2NRTA

Crystal structure of the c-terminal half of uvrc
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
b'GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrtA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrtA01
1KRPA 1SKSA 1ZJNA 5EWGA 4M0AA 4I2AA 3BQ2A 1TAQA 4B9UA 5KFHA 4IQVA 4KLJA 4XQ8A 7ICKA 1U45A 3C65A 4O3RA 1QSSA 2R8JA 2XC9A 2BCVA 3T5HA 2AQ0A 2HW3A 2XO7A 1ZQUA 4UBCA 2P6UA 4FS1A 1UT8A 8ICSA 7ICHA 3TI0A 4XRHA 4DFPA 4J9NA 4F8RA 4P2HA 3GDXA 1ZQHA 3RJHA 2HHVA 2BPFA 1ZQBA 4EZ9A 1TVAA 2RDIA 4TQRA 1XC9A 2LYHA 2OWOA 4ECWA 2HHTA 5KFAA 4RNOA 4YR3A 3RAXA 4I2EA 1RPLA 4QWAA 2C2RA 4DFKA 1U48A 4UBBA 4TUPA 3BQ0A 4ECRA 4RQ6A 4RNNA 4DSFA 4O3QA 3PY8A 3ZDAA 4O9MA 4DSLA 9ICMA 1X9SA 4IR9A 1T7PA 1QLNA 3EPGA 4G3IA 4RPXA 3C21A 2VANA 1Z00A 2V9WA 3RH4A 4M2YA 3PW7A 3Q8PB 4X5VA 4I2DA 3NTUA 5KT4A 3RAQA 9ICSA 4J9OA 5BOMA 4M9NA 4ECTA 5KFKA 1C7YA 4K4GA 5J2AA 5KFPA 5KG4A 4DQSA 1T4GA 1CUKA 2C2DA 5KG1A 5DBAA 2DPJA 4KLDA 3KHHA 2BCSA 2BPGA 1QSLA 4DFMA 2ISOA 4QZGA 2W8KA 2C2EA 1ZJMA 5J0PA 1ZQNA 1D9FA 4DF4A 2XGQA 2NRZA 5HHIA 2FMPA 2WTFA 1WCNA 5DG7A 4KLHA 1ZQTA 9ICEA 3TFRA 4YN4A 4J9MA 3Q8RB 1BPBA 4HYKA 4DL7A 3PX0A 5J0QA 3RJKA 5KFOA 8ICNA 3ETLA 4TURA 4MF2A 8ICTA 3JPNA 8ICCA 4PPXA 7ICEA 3HP6A 3PX6A 4YXJA 2XGPA 5BOLA 2XCAA 4LZGA 9ICGA 4IQUA 4B9SA 5KFIA 1X9WA 4M9JA 2BQUA 3C5GA 4EBEA 4FBUA 1UT5A 3M9MB 3OSPA 9ICHA 1XSPA 5KFRA 4MFAA 8ICLA 3JPPA 5KFZA 4KLSA 3TAPA 1SL2A 2BCRA 4C8OA 7ICLA 3OHBA 3C1ZA 4EEYA 4QZAA 1L3SA 4F5NA 1L5UA 4RQ0A 5J29A 1RZTA 1LB2B 4B9TA 5DG8A 3OHAA 1KDHA 4KLEA 3KTQA 4PHEA 1ZQJA 8ICVA 1JN3A 2HVHA 1ZQZA 1XSLA 2NRWA 3ISDA 3HPOA 3N97B 2C28A 2R8KA 1S97A 1JIHA 5DDYA 3C1YA 1JMSA 5DQIA 4RUCA 4YR2A 4QZDA 4QWCA 4TUQA 3EYZA 4ED7A 3Q8MA 1COOA 2P6RA 4F4KA 4UB4A 2PFNA 3TAQA 4O5KA 3E2EA 4J9RA 7ICPA 4JWNA 5DG9A 1HUOA 4F3OA 2FLLA 4F2RA 4TUSA 4RT3A 3H4BA 1SKWA 2F1HA 4UAYA 4ECYA 2JEGA 4K4IA 4KLIA 4Q44A 1SKRA 5DBCA 5KT3A 3MR6A 3C2MA 7ICSA 9ICFA 4RT2A 3LWMA 2ZTEA 4BWJA 1Z00B 4I2JA 3JPTA 2M9NA 3ZD9A 5IINA 4EYIB 4K4HA 4NLZA 4KLFA 5KFQA 8ICFA 4MEYA 5CJ7A 5J0XA 1NKCA 3LDAA 5CWRA 1JXEA 5L1KA 2V4QA 3C5FA 1NK9A 4ED3A 2ZJ5A 5F9NA 3Q8LA 3BDPA 4BDPA 3RBEA 2J6UA 4JV0A 5DB7A 2J6TA 3N4MB 3C2KA 4F4XA 1S76D 1D9DA 3V6HA 3PR5B 3HW8A 2BGWA 9ICRA 4DO9A 7ICMA 4YD2A 4B9MA 4RUAA 5J2GA 4DFJA 4YR0A 4QZCA 3HWTA 3ZDEA 4KLOA 4GC7A 1S0VA 1MC8A 1ZQRA 5KFXA 3PW5A 5EWFA 2ZJAA 4RQ5A 2KFNA 5KFMA 3MBYA 3ZDCA 3JPOA 1S0NA 4IRCA 1U47A 1KLNA 4F4YA 3KHGA 3PW0A 4YP3A 9ICJA 4UAWA 1NJXA 4DL3A 5EWEA 4P4MA 4Q43A 5KFNA 4QW9A 1EXNA 4IQTA 5IIMA 2P66A 3AU2A 4Z6CA 2HVIA 8ICRA 5KFGA 4JV2A 5JUMA 3LWLA 3LK9A 5HP4A 1N56A 1MQ3A 2FMQA 1Y88A 4C8KA 4GXIA 5DB6A 3SZ2A 4MEXA 4IR1A 1UA0A 2FPMA 3EPIA 4YD1A 3MDCA 4QZ8A 1PZNA 5BPCA 4YMOA 1BVSA 5IIOA 4KN7A 1ZQXA 1KSPA 4CCHA 5DBBA 3OSNA 1D8LA 2UVVA 3GIMA 5IIJA 5DB9A 3ZD8A 3H7IA 5J0WA 3RH5A 4ELUA 9ICPA 1ZQSA 5KT5A 7ICFA 4YQWA 4DOCA 4QWBA 3Q8QB 4DLEA 4M6WB 2W9BB 3GIIA 3UQ2A 3RJEA 4ECZA 2BR0A 5DKWA 4DQRA 5C5JA 4KLUA 4YVZA 4DOBA 3V72A 4ECVA 2C22A 3JPSA 2W9CB 1TV9A 1UA1A 4J9QA 4KLQA 1AROP 1NKEA 1Z3EB 5HNKA 4DEZA 1KEJA 5DB8A 4KMUA 4XUSA 3MDAA 1T8EA 3T3FA 4F93B 3RH6A 2IA6A 1ZQYA 4ECQA 4ECUA 4ED8A 5CP2A 1ZQCA 8ICJA 3PO4A 5KG6A 4ED0A 4XA5A 5CA7A 5IILA 4QZBA 5KT7A 1NK8A 3H8WA 5DGAA 2PFQA 2ZTDA 4DQPA 4BXOB 2A1JB 2NRXA 3RR7A 8ICOA 3BQ1A 1KFDA 4KITB 9ICBA 1X2IA 2ZTCA 2XCPA 4RQ3A 1ZYQA 8ICKA 3G6VA 5DQGA 2W9MA 2I1QA 1L3VA 4DSKA 7ICGA 9ICLA 4Q8FA 3RRGA 3M9OB 3UXNA 3PR4A 1RYSA 5KG7A 1BPYA 4F5OA 2V4RA 1K1QA 2B21A 5IIIA 1WCLA 4RQ8A 1S0MA 4O3PA 5KFTA 3V7KA 9ICTA 4Q45A 3MFIA 3OJSA 4DWIA 4NY8A 3RBDA 1XU4A 5KG5A 1TKDA 4FS2A 2ATLA 1ZQLA 9ICUA 2KZMA 8ICBA 3ORYA 4BGDA 3PO5A 4M9HA 3RRHA 4ELVA 3RB4A 3RJGA 3H8SA 1BPXA 4Z6EA 5HMMA 1IXRA 1TAUA 4MF8A 3AUOA 5J2FA 3PW2A 4O5EA 1DOQA 4RPYA 2HHXA 4M6WA 2W9BA 3Q8KA 4IRKA 3MGIA 4IRDA 8ICHA 1ZQVA 3SV3A 2FPLA 3PVXA 2IHMA 8ICAA 9ICXA 3EW9A 2IBKA 5F9LA 5J2DA 4F5QA 2R8IA 1L3TA 3H4DA 1JX4A 4M9LA 2W9CA 1N48A 3QEBZ 1ZQOA 2ASDA 4EYHB 4DLGA 3GV5B 1TK8A 5KFYA 4RQ2A 2W8LA 1U4BA 3MABA 1QSYA 4QZHA 4IQWA 4TQSA 1H38A 5J2CA 4DSIA 3MGHA 8ICEA 1ZQAA 2HHUA 3H40A 4F5RA 5HHHA 5D46A 3MR3A 2DPIA 4J9SA 4B9VA 3GFKB 5KFFA 4QZIA 4LZDA 5KG2A 3GIJA 1ZQDA 8ICZA 5D49A 4QZFA 5J0OA 4UB2A 1HUZA 2NRRA 1NJWA 4M04A 4F50A 5L1LA 3M8RA 3SV4A 4BXOA 2BCUA 4NLGA 9ICQA 3H8JA 2A1JA 3QZ7A 2MUTB 4DF8A 4NM1A 8ICQA 7ICRA 2PI4A 4O3OA 4YXMA 1MQ2A 5J2KA 3RB6A 7ICUA 3SI8A 3RB0A 2ASJA 1HJPA 1BPEA 3K75D 4O3NA 4YG2A 3PMNA 4UAZA 4J9LA 1ZQEA 4PGXA 5KT2A 4UB5A 1NK4A 5KTQA 5HMLA 4P4PA 5J2JA 3QZ8A 3QE9Y 2UVUA 4PGYA 1RXWA 5J0TA 3ZDBA 4RQ1A 2NRTA 4RZRA 1A77A 2Q0ZX 3B0YA 5KFBA 1NJZA 4Q8EA 1BGXT 1BPDA 2FMSA 3BJYA 4KLLA 4O3SA 4MFCA 3BQTA 2BQ3A 4GLXA 4RQ7A 4DSEA 4UB1A 4QZEA 7ICOA 4ECSA 4DL6A 9ICVA 2AQ4A 5KFLA 4I2IA 2KZ3A 9ICCA 3TQ1A 1CEZA 4PGQA 4EBDA 4JK1A 3TFSA 2PXIA 4BWMA 3V7JA 2VA3A 4I2CA 1ZQFA 7ICJA 2JZBB 3M9NB 3V6JA 3JPQA 5J0RA 4I2HA 1D8YA 4RU9A 1TK5A 5J0SA 4PHPA 3M8SA 1SL1A 3UXOA 3V7LA 3GQCA 1U9LA 2FLPA 4F92B 3V6KA 1KFSA 5D4BA 2BHNA 5J0YA 5CHGA 4R66A 3OJUA 4YFKA 3B0XA 2BPCA 7ICIA 2VA2A 1T3NA 3ISCA 