKGB 2HHXA 1KFDA 1R59O 3TQ1A 4JKCA 4KLJA 2P6UA 5EWEA 2P66A 1YJ9N 3D2EB 1ZQAA 2NNWA 1J6ZA 4YQWA 3CJCA 3F9MA 4G3IA 4HYKA 2XY7A 1K1QA 2C2DA 8ICPA 4UB3A 3JPQA 2Q31A 4B9MA 5AQSA 2F1IA 1RFQA 3RH6A 3T69A 3O9TA 3ATUA 1RYSA 1KQSM 1S3XA 4DLGA 4XA5A 3UQ0A 5J2AA 1HPMA 1ZQZA 4FWNA 2MUTA 5AQNA 3MABA 4BY9C 5F9LA 3OBWA 1QVFM 5EXWA 1BPDA 1QQNA 2FSJA 4IFEA 5KFVA 5EX5A 3PNCA 3H8JA 3WEEB 2KFZA 2BCQA 4I2JA 3UXOA 5KFSA 1Q7YO 3GIIA 4KLLA 2YHYA 3N97B 5J0TA 2A3ZA 2P9UA 4KLIA 3GBTA 3TSUA 5KG1A 5I9EB 4QZGA 5CJ7A 1MQ2A 4ED1A 3V72A 5AQYA 5GAEP 2HBJA 2ZTDA 4BRQA 1JJ2M 3ISDA 3BF3A 4UB5A 3K9KA 1EO1A 2DPNA 3DJCA 2BHNA 5DQIA 5CR0A 1LB2B 4B1ZA 4YXJA 1VQ7N 8ICXA 3HPOA 5AQGA 4RWTA 3ZDAA 5F2RA 4CJ7A 3HSCA 3CMEN 3J8AA 4ELUA 4QW9A 1VQ5N 3SK3A 1XU4A 4FOEA 3VERA 3BF1A 5BPLA 1WCLA 3QBXA 4YOYA 3GQCA 7ICIA 3PO5A 1SZPA 4MFAA 3SBTA 1U9LA 3H4BA 2W8KA 8ICKA 2FLLA 2WUSA 4R63A 3TTCA 3DXKA 4FWOA 4DOBA 3FZHA 5KFDA 2AGPA 3OJSA 3KK7A 1S0VA 4QW8A 1SKSA 3SAGA 3PIOL 2IBKA 3TFRA 5IILA 5KT7A 1VQMN 5DG9A 3T5KA 5J0PA 4K41A 3EWAA 1X3MA 3PMLA 5KFUA 4EHUA 1XO1A 3CCEN 3O80A 4B1VA 4J9MA 4MLEA 1NGCA 3VTIA 3UKUB 1GLEG 5DGBA 4Q44A 5KG6A 2J6TA 3IUCA 2FF6A 1T3VA 5AQFA 1GLJO 3ZDCA 1NGDA 3O1BA 4DSFA 2GELA 4CZHA 3ZD9A 1QVGM 3CF5L 5HHHA 2D0OA 1KFTA 4KH4A 5J0OA 2R8KA 3CD6N 8ICFA 1VQ8N 4YP3A 2ZUCA 3QB0A 5D46A 5AZIB 3TSQA 4ILJA 3IMXA 3LM9A 3E1YA 3PX0A 1NGAA 4A61A 3G6YA 4B1WB 4MO4A 4Q8FA 4RUCA 4MDAA 4DSIA 3ZEUA 2DPJA 5BN9A 3EKSA 3C1ZA 4IQVA 1ZQCA 1JCGA 3RSEB 4DFKA 3D6RA 1OKJA 4WFBL 4FPAA 5JUMA 3M5RA 4XH4A 4FPBA 2VA2A 9ICLA 4CBXA 4IEIA 1S0NA 4Q43A 5AQJA 3ENOA 5GINA 3I8BA 3QE9Y 3O4WA 1NLVA 