2NRTA

Crystal structure of the c-terminal half of uvrc
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
b'GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
molecule tags Hydrolase
source organism Thermotoga maritima
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrtA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrtA01
1BPEA 1WCNA 5J2DA 4B9VA 1S97A 5KT2A 4QWEA 4I2FA 4M9HA 1X9WA 2IA6A 2ZUBA 4YG2A 1KFSA 4DQRA 1NKCA 5DB8A 1RZTA 4F5NA 2BPGA 4F3OA 1S77D 3B0XA 1ZQLA 4NM1A 3BJYA 5IIJA 3KTQA 4ED3A 1S9FA 1QLNA 2KTQA 9ICVA 3BDPA 4KLSA 1SL0A 3Q8SB 2FLPA 1NOMA 5KG3A 3JPPA 4DSJA 4NLZA 5J2KA 3T5JA 2ZTDA 2KFNA 4DQSA 1IM4A 4M9LA 3MGIA 2R8JA 7ICGA 4FS1A 1JN3A 1MSWD 1BPDA 8ICTA 4F4ZA 1D9FA 5KFDA 3C65A 1MC8A 4DOCA 2PFOA 5DG9A 1K1QA 2ATLA 9ICAA 2ZJ5A 2MAXA 3ZD8A 4DL5A 4EBCA 3PX6A 2XY5A 1ZQTA 2UVRA 3MR6A 5KG4A 5KG6A 4K4HA 8ICBA 2NRTA 4MF8A 4KLQA 2PI5A 4MFCA 1T7PA 2HHVA 1D8YA 3UQ2A 2F1IA 4KN4A 5CB1A 1ZQOA 2BCUA 4RUAA 7ICSA 3PW5A 4C8NA 4EYIB 4QZAA 2R8IA 3ISDA 4IR9A 5CHGA 4O9MA 3MGHA 2AGQA 4UQGA 7ICOA 1KEJA 4I2EA 4F5PA 1L3VA 1ZQKA 4DWIA 3BQ2A 3M9NB 3PW4A 4RQ5A 4QWCA 4O3SA 2C2EA 2F1HA 4YMMA 3PO4A 5J2CA 4XRHA 4DOBA 3TAPA 4R63A 2FMQA 1Z00B 3H8SA 3EPGA 2BGWA 4F93B 5L1KA 1U45A 1MQ3A 1HUOA 2BCQA 3H8JA 8ICAA 3H7IA 5KFPA 8ICZA 5D46A 2BQ3A 5KFCA 1NK4A 4GXJA 4F5QA 7ICUA 3HW8A 2BDPA 2Y1JA 3PMNA 3C1ZA 3GV7B 4YR3A 1Y88A 3PX0A 1XU4A 4YCXA 2FLNA 7ICJA 1X2IA 3JPNA 4MFFA 5KFEA 7ICEA 3C2MA 3PW7A 4I27A 3T5KA 3QZ7A 2W9BA 1UT8A 2NRVA 4O3QA 5KFRA 9ICCA 7ICRA 4ECXA 2AQ4A 4JV2A 2P6UA 8ICIA 4MEYA 1D9DA 3RAXA 8ICCA 3QEBZ 1WCLA 4BWMA 4QZBA 4DLEA 1JXLA 9ICOA 3SV4A 5DLFA 5J0YA 4KLOA 4GLXA 2NRZA 4I28A 2UVWA 5DBBA 4YMNA 3EYZA 3RJIA 3MR3A 1ZQDA 4B9UA 4DSIA 2VANA 3ZDDA 2W9CB 4F5RA 3TAQA 1L3TA 5DG8A 3V72A 4UB5A 3GV8B 2VA8A 4I2AA 1B22A 2PFPA 4ED6A 4QZFA 4P4MA 3NTUA 1ZQFA 3H4BA 3RB3A 2C28A 4EBEA 1TAUA 2FMPA 4F91B 5J2JA 5J2GA 1S0MA 2BKEA 4JK1A 5KT3A 4EBDA 4ED7A 4O5EA 4DFKA 4Q8FA 7ICNA 5DB6A 4GC6A 4ECWA 2BCSA 4RQ8A 1XWLA 2C2DA 1BGXT 1ZQPA 4QZIA 4KLGA 4TUSA 8ICHA 4I2BA 3H4DA 4TQSA 2FPKA 3C5GA 1XO1A 8ICGA 8ICWA 2JZBA 1TVAA 3ISBA 5KFJA 3C21A 1LB2B 2HW3A 3GIMA 5HHIA 3TI0A 1V9PA 4KMUA 2AU0A 7ICPA 4ECRA 4DEZA 4DL6A 4F2RA 1Z00A 3LWLA 9ICIA 5L1IA 2BQUA 3RAQA 1ZQEA 5DQHA 2IMWP 3ISCA 2ISPA 3MDAA 5KT7A 4KLIA 3RRHA 9ICQA 3ZD9A 4O3RA 3UXOA 2IHNA 2BR0A 1ZQJA 4QWDA 4TURA 3RR7A 1S0OA 4EZ6A 2W8LA 5KFXA 2HHTA 4QWBA 2IBKA 3KHHA 4EEYA 5IIMA 5CJ7A 4YD2A 1S10A 4QW9A 4I2CA 2A1JB 4IQUA 3AU2A 5EWEA 1IXRA 1EXNA 3C23A 3JPTA 4TQRA 3IM1A 3EZ5A 3BQ0A 3PVXA 3RH4A 3PO5A 4MF2A 2NRWA 3PR4A 2BCRA 4YFKA 7ICFA 3V7JA 1ZQHA 1QSSA 4I2HA 4JWNA 4M9NA 2HHSA 1NK7A 9ICHA 4J9RA 9ICKA 4DF8A 2V4QA 5KFNA 3RH5A 8ICFA 1NK6A 3AU6A 4KLLA 3GQCA 5KG0A 4RT3A 3C2KA 3OHBA 1T8EA 1DGSA 1ZQWA 5J0PA 4M47A 4R66A 1NK5A 3PY8A 3T5LA 5D4BA 4C8KA 4DS4A 4PGXA 1KDHA 3GIJA 1NK9A 3HT3A 4JV0A 3EPIA 1BPBA 1T4GA 4KN7A 4R8UB 1N56A 4YD1A 9ICEA 1T3NA 4F2SA 2W9BB 2BPFA 4DQQA 3GIKA 1BPXA 3ZDCA 1U47A 4O5KA 9ICTA 9ICXA 3KHLA 5KFOA 4RQ3A 1U4BA 5EWGA 3RB6A 2I9GA 4DL4A 5F9NA 4NLNA 2M9NA 3QEAZ 3H8WA 3EWAA 1UT5A 5DQGA 4RNMA 4F4WA 4GXIA 5DGAA 2JEFA 2NRXA 5DGBA 2HHQA 4IQVA 2R8HA 4GC7A 4HYKA 1ZQQA 3ORYA 4O3OA 3KHGA 8ICUA 3UPQA 2ASJA 3ZDEA 3V6HA 4RNOA 2V4RA 2RDJA 4QZEA 5EOZA 4P2HA 1ZQXA 4UAYA 1JMSA 3LDAA 4ECTA 2DFLA 4O0IA 3GFKB 3TFRA 3PX4A 4NLGA 5IILA 4UAZA 2PFQA 9ICLA 2XY7A 1AROP 3JPSA 8ICQA 8ICRA 2W9AA 4UBBA 2R8KA 2ZTCA 3ZDBA 8ICPA 2XY6A 5J2BA 5HP4A 7ICKA 4JWMA 4KLEA 8ICNA 4Z6CA 1L5UA 4QW8A 4JUZA 4ED8A 3GILA 4EZ9A 4KLFA 2PXIA 3MFIA 5J0SA 3HP6A 3TFSA 2J6SA 2P6RA 4Q8EA 3KHRA 9ICRA 4ECVA 3MBYA 3GIIA 1H38A 5KFVA 8ICSA 3RR8A 5KT5A 3K75D 5DG7A 3B0YA 1RPLA 4ED0A 4M04A 2ZTEA 5KFMA 1TKDA 1SKRA 4O3PA 4KITB 3Q8KA 4QZGA 4R65A 4PHPA 3M8RA 1ZQIA 2PI4A 1S0VA 1S76D 9ICUA 3V7KA 1ZQRA 5KTQA 7ICHA 4RQ1A 5C5JA 5DKWA 4YXMA 3NGDA 1KTQA 1TAQA 3N97B 4O5CA 1JIHA 5KG7A 2XO7A 4ECSA 7ICQA 3FYHA 4UB2A 4YMOA 4ELUA 4LVSA 4F4XA 5KFYA 4R8UA 1ZYQA 2J6TA 1A77A 1NK0A 5DDYA 2V9WA 5CR0A 1XC9A 8ICLA 9ICNA 4K4GA 1ZQAA 4RQ6A 9ICFA 4M6WB 1QSYA 2JEIA 1RXVA 4RQ4A 4CCHA 4PGQA 1ZQSA 3BQTA 3Q8RB 5J2EA 5HHHA 4KLDA 1COOA 1L3SA 3M8SA 1QSLA 2HHWA 7ICLA 4RU9A 2XCAA 4J9MA 4YQWA 5BPCA 3Q8MA 2C2RA 7ICTA 4LZDA 3RJFA 4F92B 4BDPA 4QZ9A 2ASLA 8ICXA 4YR2A 1SKWA 2W9CA 5J2AA 3UQ0A 1K1SA 1JXEA 5J0RA 4PHEA 3C5FA 4DL7A 3RBDA 3OHAA 1S0NA 1ZQCA 1KRPA 3RRGA 1KLNA 4E0DA 3PW2A 2Q0ZX 4UB3A 5DBAA 4ECYA 1XSNA 5KFAA 2W8KA 2KZMA 4MFAA 1B43A 4QZCA 4ED2A 4DSFA 4DL2A 4J9PA 5KT4A 1NKBA 3MDCA 5J0UA 1SZPA 4PGYA 3Q8PB 4GXKA 4B9NA 4X5VA 2FPMA 2DPJA 2IHMA 4ED1A 1N48A 3LWMA 5KFBA 4Q44A 1U49A 1TFRA 5DLGA 2P66A 4F4YA 5J2IA 2LYHA 3Q8LA 3PV8A 4P4PA 5HMMA 2ZUDA 4P4OA 4J9NA 3TANA 1ZJMA 1BPZA 4LZGA 4NLKA 7ICVA 3THVA 2GWSA 3OSPA 1U48A 5J2FA 3V7LA 4ECZA 4BXOB 5J0XA 1NJZA 2VA2A 4DS5A 4YR0A 4RQ7A 3HWTA 4F50A 5CWRA 2ZUCA 4UAWA 4DFJA 1D8LA 4RPYA 3RBEA 1NJYA 5KG2A 3GV5B 4XUSA 1RYRA 2PFNA 4UBCA 5KFHA 5TZVA 1XSPA 5J0TA 2ZJAA 5KFLA 3TARA 4PH5A 3MR5A 4NM2A 4QWAA 2MUTB 4KLTA 3OSNA 8ICKA 3GDXA 4NXZA 3JPQA 5CP2A 2BPCA 5L1LA 2F1JA 5KFFA 3ZDAA 5CA7A 