2NRTA

Crystal structure of the c-terminal half of uvrc
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrtA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrtA01
3G6YA 1S0MA 2GWSA 3MBYA 4YR0A 4F5QA 4DSJA 3RAXA 2ZTCA 4RQ5A 9ICXA 4DS5A 1NKEA 4ED7A 4MF2A 2FMPA 3RH5A 2B21A 3BQTA 4O5KA 2W8KA 4J9OA 1SKSA 3V7LA 5KFQA 5HP4A 1ZQRA 1IXRA 3M8RA 5CR0A 5DBBA 3UXOA 4UAYA 1ZYQA 2IBKA 3SI8A 3V7KA 3QEAZ 2BR0A 1NJZA 4DF4A 1XWLA 2MAXA 4BWMA 4J9RA 1L3UA 1MQ3A 2HHSA 1TK0A 2W8LA 3PX6A 1Z3EB 4C8LA 4ECZA 4RZRA 4JWNA 4F4YA 5KG4A 2C2EA 3MGIA 4YVZA 5CWRA 3KHHA 4F50A 7ICIA 5KFMA 9ICMA 5F9NA 4ECQA 2HHQA 1AROP 2MUTB 4P2HA 1X9WA 4IR1A 2ZJ8A 4DQQA 4M6WA 4ED0A 4DL4A 4YCXA 3FDSA 8ICXA 2I1QA 5J2DA 4DL7A 2A1JA 4O3OA 3ZD8A 2RDIA 4ZH4A 5KFDA 3M9MB 4RUCA 4ED3A 4DS4A 2MUTA 7ICRA 4C8NA 3JPQA 8ICHA 4DLEA 3TAQA 3B0YA 1ZQQA 4RT2A 1SL2A 5DLFA 5KFJA 3ZDEA 2BQUA 2BKEA 4MFCA 5TZVA 5KFCA 2NRRA 4RQ1A 1TVAA 5J2EA 4JV1A 1U4BA 4EZ9A 3BQ2A 3BJYA 1U45A 1SZPA 4IQVA 3EW9A 4R8UA 5J2GA 4QWDA 5KG3A 7ICJA 4F4WA 2F1JA 3T5HA 2XO7A 4YR2A 1S77D 2R8JA 4I2DA 4KLUA 2FMSA 1SL0A 1QSYA 3GILA 5DG8A 1TK8A 4Q45A 4UBBA 4DOCA 2BCSA 4DSKA 4O9MA 7ICUA 4YXJA 5J0SA 4DSEA 3C1ZA 5L9XA 2JZBB 5KG1A 5KT6A 1KSPA 1JXEA 5KFTA 3T3FA 4DF8A 4O5EA 5D49A 1U47A 2JEFA 5HNKA 4J9KA 4K4GA 4ECYA 2AU0A 3H8SA 2BDPA 3T5LA 3AU2A 5DQIA 2AGQA 2BPGA 4DQPA 3K75D 1DOQA 5DKWA 3H4DA 4ECWA 2KFZA 4Q43A 2AQ4A 3JPNA 1Y88A 8ICSA 4F91B 5J2CA 3AUOA 2NRXA 1ZQVA 7ICOA 4RQ2A 4RQ4A 1B43A 5BPCA 2ASJA 4C8OA 5KG5A 1L3SA 4B9MA 2BGWA 1ZQZA 4J9NA 3HPOA 4QW8A 4F5NA 1NKBA 5L1IA 5J2JA 2NRWA 9ICPA 4DEZA 2C2DA 2KFNA 4K4IA 1T8EA 1TAQA 2IHMA 4BGDA 4GC6A 1JN3A 8ICJA 5KFBA 3C2LA 4DLGA 4JV2A 2NRVA 2XY6A 3N4MB 9ICLA 5DBCA 5HMLA 3OJUA 2VA2A 5J29A 2F1IA 5CP2A 1BGXT 3C23A 4UAWA 3PV8A 1KEJA 1BPEA 3EYZA 3HT3A 1NK7A 4UB2A 7ICVA 5J0PA 4IRCA 1XC9A 4RNNA 1ZQFA 3V6KA 3HWTA 2XC9A 4PHPA 1ZETA 1ZQGA 4KLIA 4IRKA 4EEYA 1NK8A 8ICVA 2P6UA 5KFHA 4XRHA 4KLGA 7ICKA 4K4HA 4ECRA 2FMQA 4O3QA 