4C8MA 4FO6A 3C2LA 1ZQQA 2AU0A 3MFHA 3RR8A 4QWEA 4I27A 2GWSA 3T5LA 3RJJA 5KG0A 4R63A 1S77D 1KTQA 1B43A 5CR0A 5KFWA 2KFZA 1RYRA 1KFTA 5IIKA 1ZQIA 2Y1JA 2PI5A 4DL4A 2XY6A 4Z6FA 3T5KA 3TANA 2JEFA 3C23A 3JPRA 2R8GA 4ZH4A 7ICVA 1V9PA 5KFEA 1SZPA 2AGPA 2Y1IA 3TARA 4C8LA 2AGQA 1TK0A 3RJIA 2RDJA 2XY5A 3RJFA 1SL0A 2MUTA 4PHAA 4DSJA 2PFOA 2KTQA 3RTVA 4UB3A 4DOAA 1NOMA 2NRVA 3FYHA 4PHDA 4EZ6A 5DDMA 4GC6A 4PH5A 4B9NA 3FDSA 2HHQA 2VA8A 3Q8SB 3OGUA 2UVWA 8ICPA 4R8UB 1XS9D 4ECXA 3GILA 4J9KA 4FBTA 4M47A 3PV8A 5DGBA 3PX4A 2AGOA 3KHLA 1TFRA 5TZVA 5L1IA 1K1SA 4KLGA 2FLNA 3NGDA 4F2SA 2BQRA 2KN7A 4NLKA 2HHWA 1A76A 4KTQA 4I2GA 5KFJA 8ICGA 1B22A 4C8NA 2I9GA 2MAXA 3HX0A 5J2EA 2IHNA 3QEAZ 8ICWA 9ICNA 2ISPA 3HT3A 2ZUBA 3IM1A 1NKBA 3UQ0A 4KN4A 3K4GA 3MR5A 1L3UA 2KZZA 1MSWD 8ICUA 2R8HA 2JZBA 1NK0A 1NK5A 4M9GA 1RXVA 5KG3A 4RQ4A 4MFFA 4EBCA 4LVSA 5KFDA 3GV7B 3SYZA 8ICMA 7ICTA 8ICIA 4I29A 4RPZA 5L1JA 5CB1A 2UVRA 4KLTA 2ALZA 3UXPA 1S0OA 1X9MA 4DQIA 5DQHA 5KFSA 5J2BA 1ZQWA 5EOZA 4Z6DA 3G6XA 5J2IA 8ICXA 2ASLA 1S9FA 2J6SA 3EZ5A 1NK6A 3ISBA 3GIKA 9ICIA 1NK7A 5DLGA 2JEJA 5KFVA 2ZUDA 2ZJ8A 1IM4A 4NM2A 4DL5A 4NLNA 4RNMA 1XWLA 1BPZA 3KHRA 3RB3A 4YMNA 4I2FA 3IHQB 4YMMA 5J0UA 4F4WA 4NXZA 5L9XA 4R65A 4KLMA 3THVA 1ZETA 9ICAA 4E0DA 2AJQA 4JV1A 2BCQA 4O5CA 1U49A 1S10A 3PMLA 3MR2A 7ICNA 2BKEA 1JXLA 4YCXA 4R8UA 3EWAA 2W9AA 4JUZA 9ICOA 2ZUCA 9ICWA 3PNCA 4DS4A 4DS5A 4QW8A 4J9PA 1DGSA 4QWDA 2IMWP 2PFPA 2DFLA 1ZQMA 4ED6A 1XO1A 3GV8B 1ZQPA 5DLFA 4I2BA 1LV5A 4UQGA 3G6YA 2F1IA 4B9LA 1ZQGA 3UPQA 3AU6A 4I28A 3ZDDA 4DQQA 4R64A 4ED2A 9ICKA 1QTMA 5KT6A 4GXJA 4GXKA 4F91B 4QZ9A 5KFCA 2BDPA 2JEIA 2H5XA 4P4OA 4F4ZA 1NJYA 3T5JA 2FPKA 7ICQA 3PW4A 4O0IA 4ELTA 1XSNA 4DL2A 5J2HA 2HHSA 8ICYA 1ZQKA 4ED1A 2XY7A 4JWMA 2F1JA 4F5PA 5KFUA
chains in the Genus database with same CATH superfamily
1KRPA 5BRHA 3SPZA 1ZJNA 1B0XA 5AQIA 4M0AA 3V9WA 2XRIA 4FJLA 3E0FA 4JB3A 5AFUA 2DY4A 4CJ4A 4IQVA 2F7TA 3E01A 2R8JA 5AKIA 5FPMA 3TABA 3T5HA 2HW3A 1KVBA 3FZFA 4FPAA 3VQDA 2XO7A 5AI5A 3LDQA 3O9TA 2HBMA 3DWLA 4CGJA 3OS0A 1RT4A 7ICHA 3THXA 3THYB 3EE8A 3KZBA 4RW8A 1Q7YO 2ASMA 1OH5A 3J8AA 4JKCA 3HPGA 3KK2A 3Q7BA 5LMUK 2YHBA 1RBVA 4CZGA 1IKWA 3RJHA 2ZIXB 1I3AA 4N47A 5AK6A 1ZQBA 3HBTA 3BUZB 3HRGA 4ECWA 2ZIUB 1KXPA 3VQQA 2K89A 3TKAA 5AZIA 2C2RA 4CGHA 5BRDA 5AQQA 3BQ0A 2E2NA 1CZAN 5EX5A 4CIFA 4USAA 4DSLA 3O3HA 4IR9A 1T7PA 4YOUA 3D0PA 3EPGA 4G3IA 4RPXA 1CXQA 1Z00A 2V9WA 4F71A 2WF8A 3Q8PB 3CIPA 5KT4A 3RAQA 2LKYA 2YMLA 4BR4A 2W7OA 4ECTA 4LF5K 4CJ5A 4DV6K 3CFPA 4DR5K 4DQSA 3A5LC 1CUKA 1XNSA 5KG1A 5DBAA 2DPJA 4WFAL 3VCBA 3ICXA 1QSLA 4RG8A 2C2EA 1ZQNA 5J0PA 1F5SA 5AQFA 2NRZA 3WKCA 3ZSOA 2PKEA 2F3NA 4KH5A 3UM9A 1S3XA 4JI0K 4KAZA 4CGIA 4Y0WA 4J9MA 3OYKA 3R3LA 3RJKA 4PZNA 2I7PA 4TURA 2W41A 4CFAA 2HBJA 3QDKA 1RCHA 4FJ8A 5LL6Z 4MO4A 3UE5A 3NVMA 4LZGA 1LW0A 2P9SA 4DV7K 1LKYA 4M9JA 3ED5A 1TYQB 1RTJA 1LCUA 4CFDA 9ICHA 5KFRA 1FKPA 3U26A 1Q86O 3LZIA 5KFZA 1YI2N 1RG6A 2BCRA 4DMNA 3SUPA 4C8OA 1SGGA 7ICLA 5AZJA 3VQEA 4KX3A 2DFEA 5F2RA 4ID1A 4Y2SA 1DT9A 4W5TA 1L5UA 3NH2A 2RLTA 1UHUA 5J29A 3OHAA 2K4EA 1ZD2P 4PHEA 5G5HA 3DLBA 3N97B 3HPOA 2R8KA 2RPIA 3O9QA 1PK1B 4TUQA 1S97A 1JMSA 4YR2A 4QWCA 3Q8MA 1COOA 2RE2A 2D8CA 4UB4A 3E2EA 4O5KA 7ICPA 1T6CA 3DLKA 4JWNA 5DG9A 1QE1A 2YNIA 1FJGK 4K41A 4DG1A 4F3OA 1HNWK 2O8DB 1BCMA 2G8KA 2KVCA 3H4BA 2LM4A 4AHRA 2D6FC 4UAYA 4ECYA 2JEGA 3QO9A 4CESA 2W7PA 3RMDA 4QOZB 3MR6A 9ICFA 2KOBA 5C2FA 2ZTEA 4I2JA 3ZSVA 2ZIWB 5CZ2A 5EE0A 3QUQA 4KLFA 1NU0A 8ICFA 1EO1A 2WAQC 4OO1J 1WUAA 3ETRA 3LDAA 5CWRA 3QIPA 3CCRN 1S9EA 2Z1GA 4BDPA 3BDPA 1M1KO 5AJ3K 4BVOA 2J6UA 1OXJA 3F2DA 1J54A 3IMXA 3KWGA 3IS9A 4CF1A 3C2KA 3K2PA 3I8DA 4G9ZA 4XEIA 1RM6C 3CJCA 1RDWX 3HW8A 1NGHA 4CJWA 4KHQA 4B9MA 4C80A 4BC4A 4OPKA 3QEPA 1WAJA 2F76X 1X3NA 5AKXA 4H5RA 3PW5A 1NBWA 1G15A 2IOHA 1RYUA 4KO0A 1UPHA 3HOSA 3MWTA 3ZDCA 2F4VK 3JPOA 3QIOA 4CEDA 5JVHL 1U47A 1IG8A 3T1AA 2VKQA 3VQ8A 3KLIA 3V9UA 4EX6A 2D1KA 4L3QA 4QW9A 1EXNA 2XICA 4IQTA 2HVIA 1VQ5N 3AO2A 4Q5VA 1Q3UA 5HP4A 1N56A 4KLSA 3G4SN 3DOKA 1Y88A 4C8KA 1VSMA 3AVLA 1OH8A 4YD1A 3ALRA 3DJCA 3K5OA 3AL0B 4KN7A 2KKZA 1ZQXA 1NNEA 5DBBA 1D8LA 5JTIA 4JHDB 4F9OA 2DBYA 3ZD8A 3CCQN 1HKCA 3PSFA 4DOCA 4KHWA 4NWIA 3DRPA 4GY2B 4DLEA 5LJVA 1KKXA 3NH0A 3G6EN 3RJEA 4UW9A 4GNIA 2W55A 4HAIA 4DQRA 1C6VA 5C5JA 4DOBA 1HPMA 1S6QA 2LYBA 1TV9A 1UA1A 1O13A 3U4LA 5ADXA 3A5NC 4EX7A 1NKEA 3NVZA 3TSUA 4WF9L 5T7BA 2E1ZA 3T3FA 5E41A 1ZQYA 2GOLA 4ECUA 2YHAA 1R0AA 4ED8A 8ICJA 1YITN 3PO4A 4CEBA 4KRFA 4Z4IA 1YTAA 4CNQA 3L3UA 3S9HA 4QZBA 1NK8A 3OYHA 4IO9L 3SMPA 3TAFA 3H8WA 2PFQA 4DQPA 4BXOB 3VOVA 3MEEA 4HUGA 1KFDA 9ICBA 5FROA 3O9RA 1JLGA 1L8LA 2H3ZA 4M42A 2ZTCA 1PVRA 3G6VA 5DQGA 2W9MA 9ICLA 3EUB2 3RRGA 2KLAA 1RYSA 5KG7A 1Q9XA 1JCGA 4F5OA 2V4RA 3C94A 3ITHA 3TTCA 1KW4A 4O3PA 4CI6A 4Q45A 3HTVA 5HOOA 4DWIA 4NY8A 3EY1A 1JLCA 3E9OA 3WUHA 2ATLA 4PY5A 3OTQA 1ZBUA 4NYNA 4B8AB 3ORYA 4M9HA 2W43A 3DOLA 3L2RA 2Q0UA 3H6EA 5EE9A 1ZBFA 3KD3A 1RDDA 3AA3A 2W6LA 3AUOA 5J2FA 3MN7A 1RNHA 4WFNL 3AO4A 5HRNA 4RPYA 4M6WA 8ICHA 1LOTB 4BE0A 3SV3A 