1Z3EB 4RQ0A 4ECQA 1ZQGA 2XC9A 5KFZA 1DOQA 4M6WA 4UB4A 1ZQZA 5KFQA 3QZ8A 3BQ1A 2ASDA 4NY8A 1UA0A 3HX0A 4FBTA 1BPYA 3RB0A 3G6YA 1SL1A 2BQRA 2BHNA 3UXNA 3UXPA 3Q8QB 2RDIA 8ICVA 2FLLA 1NKEA 3RJHA 4YVZA 4I2DA 4J9LA 4BWJA 4KLUA 1HJPA 3MFHA 3M9MB 4FBUA 4G3IA 4DQPA 2ALZA 4RZRA 1TK0A 5KFIA 4BGDA 4PHDA 1ZQBA 2DPIA 8ICYA 2HHXA 3OJSA 3RJJA 3SYZA 2KFZA 5D49A 3RJGA 2ISOA 4KTQA 1TK5A 4EYHB 2BCVA 2MUTA 1BVSA 4I29A 3V6JA 3RJKA 5KFWA 4YN4A 4YP3A 2Y1IA 4B9MA 1HUZA 2AJQA 7ICMA 5EWFA 4F4KA 5DB9A 1CEZA 1RXWA 1TK8A 9ICGA 4FO6A 1MQ2A 1ZQMA 4C8MA 2XGQA 1ZETA 1UA1A 3G6VA 3LK9A 2A1JA 2KN7A 3E2EA 1XSLA 1CUKA 4C8OA 4DSLA 2JZBB 3PR5B 3N4MB 1A76A 3K4GA 2XGPA 4I2IA 4RT2A 4DFPA 2C22A 4M2YA 3FDSA 5J29A 2NRRA 1ZQUA 5IIKA 2J6UA 2AQ0A 3V6KA 2XCPA 5HNKA 4DO9A 4TUQA 4B9LA 3C2LA 1ZQVA 3JPOA 4DLGA 5J0QA 2ZJ8A 4J9KA 3T3FA 8ICMA 5KFTA 5J0OA 2UVUA 4KLHA 3PW0A 3QE9Y 1XS9D 3T5HA 4PPXA 8ICOA 5JUMA 5KFKA 4K4IA 3MABA 5KT6A 4RUCA 1KFTA 4DSKA 2KZZA 4YXJA 1KFDA 1NJWA 3RH6A 4ZH4A 4QZHA 4IRKA 1ZQNA 5KFUA 4DL3A 1U9LA 3HPOA 4PHAA 1X9SA 3PMLA 4IR1A 2H5XA 4B9SA 4Z6FA 4IQTA 2UVVA 3RJEA 4M0AA 3AUOA 4DSEA 5KG5A 4QZDA 2JEJA 3MR2A 3SI8A 3EW9A 3PNCA 3SZ2A 1X9MA 5DQIA 5L9XA 4IQWA 5KFSA 3TQ1A 4ELVA 1SL2A 1TV9A 1PZNA 2VA3A 5IIIA 9ICJA 5F9LA 4RQ2A 4RNNA 9ICWA 5KG1A 5DB7A 2AGPA 5HMLA 4DQIA 4I2GA 4KLJA 4XA5A 1ZJNA 4KLMA 3OGUA 5J0WA 1RYSA 1C7YA 8ICJA 5KFGA 4I2JA 4DF4A 4XQ8A 1L3UA 1SKSA 2HVIA 4M9GA 1QTMA 4TUPA 9ICPA 5DBCA 4J9QA 1NK8A 4JV1A 4J9OA 1KSPA 3C1YA 4Q45A 4J9SA 4RPXA 3M9OB 2W9MA 4B9TA 4ELTA 4F8RA 2B21A 4IRCA 5BOLA 4RPZA 3SV3A 1ZQYA 4Q43A 5J2HA 5L1JA 5IINA 4C8LA 4O3NA 4UB1A 2OWOA 4MEXA 1NJXA 3ETLA 3RB4A 4IRDA 2R8GA 4Z6EA 3RTVA 3JPRA 1JX4A 4BXOA 4Z6DA 2AGOA 5IIOA 2I1QA 4FS2A 2FMSA 3G6XA 2HVHA 3OJUA 4F5OA 7ICIA 3H40A 4DFMA 2JEGA 2FPLA 2WTFA 5DDMA 3IHQB 9ICMA 4QZ8A 2HHUA 9ICBA 2KZ3A 8ICEA 4ECUA 5BOMA 4M9JA 4DOAA 1LV5A 4R64A 9ICSA
chains in the Genus database with same CATH superfamily
4B9VA 4I2FA 5KT2A 4QWEA 2K8AA 3G71N 3LDOA 2OYQA 2QARB 3HI0A 2ZUBA 4YG2A 2ZIWA 5DB8A 1PUZA 3B0XA 4CRXA 4ACOA 1JCGA 4JNEA 3SLCA 4BC2A 3DOLA 4HUGA 5AKJA 4ED3A 1QLNA 2KSOB 5AK4A 4KLSA 1Q3UA 1ASVA 1LKYB 1NOMA 2JGUA 1S9EA 3JYTA 3OPXA 3V81A 1X42A 3TSQA 2R8JA 1IKVA 1KVCA 4DKWA 1N33K 3UMCA 1MC8A 2RQ5A 3LDPA 5DG9A 3D0PA 2I7NA 3ENOA 2ATLA 2ZJ5A 3GE1A 4BRHA 3ZD8A 4EBCA 1ZBFA 5BRDA 4Y2VA 2F8LA 4FWSA 2UVRA 2UU9K 3MR6A 3TWHA 4V19S 5I3UA 3DM2A 8ICBA 1AQ6A 4NYNA 2EZXA 1GLAG 2PI5A 1JALA 1L7MA 4MFCA 4ISFA 1BNOA 2O4GA 3QDKA 2XICA 5EU7A 3UQ2A 5SWMA 1L6NA 1ZQOA 2Q1NA 3TACB 7ICSA 5M1NA 2W11A 1NWKA 1Q82O 1NG9A 3PW5A 4EYIB 3SI6A 4OO1J 3D2FA 4IR9A 4O9MA 2AGQA 4UQGA 2Z7JA 4I2EA 1PVPA 4DWIA 3PW4A 2KJ5A 3QYPA 5JRTA 4YMMA 3V1RA 2JR5A 4DOBA 4GMJB 5HRSA 2D4WA 3OYGA 1TE2A 1OXJA 2BGWA 3ENBA 1GLLO 4UAVA 3AVIA 4GFJA 3H7IA 3QERA 5TISU 1NJIO 1ZBUA 3AO1A 2KP7A 1NK4A 4F5QA 3HRDD 7ICUA 4CZLA 4BC3A 3AO5A 3AVGA 4OCZA 1COKA 1WUAA 4C1NI 4YR3A 2QARA 2KICA 1JLFA 4YCXA 7ICJA 1D4XA 5AQMA 3JPNA 5JLHA 4MFFA 2UUBK 4FK0A 5CY4A 5JVGL 1UT8A 3A0HU 1S6QA 4ECXA 3WKAA 2AQ4A 2P6UA 2HNYA 3DLEA 1HYSA 2JRZA 5ALVA 4DV4K 4KHPK 4JV5K 3T79A 3CCUN 3QEBZ 3E01A 2Z1GA 4US8A 1JXLA 5J0YA 3U6FA 5AI5A 4FJGA 2NRZA 4Y2UA 5TKWA 3UIQA 4Y2YA 5DBBA 5HR7A 3RJIA 2P5OA 3EO3A 1QH9A 3ZDDA 1L3TA 3TAQA 3WKEA 1W2BM 4GIBA 1OH7A 2G08A 5ALOA 5ALWA 4QZFA 2JGAA 4ED6A 2X6SA 3B8AX 4JKAA 4BQZA 4JMUA 4EBEA 3AMZA 5AKXA 1S0MA 4EBDA 4Q8FA 1YTUA 4DFKA 3VOVA 1WSHA 3AAPA 4ECWA 3PLAA 2P9PB 4LF6K 1RBUA 2HNZA 4RQ8A 3OS1A 8ICHA 2EX3A 4TUSA 4I2BA 4ILGB 3F5EA 4TQSA 2DF4B 1XO1A 2D0CA 5FRMA 2B5JA 4CE6A 3C21A 4BE1A 2HW3A 2W7OA 4BG8A 5ALDA 3TI0A 1X9XA 4DV3K 3TAMA 7ICPA 1HJOA 5T14A 3ID6A 2YB1A 5SZTA 2QB1A 4F2RA 4Z4FA 3LWLA 4J2AA 4NWIA 3SAFA 1S8OA 4PL1A 3AQFA 3D7EO 2IMWP 3C7NA 3FZLA 5J2MA 2DFHA 1O1WA 2IOHA 4QOZB 3LYSA 4TURA 3MXJA 5CYMA 2RRDA 1SIJA 2W8LA 2M0NA 2ZIVA 4K43A 2OZSA 3ENHA 3H1VX 3J7ZO 3KHHA 5E84A 4N41A 1S10A 5FPEA 3VC8A 2EANA 4CF9A 2NO5A 3EZ5A 3JPTA 3PIOL 3RH4A 1RM6C 1WG8A 1RT7A 4DR7K 2ZGZA 7ICFA 2ESEA 4IFVA 4CEDA 3V7JA 3THWA 4JYAK 2FSJA 4JWNA 4M9NA 5G5GA 1NK7A 1P7DA 3F73A 2QKBA 2VKQA 4J9RA 9ICKA 3O9RA 4P0QA 5FDLA 3FZMA 4AP9A 4DTSA 2X74A 3NVYA 3A5NC 3CJBA 4CJVA 2OTLN 4KLLA 4R79A 1SV0C 3N28A 2DUYA 4RT3A 3M5RA 5CZ1A 3MN6A 2UUCK 5BPLA 3I76A 1ZQWA 3KFUF 3NH0A 4R66A 1NK5A 1M1KO 1NK9A 1WNSA 1NGAA 3FZFA 3QFPA 5M1PA 3EPIA 3UKUB 4MFBA 4JI3K 2Y9UA 3QIPA 4R8UB 4NJ8A 3EZWA 4YD1A 3HL8A 9ICEA 1T3NA 3O5BA 4F2SA 4XH5A 3CCSN 3C94A 5JMVA 1CZ9A 5D3GA 3I28A 2K4PA 4O5KA 3WEEB 1MDUB 1U4BA 3HZ6A 4JI1K 4DL4A 5F9NA 2D0BA 2G8FA 3H8WA 3EWAA 1IH7A 3KD1E 1DXSA 5EX5A 4OKJA 1Q9XA 2Q2RA 5DK5A 4CGDA 5AKLA 2R8HA 2DKXA 3SMVA 5BN8A 2E1ZA 1N6QA 3A0BU 3KHGA 5HRRA 2I7PA 2ASJA 3QETA 2CXYA 1V4SA 4BJQA 2CGLA 2KQ2A 4QZEA 5EOZA 1L8LA 4UAYA 4B1YB 4ECTA 2DFLA 3PX4A 3GFKB 4O0IA 4GV6A 2VCPA 5IILA 2ZD1A 4CEOA 2XY7A 4NCAA 4M63C 3ZDBA 5I9EB 5HP4A 4RG8A 4JWMA 4KLEA 8ICNA 2A6AA 4Z6CA 3W0LA 2ZJPL 4QW8A 4JUZA 3GILA 2ZWHA 4UW9A 1LOTB 2PXIA 4YOTA 2NYVA 2O6KA 4BR4A 2J6SA 5KQ8A 4B3TK 2DBYA 3KHRA 1Q8IA 4H5NA 3WK4A 9ICRA 4QIWC 3NGIA 2UXDK 4WQ5A 5DG7A 3B0YA 1S9GA 2BDUA 