1Z05A 1NJWA 3NGDA 5HNKA 4YR0A 4DFMA 1TUYA 2ZJRL 4MFCA 3EO3A 5MLCQ 1QLNA 4KITB 4UQGA 4YORA 3MCPA 3ZDEA 4F5QA 4JNEA 3QZ7A 1YF5L 2QW9A 5AZIA 1TAQA 3BEXA 3PX6A 3JPNA 3CC2N 3OW2M 3CPWM 4RNNA 2E2OA 1SAZA 9ICGA 1XS9D 1DOQA 3MCAB 4ECTA 3O6WA 1D8YA 2HHVA 3SI8A 4TQRA 1NM1A 1EXNA 4KLHA 4DLEA 5AQOA 3MWPA 4BRAA 3KHGA 4A5BA 1DKGD 1ZQMA 5AFUH 3WUHA 1XSLA 2BUPA 5KPRA 5KFZA 3EE8A 2ASDA 2HMPA 1B22A 1HKBA 1U48A 3RR7A 4PKHA 4DL7A 5HP4A 4UAZA 1BGXT 3RB4A 4F4KA 4FO0A 4QS8A 1SS6A 2KN7A 2JWKA 1JN3A 4O8UA 4BVPA 4JEPA 2I7PA 4CI6A 5KFPA 2XY6A 2UVWA 4GLXA 1Z6RA 5LY3A 1T3NA 2BTFA 3RJKA 1DGSA 2JEFA 3HRGA 4I2IA 2YI1A 2ZGYA 4BWJA 3WEEA 1KDHA 2P9PA 3RR8A 4I28A 4CCHA 3RB3A 4M9GA 2BPCA 1YXQA 4FWQA 4BGBA 1KAYA 3GV5B 2QTDA 8ICLA 3B0YA 4F9OA 4BRNA 2IVNA 4O3PA 5DB9A 4FWLA 3VPZA 2XC9A 2PFNA 5M1QA 2GEMA 5J2CA 5IIIA 3A5NC 4B1XB 2BPFA 4E0DA 4IOCL 3QZ8A 4LZDA 2Q1NA 1T44A 3VETA 5KFQA 4OPAA 1XQSC 3R3LA 3MR3A 1QSSA 5AR0A 1JCFA 3MWTA 3SAFA 3I55N 9ICKA 2VGMA 4DQSA 3RAQA 3M9MB 2RDIA 1S9FA 4JK7A 3D7EO 3PW7A 8ICHA 5KT2A 1ZQPA 5BPNA 2HHWA 1BPEA 3E66A 1NOMA 3LWMA 9ICPA 2P9PB 4GXIA 1U47A 3MDCA 1TYQB 2VWBA 3FLCO 3JPOA 2J6UA 1C0FA 4H0YB 1HUXA 1O13A 4EAHD 2V7YA 5C0YA 1BOTO 4FWMA 1NJYA 3P39A 3EW9A 4YDUA 4RQ2A 4QZCA 3BQTA 3ISBA 4WQ4C 3TAPA 1TYQA 4GXKA 3PO4A 4BR0A 4YG2A 3THVA 2OTJN 3Q7CA 8ICZA 3O9UA 1JXEA 2KZZA 3CJ9A 4LC9B 5DDMA 3Q8QB 4ED8A 4FS2A 2CGKA 5BOLA 2FSNA 5GAHP 4J9KA 5JMVA 3LWLA 3CCLN 1XC3A 4UB2A 4QZHA 1CUKA 5J2BA 4BRMA 2E1ZA 1ZQLA 3QFPA 2XCAA 5AQMA 3KTQA 1D9FA 3UKUA 4M9HA 1YITN 4NB4A 1KC8O 4AF1A 1JX4A 3MDAA 4NLNA 4H5WA 1ZQXA 3O9RA 2NRVA 4DL6A 3HWTA 4M9LA 