4JI4K 2Q36A 5DM7L 3EW9A 5J2DA 4YNQA 4NL9A 1Q3VA 1HR0K 4Y2QA 5CRXA 1LAVA 3HZ6A 4FLZA 1LWCA 4LF9K 2VJ4A 3GU3A 1U4BA 1UQVA 1QSYA 1HQEA 5TKWA 1IV0A 2WONA 1KQSM 2YMQA 3JSMA 2P51A 2B6AA 4Y2VA 2DPIA 4B9VA 2HHUA 1HPZA 1NM1A 1VJ5A 3MEGA 1BOTO 5BN9A 3CM6A 3GIJA 1T44A 1X6IA 4Y1DA 3HOTA 2B5JA 4UB2A 3VEVA 3SUOA 1K8KB 2NRRA 3MN6A 2A1RA 5L1LA 3AVIA 2BCUA 5HRPA 3H8JA 8ICQA 7ICRA 2NLXA 2CPRA 4EENA 2ODGA 2G8UA 3HO1A 4NJ8A 4OX9K 4QS9A 4JKEA 3IV6A 3RB6A 7ICUA 1C0MA 3SI8A 3K75D 5KQDA 4O3NA 2GX9A 1Q9YA 4X64K 4LY7A 4UAZA 4Z4HA 2VWJA 5HP1A 3FC4A 1ZQEA 4F3TA 4PGXA 3GL1A 4UB5A 1TUUA 3CCEN 4JI1K 4P4PA 2GELA 4B1ZA 3OS2A 2JXJA 3LDPA 4UATA 5J0TA 4RQ1A 4RZRA 2Q0ZX 3B0YA 2DF4B 4FJHA 1RT5A 4RQ7A 4QZEA 1Z19A 2QW9A 4PL1A 9ICVA 4FZMA 3ZX0A 4HCCA 1VQ8N 4NCAA 2JMGA 5KFLA 9ICCA 3K59A 3DMJA 2L5YA 1CEZA 4PGQA 4EBDA 3GBTA 4QAGA 1QQCA 2PXIA 3V7JA 3PIPL 1GLAG 2JZBB 1MWMA 2LMRA 2HNZA 3M3ZA 4IO8A 4H5TA 3BGRA 3ZEUA 4AHUA 5J0RA 4I2HA 2G8VA 4RU9A 5FPEA 5J0SA 4PHPA 4CF0A 3M8SA 1SL1A 4E3SA 1U9LA 4CBWA 4ICAA 3C28A 2PYLA 3S41A 5D4BA 3U3YA 3R8EA 5CHGA 4R66A 3OJUA 4YOXA 2OZSA 2KG5A 3DM2A 1A5WA 3OYJA 3S3NA 3F9MA 2RF2A 5ALLA 5T14A 4FO6A 1ZQQA 3P39A 3GG4A 3LP3A 5KG0A 4R63A 4HWIA 1B43A 5AK3A 3KD1E 2K8CB 4CK1A 2MSNA 3T5KA 3TANA 1X6JA 4FLUA 2O8CB 4CJFA 4BRIA 2R8GA 5JMVA 4ZH4A 3BS5A 1V9PA 4FWRA 1HLUA 3ALYA 3TARA 4C4RA 4LD0A 1U6ZA 2RDJA 2XY5A 5AQLA 4PHAA 2KQ2A 2KTQA 3RTVA 2E5LK 4Y1CA 1SXEA 5KGWA 3HP9A 5DDMA 2OXOA 4ILHA 1JI7A 4B9NA 3C7NB 2O8EB 3FDSA 4HTUA 2NRHA 2HHQA 5AKZA 1DTTA 1Q8IA 2VWKA 3AA2A 5LY3A 2LM1A 4I9LA 3UKRB 4N41A 1WUDA 4FBTA 3O1WA 4M47A 3DLLL 3PV8A 3PX4A 4NLBA 5TZVA 4DHYA 3UMCA 3AQFA 4CFBA 2FLNA 1B4FA 3G71N 3HJFA 2BQRA 2OPSA 4NLCA 8ICGA 2I9GA 3HX0A 3HM9A 4BUGA 4JKAA 5J2EA 4QS7A 2JWKA 2EAPA 2FBVA 2ZJQL 3VGKA 1B9FA 4CF5A 4U6PA 3O8MA 1L3UA 1BCOA 4Z0UA 8ICUA 2OPQA 1OH7A 2E8AA 4ISFA 1NK0A 1RXVA 2O6KA 1IJJA 1HKGA 1JUDA 5KG3A 4XH1A 4BRMA 1ZQ1C 1ITGA 5KFDA 4WFBL 8ICIA 5AKKA 7ICTA 1J5OA 5M1PA 4KHYA 4Y2RA 1EWQA 4ZTFA 3QUTA 5L1JA 1R59O 4CZFA 1QZ6A 2A42A 2VG5A 3H0MB 3KZXA 4LF8K 4KLTA 3PSPA 3WXLA 1N5YA 3ZLJA 1ILYA 4FWKA 2K8BB 1L6NA 5EOZA 2I7NA 1HMVA 5J2IA 3F2BA 1FEZA 3A8YA 2RRDA 5LMNK 3H08A 3CC2N 4W5NA 1GLJO 4FK2A 5G5GA 2V51B 3G0ZA 1NMDA 4CJ7A 2ZJ8A 4BR0A 2QKBA 1DTQA 3K5NA 4I2FA 3ONNA 4NXZA 5L9XA 3ZETB 4CIEA 3THVA 9ICAA 4E0DA 3DXKB 3VQ6A 1XO0A 3CPWM 2AJQA 3CD6N 4Y2UA 4G9BA 3TADC 3WK9A 3FLCO 4IDKA 3CP8A 2BCQA 3P1GA 3KLFA 4O5CA 1T3VA 3PMLA 1JL2A 7ICNA 3KLHA 2YJEA 4R8UA 1H1VA 3M5RA 2KD1A 3HVRA 4RW4A 4QW8A 2IMWP 3WKAA 3QINA 1ZD4A 1QVGM 2DFLA 4ED6A 1XO1A 3GV8B 4I2BA 2BH1A 3WEEB 4DTUA 2YCHA 4B9LA 2Q2RA 4CJLA 4IOAL 1N5XA 1NJIO 5AM5A 4I28A 1T6DA 2PMZF 4CF8A 5DM6L 5AQKA 1VDVA 4A2AA 4BRQA 4GXJA 5AM1A 1YJNN 2BDPA 2GLEA 4OJ5A 2JEIA 4KB1A 4P4OA 4MO5A 1NJYA 3T5JA 4FYDA 1HYSA 2FPKA 4QNLA 3S3MA 4GVMA 5AK4A 2A41A 3AVNA 4O0IA 2HBLA 5H2FU 5KGXA 5KRSA 1XSNA 5J2HA 5CYMA 2YHYA 2K60A 1KQQA 2HHSA 4DB3A 5A2QO 3R6MA 4M3ZA 4NB4A 4DL7A 3AMZA 3LPUA 3T79A 2A19A 4C0ZA 3QNMA 4I2AA 2E6MA 2GEMA 3CG7A 4BR2A 1TAQA 7ICKA 4O0JA 1QSSA 2BCVA 2AQ0A 3NMUA 3ASMA 2EAMA 2ZF5O 3AGKA 3IRXA 4DTOA 1WSIA 1GLEG 2P6UA 2ZGZA 3K57A 2P9KB 5K4LA 5AQOA 1BWFO 4KHUA 3CQYA 4AQYK 2YX6A 3C6TA 1YF5L 4KHPK 1ZQHA 3UMBA 3OPXA 2HHVA 3SJJA 4FLWA 3B6OA 4EZ9A 2P9UA 1C1CA 4TQRA 2OWOA 2LYHA 2F9WA 4B1WB 3KBBA 2G06A 4RWTA 3NUQA 4RNOA 1DRGA 1HRHA 3L4QA 3DXMA 5CHIA 5FRNA 4QWAA 3FZHA 4P0QA 2W04A 4DFKA 1U48A 4JKDA 4TUPA 4PL8A 1ESVA 2NO5A 4ECRA 3NHGA 4RQ6A 4E7LA 1V4SA 3ZDAA 3M8QA 5SWMA 2E1YA 3AV9A 1RBUA 3C21A 3AVAA 2AXTU 3I28A 4YY3K 3RH4A 1KAXA 1KVCA 4JN4A 4RW6A 1YUWA 3NTUA 2QEXN 9ICSA 5L1MA 3BF3A 4US9A 5BOMA 4M9NA 3PLAA 2E6LA 4K4GA 1YVUA 1T4GA 1A5VA 3VQPA 1CLQA 1ASUA 1U2VB 2VIXA 2X78A 3KHHA 3ZSQA 4DFMA 2ISOA 2W8KA 1D9FA 4FK0A 3QEWA 4DF4A 2GV9A 1X1PA 2YB1A 2YHXA 4O4GA 4B6JA 1KAZA 4EIAA 4CJ3A 4JAXA 4KTZA 5KFOA 2P9IA 3ETLA 3PSTA 1Z4OA 4MF2A 8ICTA 2E8OA 4M45A 2JR5A 8ICCA 4DR1K 3QEVA 7ICEA 5ALTA 4YXJA 1RDBA 3NS1A 2M0NA 3HJEA 2B4JA 1X9WA 3IG8A 3VN5A 2EDUA 1XMOK 4BG9A 3M9MB 1XSPA 3ZSWA 3JPPA 2KNJA 2AA4A 3TAPA 3OHBA 3HK2A 2E8PA 2GUIA 3THWB 1L3SA 4JNEA 4F5NA 3O9SA 5BN8A 2N1RA 3PSIA 1RZTA 5DG8A 1EXQA 2YJFA 4KLEA 4HVJA 8ICVA 2H3QA 2HVHA 1XSLA 5F1XA 5AQZA 3CM5A 4FCYA 2XI9A 4CHNA 4RUCA 5AFUH 4ED7A 4K8ZA 4F4KA 2KJ5A 3TSPA 4UB8U 3WNEA 4J9RA 2EHGA 2QWNA 4WJ3B 5B66U 5JLFA 3QB0A 1VRUA 1E4GT 4JEPA 3AVKA 3K1ZA 3CCLN 4Q44A 1SKRA 2YN4A 4RT2A 3LWMA 4JKBA 3SBTA 4JD2B 1LWEA 4CGDA 1IBMK 4BWJA 4AHTA 5C12A 2AH5A 2FI1A 3JPTA 4FWOA 5EOYA 3VQ4A 4EYIB 4Y2TA 3ZSRA 2ZD1A 2QI2A 2FDRA 5KFQA 5AM3A 1HYVA 4O55A 4MEYA 5AKGA 2PMZC 3QX7A 5J0XA 1Z25A 1VSFA 2IOFA 4H0TB 5I42A 4KHSA 1NK9A 2HOIA 3IRUA 5F9NA 4ED3A 1E4FT 3H1VX 4M7XA 2KE7A 4JV0A 5DB7A 3P38A 4OJOA 5AKJA 4Z4CA 1XC3A 4JK9A 2DQNB 2WF5A 2BGWA 3CJ9A 4DO9A 7ICMA 5F0XA 3EZWA 4CJUA 4RUAA 4O3MA 2NO4A 3LM2A 4CEEA 3V9XA 1SZHA 4YR0A 3HWTA 1CZ9A 4KLOA 4IJAA 1S0VA 1MC8A 2W3SA 4A2BA 2E20A 3CMAN 1BDGA 1RBSA 5KFXA 2ZJAA 3N4QA 4RQ5A 3KIOA 4M3RA 2LBOA 3FFIA 2QTDA 2FBXA 4JK8A 2ZIVA 1KLNA 3UMGA 4N5SA 2RP5A 4BJQA 4E7KA 1N32K 4F4YA 3QU2A 2H3FA 4YP3A 