2ZTEA 1TKDA 1SKRA 5AQGA 1XHXA 1PK1B 3M8RA 3MGVA 2IVNA 5KGXA 5AKYA 3V7KA 3PSTA 4RQ1A 3CFRA 2GX9A 2P9IA 1TAQA 3SPYA 1JLCA 1JIHA 5KG7A 3RWUA 5GADP 3AV9A 2JV3A 5AI8A 1RDWX 4NLCA 4R8UA 1ZYQA 2HSTA 2Z1JA 1X6JA 3A5MC 3B6PA 4FVMA 2P9LA 4RW8A 2NZTA 4HTLA 2W43A 1IIPA 4BRLA 1A5WA 1ZRMA 1NLVA 4RQ6A 4CE9A 1I94K 3CG7A 4DR2K 2I6XA 4DFDA 1NU0A 4JI2K 1RXVA 1Q9YA 4FJMA 3BQTA 3Q8RB 1WSEA 1ZBSA 3LP3A 4A59A 4GV3A 1IO2A 1COOA 1L3SA 2ASMA 4FWQA 4CBXA 4DV7K 4DR4K 2PY5A 2UXBK 3V1QA 5BPCA 7ICTA 3L2RA 1HNXK 4G1QA 3BS5B 3PSFA 3CJCA 1KD1O 5ALJA 1SKWA 1WBDA 2W9CA 2HMIA 3UQ0A 1K1SA 1SXEA 1S0NA 3J8AA 1KRPA 1W9HA 1N63A 2G09A 3WNFA 3QU9A 3PW2A 2D3DA 4UB3A 2BANA 4ECYA 2YB4A 4H4MA 1IBKK 1VAZA 4XH1A 5GTHU 4MFAA 3OYNA 4ED2A 4DSFA 3N7SC 1HIWA 2FPMA 1S1TA 2IHMA 4E3SA 3KLFA 4LJXA 2FJ6A 1ZXOA 4AM6A 2YN4A 2WHEA 3SJHA 1TFRA 2QEXN 4P0PB 2HF3A 4RQMA 2P66A 3D2EB 2E1FA 3Q8LA 3CQXA 5C24A 4O8KA 1X9JA 3EKUA 2ZUDA 1ZJMA 2LPEA 3MK6A 2QTDA 4KKOA 4NXMK 3TR8A 3QEWA 2B6AA 3R9KA 5J2FA 1VQLN 4BXOB 5JVHL 4YR0A 3HWTA 4F50A 4CDGA 5AKIA 1DGJA 2JXJA 4RPYA 3RBEA 5KG2A 4O5BA 3H45C 4XUSA 5LJWA 3NS1A 4CFDA 1S1UA 5GAGP 2E8PA 5GIPA 1XSPA 4I2PA 5KFLA 4AHCA 1IJJA 4FM2A 3PUFA 3OYCA 2EWSA 1T44A 3TU5A 4F71A 1U2VB 3WXKA 3VA0A 1HYVA 2WF9A 2P9UB 4GW6A 3AVBA 2PKEA 5CA7A 4RQ0A 5F2RA 1ZQGA 2XC9A 3F5AA 2ASDA 4M6WA 3QZ8A 1BG3A 2QWPA 3DLBA 4KI4A 4M3YA 1GO3F 1N61A 2Q31A 4FBTA 3VEOA 1BPYA 1BL3A 1SL1A 5AJ3K 5ALNA 1C1AA 2IVPA 3QNMA 4A61A 2NNWA 4CHOA 3Q8QB 2MSNA 2FLLA 4US9A 1NKEA 3QX7A 1IV8A 5ELZA 4I2DA 4E7LA 4KLUA 1HJPA 3CJ7A 3SD7A 2KNJA 3AEVA 4Y2SA 4DQPA 2YJEA 3HP9A 1RT3A 1TKTA 3QBXA 3L2UA 3DLHA 4J2BA 1SB3C 3H0LB 5KFIA 4CGZA 3C29A 1ZD2P 3WXLA 2B0CA 5D49A 3C28A 2ISOA 1TK5A 4EYHB 4KTQA 2MUTA 1BVSA 4OGEA 5KI6A 3OTOK 3RJKA 4A57A 1KW4A 4YHHK 1S1WA 1HUZA 1RTJA 5A2QO 4P0PA 2UUAK 1T6DA 2IS3A 1VQ9N 4M3TA 4DV6K 1SV4A 4C8MA 2HNDA 3D6RA 3G6VA 1YIJN 1CUKA 3P1GA 3N4MB 1YF5L 3PIPL 3GG4A 2XGPA 2O8CB 4IC9A 2O8EB 4KHQA 4EENA 2C22A 4BC4A 4GKJK 1ZOLA 5J29A 1BCOA 5IIKA 1BISA 5HNKA 4DO9A 4KBOA 4Y2XA 3C2LA 3AAQA 3JPOA 2ZJ8A 4J9KA 3T3FA 3HKZC 1WWVA 1HNZK 4KLHA 3PW0A 2HOEA 1ZBHA 3RF9A 3WXMB 5KFKA 2D1KA 5KT6A 1KFTA 5AKGA 1KFDA 2K8CB 4Y2TA 3RH6A 4ZH4A 2GELA 2F2AB 2QLTA 4DL3A 1TKZA 1XUPO 2ZXIA 3AARA 3J80O 3NH2A 1Z25A 3PMLA 4HUFA 4FJXA 2H5XA 3EE8A 3O9TA 4PJ0U 3UMBA 2UVVA 3O08A 5KG5A 1SGGA 3MR2A 2EZZA 2WAQC 3EW9A 1SQKA 4RW6A 1X9MA 5C42A 4BRQA 5KPRA 4DTMA 3SUQA 5AZIA 2O8FB 4J03A 5L9XA 3KIOA 4KREA 3TQ1A 2RP5A 1SL2A 4ISEA 1L8OA 2YJFA 3H0RB 1B9DA 4QS7A 2YX8A 3FFKB 4RQ2A 2W40A 5ALFA 3OYEA 1WAFA 5HMLA 3P38A 2GOLA 4YNQA 4H0XB 2K89A 3MWPA 1SKSA 4PHTX 4M9GA 3AO4A 9ICPA 1NK8A 3NF8A 5EVZA 3UE5A 4J9OA 3J7YP 4QS8A 1B4FA 4BREA 4J9SA 1SWWA 3M9OB 3CIPA 3T1AA 4B9TA 2B21A 3CCRN 4IRCA 4Z4IA 3QUCA 3NBPA 1NNEA 2KD1A 4RPZA 1K8KB 1ZQYA 2QKKA 2P9NA 4DMNA 4C8LA 2YHBA 1NJXA 3VEZA 3WQUA 3SR6A 1V4TA 5IT9O 3RB4A 4IRDA 4Z6EA 4BUGA 1N32K 3JPRA 1QQMA 3M8QA 1XNQK 1S22A 2VJ5A 2I1QA 3AN1A 2ZF5O 4OX9K 1JLEA 5EY4A 3U8XA 5H1SQ 4WE1A 5AK6A 3CQYA 3ZETA 3P4IA 5DDMA 1EWRA 5EE3A 4QZ8A 3ZX2A 1K8AO 4AHVA 4ECUA 5BOMA 3CHWA 4ISGA 4BGAA 1LV5A 5AQUA 2PYJA 3EL2A 4OPJA 4YFUA 4CHPA 3LL3A 3QLHA 1KFSA 1NKCA 1RZTA 4F5NA 3H08A 1S77D 3JAMO 3AA4A 3RSEA 1ZQLA 4JI4K 3BJYA 1HKBA 2ETJA 5IIJA 3KTQA 1JLAA 1RT4A 1IV0A 3N7RC 3LAMA 3ONNA 1TGOA 3Q8SB 5T7BA 4NYFA 4NLZA 1JROA 4DQSA 2YTUA 4Y1CA 4CZEA 4EEKA 3VESA 1MSWD 1BPDA 3CJ1A 5KFDA 1QS4A 2RPIA 1LWCA 3DXKB 5EE1A 1K1QA 3I33A 3CCJN 3VGLA 3KK2A 4DL5A 2Q4TA 3K0SA 1BIUA 4YDUC 4ZHRA 4RCHA 1ZQTA 1EP4A 3ZSZA 2F8TA 1W97L 5KG6A 4DCCA 1WSFA 4KHYA 4XH4A 4KLQA 4RTFD 4BY9C 3QEPA 1T7PA 4JI7K 3SEIA 4BDZA 1QVFM 1GLFO 1K8KA 4YDUA 5CB1A 2YY6A 1YHQN 5HROA 1EETA 5ALLA 4C8NA 3J7AP 4QZAA 1CXQA 2W3SA 4CEZA 4FJ9A 3ISDA 5AQQA 1HNWK 3HM9A 4F5PA 1L3VA 5AQWA 1J2MA 4RQ5A 3BF1A 3PO4A 1RILA 2DL0A 3O1WA 4JRPA 2LYBA 4R63A 5MLCQ 1Z00B 3H8SA 2YV0X 2W03A 3S6JA 4F93B 5L1KA 1HUOA 1MU2A 3H8JA 1VSFA 8ICAA 5KFPA 3K5LA 2RLTA 5LJVA 4FZZA 2BDPA 2Y1JA 3R1XA 3PMNA 3C1ZA 5AM2A 3GV7B 4C4TA 1YT3A 1ZD4A 1IBMK 4RW7A 1GLDG 2FLNA 4NB4A 1X2IA 4CHNA 3B9JA 1WSGA 2GV9A 5KFEA 5KAFU 3L4PA 3AM9A 3QZ7A 2P9PA 3ISNC 4O0JA 4PKHA 2LHTA 4O3QA 1BOTO 2KKZA 4CJWA 5ALPA 3VN5A 2Q0RA 4DR5K 1VQPN 2OTJN 4LC9B 3VTIA 1I3AA 1PVQA 4M7YA 3TSUA 4M41A 3P31A 2QXLA 3SV4A 2F44A 2XVTA 3VPZA 3KBBA 2GUPA 3DYAA 3ZETB 4I28A 4YOVA 4CECA 4YMNA 4F9OA 1JUDA 4PUOA 3MR3A 1ASWA 3CCMN 4Z94A 4WF9L 4UB5A 4I2AA 2VA8A 2QWRA 2W3RA 3OYIA 3DRSA 2PFPA 4NO7A 2KJ8A 5AM1A 1TAUA 4F91B 5GINA 4LSLA 4E7JA 2FF6A 1FFVA 2EAPA 4ED7A 4O5EA 5GIOA 1S6PA 3BZCA 5DB6A 4GC6A 3WXJA 2QB0B 3RSEB 4NLBA 1MA7A 4H0VB 2G07A 1XWLA 3LALA 5ALIA 1E4FT 4QZIA 3J81j 2A1AA 2O4IA 3C5GA 4C4RA 4FFDA 1KLMA 3RMDA 4PKIA 1TVAA 1QHAA 1Q86O 1LB2B 1BA0A 3THWB 3GIMA 1V9PA 2AU0A 3RVCA 4BACA 2EAOA 2HBKA 3AGKA 4JKDA 9ICIA 3CC7N 1HQUA 2Y0SC 2ES6A 3RAQA 1ZQEA 2OCEA 5BR9A 3ISCA 3BZKA 5J8YA 5AI4A 5AKZA 4BR0A 2D8CA 2IHNA 4OJOA 4O3RA 1TYQB 4CJ3A 2VGNA 5ALRA 4MLEA 4HCBA 1KCFA 1BI4A 1J2NA 5KFXA 1A5VA 4W5TA 4H5RA 3THXB 2YQEA 1EWQA 4YD2A 4CF1A 3QO9A 4I2CA 3R3LA 3IM1A 3BQ0A 3KK3A 2KG5A 1X1PA 3CCQN 3PR4A 3ALRA 