4ILHA 3EPGA 2VA8A 1NK0A 2I1QA 4QZBA 3EZWA 3VEYA 5KG4A 5CP2A 1TFRA 2KZ3A 2Y1IA 5J2EA 4IXCA 4C1NK 2RHKA 1NWKA 1HKCA 5KQDA 5F0XA 4KLEA 4QZIA 9ICBA 3ENHA 4IO9L 2WC9A 1VQ4N 3OHAA 4JK9A 4HWIA 3QMLA 1SZ2A 2AJQA 5BRHA 4JWNA 4C8KA 3TANA 4XEIA 4BRFA 1IM4A 4BR7A 4WQ5C 4QZEA 9ICMA 1JIHA 4JK1A 3HW8A 4NLCA 1QQOA 3WT0A 3UB5A 2BQUA 3SBGA 4P2HA 4DEZA 3ZYYX 1KEJA 5L1IA 4EBEA 3S41A 2P9IB 8ICMA 1G99A 3GIMA 5L1KA 5IIKA 3CIPA 3U4LA 2R8HA 2YX6A 3VF4A 1ZQTA 3TFSA 1ZQJA 1BUPA 1ATRA 1K8KA 1ZQWA 5HL7L 3L4QA 3HOSA 2OTLN 5KFOA 9ICFA 2FSKA 5JVGL 1RYRA 1N8RO 2FLNA 1DEJA 9ICJA 2YJEA 2PFQA 2ASPA 2HSTA 2AQ0A 2F1HA 4DFPA 2AP1A 2R8JA 3Q8MA 4NLGA 3CJ1A 3TU5A 1U4BA 3OBYA 3B0XA 1NJXA 1K8AO 4C8MA 1LOTB 2Q0UA 3SV3A 1PZNA 5AQQA 4JWMA 8ICUA 2J4RA 5EVZA 3O9QA 2ZUDA 3R1XA 5JLHA 2Q2RA 1Q82O 2LYHA 4JKEA 4KBOA 5M1OA 5J2IA 2BPGA 5KFCA 4QWAA 3M3ZA 9ICEA 2QWPA 2E1YA 3G6VA 5DQHA 8ICEA 2JZBB 3IKMA 4OO1J 4LVSA 4EHTA 2W41A 4J9PA 2HBLA 1YJWN 1UA0A 4CD1A 4RT3A 3OSPA 4WQ4A 7ICGA 3IHQB 4P4PA 4RNOA 2E2PA 3QEBZ 4EZ6A 1YI2N 3GV8B 1NGEA 5FPNA 2XCPA 4I29A 4BREA 2IA6A 4GY2B 2IMWP 9ICAA 3GILA 2YCHA 3VTHA 2ZGZA 4TUPA 4DHYA 3UKRB 1C7YA 3QDKA 2W9BB 1TK8A 5J0SA 3VEZA 2A40A 1KXPA 2ZTEA 4JD2A 3CCQN 4CBUA 4ECZA 2OWOA 3RJIA 2QM1A 3L6QA 1NJIO 3FFKB 4BRDA 1NK7A 1ZQIA 8ICCA 1P8ZA 3CC7N 1NGJA 5TZVA 2AU0A 4R79A 3JPTA 4EBDA 4BRIA 2AQ4A 4J9LA 7ICQA 3R6MA 3VENA 4DCHA 2HOEA 4AM6A 2JWLA 5F9NA 4UBBA 8ICSA 5CHIA 2RE2A 4DO9A 3TAQA 3KHRA 3VGKA 3IDHA 5GIOA 4KLFA 4FSVA 2YHXA 5KG3A 4DFJA 2F9TA 1IG8A 4I2DA 4DS5A 2I7NA 4CZGA 1ZBSA 5BRFA 1GLDG 4M7XA 5AQWA 4B9LA 1L3VA 5DBBA 1XWLA 3D2FA 3TTDA 5KFYA 4O9MA 