3KHGA 3QEIA 5AI6A 4UAWA 4DL3A 4W5OA 3AVHA 4Q43A 5KFNA 2FBYA 1WN7A 4Z6CA 4HUEA 1O03A 4B3MK 4MFBA 3LWLA 3LK9A 9ICKA 4IR1A 3ZT3A 3QYPA 4GXIA 5DB6A 4H0XB 3VGMA 3QEXA 1SB3C 2HCFA 4FLXA 1S1TA 1PZNA 4GW6A 5BPCA 2Y0SF 4Y2YA 4YMOA 2WC9A 4CEOA 3NFAA 3OSNA 2UVVA 4C4SA 4GV6A 3RH5A 3CC4N 4YOYA 2ZJPL 2ZWHA 3AGRA 4YQWA 4O5BA 3Q8QB 3VTIA 4XH4A 5E79U 3WKBA 2W9BB 3GIIA 5CZ1A 3QU5A 1J2NA 4M63C 4A59A 3TPQA 3NF9A 4E1MA 3KHYA 5ALSA 3V72A 3AQEA 1C0GA 2W9CB 4LFAK 3C95A 3VEXA 5HBMA 3E66A 2OEHA 3QBWA 1N61A 3MWPA 1NGGA 4GFJA 2UXCK 3I76A 3DV9A 1KEJA 5DB8A 4KMUA 3MDAA 2IA6A 9ICOA 3RH6A 2IS3A 3OHRA 3M6ZA 1TUYA 3RMBA 2QXLA 4X62K 5CP2A 1BNOA 1HYZA 3VF6A 5KG6A 5CA7A 2WBNA 2VWBA 3W0LA 4CHZA 3BS7A 5DGAA 3LPTA 3L6QA 2A1JB 3RR7A 1JCFA 1HX1A 1KAYA 2ZM6K 2OA8A 4P0PA 1F21A 2O8FB 1ZYQA 4LSNA 1N6QA 1YAGA 1L3VA 4DSKA 1LAWA 2CH5A 1WG8A 4Q8FA 3M9OB 4IFYA 1WWUA 3PUFA 4DKWA 4CHOA 2XVTA 4PWDA 1VRTA 1WCLA 2ZXHA 1NG9A 3V7KA 5JLHA 4E7JA 2KSOA 1XU4A 3DLEA 2G08A 2Z1JA 3VA0A 2YNHA 1VSDA 1Z1VA 1X9XA 5AQUA 2KZMA 8ICBA 3PO5A 3QESA 2OPPA 4EFHA 2EAOA 1OW5A 2OANA 3H8SA 5AM4A 4FK4A 2BDUA 3D2EB 1BPXA 3L8BA 1BL3A 4MF8A 3TR8A 1RDAA 3PW2A 4FFDA 4RW7A 4J2AA 2HHXA 1BG3A 2E88A 4IRKA 1BIUA 1SS6A 4KI6A 1MDUB 4KV8A 9ICXA 2QXFA 1W7AA 5CEHA 3LDOA 3E9PA 2PY5A 1VSHA 4EYHB 2FE9A 4DLGA 3ULEB 5ALQA 5BPLA 4OD0A 3V81A 4RQ2A 2FF3B 5ALFA 1GLCG 4IQWA 1VQNN 4QZHA 5AQMA 1PVQA 5J2CA 8ICEA 3QBXA 1NOYA 4F5RA 5HHHA 1N8RO 3MR3A 3TADA 1S5JA 1WSGA 2HMIA 5EU7A 1Q18A 1WSEA 5J2QA 3SJHA 4QZFA 4IDHA 1HUZA 3WNHA 1NJWA 3ID6A 4M04A 4F50A 4NLGA 9ICQA 4DF8A 3M8PA 3VESA 3VERA 1SWVA 2W03A 5J2KA 1NGAA 1FIQA 3QUCA 4WYBA 1CXUA 3RB0A 1OUQA 1BPEA 4LF4K 1FO4A 2YNFA 4YG2A 3PMNA 5BPMA 5ADXH 4B3OA 3UIQA 4J9LA 1ZD3A 5KT2A 5CY4A 5KTQA 3DRRA 5J2JA 2RQ5A 1COKA 4PGYA 2WTUA 3D2FA 4Q8EA 4GVEA 4DTPA 1BGXT 2QARB 4DSEA 5E84A 3TACB 1QHTA 2KZ3A 3VENA 2IVOA 2IVPA 3ZCMA 2KMDA 5TKYA 4I2CA 4BWMA 4PA1A 2YKMA 4HUFA 1ZQFA 3ATUA 2P9LA 4CE9A 1T03A 1F44A 1XHZA 4B9QA 2Y0SC 4DR4K 3QU4A 5AKYA 1IBKK 1TK5A 4B1UB 1FKOA 4OJRA 4FL9A 2EQYA 3JS6A 2P9NA 4KTWA 4DTNA 3ENBA 4IJNA 3KK3A 2FSJA 3F5TA 4BRNA 1SXDA 2YMPA 4CE6A 3N7RC 5J0YA 4CEZA 4AM7A 1IKXA 4YFKA 4FLTA 2VA2A 1DGKN 4UARA 4LC9B 3K58A 3C2LA 3T69A 3MFHA 4FZXC 4I27A 2GWSA 3T5LA 3RJJA 1S77D 3O4QA 4AH9A 2KFZA 2RKIA 5AQRA 4E7IA 4GKKK 5J2MA 2O4GA 4Z6FA 2JEFA 2BGGA 3RWUA 1RTHA 3C23A 3JPRA 3TAMA 2QK9A 1SZPA 4BRHA 2AGQA 3RJFA 1SL0A 2MUTA 2W42A 3H1QA 4ID5A 1NOMA 1T94A 5EE3A 4PH5A 4FJGA 4CD1A 3NF8A 3EL2A 1A0PA 3IDHA 5JVGL 1V97A 3OGUA 2UVWA 5J1EA 4BACA 3KK1A 3NH1A 4K0KK 1N36K 1XS9D 2KHVA 4OJLA 1XMQK 3KHLA 2ATQA 1K1SA 2YMMA 4KLGA 1VQMN 3NGDA 5CR4A 3PIOL 3KKAC 4KTQA 4IOCL 1IG9A 2DKXA 3WXIA 4C8NA 1REVA 2MAXA 1QHAA 3AVBA 4IBNA 5C24A 1VSEA 9ICNA 2VCPA 2ZE2A 3HT3A 4X66K 4YORA 3IM1A 3UQ0A 1MSWD 1S8OA 3K4GA 4BY9C 2O8BA 4FZZA 1OKJA 1JRPA 1QQOA 3UKUB 4JKGB 1S1UA 4MFFA 3UB5A 2Q3SA 1PK3A 3F5AA 8ICMA 4JKFA 3VQ5A 2XY8A 1UOCA 4M3WA 4RPZA 2A5XA 3P4IA 1ZC6A 1MA7A 4CZHA 5C10A 5C25A 2ALZA 5GAHP 4FW1A 1S0OA 1VSLA 3OYCA 1X9MA 5TISU 5KFSA 5J2BA 3FZMA 1YZ7A 4YDUC 2ESEA 5AK5A 2F8SA 8ICXA 3OBYA 2ASLA 1S9FA 4BRAA 2J6SA 4BR5A 3ISBA 5FRMA 2OCEA 3CYMA 4B1YB 3M7DA 1UWBA 1RILA 5AQVA 4I6MA 3QMLA 2E3TA 3THXB 2ZUDA 4NLNA 4DL5A 3LP1A 3VQ7A 4RNMA 1XWLA 3N7SC 1MU2A 4JYAK 2E8NA 2MA1A 3NRWA 4U67L 2O4IA 5J0UA 1SUQA 1FFUA 1TV6A 5BREA 1N2XA 1WBBA 3HSCA 1C20A 2QB0A 3VQCA 1SWWA 3VEYA 5I3UA 4JV1A 2FBTA 4FZNA 2OYQA 2E2PA 4BRGA 2DFFA 3EKSA 1RDUA 3J80O 2BKEA 5AZIB 5A0LA 4JUZA 4C1NK 3AO3A 4DS4A 1ZRNA 1WBDA 2PFPA 1ZQMA 3P5JA 1SV5A 5DLFA 2QM1A 3I0RA 3V1RA 4UQGA 2F1IA 3UPQA 5AQSA 3AU6A 4FWPA 2IOFK 4FWSA 1WYGA 3TU5A 4PUOA 3ZDDA 4DQQA 4R64A 2JH1A 4ED2A 1DK2A 1TL3A 2UXBK 4CD3A 3IN5A 4F91B 4ILGB 4IFVA 5AIAA 1W9HA 1Z4NA 2GH1A 2FLOA 7ICQA 3KOOA 4BC2A 3PW4A 4IG3A 3ZSZA 4CZIA 1TKXA 2YKNA 4E1NA 4EP5A 1TVRA 3CCUN 3LP0A 4AF1A 1ZQKA 4ED1A 2XY7A 4JWMA 4B8CA 2F1JA 4AILC 4F5PA 1JKHA 3RMCA 1SKSA 3C29A 3M1YA 3D2QA 3AAQA 2H3IA 3A2FA 3HI0A 4FOEA 3BQ2A 2KV2A 3KLGA 1BQMA 1NNLA 4B9UA 4KKOA 5KFHA 3RFAA 4KLJA 1DLOA 3RSEA 1U45A 2P9PA 1S6PA 4O3RA 2D4WA 3I55N 1UAXA 1BI4B 1K8AO 4CBXA 1RTIA 2P9SB 1ZQUA 2EZYA 3A5MC 1LKYB 5ALNA 1UT8A 8ICSA 1MA9B 5HROA 4DFPA 1J5EK 2ZJRL 1I94K 1LVHA 4P2HA 5AZJB 3QFUA 4UAUA 4CJSA 2BPFA 1TVAA 3SI6A 3MXMA 2RDIA 1XC9A 3ID8A 1YJWN 2CGJA 1KBUA 4YFUA 3SNNA 3BF1A 2HHTA 1HNVA 5KFAA 2YV0X 3RMAA 2QWOA 3QLHA 3CCMN 4AYBF 4RNNA 4EP4A 2KHQA 4O3QA 1NLVA 4Z4GA 4O9MA 1KN5A 4CZKA 9ICMA 1X9SA 1KLMA 1QLNA 3CRXA 2A3ZA 5J8YC 4FE3A 1OVYA 2VANA 4I2PA 4KH4A 4M2YA 2YI1A 3PW7A 4ZHRA 1X42A 4X5VA 4I2DA 5AI4A 5DK5A 1HNIA 4LJXA 4J9OA 3VETA 1BIZA 1X40A 5KAIU 1C7YA 5J2AA 5KFPA 5AKLA 2K4IA 4NXMK 3ZT2A 2HHHK 3F9KA 1C0FA 3CNHA 5ALMA 2BCSA 4QZGA 4C23A 1ZJMA 4FJ9A 5KAFU 3C6AA 3DLHA 1T3QA 4QS8A 2E5SA 3CFOA 3AY9A 1WCNA 2NV3A 5DG7A 2PZSA 1SV4A 1ZQTA 4KLHA 2KJ8A 9ICEA 4LH5A 4YN4A 1VQON 4CJEA 1BPBA 5FPNA 3PX0A 3OVNA 3J7ZO 2PYJA 3JPNA 1GOAA 4PPXA 5CE3A 4DR3K 3M1FA 2ASPA 2RN2A 4MHVA 2XGPA 4H5WA 2XCAA 4IQUA 4B9SA 2YHWA 5KFIA 1J6ZA 1U04A 2BQUA 3C5GA 5MLCQ 3CCVN 4ZTJA 3THYA 1UT5A 3OSPA 3SAHA 8ICLA 4CERA 