4YFKA 4IDKA 4BRMA 1RYUA 3G10A 4JHDA 2FXUA 1YTAA 2HHSA 9ICHA 1VHXA 1CZBA 1X6IA 2KKVA 1LCUA 2GUIA 2V4QA 3MC1A 1NK6A 3ZLJA 4BRCA 5HLFA 5AKHA 1XNSA 3S3OA 5J0PA 5FPDA 2KIVA 3R8EA 3T5LA 5D4BA 3AVAA 3GIJA 4PZOA 4JD2B 3K2PA 4JKHA 5EE9A 3K5MA 1SAZA 3V4IA 2QWMA 4KN7A 4PL2A 2YCHA 3BEXA 4JKBA 1VSHA 3DRPA 4CF4A 4UY8O 5ALZA 3IN5A 5AKKA 4FZXC 1ILYA 2E8MA 4ID1A 9ICTA 3D2FB 4RQ3A 4CBWA 5EWGA 3RB6A 1IKYA 2VQFK 2DWQA 3AO3A 2M9NA 2R18A 3KOOA 5M1FA 3OYHA 2EAMA 5LMUK 1UT5A 4PQUA 5DQGA 3BGRA 4F4WA 2ZG6A 4Q0BA 3O3FA 1Q3VA 2HHQA 4CJKA 1ZQQA 2QWNA 3ORYA 3QUBA 3SQ0A 4O3OA 5ALGA 1VSIA 3V9WA 2YMLA 3ZDEA 3TADA 2XHBA 5AQIA 2RDJA 2V4RA 3CD6N 4C23A 3K9KA 5ADXH 3LDAA 3TFRA 1OKJA 5FPMA 4UAZA 2PFQA 3UB5A 1S72N 9ICLA 3SMSA 2W9AA 4J2EA 4UBBA 2R8KA 4CGHA 8ICPA 7ICKA 3I8DA 1JJ2M 4DV1K 3HP6A 4FPAA 1UCVA 4E1JA 4ECVA 4LFBK 2HCFA 3GIIA 3N4QA 5KT5A 3K75D 4ED0A 4M04A 4E89A 3K1RB 1S5JA 1JKHA 4O3PA 2KJ9A 4CJEA 4R65A 4PHPA 1S76D 4ICAA 2IOCA 2RHFA 5KTQA 1W7AA 1YUWA 1TYQA 5C5JA 3IAYA 2AXTU 4B3OA 5AZJA 4ECSA 5HP1A 4CNQA 5JTIA 1HR0K 3TAEA 3FYHA 4JD2A 3SQ2A 3THXA 3AGRA 4LVSA 3ZSXA 2J6TA 1NK0A 1KAXA 5AQZA 4JKFA 4KRFA 3FR0A 1K5OA 1PVRA 4GV9A 1XC9A 3E9LA 9ICFA 1BCMA 4C1NK 4H0YB 2ITGA 4LFAK 3R9PA 3K59A 3O9UA 4QS9A 4LF7K 2W55A 4CIFA 4FJ7A 1QSLA 7ICLA 3M8SA 4A2BA 4RU9A 4GNIA 2XCAA 1O08A 3Q8MA 4JRQA 2CGKA 3ULEB 4OKEA 4CZFA 3MXIA 1TUYA 4PY5A 2JHDA 3RBDA 3FLCO 3JS6A 3ETRA 3I55N 1XSNA 2FC0A 3WU2U 3F2KA 4J2DA 3VQQA 1B43A 1ITGA 1NKBA 2FLOA 4J9PA 4B9NA 5J0UA 5GAEP 3LVWA 4DUYK 4N76A 1KAZA 3K9JA 5AQJA 4U7BA 4CF5A 1FFUA 3LWMA 1JL2A 5KFBA 4FJ5A 5DLGA 1SV5A 3QESA 4FZYA 5K14A 5AQTA 4UASA 4B1XB 3A2FA 1BPZA 7ICVA 2ZXHA 4J9NA 4H03B 2Q36A 4FW2A 3L3FX 3THVA 2GWSA 2CPRA 5B5EU 2FI1A 3V7LA 4KPYA 1NJZA 5DMRA 4CGJA 2D0OA 4RQ7A 3SQIA 1BHLA 2H3IA 3BY5A 4JK9A 4YOXA 1UHUA 3C7NB 2FSNA 2ZUCA 3D6JA 1BWFO 3NCIA 5HRNA 3C6HA 2BZFA 4DFJA 4DTXA 1SXDA 1LWFA 4X62K 1KQSM 3ZX0A 2YKNA 1RYRA 3F2BA 5AI9A 2PFNA 1IKXA 1T6CA 2X6NA 3OHRA 3QNNA 3DJCA 3WK6A 5KGWA 5BN9A 3MR5A 4JI6K 4NM2A 4QWAA 2MUTB 4KLTA 3CPWM 3U26A 3OSNA 8ICKA 4NXZA 2XRIA 4EFHA 3HBTA 3VMFB 5L1LA 1IG9A 2OXOA 4CEEA 3E9OA 4CJUA 1XNRK 5HOOA 3U3YA 1ZQZA 5KFQA 4FWRA 1UA0A 3CXCM 3QU5A 3HYFA 3I0RA 4WJ3B 3E0FA 3UXNA 2KLAA 4K8ZA 2RDIA 3WNHA 1OH8A 2Q3SA 3G4SN 1F0MA 5JS1A 3DRRA 2OPPA 1UPHA 4BWJA 4B1ZA 3HKZF 4FBUA 3CFPA 1UQVA 1RCHA 4RZRA 2HI0A 1TK0A 1DT9A 1GLCG 4BGDA 4PHDA 1ZQBA 3VEYA 3CF5L 2HHXA 2KFZA 3SYZA 2WFAA 2BCVA 1O03A 3F53A 4IL6U 1BU6O 2VIXA 4BE0A 5KFWA 5BRFA 4YN4A 4YP3A 4F72A 4FSVA 2NV3A 2PMZF 4B9MA 3NASA 2RHKA 3KZXA 4IEEA 2OANA 3OBWA 1KXPA 4DHYA 3WK5A 4E7HA 3GL1A 4B8CA 2XGQA 2WAQF 4FZLA 1ZETA 1TVRA 3AA5X 3IG5A 2OZMA 4NCBA 4Z4EA 5AR0A 2JZBB 5FROA 3SUOA 1A76A 2W54A 3K4GA 1ESVA 3LPUA 4K8XA 3O6WA 4RT2A 4BR9A 2O8CA 3L3UA 3M7DA 3FGUA 4I2QA 4M2YA 2F7TA 3VQ5A 1ASUA 5CZ2A 2AQ0A 1NM1A 1VSJA 2QW9A 5EXWA 2B6GA 4OJPA 1RTHA 2DPNA 3SQ4A 4I6MA 1WSIA 3HOTA 8ICMA 1Z1BA 1N62A 3OBYA 5J0OA 3O4QA 4KH4A 4EP5A 1XS9D 3AA2A 5JUMA 3MABA 4RUCA 2KEYA 1RQNA 4DSKA 2P9LB 1N36K 3S3MA 1NJWA 1ZQNA 2F4VK 5LY3A 4HUEA 4IQTA 4DUZK 1A5XA 2YKMA 4CIEA 1ZXIA 4M3XA 1Z26A 3H3OB 3IG1A 4FJNA 4DSEA 2A19A 4OJ5A 2JEJA 4OPHA 3LVVA 5AQXA 3PNCA 5KAIU 4IOCL 5DQIA 1OW5A 1G99A 4MO4A 4H5VA 4NL9A 5KFSA 1RT2A 3WKDA 1RFQA 3DMJA 1PZNA 2LYAA 2VA3A 1WLJA 5M1KA 3DEEA 4PL7A 3AA3A 5ALYA 4I2GA 4DQIA 4KLJA 1WSJA 3EE9A 3OGUA 5J0WA 1C7YA 1BA1A 1QHTA 3CQ8A 4XQ8A 1C6VA 4NL9C 4OLAA 1GOAA 3KLIA 4TUPA 1KSPA 4EHUA 1N60A 3C1YA 2ZIUB 1B9FA 3K5OA 4Q5VA 3ID8A 3VTHA 1YI2N 1VRTA 1K6YA 1URJA 5BOLA 3DI6A 2NUBA 4CFCA 3B6OA 4JI0K 3NAEA 3VF6A 5IINA 5AFUA 3MCAB 3MMVA 2ASPA 2A42A 4O3NA 1IG8A 3S9HA 4KHUA 2OWOA 4M42A 2KK0A 4IXCA 2I5JA 3T19A 3ETLA 4DR1K 1S1XA 3LANA 3FM9A 1VQ7N 4BXOA 1J6ZA 4CK3A 4IZ9A 3O8MA 2W04A 3P83D 2DQNB 4C7YA 2FMSA 4CJFA 3G6XA 2HVHA 1J53A 2OPRA 2YHAA 3G25A 2E4LA 3H40A 2JH7A 4DFMA 2JEGA 4C4SA 3HRGA 1VQNN 2O8BB 3IHQB 2HHUA 9ICBA 2P51A 4YOWA 5B66U 4I6MB 3ZT4A 2G8VA 4EX7A 1IKWA 4HTUA 4CGFA 5CEHA 4M9JA 4CI6A 1HLUA 2E1YA 3DLRA 5ALHA 4R64A 3O4WA 9ICSA 5J2DA 3OYFA 4FLZA 2OM6A 2FE9A 2GWJA 1DEJA 4E7KA 4X64K 3KLEA 4FLUA 2P9UA 4DQRA 2GEMA 2BPGA 2BGGA 2F76X 4F3OA 3RMAA 4Z4CA 1T3VA 1V38A 4NM1A 3PZPA 3M8PA 2KTQA 1S9FA 1S5LU 3ZEUA 2P9KA 3CCVN 2HOQA 2ZIXA 3L3VA 2FLPA 5KG3A 5AQFA 4I9QA 2QKQA 5J2KA 2ZTDA 4OVLA 4L3QA 1NGDA 3ATUA 4M9LA 7ICGA 5HBMA 4FS1A 3FC4A 3O9QA 4M3RA 1D9FA 1M6YA 4DOCA 2PFOA 2QM1A 5F0XA 4E1MA 9ICAA 1Q18A 1LW2A 4EIAA 2XY5A 3Q7BA 4CZMA 1NMNA 1NGFA 3IG8A 1OH6A 3WK9A 4K4HA 1RT6A 2NRTA 3IUCA 1NNLA 2E5LK 4PWDA 3IMXA 1VSKA 2E2OA 4FOIA 3V1OA 3AVLA 2BCUA 3DOKA 4RUAA 4AHUA 4JI5K 2EH9A 1QQOA 1L7OA 3L2QA 5AQSA 2H3GX 3VQBA 4CJ7A 4KTWA 3UM9A 5CHGA 3ZSQA 2Z1IA 3MGHA 4DTNA 7ICOA 1KEJA 1P8ZA 1ZD5A 1ZQKA 2F96A 3V9XA 1KC8O 4FLXA 1FJGK 4QWCA 3QXGA 1TL1A 3ZYYX 4DQ8A 3T69A 3WKBA 3CJ9A 3ZSVA 3AVJA 3LM2A 1MWKA 3TAPA 2VYPA 1X3NA 3EPGA 2BCQA 4DTRA 1MQ3A 2WBNA 4JKCA 4FJLA 3N4PA 4OJ6A 2BQ3A 3DXMB 3HW8A 1RG6A 1NBWA 3CM5A 2L5YA 2FBXA 2ZIVB 4H0PA 2YNHA 2JH1A 1Y88A 5AI0A 4JLHA 3ZX3A 1XU4A 1GOBA 2OPQA 7ICEA 5KQDA 4I27A 1U2VA 3KD3A 3L8BA 2QB0A 2GTDA 2DKZA 5KFRA 3IKMA 