3C5GA 1RXVA 4FL9A 1TUUA 4GV3A 4YCXA 4J9OA 2QWNA 3TI0A 5AZJB 3D2EA 4C8LA 4M9NA 2R8IA 4JV1A 5J0QA 5M1NA 4RUAA 1NK5A 4O0IA 5CB1A 3HT3A 4L3QA 1KLNA 4IQTA 1CEZA 3ZDDA 3OHRA 3RBDA 4JV2A 5EWGA 3MGHA 3N4MB 3LDAA 3F2KA 1ZQFA 4I6MB 3G6XA 3ZD8A 2PXIA 4M9JA 3WXIA 2FF3B 4KTQA 4H0TB 4YOWA 4B9SA 5AQIA 1NBWA 3N4PA 4FOIA 4RQ5A 4BC2A 3BJYA 3BUZB 3AY9A 7ICEA 8ICRA 4EYHB 3KHLA 3CCSN 3M8RA 3PW2A 3O5BA 5KG2A 4PHAA 4RQ7A 5CWRA 4JHDA 3C21A 2HF4A 2ZJQL 3FYHA 1VQON 1VQKN 4B1YB 2P9UB 4IJNA 5DB7A 3P31A 1H38A 2A42A 5AQXA 1BG3A 1VQNN 1ZQSA 2UYTA 3H40A 9ICHA 5J0YA 5ADXH 3O9SA 3TPQA 4B9UA 4BQLA 4P4MA 2C22A 2JEJA 3C5FA 3ULEA 4C8OA 5DLFA 3FZMA 4Q45A 1QZ5A 4BRPA 2I9GA 5BN8A 3RAXA 4KH5A 2BQ3A 1TV9A 1DT9A 3SMSA 5J2FA 4NY8A 4KLGA 1YIJN 1T4GA 3M8SA 2KLAA 2ALZA 4Q8EA 3LDOA 4B9VA 1QZ6A 4RQ6A 1YAGA 5KT3A 4B9NA 4F8RA 4O3OA 4EFHA 4M2YA 3UXPA 1ZQVA 1M90O 4F5OA 4IEEA 4EYIB 1SL2A 5JLFA 4JKGA 1QSLA 2QWLA 3AU2A 3V7JA 1T7PA 2E20A 3LDLA 4BXOB 4ELTA 1UT8A 3MFIA 4MDBA 5KFLA 5J2GA 4KLTA 3MX2A 3LDPA 4GNIA 3A5MC 5J2JA 4TUQA 4DQPA 7ICFA 4PPXA 3GOIA 4O3SA 1KTQA 3GFKB 1HUZA 4NLBA 1KD1O 8ICNA 3MFHA 7ICMA 3OSNA 4YR3A 2ZJ5A 4YFKA 1ZQDA 3ULEB 4C23A 4ECWA 2E88A 1SQKA 2BGWA 3ETLA 3VGLA 3VMFB 4QWBA 1UA1A 4P4OA 4PGQA 4I2CA 1W97L 3K75D 4NLZA 2NRXA 2YJFA 4DQIA 4FVUA 4M7YA 2ZJ8A 3QBWA 2BCSA 5KFHA 2W9CB 4ED3A 1WUAA 5CE3A 3EYZA 4Z6FA 2VANA 2BCVA 3JPPA 1YUWA 5J0XA 1SL0A 5KFTA 5J29A 4IQUA 3RB0A 3MR2A 1ZQQA 2NRRA 4YOUA 1HUOA 1BA0A 4KN4A 4R8UA 2HW3A 4GXJA 4KLMA 1S0OA 5KFBA 8ICWA 3V6KA 3DAWA 5J2DA 4YD1A 4YOVA 1ESVA 4RQ4A 1S0MA 5KG7A 2D0PA 4K4HA 1W2BM 2XGPA 4IDHA 1RXWA 2BH1A 3R8EA 