2QKQA 2NUBA 5AQPA 3O1BA 4EEYA 4N56A 3K0SA 2QB1A 2ZIXA 4QIWF 1A5XA 2HBKA 2D0OA 4RQ0A 1VSKA 3WK6A 2VJ5A 1LB2B 4B9TA 3D6RA 2EZXA 2E1EA 2ZIUA 1NZBA 3KTQA 1ZQJA 2Q4TA 3LANA 1JN3A 1ZQZA 4CF4A 3LAMA 2NRWA 3ISDA 3VEZA 3FM9A 5DQIA 3NVVA 3EYZA 2VA3A 1BUPA 2B0CA 4MLHA 5C42A 1RT1A 2AHOB 3TAQA 2PFNA 3CFRA 4FM1A 4CW7B 1ZBIA 4B3TK 1HUOA 3H3NO 3HM8A 1B9DA 3KWIA 2FLLA 3L3FX 4TUSA 1L8OA 1BNPA 4H0VB 5HRSA 4KLIA 2KK0A 1NGDA 4BREA 4BC3A 5DBCA 3LZJA 7ICSA 3AEVA 3LDSA 1K9MO 1GLBG 1RDFA 3ZD9A 1HKBA 4K4HA 4NLZA 2JHDA 1EP4A 1IG6A 1NKCA 1A6SA 3O3GA 3CERA 4IXCA 2EANA 4KPYA 5L1KA 1N33K 3DEEA 3C5FA 4C7ZA 1JLQA 3L3VA 3Q8LA 1DKGD 3RBEA 3C6HA 2UUAK 4OPHA 3N4MB 1RT7A 1D9DA 3WQUA 4DTSA 9ICRA 4H4OA 3VTHA 4QZCA 3ZDEA 3MCPA 1K73O 3V6DA 1ZQRA 2QLTA 3VEWA 4DU3A 5D3GA 3DLGA 1TYQA 3QICA 3U9ZA 3SQ1A 2KFNA 3I1YA 3L2UA 2IOCA 5GTHU 1JLEA 4OGEA 2BTFA 5GADP 1HNZK 3EEQA 1YTUA 5AHXA 4C7YA 3HRDD 9ICJA 5AQNA 5EWEA 4HTLA 3WKEA 2KEYA 4P4MA 2LHTA 2P66A 2CGKA 2FC0A 5HL7L 5BR8K 3OY9A 5KPZA 4DV2K 1S1XA 2UU9K 1HIWA 2QWLA 5JUMA 1J9AA 5ALRA 1MQ3A 2X74A 1RBTA 3CXCM 1IKVA 3GDQA 3SZ2A 1S22A 2LSNA 1UA0A 2FPMA 1PK1A 3EPIA 4QZ8A 4H03B 5KPTA 3AN1A 1KSPA 2A1AA 2QWQA 2P1JA 1VQ6N 9ICPA 4EHUA 4ELUA 7ICFA 5KT5A 3J7YP 2O8DA 3N7PD 1ZXOA 4AYBC 4G1QA 1TGOA 4M6WB 2DL0A 2G07A 1OVQA 3UQ2A 4I7FA 3CJBA 3ISNC 4O5FA 5DKWA 4MLEA 4KLUA 4CHQA 4YVZA 4AHVA 1YJ9N 3F53A 2VQEK 4JS5A 2MRLA 2D0BA 2ZIWA 4J9QA 1IV8A 1GLLO 2G8HA 2WB1F 3FR0A 1Z3EB 3AVFA 4ZOHC 1QCKA 5HNKA 3HKZF 3SK3A 4CF9A 1YZ6A 4DEZA 4DV1K 4XUSA 2G8WA 4JRQA 2GTDA 4F93B 4ECQA 1W97L 4DTXA 1JLFA 1IKYA 4J03A 2W3RA 4XA5A 5KT7A 1QS4A 5M1KA 1WLJA 1X66A 1HNXK 2ZTDA 1Y64A 3O0FA 2D3DA 1NMNA 2NRXA 3TTDA 4KITB 1XQSC 3VEOA 4ACOA 3T7ZA 3L2QA 2XCPA 2W11A 1GLFO 4RQ3A 3D2NA 3WXMB 3KKAA 8ICKA 3EE9A 1KVAA 5H1SQ 2DTUA 2I1QA 5M1QA 3UXNA 3PR4A 4NV0A 1BPYA 5ALIA 1K1QA 1MN8A 2B21A 3ZSXA 4PL2A 9ICTA 2G0AA 3OYGA 4B08A 5JRTA 1RT3A 3LALA 3QFPA 5KG5A 3IG5A 4QIWC 1TKDA 5B5EU 4CZLA 3OYMA 1ZQLA 4PHTX 9ICUA 4OLAA 1RTDA 4BGDA 3NASA 3RRHA 4ELVA 5ALDA 3RJGA 1ZBLA 4JI3K 4JHDA 3QNOA 5FPDA 5HMMA 1IXRA 1TAUA 1KCFA 4E19A 3SR6A 2A1SA 2CXYA 3ZEUB 1XHXA 1DOQA 5KL1B 3Q8KA 4YDUA 3MGIA 4TSXA 2G8FA 2FPLA 3PVXA 2IHMA 1TL1A 4OKKA 5HR6A 2W54A 2A3VA 5F9LA 4F5QA 2IBKA 1TKZA 4LH4A 5C15A 1EWRA 3H4DA 1JX4A 1X9JA 4M3XA 4AP9A 3QUBA 1L7PA 2HF4A 1TK8A 1S1VA 5B8HA 2KP7A 4M7YA 2P5OA 1WAFA 2W8LA 1V4TA 1H38A 4B3SK 4BRCA 2YB4A 4GV3A 3L4IA 2I5HA 1BQNA 2KHOA 3O4WA 5GAGP 4J9SA 3AVCA 3ZYYX 3GFKB 4QZIA 5KG2A 3GE1A 5D49A 1N62A 5J0OA 5M1NA 3LDNA 3BS5B 1SV0C 3SV4A 4BXOA 3BP8A 1WB9A 4NM1A 5SZTA 1D5AA 4CEFA 3L0QA 4CVNE 4Z4EA 3BQ7A 2PI4A 4FWLA 4YXMA 1MQ2A 1EX4A 4E7HA 1WSJA 1Q82O 4CK3A 4V19S 3NVKA 3VF2A 2KKPA 4MQ3A 2MU2A 1JCEA 2QWPA 4DV0K 2PAVA 1VSIA 3D45A 2WFBA 3K5MA 4K25A 5GINA 3SLCA 1NK4A 5HMLA 4GV9A 3ZDBA 1RXWA 2WUSA 3ENOA 2NRTA 2HI0A 1NJZA 4CEQA 1BPDA 3BJYA 4KLLA 4O3SA 4BVPA 4FXDA 3BQTA 3SQ0A 4GLXA 4FJIA 2NNWA 1HUXA 4FZLA 1RT6A 7ICOA 4IS7A 4ECSA 1GLDG 3NBPA 3F5EA 4FJNA 2AQ4A 2UUBK 4UY8O 4OLBA 3TQ1A 2IAJA 5ALKA 1VQPN 3E9LA 4DR2K 4BRKA 3WQTA 1T05A 4FJJA 3M9NB 3SAGA 1P7DA 3M6GA 3V6JA 1SQKA 1RQLA 3V7LA 2FLPA 3H45C 3SENA 4F92B 1QQ5A 4BQLA 1Z6RA 1RQNA 1D8BA 1S9GA 3AVGA 5HRRA 4JS4A 2JH7A 2OPRA 1T3NA 1S1WA 2F96A 3ISCA 1VHXA 4C8MA 3NGIA 3CMEN 3RR8A 1BA0A 1FFVA 4FWQA 5K14A 4BGBA 5KFWA 2WB1C 5CR0A 1KFTA 3NE6A 4JV5K 1ZQIA 2DKZA 3HKZC 2Y1JA 2XY6A 3WNGA 4RW9A 3DYAA 1K8KA 5KFEA 2AGPA 2P35A 4C8LA 4CZEA 1AQ6A 4ICLA 4M3TA 1TK0A 3RJIA 5KQ8A 2IVNA 3WXJA 4DSJA 4O8UA 4BR7A 3K1RB 3D2SA 3C6UA 4UB3A 4DOAA 3HYFA 3KK7A 2NRVA 1ASVA 3AVJA 3T19A 3HXMA 5J8YA 4GC6A 5EVZA 2Y9TA 3IKMA 1IH7A 3L5KA 2Z1IA 4LF7K 1FXXA 3TAGA 3Q8SB 4FW2A 4FJ7A 4K43A 4FVUA 5I9EB 8ICPA 3OW2M 1JL1A 5BR9A 4R8UB 4I9QA 2E8MA 3LYSA 4ECXA 3MK6A 4PKGA 3WK7A 2LYAA 1GOBA 2OTJN 4DV5K 3U8XA 1S5LU 3FZLA 4LSLA 4CJTA 3AM9A 1VK0A 3VMFB 4H5NA 2KN7A 4NLKA 2HHWA 4PKIA 1DGJA 5KFJA 3J81j 2I5JA 4KFBA 3QEAZ 2HSZA 8ICWA 2ZGYA 4OPAA 4DUZK 3H46O 1NKBA 4KN4A 3MR5A 3IFRA 3CCJN 2JZBA 2QKKA 3RVCA 4FO0A 4RQ4A 3R9KA 2DWQA 4EBCA 1GOCA 3SYZA 2JLEA 3CF5L 1BA1A 2LI6A 4WQ5C 2FXUA 4HHTA 1BI4A 2UVRA 2BZFA 3ZT0A 3UXPA 2F44A 4AHSA 3BY5A 4A57A 4DFDA 5DQHA 4DQIA 3CHWA 1ZQWA 3NF7A 3MDQA 3V9SA 4YOTA 1ATNA 2GWKA 3EZ5A 1NK6A 1JJ2M 3GIKA 1OH6A 3J7AP 4DQ8A 2JEJA 4QCLA 1VAZA 3SD7A 5EY4A 3T1HK 3AVMA 4GMJB 1IM4A 4H0PA 5IT9O 2HNYA 2O8CA 2KIVA 4CBUA 3VF4A 3IHQB 2FF6A 1VQ7N 1QQMA 1KL9A 4KLMA 1NWKA 2HMXA 1ZETA 2OH2A 2P9UB 3BEXA 3KD5E 4M3UA 3C7NA 2O8EA 4A5BA 1S10A 5IWAK 4NXNK 4IC9A 3DXMB 1JXLA 2GO7A 4P0QB 2IGIA 4IWVA 4NYFA 2F8LA 3WK4A 3EWAA 5AQHA 3UKRA 3SQ4A 4Z94A 2KVSA 3DLRA 9ICWA 1YVNA 4J9PA 1O1WA 3NVWA 2Z7JA 2V7ZA 3G25A 3G6YA 3WNFA 1N34K 3D6JA 4CK2A 5C0YA 2J4RA 1DEJA 4PZOA 2HOEA 4FWMA 4K42A 3MGVA 1QTMA 5KT6A 3O6WA 4DU1A 4KMOB 2GUPA 4AHCA 3O5BA 2WHEA 4KX5A 4QZ9A 1QQ7A 5KFCA 4F4ZA 3I0SA 4CZMA 4KI4A 4ELTA 2LPEA 4E89A 4DL2A 1C0TA 2VYPA 1Q81O 4BRPA 3WU2U 4CF3A 4X65K 5KFUA 3JAMO 4JI8K 4US8A 4EELA 1KD1O 2UUCK 5EWGA 2P9IB 4FOIA 5ALHA 4JI7K 1TAMA 4K8XA 2VGNA 2WOMA 3QERA 3I8BA 4JRPA 4XQ8A 2YX8A 1SAZA 3CC7N 1NOZA 2XC9A 1Z05A 