9ICCA 8ICIA 2P9KB 2KSOA 4MEYA 1D9DA 3RAXA 2O8FA 3NE6A 3NVZA 4QZBA 4BWMA 3KKRA 2JMGA 5DLFA 3O3HA 3UKRA 4GLXA 4BVPA 4OJRA 2UVWA 2FBTA 2N1RA 3EYZA 1ZQDA 4FJIA 5G5HA 1YJNN 3V72A 3NH1A 3GV8B 1B22A 3I8BA 4P4MA 1ZQFA 2XY8A 4BRNA 3H4BA 2C28A 2YX6A 5DM7L 2FMPA 1V85A 2G06A 1DLOA 5J2JA 4B3MK 5J2GA 4JK1A 2CN1A 7ICNA 4IG0A 2P9SA 1FIQA 4FW1A 3VQ7A 5C12A 2BCSA 3KK7A 3QU7A 5I42A 3KKAA 3MXMA 4AYBC 4Z4GA 4KLGA 4NV0A 1VRUA 2A40A 3WT0A 4NCGA 3H4DA 3ZSRA 4LF4K 1OH5A 3KZBA 5AZIB 4CEQA 4CZJA 4FJKA 1K73O 4W5NA 5AQOA 8ICGA 1RBTA 3ISBA 5KFJA 2KW4A 4A5AA 2DY4A 2Q0UA 5AM4A 4JHDB 4CBUA 4DU1A 4LF8K 1F21A 2G5IB 2E8OA 4ECRA 3SUNA 2ZE2A 2ATQA 2H3QA 5L1IA 2BQUA 1SWVA 1NGCA 1B0XA 5DQHA 1R59O 4LF5K 3NMUA 2ISPA 3G0ZA 2FDRA 9ICQA 3BS7A 1R0AA 3NF7A 2YHXA 3ZD9A 3ATVA 3UXOA 2IC3A 4QWDA 2E8AA 3A5OC 3O4NA 3QNOA 3QUQA 2D0PA 1A0PA 2HHTA 4QWBA 2F3NA 5A0LA 2IBKA 1BI4B 1RGIA 2PFUA 4FK2A 4EEYA 3CMAN 1WN7A 2AP1A 4DV0K 2P9NB 4QW9A 3HJFA 2A1JB 5EWEA 5CRXA 3SJJA 3C23A 4NXNK 4B3RK 4TQRA 3PVXA 1ZQ1C 4BRGA 3N7PD 2E8NA 4CHQA 3BQ7A 3C0BA 3MAQA 2BCRA 3T7ZA 5AI6A 4HWIA 4FYDA 4I2HA 1O13A 3WNGA 2KVSA 2W6LA 3UKRB 4C7ZA 5E41A 4Y2JA 4DF8A 3S41A 5KFNA 2YHYA 1IG6A 4JN4A 3QB0A 4PZNA 3H1QA 4CJLA 2G8WA 3AU6A 3GQCA 4KO0A 3DLLL 1T8EA 2G5HB 3C2KA 1KKXA 3D45A 4YOUA 1GLJO 5AQNA 3PY8A 1T05A 5M1OA 4CZHA 2KV2A 4PGXA 1KDHA 3H3NO 2WF7A 3AY9A 5ADXA 5AM0A 2WTUA 1BPBA 1T4GA 1J5OA 1N5YA 1QCKA 1N56A 2WOMA 2VG7A 4DQQA 3GIKA 9ICXA 4W5OA 5KFOA 1RNHA 4ID5A 5C10A 5J2NA 4M3ZA 2K8BB 2RN2A 3FAHA 4FLTA 3QUTA 2QWOA 3NFAA 2GLEA 4RNMA 4GXIA 5DGAA 5AQPA 4Y0WA 2JEFA 4K25A 5J1EA 2NRXA 5DGBA 4BDYA 5DM6L 1EKEA 4GC7A 2JLEA 4ZOHC 8ICUA 2G8UA 4KX5A 1MWMA 2YMQA 5LMNK 4RNOA 2WUSA 2VGMA 1HMVA 4LD0A 3WNEA 3LDQA 5L1MA 3LDSA 4C0ZA 3IDWA 4WQ4C 3NVWA 2VWKA 1B92A 1PK3A 4UATA 4CF3A 2E2PA 5ALMA 1AROP 8ICQA 2JWKA 1LVHA 4BRIA 3M6GA 2CH6A 3VQCA 1YJ9N 4LSNA 2ZTCA 2A1RA 2XY6A 1L5UA 2DFFA 1TKXA 2EHGA 4IOXA 4ED8A 4KLFA 1NMDA 4MLHA 1FK9A 2HDOA 3MFIA 4Q8EA 3U4LA 4PL8A 3LPTA 4IOAL 5KFVA 3KJVA 1RPLA 2WF6A 5KL8B 1X3MA 2YI1A 4WYBA 2F8SA 1N34K 2LM1A 4P0QB 1JI7A 3OS2A 4GKKK 4Y2RA 3Q8KA 4KITB 4QZGA 1S0VA 1ZQIA 4GY2B 1JCEA 1ZQRA 7ICHA 2OPSA 3DXKA 1UOCA 1C1BA 1KTQA 5ALQA 4O5CA 2Z1HA 5FP0A 3HILA 2XO7A 2G8IA 7ICQA 4EX6A 4IJNA 3VQAA 4YMOA 4YOYA 4ELUA 3SQ1A 4OPKA 5AQHA 4BRFA 1RDFA 2PBDA 4AHRA 5DDYA 2V9WA 1YAGA 2ZGYA 2IOFK 4A8EA 9ICNA 4DG1A 1ZQAA 4RW9A 4M6WB 4OJLA 5GTIU 2JEIA 4RQ4A 2A1SA 1H1VA 1ZQSA 3DWLA 3HTVA 4CJPA 3NGYA 2VQEK 5J2EA 5HHHA 3M1YA 4KLDA 4ZTJA 1XMOK 2HHWA 4QCLA 4J9MA 4YQWA 3ZT2A 3RJFA 3HXMA 2A3VA 4BDPA 4XIUA 4QZ9A 2ASLA 2OA8A 4JK7A 1VLBA 5J0RA 3C5FA 1ZQCA 3RRGA 4M7XA 3OHAA 4FJJA 3NF6A 4CESA 5J2PA 3TAGA 1VK0A 2Q0ZX 4AQYK 5J2QA 1SZHA 1N2XA 2KZMA 1GLBG 5KT4A 1XO0A 3GOIA 3Q8PB 1SUQA 3KWIA 4DV2K 4X5VA 2D5RA 3ZSOA 4MO5A 3KKAC 3CP8A 4O3MA 1C0GA 4FWPA 5H2FU 3MN7A 1C0UA 4Q44A 4PA1A 2ZIWB 4G9BA 4F4YA 1KVBA 3HJEA 1W0HA 1K9MO 3AVNA 3QEXA 2QXFA 1RBSA 2P1JA 4IDHA 5HMMA 3TANA 4P4OA 3TSPA 3E9PA 2A41A 4I9LA 5ALSA 2RF2A 4AH9A 4ECZA 4KAZA 5J0XA 2VA2A 3D2NA 3RMBA 5HR6A 2FF3B 3QIOA 3KLGA 3QFUA 5CWRA 1DTTA 2K4HA 3MX5A 4F3TA 4USAA 5AM3A 1MA9B 1NJYA 3QMLA 4H0TB 4WQ5C 3HVRA 1VQ5N 4DCHA 4FLWA 2F9TA 3QEIA 4UBCA 5KFHA 3DV9A 4IWVA 3KZIU 2ZJAA 3OYDA 4U7CA 3TARA 1RTIA 5AQRA 4CVNE 4DTOA 1NGJA 3VERA 2ITMA 3OY9A 3GDXA 3JPQA 3AVHA 3MEGA 3TAFA 4B9QA 2HB5A 4H5WA 3HPGA 4UAUA 4CF8A 1EO1A 4KH5A 1Z3EB 5C0YA 1VSMA 4IO9L 5KFZA 4UB4A 1NOYA 2XIDA 4NY8A 2HMPA 1LW0A 2WFBA 3RB0A 3G6YA 3OVNA 2BQRA 1LKYA 2H3ZA 3DLGA 1FKOA 3SPZA 1ATNA 3AL0B 1F44A 4BRKA 4CK2A 1C20A 1TAMA 3M9MB 3V9UA 4G3IA 1JL1A 4KHWA 3EKSA 5KRSA 1KVAA 1GLEG 2GWKA 3A8YA 3UMGA 5HL7L 8ICYA 3OJSA 3RJJA 2IDOA 3K57A 3JXUA 3V6JA 1BDGA 5C25A 2CH5A 5BPMA 2AJQA 7ICMA 1FW6A 1VQ6N 4F4KA 5DB9A 1T3QA 1CEZA 1RXWA 2R7YA 1Q7YO 1TK8A 4LH4A 9ICGA 1IBLK 4L8RB 3KWGA 4M45A 1ZQMA 3LK9A 1Z4OA 3D2EA 2KN7A 3E2EA 5AQKA 1XSLA 2G0AA 5TKYA 3PR5B 5FLXO 1NGIA 1NI3A 3ZSWA 3TABA 4DFPA 3VENA 4HCCA 3FDSA 2WB1C 4IEIA 2NRRA 1ZQUA 3CM6A 4GVEA 3RFAA 2XCPA 2HBLA 2WC9A 5JU5A 2IOFA 2BH1A 1ZQVA 1U6ZA 4DLGA 1RT5A 5J0QA 4CZGA 5BR8K 3OS0A 4RWTA 4UARA 5KFTA 3QE9Y 3T5HA 1YITN 8ICOA 3CRXA 4JKGB 4A5BA 2GO7A 4K4IA 4EAHD 1L7NA 2KZZA 1BO5O 3KK1A 3THYA 4BQLA 4IRKA 3HVTA 5KFUA 3QINA 4CZKA 4PHAA 1X9SA 3H46O 2O8DA 4UB8U 4Z6FA 4O5FA 3ZT3A 5AKEA 2BTFA 2EZYA 3AUOA 4M0AA 5AFUH 3ZCMA 4QZDA 1M90O 4KB0A 4KI6A 3I56N 4FPBA 4WQ4A 3I1YA 4FCYA 4IQWA 1QZ5A 4ELVA 4AYBF 3ZT1A 2QK9A 3ZI4A 3L2WA 5AIAA 9ICJA 5F9LA 1HQEA 3CI5A 2AGPA 4XA5A 1ZJNA 2A5XA 2E1EA 5E79U 4I2JA 5KFGA 3VCBA 4DF4A 3LAKA 1T94A 1YZ7A 1VSDA 3EN9A 4JV1A 4FWMA 3TKAA 4Q45A 3LZIA 1YJWN 3HOSA 2W9MA 2YNIA 4F8RA 3LP0A 4KTZA 2FBYA 1HPMA 2LI6A 3SV3A 4Q43A 4BC5A 1BQNA 1XQSC 4UB6U 2JWLA 4UB1A 3CPEA 2VWJA 3V9SA 1E4GT 3IDHA 2R8GA 3E1YA 4KV8A 3RTVA 4AHSA 1EX4A 3L6QA 4Z6DA 1JLGA 2AGOA 2YHWA 3FZKA 3WQTA 4DTJA 2O8EA 4FS2A 4FJ8A 2AA4A 2KKPA 3VQPA 3K58A 3LZJA 3OJUA 4F5OA 2GH1A 5EOYA 3TTCA 3E66A 2WTFA 9ICMA 2O8BA 5BRHA 2KZ3A 4O44A 4JB3A 4CGIA 3O80A 1I39A 4CJRA 3V6DA 5KRTA 4BVOA 4DOAA 4NLGA 1RDDA 1BPEA 1WCNA 1S97A 3VQEA 4M9HA 2KOBA 3PSPA 1X9WA 2IA6A 