3VF2A 1S72N 4BRCA 1K1SA 5AZJA 1WOQA 5C2FA 3CHWA 1D9DA 4WF9L 4R64A 5EOZA 5AQZA 2PI4A 2JZBA 2PBDA 1IJJA 3QICA 4JN4A 2A1JB 2C2RA 4BVOA 3BQ1A 4IWVA 3BQ0A 3VGMA 4BR4A 3CJAA 3MN5A 3IFRA 7ICTA 1X9JA 3AGRA 5DB8A 2ITMA 3T7ZA 1GLBG 3V6HA 2MUTB 4BDPA 4KLSA 3FR0A 4MFFA 3PW4A 3CQXA 4F3OA 1N56A 4FWSA 9ICXA 3CQYA 5BREA 1A77A 2EWSA 4RU9A 4H0PA 1ZYQA 4CZEA 3OHBA 4QWDA 4O3RA 1MSWD 1QTMA 3WXMB 3EKUA 1ZC6A 3RJEA 4BWMA 5KQ8A 4PH5A 1ZJNA 4RQ3A 4I2FA 1ZQBA 3MR5A 4KH6A 5EY4A 1TKDA 3FDSA 1M1KO 4M04A 4UB4A 2HBMA 4MEXA 3FE1A 2Q0ZX 2Y1JA 3LDNA 5JVHL 4EEYA 5D49A 3RH5A 2HF3A 4UB1A 3P4IA 4Z6EA 3PR4A 1NKBA 4DSEA 1NGFA 3JPSA 3EE9A 1L5UA 4MLHA 5FPMA 2HVIA 5BPMA 2FLPA 1L3TA 3O8MA 4FWKA 3NVKA 1D8LA 4F50A 4ECYA 3W0LA 4CZKA 2UVRA 2FMPA 4BG8A 1T6CA 3O1WA 4H0XB 3B8AX 2PFPA 2NLXA 1TK0A 4RQ0A 2P9SA 4J9QA 4BRKA 3WXLA 2V9WA 2MAXA 3MGIA 1BU6O 1NKCA 1COOA 3AARA 5C10A 3T5LA 4F93B 2CH6A 5BRDA 4EZ9A 4PHEA 3CXCM 3PX4A 7ICHA 4K25A 4QZ8A 5M1KA 3KWGA 4F2SA 4BGDA 1P90A 2A6AA 3U9ZA 5KPZA 5E84A 3MR6A 1LV5A 4K42A 4I2EA 3ATVA 2F9WA 4A62A 4CZJA 3UPQA 2V4RA 1NGBA 1U2VA 2A1JA 5C5JA 3IM1A 5GIPA 3C65A 3EPIA 1Y64A 3H7IA 1Y88A 9ICQA 5HHIA 2WTFA 4ECUA 4C1NI 2ISOA 3ZETB 2P9NB 1GLFO 2E2NA 3W3DA 2QWOA 1X9MA 1D4XA 3T5HA 2JEGA 1VQPN 2P9NA 2HVHA 2IHNA 1TVAA 3ID6A 1ZQOA 4BC4A 3NMUA 3MN9A 3CJBA 2FMQA 4A2BA 1CZAN 3UE5A 1T6DA 1X2IA 3GIJA 3DWLA 3H45C 4JKHA 1U49A 2P9IA 3ISCA 1MC8A 5AQVA 1TAUA 4J9RA 3MX5A 7ICLA 3MN7A 4RT2A 1Q81O 1MA9B 3RRGA 2ZJPL 2ASLA 4ZH4A 1YHQN 4CD3A 4U7BA 5KFAA 1HX1A 1XSPA 5KFGA 4G9ZA 2FMSA 4GVEA 2M9NA 1K73O 3AU6A 3P38A 1X9SA 1NKEA 3I33A 2R8GA 4I2GA 5C2DA 2ISPA 3MN6A