3WT0A 4UBCA 4E1JA 3SAFA 3WK8A 4FS1A 4B1VA 4BE1A 3TI0A 4XRHA 1ZBSA 4FSVA 4YOWA 3S6JA 4J9NA 2QWRA 3NGYA 3O80A 5GIPA 4F8RA 3VPZA 2F2AB 4PJ0U 3GDXA 2FSKA 4O8KA 3ZETA 1EQYA 2YQEA 5ELZA 3NGZA 3DXKA 4DTMA 1J2MA 3OYIA 4R5PA 1BHLA 2VQFK 1QVFM 2IDOA 3FZKA 1FW6A 4M41A 5AM0A 3H0RB 4YR3A 4IOXA 3RAXA 4I2EA 1RPLA 4UBBA 3HILA 5HR7A 4DSFA 1C1BA 1GO3F 3PY8A 3LP2A 5ALVA 3L4PA 3WKDA 1CI4A 2DFHA 3LVVA 3WEEA 1HJOA 4DUYK 5JICA 4C4TA 1UCVA 3OYLA 3SQIA 1ZXIA 2CN1A 4JI6K 3SMVA 2EX3A 4BRLA 4JI5K 5KFKA 5AQXA 5KG4A 1LWFA 5GTIU 4WQ4C 3L2WA 2RHFA 2C2DA 4KLDA 3LAKA 4BC5A 3JXUA 1N60A 1JLBA 2BPGA 1FK9A 1JXBA 4ISEA 3QU9A 2XGQA 4JI2K 5HHIA 2FMPA 5KNIA 2WTFA 3MN5A 4OKEA 1WSHA 4DV3K 3TFRA 1VLBA 2G5IB 1VQLN 1EKEA 3Q8RB 4HYKA 2QWMA 5J0QA 8ICNA 4ISGA 3I33A 4MDAA 3K9KA 3CPEA 3HP6A 3PX6A 2Y9UA 4UASA 3NVYA 5BOLA 3ZX3A 3ZI4A 9ICGA 1W0HA 2Q31A 3MXJA 4C1NI 3L2VA 2P9KA 4EBEA 4FBUA 2QA4N 1VQ9N 4MFAA 3OBWA 2ZIVB 1SL2A 2HOQA 4GKJK 1NZPA 3F2KA 3C1ZA 1K5OA 3F2CA 3HL8A 4H8KA 4QZAA 2E2QA 3GZFA 5AR0A 2OM6A 1KDHA 2R18A 1NGJA 1L7OA 2E4LA 4WE1A 3CI5A 1G99A 5ALUA 3OTOK 5JS1A 1V85A 2JGAA 1BO5O 2C28A 4CIGA 3ZX2A 1JIHA 5DDYA 3C1YA 4QZDA 2P6RA 3SQ2A 2RHKA 1L7NA 1ASWA 5FDLA 4AM6A 3NRZA 4Z4FA 2HMPA 2JWLA 4JMUA 1SIJA 4F2RA 1JLAA 1VSJA 4RT3A 4KBOA 4FJMA 1SKWA 4YOVA 3OYFA 2F1HA 3NAEA 4K4IA 4J2DA 3AO1A 5M1OA 5KT3A 1WSFA 3R9PA 3C2MA 1CRXA 3CETA 4Q0BA 1YHQN 1Z00B 1MWKA 2M9NA 5IINA 1U2VA 3I56N 3ULDA 4IKFA 3SMSA 4A5AA 4RQNA 5CJ7A 1Y97A 3W3DA 1JXEA 1SV0A 3G10A 5ALJA 1URJA 2V4QA 3A0BU 4N76A 2ZJ5A 2J6TA 3NCIA 1RFQA 3MAQA 4F4XA 1S76D 3AA5X 4YHHK 1ATRA 3V6HA 3KZIU 5GIOA 3PR5B 1P90A 4QJFB 3DRSA 5AICA 1Q8KA 4YD2A 3AA4A 5J2GA 4DFJA 3O4NA 3H3OB 4BGAA 4GC7A 5KL8B 4U7BA 4CFCA 4Y2XA 4ILJA 5EWFA 4A8EA 4P0PB 4WCEL 4M3YA 5ALWA 1JALA 3LM9A 3LL3A 4CJVA 2XIDA 5KFMA 2IC3A 3MBYA 2JGUA 3CJAA 2KKVA 1S0NA 4IRCA 2PFUA 4OPJA 4U7CA 4CHYA 4DU4A 3SPYA 1I39A 3PW0A 4EEKA 3B8AX 3CQXA 4L8RB 3R1XA 1NJXA 3THWA 4DV4K 1M90O 4FJKA 1TE2A 1PUZA 3BZKA 5IIMA 8ICRA 3AU2A 2KSOB 4F72A 3VGLA 5KFGA 4JV2A 1QQ6A 1ZRMA 2FMQA 3V1OA 4MEXA 4BRDA 5KPRA 5ALYA 3MDCA 5E26A 4EAHD 2V52B 1BVSA 5IIOA 4Y2JA 4CECA 1S72N 4CCHA 4RCHA 3SEIA 3GIMA 3OYAA 3LVWA 3JYTA 5IIJA 5DB9A 3CCSN 3H7IA 1QH9A 5J0WA 3MX2A 4W5QA 2EZZA 2ES6A 1ZQSA 4CGZA 4QWBA 2A40A 2AP1A 3AO5A 4PKHA 3V1QA 4OGCA 4ECZA 2BR0A 3ENHA 3IP4B 4XH5A 4DTRA 2YNGA 4JD2A 4ECVA 2C22A 3JPSA 2EWSA 5ALGA 5AI8A 3K9JA 4KLQA 1AROP 3KVGA 2VG6A 1YXQA 4Y2PA 5BPNA 4O44A 4OJ6A 2CH6A 4CEAA 5ALOA 1XNQK 2WF6A 4BQZA 1T8EA 3MC1A 3KLEA 4LF6K 1VQ4N 2OHFA 1M6YA 3IG1A 5FLXO 5EXWA 3S3OA 1ZQCA 2KW4A 4ED0A 5IILA 2CGLA 4CDGA 5BRFA 2XHBA 3KKSA 4KH6A 3SCXA 4UB6U 2X6SA 4FM0A 3VC8A 8ICOA 3WXKA 3BQ1A 4JKHA 3V9ZA 4FJ5A 1E3MA 1X2IA 1O08A 5KI6A 2ITGA 4BROA 3AARA 4RQMA 1XI1A 2HNDA 7ICGA 2HDOA 2NZTA 4H4MA 5ALZA 4JLHA 3IDWA 2G5HB 3WK5A 3DDHA 5IIIA 4RQ8A 1Z26A 1S0MA 3D2FB 5KFTA 3MFIA 1J53A 3OJSA 4XIUA 3RBDA 3GOIA 3KJVA 2Q0RA 4FS2A 3M6KA 5AI9A 2K4PA 3TAEA 2H3GX 3B9JA 3QNNA 4FLYA 4FVMA 4WQ5A 3RB4A 3VQBA 5HLFA 4Z6EA 3OYEA 2P9LB 3CJ1A 4O5EA 4B1XB 1J97A 2W9BA 4IRDA 1ZQVA 8ICAA 2WF7A 4CHPA 2P9NB 2HSTA 2R8IA 1L3TA 1WNSA 1JROA 2PBDA 2JV3A 4M9LA 2W9CA 1N48A 3QEBZ 1ZQOA 2ASDA 5AQWA 4PL7A 4CJPA 3O9UA 1N63A 3GV5B 2K8AA 1NI3A 5KFYA 1BU6O 4CGGA 3LDLA 4BR9A 2F77X 3MABA 1NGFA 2VG7A 3VA3A 4TQSA 1NGCA 2ETJA 2I6XA 3OA9A 4DSIA 3MGHA 1ZQAA 4W5RA 3H40A 5D46A 3A0HU 1F0MA 5KFFA 1ZQDA 4LZDA 8ICZA 5AQGA 4DCHA 1NGIA 3NF6A 5C2DA 1VQKN 2V7YA 5AKHA 5FP0A 4NO7A 4IG0A 3J81O 3M8RA 4BDYA 4J2BA 3Q7CA 3QXGA 5EE1A 2A1JA 3QZ7A 2MUTB 1NGEA 1QZ5A 2Q97A 3FGUA 3HSTB 5AI0A 2FJ6A 2E1FA 4O3OA 5AIBA 4DR6K 3O08A 3V4IA 2ASJA 2O8FA 1HJPA 3EKUA 3FE1A 4R79A 4A61A 2BANA 1Q46A 1C1AA 3O3FA 4B3RK 3FFKB 4UAVA 2OZMA 3QZ8A 3QE9Y 2UVUA 4BX9C 1A77A 5KFBA 2FMSA 1LW2A 5LJWA 2OTLN 2WFAA 4MFCA 1WWVA 2BQ3A 1BISA 2GWJA 3MECA 5J2NA 4UB1A 4DL6A 4CF2A 1IBLK 1QQNA 4HCBA 4I2IA 4KHNA 4JK1A 3TFSA 3D2EA 7ICJA 4FPBA 4BRFA 2O8BB 2WF9A 5ALXA 3N4PA 4H0YB 3SBGA 3N28A 3JPQA 1D8YA 3OYBA 5ALPA 1P8ZA 1YT3A 3RF9A 3UXOA 2JRZA 3GQCA 2F8TA 4KREA 4FM2A 2BUPA 3F73A 3V6KA 1KFSA 4OCZA 2BHNA 4BDZA 4CJRA 3ULEA 3K5LA 3MN9A 1ZBHA 3B0XA 2BPCA 7ICIA 4IFEA 3TSQA 2HF3A 2H3VA 4FLVA 4H0OA 2D0AA 2AU0A 4GIBA 4NCGA 4QWEA 4NCBA 3C65A 3NDKA 1KTQA 3EN9A 3IUCA 1RYRA 5IIKA 3FAHA 4I6MB 2PI5A 4DL4A 5AQTA 4PQUA 3A0IX 1D4XA 2D0PA 4MDBA 3ZT1A 3VQAA 7ICVA 2DUYA 2Y1IA 3MX5A 1CZBA 2B6GA 4CRXA 3P31A 4IEEA 2PFOA 2QB0B 5J2PA 3FYHA 4PHDA 4EZ6A 1SZ2A 3VQ9A 1RDCA 4DTJA 3U6FA 2VA8A 4IZ9A 2YTUA 3A5OC 1DK3A 3CJ7A 2D5RA 3ZSYA 3GILA 4J9KA 1Z1BA 5DGBA 1RBRA 2AGOA 2D0CA 1TFRA 5L1IA 5AKEA 3AAPA 3D7EO 4WQ4A 5M1FA 1W2BM 2P5GA 4DR7K 1RT2A 2IIRA 3DI6A 4CGFA 2DPNA 4F2SA 4CJQA 1YIJN 2BE2A 1A76A 5CYQA 4I2GA 1B22A 2QARA 3TWHA 5AM2A 3CW2C 1DXSA 2IHNA 4LFCK 5DMRA 2ISPA 2ZUBA 4H5VA 3PZPA 1XNRK 2KZZA 2X6NA 2F9TA 4CZJA 4EHTA 5GAEP 2R8HA 4FJXA 1ECWA 3CQ8A 1NK5A 4M9GA 3OYDA 2K4HA 4I2QA 4BE2A 3C0BA 2KICA 2ZXIA 2VGMA 4LVSA 3GV7B 4JK7A 1HJRA 5KRTA 4LFBK 4DCCA 1V38A 4I29A 1K6YA 2DGZA 4OVLA 5CB1A 1ZD5A 1PVPA 2G8IA 3BZCA 1XUPO 3B6PA 4OKJA 3ZT4A 2R7YA 4FZYA 2F8KA 3MEDA 1HEKA 4Z6DA 2KIWA 3G6XA 2P9PB 3RSEB 4FWNA 1X3MA 3SUNA 3MXIA 1ZOLA 9ICIA 2KJ9A 4NL9C 1NK7A 5DLGA 3QETA 3E58A 5KFVA 3KFUF 2Z1HA 1IIPA 4NM2A 2ZQBA 3H0LB 1BPZA 2E2OA 3KHRA 3RB3A 2ITMA 4YMNA 1ED1A 1WOQA 4YMMA 5F3XB 4F4WA 2W6KA 3U3GA 4KB0A 2UXDK 2NYVA 4R65A 3H8MA 3T1YK 2HB5A 4A62A 4RTFD 4IL6U 2FSNA 2HOFA 1U49A 3TTFA 3MR2A 5JS2A 1C0UA 3OS1A 3DAWA 4YCXA 1TKTA 5AQYA 4CJKA 2GBZA 2W9AA 2ZUCA 3PNCA 4BG8A 1HQUA 4DS5A 2OYYA 4J2EA 1NGBA 3E1YA 4OJPA 1DGSA 4QWDA 3P83D 3OYNA 1ZQPA 3IAYA 3EO3A 1LV5A 3QU7A 3KKRA 3U9DA 2A6AA 1ZQGA 1KC8O 1RGIA 1B92A 1L7MA 2EH9A 4J8FA 2WAQF 2G09A 2Q1NA 3ATVA 2W40A 4GXKA 2CRXA 3HVTA 2H5XA 2ZG6A 2UYTA 2ASOA 3MMVA 4IEIA 4JKGA 5ALEA 3MCAB 3UKUA 5AQJA 1ATSA 5JU5A 3SUQA 1EETA 1N5WA 8ICYA 2YY6A 1IO2A 3HPHA