1VQON 1VJ5A 4AM7A 3NGZA 5AICA 3NRZA 4CFBA 4CF2A 3VA3A 2DTUA 3SAHA 3KVGA 5LL6Z 3IV6A 3SBTA 3HSCA 4AHTA 9ICVA 2K60A 3GZFA 3BDPA 1SL0A 4CD1A 3JPPA 5AK3A 4DSJA 4DTPA 3T5JA 2KFNA 3U3GA 4FL9A 1Y97A 1IM4A 3MGIA 4E19A 1JN3A 8ICTA 3WUHA 3F2CA 4F4ZA 3C65A 3CC2N 4BR2A 2LMRA 4BRAA 1HX1A 2MAXA 3PX6A 1TV6A 4Y2QA 1BNPA 2NRHA 4FE3A 4KX3A 4JKGA 1V97A 4OD0A 1RBRA 5KG4A 2UYTA 1KBUA 2MRLA 1NGHA 4MF8A 2YMMA 5ALXA 2V7YA 4JK8A 3P39A 2ZM6K 2HHVA 1D8YA 3OYKA 2F1IA 1HKGA 1TUUA 4H8KA 4KN4A 3ASMA 5K4LA 2QA4N 2R8IA 3TTDA 4M3UA 2KMDA 4CF0A 2FBVA 3BQ2A 3M9NB 4IJAA 1ECWA 3MECA 3VQ6A 4DR3K 4O3SA 2C2EA 1VQKN 2F1HA 4R5PA 5J2CA 4XRHA 1QQ7A 3HO1A 2K4IA 3LP1A 3SAGA 2FMQA 4DTUA 4DR6K 2OHFA 1U45A 4FK4A 4KMOB 5KL1B 8ICZA 2NLXA 5D46A 5KFCA 4BX9C 4GXJA 3FE1A 2Y0SF 4HHTA 2HMXA 1J54A 4WFAL 3PX0A 3FFIA 3C2MA 3PW7A 3T5KA 2P9SB 4N47A 2W9BA 4B1WB 2NRVA 4Y1DA 5ALEA 7ICRA 3VF4A 1Z05A 4JV2A 5CE3A 4B08A 1OVQA 1ZC6A 5CR4A 4C80A 8ICCA 3K5NA 4M3WA 2FSKA 2EQYA 1LAVA 5JS2A 3TTFA 1WCLA 4DLEA 9ICOA 2I5HA 3ULDA 3H6EA 2KHQA 5M1QA 4KLOA 1BUPA 3H8MA 2Y9TA 1MN8A 1EQYA 4OPAA 1X66A 3J81O 1KL9A 4B9UA 4DSIA 2VANA 4HAIA 1ATRA 2W9CB 4F5RA 1OVYA 2ZQBA 3CERA 5DG8A 3T1YK 1F5SA 5F3XB 4ILJA 3VQ4A 1N5XA 1Q81O 5GAHP 4LH5A 3NTUA 2ZIUA 2E6MA 1N5WA 2WF8A 4FZMA 3RB3A 3LDLA 3VF2A 4KHNA 1P90A 2BKEA 5KT3A 3K1ZA 4BROA 2UXCK 4IS7A 4FZNA 1WAJA 3ITHA 2VJ4A 3BP8A 1ATSA 4FOEA 2C2DA 1KN5A 1BGXT 1ZQPA 1QQ5A 4N56A 2AH5A 4IFEA 2RE2A 1DK2A 1VQ4N 1RDUA 2FPKA 4DU3A 4TSXA 8ICWA 4OKKA 2JZBA 4E1NA 1VQ8N 5HHIA 1C1CA 2F9WA 1JRPA 4KMUA 5AQLA 4DEZA 4DL6A 2KHOA 1Z00A 3MN5A 4Y2PA 2CRXA 3MDAA 5KT7A 4KLIA 3RRHA 3GBTA 2G8HA 3T1HK 2BR0A 1ZQJA 1C0FA 3SUPA 3RR7A 1S0OA 4EZ6A 2LM4A 1RDBA 1YVNA 1HNVA 2J4RA 4RW4A 4YORA 2QWQA 3CYMA 3BF3A 4KHSA 4IBNA 5IIMA 5CJ7A 1QQNA 2GBZA 3QU2A 1RDCA 4IQUA 4GVMA 3AU2A 1T03A 1IXRA 1EXNA 3VQ8A 5HRPA 3PO5A 2KE7A 4FWOA 4MF2A 4CW7B 3NVKA 2NRWA 3OYLA 2ZIXB 3A0IX 2K4EA 1X40A 4AF1A 3E58A 2E20A 3OTQA 1ZQHA 4U67L 1QSSA 3KD5E 4QJFB 2W7PA 4FLVA 4X65K 1ZD3A 3SNNA 8ICFA 3RH5A 2BE2A 3HPHA 4CJQA 4CK1A 2PMZC 3D2SA 4CEBA 5AQYA 5KG0A 4DV5K 3OHBA 3C6TA 1DGSA 2VWBA 4M47A 3DLKA 3VGMA 1CZAN 4C8KA 2WONA 3QICA 3UKUA 4DS4A 2D6FC 3U9DA 1QZ6A 3HT3A 4JV0A 2HHHK 1NZPA 1NOZA 3M1FA 5F1XA 3O0FA 1KQQA 3CMEN 4H4OA 2W9BB 3F2DA 2BPFA 3WEEA 4JS5A 5JICA 1BPXA 3ZDCA 1U47A 3P5JA 1C0TA 4JAXA 3KHLA 2LKYA 2HBJA 2I9GA 3MN9A 1RQLA 4K42A 4PKGA 3CW2C 2H3FA 3QEAZ 4NLNA 2IIRA 4WFBL 3ALYA 1CXUA 3AVCA 4IQVA 3HSTB 1WBBA 4HYKA 4B1UB 1ZBLA 3FZHA 4H5TA 3SK3A 1Q8KA 3UPQA 2W41A 3V6HA 2BUPA 3L4QA 4P2HA 1RT1A 2PAVA 2RKIA 1XMQK 1ZQXA 1FO4A 1JMSA 3M3ZA 4H0OA 5FPNA 2HSZA 1REVA 1ZRNA 2YNFA 2DFEA 4MQ3A 2PZSA 4CGGA 3JPSA 8ICRA 3S3NA 5J2BA 1UWBA 3R6MA 3VGKA 4AILC 3C95A 1FEZA 2IAJA 4CIGA 3DAWA 4EZ9A 4CHYA 4HVJA 5J0SA 1FXXA 3TFSA 2HF4A 2P6RA 3VQDA 5C2FA 4QNLA 1Q46A 4FXDA 3MBYA 3M6KA 3ZEUB 1H38A 2F8KA 3IS9A 5BPNA 3VETA 8ICSA 3RR8A 3SCXA 3OYMA 4IFYA 1HPZA 3W3DA 3IP4B 1J9AA 3HK2A 5IWAK 1LAWA 5KFMA 1PK1A 4WCEL 3OA9A 3SBGA 2PI4A 3ED5A 1WUDA 2MU2A 9ICUA 3IFRA 4CERA 3NGDA 5DKWA 4YXMA 3QU4A 3N97B 2OEHA 3CJAA 3LM9A 4X66K 4J8FA 2YMPA 3D2QA 4UB2A 3JSMA 5AIBA 3QEVA 4BRDA 4F4XA 5KFYA 5CHIA 1A77A 2IGIA 4O4GA 3SENA 4FLYA 3KHYA 2E2QA 1G15A 3AQEA 3MCPA 2OH2A 3ICXA 5CR0A 8ICLA 5CYQA 4K4GA 3PSIA 1QSYA 3WKCA 4CCHA 4PGQA 4CEAA 1SS6A 4DU4A 4FO0A 4FJHA 3OYJA 3LP2A 3GDQA 4JKEA 1YZ6A 4CJSA 3VQ9A 5EE0A 2C2RA 2AHOB 1VSLA 1ZBIA 4LZDA 3BS5A 4F92B 4I7FA 3EEQA 8ICXA 4FM0A 4YR2A 3NDKA 4FM1A 2XI9A 5J2AA 1JXEA 5ALTA 4PHEA 4DL7A 2P9IB 4E0DA 3OW2M 1DRGA 4DB3A 1KLNA 1HNIA 2CGJA 3G6EN 5DBAA 4EHTA 4QAGA 5KFAA 2W8KA 1C0MA 3MDQA 5FRNA 3H0MB 5KPZA 3NUQA 4QZCA 2D0AA 1RBVA 4DL2A 1A6SA 4A2AA 2E88A 1J5EK 3MDCA 1BQMA 1SZPA 4GXKA 3EUB2 1DK3A 4PGYA 1HUXA 2MA1A 2ODGA 2DPJA 1NGGA 2W6KA 4ED1A 1N48A 1Z6RA 4B6JA 4KB1A 4JEPA 5C2DA 3GU3A 5ALKA 3NF9A 1U49A 3WK7A 3OYBA 5J2IA 1JLQA 2LYHA 2G8KA 4BR7A 5E26A 5C15A 3PV8A 4P4PA 4LZGA 3L0QA 3MX2A 4NLKA 4MDBA 3Q7CA 3AVKA 3OSPA 1U48A 4IO8A 2V51B 4DS5A 1JCFA 1HRHA 3KKSA 4O8UA 4LY7A 1S3XA 3TPQA 4UAWA 4Z4HA 1DTQA 3VEVA 1D8LA 3GV5B 5AQVA 4O55A 1S1VA 5AZJB 2H3VA 5TZVA 3DXMA 5AK5A 5J0TA 1TL3A 3RMCA 1D5AA 1XI1A 4PH5A 4G9ZA 3C6AA 4BR5A 4N5SA 1HYZA 4WFNL 1QE1A 1QQ6A 2HOIA 1N8RO 2E2NA 4KFBA 5CP2A 1CRXA 1SZ2A 2X78A 2BPCA 3F9MA 1LWEA 2A3ZA 2F1JA 5KFFA 3ZDAA 4ECQA 4W5RA 4IKFA 2Q97A 2B4JA 4K0KK 1DOQA 3BQ1A 4BRPA 3CC4N 4CFAA 3HX0A 4W5QA 2WB1F 2BHNA 3UXPA 1GOCA 8ICVA 1YXQA 1DKGD 3RJHA 1WOQA 4FWKA 2ZJRL 1BIZA 3F9KA 3NRWA 4YVZA 3ULEA 4J9LA 1HEKA 3MFHA 2LBOA 3SMPA 4XEIA 2ALZA 5AHXA 3AVFA 1VSEA 1QQCA 2DPIA 2E5SA 4B8AB 4YY3K 3RJGA 3CNHA 3QBWA 4IG3A 4OLBA 4I29A 3HM8A 2OYYA 1D8BA 5J8YC 2Y1IA 1YVUA 3DDHA 3O9SA 1E3MA 5EWFA 4JI8K 2YNGA 4OGCA 5ALUA 2E3TA 4FO6A 1MQ2A 1Z19A 1CI4A 1UA1A 4CD3A 2A1JA 1HJRA 1XC3A 2HOFA 1DGKN 3A5LC 1XHZA 3WK8A 4C8OA 4DSLA 1NGEA 2PYLA 3EY1A 1UAXA 4I2IA 3CCLN 2P35A 1NZBA 3TADC 1JLBA 4E7IA 4EELA 2J6UA 3L2VA 3AVMA 3KLHA 3V6KA 2LSNA 1FKPA 4TUQA 4B9LA 2V7ZA 3LDNA 4LFCK 1KAYA 4K41A 3MEDA 4FWNA 2UVUA 5BREA 3U9ZA 4PPXA 4BGBA 2NO4A 3MWTA 3BUZB 4YXJA 4BE2A 4QZHA 1WYGA 3NVMA 3ZT0A 2KIWA 3L5KA 