chains in the Genus database with same CATH topology
1KRPA 5BRHA 1ZJNA 5AQIA 4M0AA 5AFUA 4IQVA 2F7TA 2R8JA 5FPMA 3T5HA 2HW3A 3FZFA 4FPAA 2XO7A 3LDQA 3O9TA 2HBMA 3DWLA 7ICHA 3EE8A 3KZBA 1Q7YO 2ASMA 3J8AA 4JKCA 3Q7BA 4CZGA 3RJHA 1ZQBA 3HBTA 3BUZB 3HRGA 4ECWA 1KXPA 5AZIA 2C2RA 5BRDA 5AQQA 3BQ0A 2E2NA 1CZAN 5EX5A 4DSLA 4IR9A 1T7PA 4YOUA 3EPGA 4G3IA 4RPXA 1Z00A 2V9WA 3Q8PB 3CIPA 5KT4A 3RAQA 4BR4A 4ECTA 4DQSA 3A5LC 1CUKA 5KG1A 5DBAA 2DPJA 4WFAL 1QSLA 2C2EA 1ZQNA 5J0PA 5AQFA 2NRZA 4KH5A 1S3XA 4Y0WA 4J9MA 3R3LA 3RJKA 2I7PA 4TURA 2W41A 2HBJA 3QDKA 4MO4A 3UE5A 3NVMA 4LZGA 2P9SA 4M9JA 1TYQB 1LCUA 9ICHA 5KFRA 1Q86O 5KFZA 1YI2N 2BCRA 4C8OA 7ICLA 5AZJA 5F2RA 1DT9A 1L5UA 5J29A 3OHAA 4PHEA 3N97B 3HPOA 2R8KA 3O9QA 1S97A 4TUQA 1JMSA 4YR2A 4QWCA 3Q8MA 1COOA 2RE2A 4UB4A 3E2EA 4O5KA 7ICPA 1T6CA 4JWNA 5DG9A 4K41A 4F3OA 3H4BA 4UAYA 4ECYA 2JEGA 3MR6A 9ICFA 5C2FA 2ZTEA 4I2JA 4KLFA 8ICFA 1EO1A 4OO1J 1WUAA 3LDAA 5CWRA 3CCRN 4BDPA 3BDPA 1M1KO 4BVOA 2J6UA 3KWGA 3IMXA 3C2KA 4G9ZA 4XEIA 3CJCA 1RDWX 3HW8A 1NGHA 4B9MA 4BC4A 1X3NA 4H5RA 3PW5A 1NBWA 3HOSA 3MWTA 3ZDCA 3JPOA 5JVHL 1U47A 1IG8A 2D1KA 4L3QA 4QW9A 1EXNA 4IQTA 2HVIA 1VQ5N 5HP4A 1N56A 4KLSA 3G4SN 1Y88A 4C8KA 4YD1A 3DJCA 4KN7A 2KKZA 1ZQXA 5DBBA 1D8LA 4JHDB 4F9OA 3ZD8A 3CCQN 1HKCA 4DOCA 4GY2B 4DLEA 5LJVA 3G6EN 3RJEA 4GNIA 4DQRA 5C5JA 4DOBA 1HPMA 1TV9A 1UA1A 1O13A 3U4LA 5ADXA 3A5NC 1NKEA 3TSUA 4WF9L 2E1ZA 3T3FA 1ZQYA 4ECUA 4ED8A 8ICJA 1YITN 3PO4A 4QZBA 1NK8A 4IO9L 3SMPA 3H8WA 2PFQA 4DQPA 4BXOB 3VOVA 1KFDA 9ICBA 3O9RA 2ZTCA 3G6VA 5DQGA 2W9MA 9ICLA 3RRGA 2KLAA 1RYSA 5KG7A 1JCGA 4F5OA 2V4RA 3TTCA 4O3PA 4CI6A 4Q45A 3HTVA 5HOOA 4DWIA 4NY8A 3E9OA 3WUHA 2ATLA 3ORYA 4M9HA 2Q0UA 3H6EA 3AUOA 5J2FA 3MN7A 4WFNL 4RPYA 4M6WA 8ICHA 1LOTB 3SV3A 2Q36A 5DM7L 3EW9A 5J2DA 3HZ6A 1U4BA 1QSYA 5TKWA 1KQSM 3O1BA 1NM1A 2HHUA 2DPIA 4B9VA 1BOTO 5BN9A 3GIJA 1T44A 3HOTA 4UB2A 3VEVA 1K8KB 2NRRA 3MN6A 5L1LA 2BCUA 3H8JA 8ICQA 7ICRA 2NLXA 4QS9A 4JKEA 3RB6A 7ICUA 3SI8A 3K75D 5KQDA 4O3NA 2GX9A 4UAZA 1ZQEA 4PGXA 3GL1A 4UB5A 1TUUA 3CCEN 4P4PA 2GELA 4B1ZA 3LDPA 5J0TA 4RQ1A 4RZRA 2Q0ZX 3B0YA 4RQ7A 4QZEA 2QW9A 9ICVA 3ZX0A 1VQ8N 5KFLA 9ICCA 4BC3A 1CEZA 4PGQA 4EBDA 3GBTA 2PXIA 3V7JA 3PIPL 1GLAG 2JZBB 1MWMA 3M3ZA 4IO8A 4H5TA 3ZEUA 5J0RA 4I2HA 4RU9A 5FPEA 5J0SA 4PHPA 3M8SA 1SL1A 1U9LA 4CBWA 3S41A 5D4BA 3R8EA 5CHGA 4R66A 3OJUA 4YOXA 3F9MA 4FO6A 1ZQQA 3P39A 3GG4A 5KG0A 4R63A 4HWIA 1B43A 3T5KA 3TANA 4BRIA 2R8GA 5JMVA 4ZH4A 4FWRA 1V9PA 1HLUA 3TARA 1U6ZA 2RDJA 2XY5A 5AQLA 4PHAA 2KTQA 3RTVA 5DDMA 4ILHA 4B9NA 3C7NB 3FDSA 2NRHA 2HHQA 5LY3A 3UKRB 4FBTA 3O1WA 4M47A 3DLLL 3PV8A 3PX4A 4NLBA 5TZVA 4DHYA 2FLNA 3G71N 2BQRA 8ICGA 4NLCA 2I9GA 3HX0A 4JKAA 5J2EA 4QS7A 2JWKA 2ZJQL 3VGKA 3O8MA 1L3UA 8ICUA 2E8AA 4ISFA 1NK0A 1RXVA 1HKGA 1IJJA 4XH1A 5KG3A 4BRMA 5KFDA 4WFBL 8ICIA 7ICTA 5M1PA 5L1JA 1R59O 4CZFA 1QZ6A 2A42A 4KLTA 3WXLA 1ILYA 4FWKA 5EOZA 2I7NA 5J2IA 3A8YA 3CC2N 1GLJO 2V51B 1NMDA 4CJ7A 2ZJ8A 4BR0A 4I2FA 4NXZA 5L9XA 3ZETB 3THVA 9ICAA 4E0DA 3DXKB 3CPWM 3CD6N 2AJQA 3FLCO 2BCQA 4O5CA 1T3VA 3PMLA 7ICNA 2YJEA 4R8UA 1H1VA 3M5RA 4QW8A 2IMWP 1QVGM 2DFLA 4ED6A 1XO1A 3GV8B 4I2BA 2BH1A 3WEEB 2YCHA 4B9LA 2Q2RA 4IOAL 1NJIO 4I28A 1T6DA 5DM6L 5AQKA 4A2AA 4BRQA 4GXJA 1YJNN 2BDPA 2JEIA 4P4OA 4MO5A 1NJYA 3T5JA 2FPKA 2A41A 4O0IA 2HBLA 1XSNA 5J2HA 2YHYA 2HHSA 4DB3A 3R6MA 4NB4A 4DL7A 4I2AA 2GEMA 4BR2A 1TAQA 7ICKA 1QSSA 2BCVA 2AQ0A 3NMUA 2ZF5O 3AGKA 1GLEG 2P6UA 2ZGZA 2P9KB 5AQOA 1BWFO 3CQYA 2YX6A 1YF5L 1ZQHA 2HHVA 4EZ9A 2P9UA 4TQRA 2OWOA 2LYHA 2F9WA 4B1WB 4RWTA 4RNOA 3L4QA 3DXMA 5CHIA 4QWAA 3FZHA 4DFKA 1U48A 4JKDA 4PL8A 4TUPA 1ESVA 4ECRA 4RQ6A 1V4SA 3ZDAA 2E1YA 3C21A 3RH4A 1KAXA 4JN4A 1YUWA 3NTUA 2QEXN 9ICSA 3BF3A 5BOMA 4M9NA 3PLAA 4K4GA 1T4GA 1U2VB 3KHHA 4DFMA 2ISOA 2W8KA 1D9FA 4DF4A 2YHXA 1KAZA 4EIAA 4JAXA 5KFOA 2P9IA 3ETLA 4MF2A 8ICTA 8ICCA 7ICEA 4YXJA 1X9WA 3M9MB 1XSPA 3JPPA 2AA4A 3TAPA 3OHBA 1L3SA 4JNEA 4F5NA 3O9SA 5BN8A 1RZTA 5DG8A 2YJFA 4KLEA 8ICVA 2HVHA 1XSLA 5F1XA 5AQZA 4RUCA 5AFUH 4ED7A 4F4KA 3TSPA 4J9RA 2QWNA 5JLFA 3QB0A 1E4GT 4JEPA 3CCLN 4Q44A 1SKRA 4RT2A 3LWMA 4JKBA 3SBTA 4JD2B 4BWJA 5C12A 3JPTA 4FWOA 5EOYA 4EYIB 2QI2A 5KFQA 4MEYA 5J0XA 4H0TB 1NK9A 1E4FT 4ED3A 5F9NA 3H1VX 4M7XA 4JV0A 5DB7A 3P38A 1XC3A 4JK9A 2BGWA 3CJ9A 5F0XA 4DO9A 7ICMA 3EZWA 4RUAA 3LM2A 4YR0A 3HWTA 4A2BA 4KLOA 4IJAA 1S0VA 1MC8A 3CMAN 2E20A 1BDGA 5KFXA 2ZJAA 3N4QA 4RQ5A 2QTDA 4JK8A 1KLNA 4F4YA 3KHGA 4YP3A 4UAWA 4DL3A 4Q43A 5KFNA 4Z6CA 3LWLA 3LK9A 9ICKA 4IR1A 4GXIA 5DB6A 4H0XB 3VGMA 1PZNA 5BPCA 4YMOA 2WC9A 3OSNA 2UVVA 4GV6A 3RH5A 3CC4N 4YOYA 2ZWHA 3AGRA 4YQWA 3Q8QB 3VTIA 4XH4A 2W9BB 3GIIA 4M63C 4A59A 3TPQA 3KHYA 3V72A 1C0GA 2W9CB 3VEXA 3E66A 3QBWA 3MWPA 1NGGA 4BG9A 1KEJA 5DB8A 4KMUA 3MDAA 2IA6A 9ICOA 3RH6A 3OHRA 1TUYA 2QXLA 5CP2A 3VF6A 5KG6A 5CA7A 2WBNA 2VWBA 3W0LA 5DGAA 3L6QA 2A1JB 3RR7A 1JCFA 1HX1A 1KAYA 1ZYQA 1YAGA 1L3VA 4DSKA 2CH5A 4Q8FA 3M9OB 4DKWA 1WCLA 3V7KA 5JLHA 1XU4A 5AQUA 2KZMA 8ICBA 3PO5A 4EFHA 2OANA 3H8SA 3D2EB 1BPXA 4MF8A 3PW2A 2HHXA 2E88A 1BG3A 4IRKA 1SS6A 1MDUB 9ICXA 3LDOA 3E9PA 4EYHB 4DLGA 3ULEB 5BPLA 4RQ2A 2FF3B 1GLCG 4IQWA 1VQNN 4QZHA 5AQMA 5J2CA 8ICEA 3QBXA 4F5RA 5HHHA 1N8RO 3MR3A 1Q18A 3SJHA 4QZFA 4IDHA 1HUZA 1NJWA 3ID6A 4M04A 4F50A 4NLGA 9ICQA 4DF8A 3VESA 3VERA 5J2KA 1NGAA 4WYBA 3RB0A 1BPEA 4YG2A 3PMNA 5BPMA 5ADXH 4J9LA 5KT2A 5KTQA 5J2JA 4PGYA 3D2FA 4Q8EA 4GVEA 1BGXT 4DSEA 5E84A 2KZ3A 3VENA 2IVOA 2IVPA 5TKYA 4I2CA 4BWMA 1ZQFA 3ATUA 2P9LA 4B9QA 1TK5A 4B1UB 4FL9A 3JS6A 2P9NA 3ENBA 4IJNA 2FSJA 3F5TA 4BRNA 5J0YA 4AM7A 4YFKA 2VA2A 1DGKN 4LC9B 3C2LA 3T69A 3MFHA 4I27A 2GWSA 3T5LA 3RJJA 1S77D 2KFZA 5AQRA 4Z6FA 2JEFA 3C23A 3JPRA 1SZPA 4BRHA 2AGQA 3RJFA 1SL0A 2MUTA 3H1QA 1NOMA 4PH5A 4CD1A 3EL2A 3IDHA 5JVGL 3OGUA 2UVWA 1XS9D 3KHLA 1K1SA 4KLGA 1VQMN 3NGDA 5CR4A 3PIOL 4KTQA 4IOCL 3WXIA 4C8NA 1QHAA 2MAXA 2VCPA 9ICNA 3HT3A 4YORA 3IM1A 3UQ0A 1MSWD 3K4GA 4BY9C 1OKJA 1QQOA 3UKUB 4JKGB 4MFFA 3UB5A 8ICMA 4JKFA 4RPZA 2A5XA 3P4IA 1ZC6A 4CZHA 5C10A 2ALZA 5GAHP 1S0OA 1X9MA 5KFSA 5J2BA 3FZMA 4YDUC 8ICXA 3OBYA 2ASLA 1S9FA 4BRAA 2J6SA 4BR5A 3ISBA 4B1YB 5AQVA 4I6MA 3QMLA 2ZUDA 4NLNA 4DL5A 4RNMA 1XWLA 4U67L 5J0UA 5BREA 3HSCA 3VEYA 4JV1A 2E2PA 4BRGA 3EKSA 1RDUA 2BKEA 5AZIB 4JUZA 4C1NK 4DS4A 2PFPA 1ZQMA 5DLFA 2QM1A 4UQGA 2F1IA 3UPQA 5AQSA 3AU6A 4FWPA 4FWSA 3TU5A 3ZDDA 4DQQA 4R64A 4ED2A 4CD3A 4F91B 4ILGB 4BC2A 2FLOA 7ICQA 3PW4A 4CZIA 3CCUN 4AF1A 1ZQKA 4ED1A 2XY7A 4JWMA 2F1JA 4F5PA 1SKSA 3AAQA 3HI0A 4FOEA 3BQ2A 4B9UA 5KFHA 2ZJPL 4KLJA 3I55N 3RSEA 1U45A 2P9PA 4O3RA 2D4WA 1K8AO 4CBXA 2P9SB 1ZQUA 3A5MC 1UT8A 8ICSA 1MA9B 4DFPA 2ZJRL 4P2HA 5AZJB 3QFUA 2BPFA 1TVAA 2RDIA 1XC9A 3ID8A 1YJWN 2CGJA 3BF1A 2HHTA 5KFAA 2QWOA 3CCMN 4RNNA 4O3QA 1NLVA 4O9MA 4CZKA 9ICMA 1X9SA 1QLNA 2A3ZA 1OVYA 2VANA 4KH4A 4M2YA 2YI1A 3PW7A 4X5VA 4I2DA 4J9OA 3VETA 1C7YA 5J2AA 5KFPA 1C0FA 2BCSA 4QZGA 4C23A 1ZJMA 3C6AA 4QS8A 3AY9A 1WCNA 5DG7A 4KLHA 1ZQTA 9ICEA 1VQON 4YN4A 1BPBA 5FPNA 3PX0A 3J7ZO 3JPNA 4PPXA 5CE3A 3M1FA 2ASPA 2XGPA 4H5WA 2XCAA 4IQUA 4B9SA 2YHWA 5KFIA 1J6ZA 5MLCQ 2BQUA 3C5GA 3CCVN 1UT5A 3OSPA 3SAHA 8ICLA 5AQPA 4EEYA 2HBKA 2D0OA 4RQ0A 1LB2B 3D6RA 4B9TA 3KTQA 1ZQJA 1JN3A 1ZQZA 2NRWA 3ISDA 3VEZA 5DQIA 3EYZA 1BUPA 2VA3A 4MLHA 2PFNA 3TAQA 1HUOA 3H3NO 3HM8A 3KWIA 2FLLA 4TUSA 4H0VB 4KLIA 1NGDA 4BREA 5DBCA 7ICSA 1K9MO 1GLBG 3ZD9A 1HKBA 4K4HA 4NLZA 1NKCA 3CERA 4IXCA 5L1KA 3C5FA 3Q8LA 1DKGD 3RBEA 3C6HA 4OPHA 3N4MB 1D9DA 3WQUA 9ICRA 3VTHA 4QZCA 3ZDEA 3MCPA 1K73O 1ZQRA 3VEWA 1TYQA 3QICA 3U9ZA 2KFNA 2BTFA 5GADP 9ICJA 5AQNA 5EWEA 4HTLA 5HL7L 2CGKA 4P4MA 2P66A 5KPZA 2QWLA 5JUMA 1MQ3A 3CXCM 3GDQA 3SZ2A 1S22A 1UA0A 2FPMA 3EPIA 4QZ8A 4H03B 5KPTA 1KSPA 2QWQA 1VQ6N 9ICPA 4EHUA 4ELUA 7ICFA 5KT5A 1ZXOA 4M6WB 3UQ2A 3CJBA 4O5FA 5DKWA 4MLEA 4KLUA 4YVZA 1YJ9N 4J9QA 1GLLO 3FR0A 1Z3EB 5HNKA 3SK3A 4DEZA 4XUSA 2GTDA 4F93B 4ECQA 1W97L 4XA5A 5KT7A 5M1KA 2ZTDA 1Y64A 2NRXA 3TTDA 4KITB 1XQSC 3VEOA 3T7ZA 2XCPA 1GLFO 4RQ3A 3WXMB 8ICKA 3EE9A 5H1SQ 2I1QA 5M1QA 3UXNA 3PR4A 1BPYA 1K1QA 2B21A 9ICTA 3QFPA 5KG5A 4CZLA 1TKDA 1ZQLA 4PHTX 9ICUA 4BGDA 3RRHA 4ELVA 3RJGA 4JHDA 5FPDA 5HMMA 1IXRA 1TAUA 3ZEUB 1DOQA 3Q8KA 4YDUA 3MGIA 2FPLA 3PVXA 2IHMA 2IBKA 5F9LA 4F5QA 5C15A 3H4DA 1JX4A 1X9JA 2HF4A 1TK8A 5B8HA 4M7YA 2W8LA 1V4TA 1H38A 4BRCA 4GV3A 3L4IA 5GAGP 2KHOA 3O4WA 4J9SA 3ZYYX 3GFKB 4QZIA 5KG2A 3GE1A 5D49A 5J0OA 5M1NA 3LDNA 3SV4A 4BXOA 3BP8A 4NM1A 3L0QA 2PI4A 4FWLA 4YXMA 1MQ2A 1Q82O 3NVKA 3VF2A 1JCEA 2QWPA 2PAVA 2WFBA 4K25A 5GINA 3SLCA 1NK4A 5HMLA 4GV9A 3ZDBA 1RXWA 2WUSA 3ENOA 2NRTA 1NJZA 1BPDA 3BJYA 4KLLA 4O3SA 4BVPA 3BQTA 4GLXA 2NNWA 1HUXA 7ICOA 4ECSA 1GLDG 2AQ4A 4UY8O 3TQ1A 1VQPN 3E9LA 4BRKA 3WQTA 3M9NB 3SAGA 3M6GA 3V6JA 1SQKA 3V7LA 2FLPA 3H45C 4F92B 4BQLA 1Z6RA 1T3NA 3ISCA 4C8MA 3CMEN 3RR8A 1BA0A 4FWQA 4BGBA 5KFWA 5CR0A 1KFTA 1ZQIA 2Y1JA 2XY6A 1K8KA 5KFEA 2AGPA 4C8LA 4CZEA 1TK0A 3RJIA 5KQ8A 2IVNA 3WXJA 4DSJA 4O8UA 4BR7A 4DQ8A 4UB3A 4DOAA 3KK7A 2NRVA 4GC6A 5EVZA 3IKMA 3Q8SB 4K43A 4FVUA 5I9EB 8ICPA 3OW2M 5BR9A 4R8UB 3MK6A 4ECXA 4PKGA 2OTJN 3U8XA 3FZLA 3VMFB 4H5NA 2KN7A 4NLKA 2HHWA 4PKIA 5KFJA 3QEAZ 8ICWA 2ZGYA 4OPAA 3H46O 1NKBA 4KN4A 3MR5A 3IFRA 3CCJN 2JZBA 3RVCA 4FO0A 4RQ4A 4EBCA 3SYZA 3CF5L 1BA1A 4WQ5C 2FXUA 2UVRA 3UXPA 4A57A 4DQIA 5DQHA 3CHWA 1ZQWA 3MDQA 4YOTA 1ATNA 2GWKA 3EZ5A 1NK6A 1JJ2M 3GIKA 2JEJA 1VAZA 5EY4A 1IM4A 4H0PA 4CBUA 3VF4A 3IHQB 2FF6A 1VQ7N 1QQMA