4QIWF 1U9LA 4CJ4A 3HPOA 3THYB 3F5TA 3WXIA 4ICLA 3ZSYA 4ZTFA 4IR1A 4A62A 4B9SA 2O8DB 3RJEA 1OUQA 4U6PA 4B3SK 2DGZA 3VEWA 3SI8A 3SZ2A 4MHVA 4KH6A 1Z4NA 4CZIA 4LF9K 1SV0A 2W42A 3V9ZA 3CFOA 1TV9A 2WF5A 5IIIA 4ILHA 1Z1VA 1JXBA 4Z0UA 4RNNA 9ICWA 5KG1A 2KVCA 5DB7A 4KLMA 2E6LA 5B8HA 3AO2A 1RYSA 8ICJA 2ASOA 2HVIA 1L3UA 3OYAA 3NVVA 4JS4A 1L7PA 1QTMA 1J97A 5DBCA 4J9QA 2IVOA 3IRUA 2KHVA 1WWUA 4RPXA 3CCEN 4ELTA 4CJTA 5KNIA 2ZJQL 1NGBA 1EXQA 1Y64A 1RDAA 2VG5A 3VEXA 1QVGM 1VQMN 5JLFA 5J2HA 5L1JA 3MEEA 2P5GA 1CLQA 4CEFA 1HKCA 4CHZA 4MEXA 4BG9A 4EP4A 2V52B 1JX4A 4FVUA 5KPTA 4FWLA 4CJ5A 5IIOA 2VG6A 3NHGA 2F77X 2HBMA 4RQNA 3CETA 1ED1A 3L4IA 7ICIA 3O3GA 1WB9A 1RTDA 1VDVA 2FPLA 2QI2A 2EDUA 3I0SA 3C6UA 3O1BA 2QWLA 3IRXA 8ICEA 4MDAA 4B1VA 3M6ZA 1U04A 5AM5A
chains in the Genus database with same CATH topology
4B9VA 4I2FA 5KT2A 4QWEA 3G71N 3LDOA 3HI0A 2ZUBA 4YG2A 5DB8A 3B0XA 1JCGA 4JNEA 3SLCA 4BC2A 1QLNA 4ED3A 4KLSA 1NOMA 3TSQA 2R8JA 4DKWA 1MC8A 3LDPA 5DG9A 2I7NA 3ENOA 2ATLA 2ZJ5A 3GE1A 4BRHA 3ZD8A 4EBCA 5BRDA 4FWSA 2UVRA 3MR6A 8ICBA 1GLAG 2PI5A 4MFCA 4ISFA 3QDKA 3UQ2A 1ZQOA 2Q1NA 7ICSA 5M1NA 1Q82O 1NWKA 3PW5A 4EYIB 4OO1J 3D2FA 4IR9A 4O9MA 2AGQA 4UQGA 4I2EA 4DWIA 3PW4A 4YMMA 4DOBA 2D4WA 2BGWA 3ENBA 1GLLO 3H7IA 1NJIO 1NK4A 4CZLA 4F5QA 7ICUA 4BC3A 1WUAA 4C1NI 4YR3A 4YCXA 7ICJA 1D4XA 5AQMA 3JPNA 5JLHA 4MFFA 5JVGL 1UT8A 4ECXA 2AQ4A 2P6UA 3CCUN 3QEBZ 1JXLA 5J0YA 2NRZA 5TKWA 5DBBA 3RJIA 3EO3A 3ZDDA 1L3TA 3TAQA 1W2BM 4ED6A 4QZFA 3B8AX 4BQZA 4JKAA 4EBEA 1S0MA 4EBDA 4Q8FA 4DFKA 3VOVA 3AAPA 4ECWA 3PLAA 2P9PB 4RQ8A 8ICHA 4TUSA 4I2BA 4ILGB 4TQSA 1XO1A 3C21A 2HW3A 4BG8A 3TI0A 7ICPA 1HJOA 3ID6A 4F2RA 3LWLA 3SAFA 3D7EO 2IMWP 3C7NA 3FZLA 4TURA 2W8LA 4K43A 3ENHA 3H1VX 3J7ZO 3KHHA 5E84A 1S10A 5FPEA 3EZ5A 3PIOL 3JPTA 3RH4A 2ZGZA 7ICFA 3V7JA 2FSJA 4JWNA 4M9NA 1NK7A 4J9RA 9ICKA 3O9RA 3FZMA 3A5NC 3CJBA 2OTLN 4KLLA 4R79A 3M5RA 4RT3A 3MN6A 5BPLA 1ZQWA 4R66A 1NK5A 1M1KO 1NK9A 3FZFA 1NGAA 3QFPA 5M1PA 3UKUB 3EPIA 4R8UB 3EZWA 3O5BA 4YD1A 3CCSN 9ICEA 1T3NA 4XH5A 4F2SA 5JMVA 3WEEB 4O5KA 1MDUB 1U4BA 3HZ6A 4DL4A 5F9NA 3H8WA 3EWAA 5EX5A 2Q2RA 2R8HA 5BN8A 2E1ZA 3KHGA 2I7PA 2ASJA 1V4SA 2CGLA 4QZEA 5EOZA 4UAYA 4B1YB 4ECTA 2DFLA 4O0IA 3GFKB 3PX4A 4GV6A 2VCPA 5IILA 2XY7A 4M63C 3ZDBA 5I9EB 5HP4A 4JWMA 4KLEA 8ICNA 2A6AA 4Z6CA 3W0LA 2ZJPL 4QW8A 4JUZA 3GILA 2ZWHA 1LOTB 4YOTA 2PXIA 4BR4A 5KQ8A 2J6SA 3KHRA 4H5NA 9ICRA 4WQ5A 5DG7A 3B0YA 2ZTEA 1TKDA 1SKRA 5AQGA 3M8RA 2IVNA 3V7KA 4RQ1A 2GX9A 2P9IA 1TAQA 1JIHA 5KG7A 5GADP 1RDWX 4NLCA 4R8UA 1ZYQA 2HSTA 3A5MC 2P9LA 2NZTA 4HTLA 4BRLA 1NLVA 4RQ6A 1RXVA 3BQTA 3Q8RB 1ZBSA 4A59A 4GV3A 4FWQA 1COOA 1L3SA 2ASMA 4CBXA 5BPCA 7ICTA 1KD1O 3CJCA 1SKWA 2W9CA 3UQ0A 1K1SA 1S0NA 3J8AA 1KRPA 3PW2A 4UB3A 4ECYA 1VAZA 4XH1A 4MFAA 4ED2A 4DSFA 2FPMA 2IHMA 1ZXOA 4AM6A 3SJHA 1TFRA 2QEXN 2HF3A 2P66A 3D2EB 3Q8LA 3CQXA 4O8KA 1X9JA 3EKUA 2ZUDA 1ZJMA 3MK6A 2QTDA 5J2FA 1VQLN 4BXOB 5JVHL 4YR0A 3HWTA 4F50A 4RPYA 3RBEA 5KG2A 5LJWA 3H45C 4XUSA 5GAGP 5GIPA 1XSPA 5KFLA 1IJJA 2EWSA 1T44A 3TU5A 3WXKA 1U2VB 2P9UB 5CA7A 4RQ0A 5F2RA 2QWPA 1ZQGA 2XC9A 4M6WA 2ASDA 3QZ8A 1BG3A 2Q31A 4FBTA 3VEOA 1BPYA 1SL1A 4A61A 2IVPA 2NNWA 3Q8QB 2FLLA 1NKEA 5ELZA 4I2DA 4KLUA 1HJPA 3CJ7A 2YJEA 3QBXA 4DQPA 5KFIA 3WXLA 5D49A 2ISOA 4KTQA 1TK5A 4EYHB 2MUTA 1BVSA 3RJKA 4A57A 1HUZA 1T6DA 1VQ9N 4C8MA 3D6RA 3G6VA 1YIJN 1CUKA 3N4MB 1YF5L 3PIPL 3GG4A 2XGPA 2C22A 4BC4A 5J29A 5IIKA 5HNKA 4DO9A 4KBOA 3C2LA 3AAQA 3JPOA 2ZJ8A 4J9KA 3T3FA 4KLHA 3PW0A 2HOEA 3WXMB 5KFKA 2D1KA 5KT6A 1KFTA 1KFDA 3RH6A 4ZH4A 2GELA 3AARA 4DL3A 1XUPO 3PMLA 2H5XA 3EE8A 3O9TA 2UVVA 3O08A 5KG5A 3MR2A 5KPRA 3EW9A 1SQKA 1X9MA 4BRQA 5AZIA 5L9XA 3TQ1A 1SL2A 4ISEA 2YJFA 4QS7A 3FFKB 4RQ2A 2W40A 5HMLA 3P38A 4H0XB 3MWPA 1SKSA 4PHTX 4M9GA 5EVZA 9ICPA 1NK8A 3UE5A 4J9OA 4QS8A 4BREA 4J9SA 3M9OB 3CIPA 4B9TA 2B21A 3CCRN 4IRCA 4RPZA 1K8KB 1ZQYA 2P9NA 4C8LA 1NJXA 3VEZA 3WQUA 1V4TA 3RB4A 4IRDA 4Z6EA 3JPRA 1QQMA 1S22A 2I1QA 2ZF5O 5EY4A 3U8XA 5H1SQ 3ZETA 3P4IA 5DDMA 1K8AO 4QZ8A 3ZX2A 4ECUA 5BOMA 3CHWA 4ISGA 4BGAA 1LV5A 5AQUA 3EL2A 3LL3A 1KFSA 1NKCA 1RZTA 4F5NA 1S77D 3RSEA 1ZQLA 3BJYA 1HKBA 5IIJA 3KTQA 3Q8SB 4NLZA 4DQSA 4CZEA 3VESA 1MSWD 1BPDA 3CJ1A 5KFDA 3DXKB 1K1QA 3I33A 3CCJN 3VGLA 4DL5A 4YDUC 4RCHA 1ZQTA 1W97L 5KG6A 4XH4A 4KLQA 4RTFD 4BY9C 1T7PA 1QVFM 1GLFO 1K8KA 4YDUA 5CB1A 1YHQN 4C8NA 4QZAA 3ISDA 5AQQA 4F5PA 1L3VA 5AQWA 4RQ5A 3BF1A 3PO4A 3O1WA 4R63A 5MLCQ 1Z00B 3H8SA 4F93B 5L1KA 1HUOA 3H8JA 8ICAA 5KFPA 5LJVA 2BDPA 2Y1JA 3R1XA 3PMNA 3C1ZA 3GV7B 1GLDG 2FLNA 4NB4A 1X2IA 5KFEA 3QZ7A 2P9PA 4PKHA 4O3QA 1BOTO 2KKZA 2Q0RA 1VQPN 2OTJN 4LC9B 3VTIA 4M7YA 3TSUA 3P31A 2QXLA 3SV4A 3VPZA 2GUPA 3ZETB 4I28A 4YOVA 4YMNA 4F9OA 3MR3A 3CCMN 4Z94A 4WF9L 4UB5A 4I2AA 2VA8A 2QWRA 2PFPA 4NO7A 1TAUA 4F91B 2FF6A 4ED7A 4O5EA 5GIOA 5DB6A 4GC6A 3WXJA 3RSEB 4NLBA 4H0VB 1XWLA 1E4FT 4QZIA 3C5GA 4PKIA 1TVAA 1QHAA 1Q86O 1LB2B 1BA0A 3GIMA 1V9PA 2AU0A 3RVCA 2HBKA 3AGKA 4JKDA 9ICIA 3CC7N 3RAQA 1ZQEA 5BR9A 3ISCA 4BR0A 4O3RA 2IHNA 1TYQB 2VGNA 4MLEA 5KFXA 4H5RA 4YD2A 4I2CA 3R3LA 3IM1A 3BQ0A 3CCQN 3PR4A 4YFKA 4BRMA 4JHDA 2FXUA 2HHSA 9ICHA 1LCUA 2V4QA 1NK6A 4BRCA 5J0PA 5FPDA 3R8EA 3T5LA 5D4BA 3GIJA 4JD2B 4JKHA 1SAZA 2QWMA 4KN7A 2YCHA 3BEXA 4JKBA 4UY8O 1ILYA 9ICTA 3D2FB 4RQ3A 4CBWA 5EWGA 3RB6A 2M9NA 5M1FA 1UT5A 5DQGA 4F4WA 2HHQA 1ZQQA 2QWNA 3ORYA 4O3OA 3ZDEA 5AQIA 2RDJA 2V4RA 3CD6N 4C23A 3K9KA 5ADXH 3LDAA 3TFRA 1OKJA 5FPMA 4UAZA 2PFQA 3UB5A 1S72N 9ICLA 3SMSA 2W9AA 4UBBA 2R8KA 8ICPA 7ICKA 1JJ2M 3HP6A 4FPAA 4E1JA 4ECVA 3GIIA 3N4QA 5KT5A 3K75D 4ED0A 4M04A 4O3PA 4R65A 4PHPA 1S76D 5KTQA 1YUWA 1TYQA 5C5JA 5AZJA 4ECSA 3FYHA 4JD2A 3AGRA 4LVSA 2J6TA 1NK0A 1KAXA 5AQZA 4JKFA 3FR0A 4GV9A 1XC9A 3E9LA 9ICFA 4C1NK 4H0YB 3R9PA 3O9UA 4QS9A 1QSLA 7ICLA 3M8SA 4A2BA 4RU9A 4GNIA 2XCAA 3Q8MA 2CGKA 3ULEB 4CZFA 1TUYA 3RBDA 3FLCO 3JS6A 3I55N 1XSNA 3F2KA 1B43A 1NKBA 2FLOA 4J9PA 4B9NA 5J0UA 5GAEP 1KAZA 3K9JA 5AQJA 4U7BA 3LWMA 5KFBA 5DLGA 5AQTA 4B1XB 1BPZA 7ICVA 4J9NA 4H03B 2Q36A 3THVA 2GWSA 3V7LA 1NJZA 2D0OA 4RQ7A 4JK9A 4YOXA 3C7NB 2FSNA 2ZUCA 1BWFO 3C6HA 4DFJA 1KQSM 3ZX0A 1RYRA 2PFNA 1T6CA 3OHRA 3DJCA 5BN9A 3MR5A 4NM2A 4QWAA 2MUTB 4KLTA 3CPWM 3OSNA 8ICKA 4NXZA 4EFHA 3HBTA 3VMFB 5L1LA 3E9OA 5HOOA 1ZQZA 5KFQA 4FWRA 1UA0A 3CXCM 3UXNA 2KLAA 2RDIA 3G4SN 4BWJA 4B1ZA 4FBUA 4RZRA 1TK0A 1DT9A 1GLCG 4BGDA 4PHDA 1ZQBA 3VEYA 3CF5L 2HHXA 2KFZA 3SYZA 2BCVA 1BU6O 5KFWA 5BRFA 4YN4A 4YP3A 4FSVA 2RHKA 4B9MA 4IEEA 2OANA 3OBWA 1KXPA 4DHYA 3GL1A 2XGQA 1ZETA 5AR0A 2JZBB 1A76A 3K4GA 1ESVA 3O6WA 4RT2A 4BR9A 3FGUA 4M2YA 2F7TA 2AQ0A 1NM1A 2QW9A 5EXWA 2DPNA 4I6MA 3HOTA 8ICMA 3OBYA 5J0OA 4KH4A 1XS9D 5JUMA 3MABA 4RUCA 4DSKA 2P9LB 1NJWA 1ZQNA 5LY3A 4IQTA 3H3OB 4DSEA 2JEJA 4OPHA 5AQXA 3PNCA 4IOCL 5DQIA 1G99A 4MO4A 4H5VA 5KFSA 1RFQA 1PZNA 2VA3A 5M1KA 4PL7A 4I2GA 4DQIA 4KLJA 3EE9A 3OGUA 5J0WA 1C7YA 1BA1A 4XQ8A 4TUPA 1KSPA 4EHUA 3C1YA 3ID8A 3VTHA 1YI2N 5BOLA 3VF6A 5IINA 5AFUA 3MCAB 3MMVA 2ASPA 2A42A 4O3NA 1IG8A 2OWOA 4IXCA 3ETLA 1VQ7N 4BXOA 1J6ZA 4IZ9A 3O8MA 2FMSA 3G6XA 2HVHA 3G25A 3H40A 4DFMA 2JEGA 3HRGA 1VQNN 3IHQB 2HHUA 9ICBA 4YOWA 4I6MB 4M9JA 4CI6A 2E1YA 1HLUA 4R64A 3O4WA 9ICSA 5J2DA 2GWJA 1DEJA 2P9UA 4DQRA 2GEMA 2BPGA 4F3OA 1T3VA 4NM1A 2KTQA 1S9FA 3ZEUA 2P9KA 3CCVN 2FLPA 5KG3A 5AQFA 5J2KA 2ZTDA 4L3QA 1NGDA 3ATUA 4M9LA 7ICGA 4FS1A 3O9QA 1D9FA 4DOCA 2PFOA 2QM1A 5F0XA 9ICAA 1Q18A 4EIAA 2XY5A 3Q7BA 4CZMA 1NGFA 4K4HA 2NRTA 3IUCA 3IMXA 2E2OA 4FOIA 2BCUA 4RUAA 1QQOA 5AQSA 2H3GX 4CJ7A 5CHGA 3MGHA 7ICOA 1KEJA 1P8ZA 1ZQKA 1KC8O 4QWCA 3ZYYX 4DQ8A 3T69A 3CJ9A 3LM2A 1MWKA 3TAPA 2VYPA 1X3NA 3EPGA 2BCQA 1MQ3A 2WBNA 4JKCA 3N4PA 2BQ3A 3DXMB 3HW8A 1NBWA 4H0PA 3ZX3A 1Y88A 1XU4A 7ICEA 5KQDA 4I27A 1U2VA 2GTDA 5KFRA 3IKMA 9ICCA 8ICIA 2P9KB 4MEYA 1D9DA 3RAXA 4QZBA 4BWMA 5DLFA 3UKRA 4GLXA 4BVPA 2UVWA 3EYZA 1ZQDA 1YJNN 3V72A 3GV8B 1B22A 3I8BA 4P4MA 1ZQFA 4BRNA 3H4BA 2C28A 2YX6A 5DM7L 2FMPA 5J2JA 5J2GA 4JK1A 7ICNA 2P9SA 5C12A 2BCSA 3KK7A 4KLGA 2A40A 3WT0A 3H4DA 3KZBA 5AZIB 4CZJA 1K73O 5AQOA 8ICGA 3ISBA 5KFJA 4A5AA 2Q0UA 4JHDB 4CBUA 4ECRA 5L1IA 2BQUA 1NGCA 5DQHA 1R59O 3NMUA 2ISPA 9ICQA 2YHXA 3ZD9A 3ATVA 3UXOA 4QWDA 2E8AA 3A5OC 2D0PA 2HHTA 4QWBA 2IBKA 1RGIA 2PFUA 4EEYA 3CMAN 2AP1A 2P9NB 4QW9A 2A1JB 5EWEA 3C23A 4TQRA 3PVXA 4BRGA 3C0BA 2BCRA 3T7ZA 4HWIA 4I2HA 1O13A 3UKRB 4DF8A 3S41A 5KFNA 2YHYA 4JN4A 3QB0A 3H1QA 3AU6A 3GQCA 3DLLL 1T8EA 3C2KA 4YOUA 1GLJO 5AQNA 3PY8A 5M1OA 4CZHA 4PGXA 1KDHA 3H3NO 5ADXA 3AY9A 1BPBA 1T4GA 1N56A 4DQQA 3GIKA 9ICXA 5KFOA 5C10A 2QWOA 4RNMA 4GXIA 5DGAA 5AQPA 4Y0WA 2JEFA 4K25A 2NRXA 5DGBA 5DM6L 4GC7A 8ICUA 1MWMA 4RNOA 2WUSA 2VGMA 3LDQA 4WQ4C 2E2PA 1AROP 8ICQA 2JWKA 4BRIA 3M6GA 2CH6A 1YJ9N 2ZTCA 2XY6A 1L5UA 4IOXA 4ED8A 4KLFA 1NMDA 4MLHA 3MFIA 4Q8EA 3U4LA 4PL8A 4IOAL 5KFVA 1RPLA 4WYBA 2YI1A 1X3MA 4KITB 3Q8KA 4QZGA 1S0VA 1ZQIA 4GY2B 1JCEA 1ZQRA 7ICHA 3DXKA 1KTQA 4O5CA 2XO7A 7ICQA 4IJNA 4YMOA 4YOYA 4ELUA 5AQHA 4BRFA 2PBDA 5DDYA 2V9WA 1YAGA 2ZGYA 9ICNA 1ZQAA 4M6WB 2JEIA 4RQ4A 3DWLA 1H1VA 1ZQSA 3HTVA 5J2EA 5HHHA 4KLDA 2HHWA 4J9MA 4YQWA 3RJFA 4BDPA 4QZ9A 2ASLA 4JK7A 5J0RA 3C5FA 1ZQCA 3RRGA 4M7XA 3OHAA 2Q0ZX 2KZMA 1GLBG 5KT4A 3GOIA 3Q8PB 3KWIA 4X5VA 4MO5A 1C0GA 4FWPA 3MN7A 4Q44A 4F4YA 1K9MO 4IDHA 5HMMA 3TANA 4P4OA 3TSPA 3E9PA 2A41A 4ECZA 5J0XA 2VA2A 2FF3B 3QFUA 5CWRA 3MX5A 1MA9B 1NJYA 3QMLA 4H0TB 4WQ5C 1VQ5N 4DCHA 2F9TA 4UBCA 5KFHA 4IWVA 2ZJAA 5AQRA 3TARA 1NGJA 3VERA 2ITMA 3GDXA 3JPQA 4B9QA 4H5WA 1EO1A 4KH5A 1Z3EB 5C0YA 4IO9L 5KFZA 4UB4A 4NY8A 2HMPA 2WFBA 3RB0A 3G6YA 2BQRA 1ATNA 4BRKA 3M9MB 4G3IA 3EKSA 3A8YA 1GLEG 2GWKA 5HL7L 8ICYA 3OJSA 3RJJA 3JXUA 3V6JA 1BDGA 2CH5A 5BPMA 2AJQA 7ICMA 1VQ6N 4F4KA 5DB9A 1CEZA 1RXWA 1Q7YO 1TK8A 9ICGA 1ZQMA 3LK9A 3D2EA 2KN7A 3E2EA 5AQKA 1XSLA 5TKYA 3PR5B 1NGIA 4DFPA 3VENA 3FDSA 4IEIA 2NRRA 1ZQUA 4GVEA 2XCPA 2HBLA 2WC9A 2BH1A 1ZQVA 1U6ZA 4DLGA 4CZGA 5J0QA 4RWTA 5KFTA 3QE9Y 3T5HA 1YITN 8ICOA 4JKGB 4A5BA 4K4IA 4EAHD 2KZZA 1BO5O 4BQLA 4IRKA 5KFUA 4CZKA 4PHAA 1X9SA 3H46O 4Z6FA 4O5FA 2BTFA 4M0AA 3AUOA 5AFUH 1M90O 4QZDA 3I56N 4FPBA 4WQ4A 4IQWA 1QZ5A 4ELVA 9ICJA 3CI5A 5F9LA 2AGPA 4XA5A 1ZJNA 2A5XA 5KFGA 4I2JA 4DF4A 3EN9A 4JV1A 4FWMA 4Q45A 1YJWN 3HOSA 2W9MA 4F8RA