3MDAA 3MR2A 5KFGA 4UQGA 4Z6FA 4Z6CA 5F9LA 2PFOA 1UT5A 2W9CA 1CEZA 3SZ2A 4PGQA 3K4GA 4F4ZA 4F92B 4LZGA 4FBUA 1LB2B 4HYKA 2BPFA 4Z6DA 2Y1IA 2UVWA 9ICQA 4EBDA 4DL2A 4I2FA 4NLNA 3PMLA 4KN7A 3MFIA 3T5JA 1JXLA 3PW5A 4F4KA 1ZQEA 4LVSA 4DL3A 1ZQBA 5KT4A 5DQHA 4ED2A 3RH4A 3H8WA 2NRZA 4DO9A 4J9QA 2PFQA 3BDPA 3PNCA 3PW2A 1Z00A 2BQRA 2ASLA 3M9OB 3HP6A 4PHAA 3MDCA 4KLSA 1NK6A 4I29A 3BQ1A 2KZ3A 1L5UA 4ECVA 4EYHB 2W9AA 2AGOA 4M04A 7ICQA 5JUMA 5J2BA 3Q8QB 4YMOA 4O3RA 2R8IA 1X9MA 9ICEA 9ICCA 7ICSA 4Z6EA 1ZQCA 4QZHA 4ELTA 5KFFA 4QZEA 3PO4A 5DDYA 2XY5A 1ZJMA 4DL5A 1UA1A 5J2FA 4DFJA 2DFLA 3GV7B 3Q8PB 2V4QA 7ICPA 3RBEA 3UXNA 4QZAA 4B9UA 1HUOA 5KT3A 1T3NA 4KN4A 5KT5A 3H40A 3ZDCA 2WTFA 4GXKA 5HHHA 3RRHA 9ICVA 1NK5A 4M0AA 1X2IA 2H5XA 4NXZA 1DGSA 3PR5B 3AU6A 1KDHA 4C8MA 1NK0A 1BPZA 1TAUA 1S9FA 5DLGA 3V6JA 2IHNA 3C65A 2W9CB 2JEJA 3GQCA 1NJXA 7ICTA 2VANA 5EWFA 7ICNA 4ED6A 2HHVA 5KFYA 3G6VA 8ICGA 1BVSA 1ZQXA 5J0UA 4RT3A 4F8RA 5DBAA 4TUPA 4F5RA 8ICYA 3OSPA 7ICLA 1BPDA 1JIHA 4RNOA 3QE9Y 5DDMA 5CJ7A 5IIMA 3THVA 1RYSA 2KZZA 4RUAA 1WCNA 5C5JA 1L3VA 1RXWA 4KLQA 5KFVA 1S0OA 2JZBA 5J0TA 5DB9A 4PHDA 2J6UA 5IINA 3JPPA 1MQ2A 2IA6A 8ICIA 2BPCA 3C21A 2R8KA 2HW3A 1ZQSA 5EWGA 4P4OA 4P4PA 4M9HA 4NLGA 4O3SA 3M9NB 2W9BB 3Q8KA 2VA8A 3MABA 5KFSA 4RQ3A 3UQ0A 3V72A 2BHNA 3KHRA 4RPXA 1RYRA 2R8GA 8ICLA 1ZQWA 4R8UB 5KFEA 1ZQDA 9ICIA 3E2EA 2HVHA 1XS9D 1EXNA 2ZUBA 8ICPA 3Q8LA 9ICHA 4ECUA 2FLLA 1LV5A 4ECXA 1SKRA 5L1JA 5J2KA 1COOA 5J0RA 4M9JA 4ELUA 5KFXA 2M9NA 4GXJA 3RJGA 1S10A 4B9LA 4IR9A 1HJPA 1PZNA 3GFKB 4PH5A 3ISBA 3KHGA 3BQ0A 4ECTA 3GDXA 2LYHA 4QZFA 3PVXA 2ALZA 1ZQKA 3RRGA 4YQWA 5J0OA 4J9PA 4EZ6A 4RQ7A 3RR7A 1XO1A 1QLNA 2AJQA 4YD2A 3PW4A 1KFDA 1XSNA 1SKWA 1IM4A 2ZUDA 5IILA 3PO5A 3RJFA 4F2SA 3C1YA 4M9LA 1H38A 3RJEA 4DQIA 2KN7A 4M6WB 5KFNA 3EPIA 2ZTDA 3ORYA 4TURA 3OJSA 2J6TA 3TQ1A 3TFRA 5DGAA 3RBDA 3NGDA 3EZ5A 3TI0A 4KITB 5D46A 3G6XA 4MFFA 4KLEA 4QWCA 4KLTA 9ICKA 4M9GA 2HHTA 1KFTA 4KLDA 4I2JA 4RU9A 1ZQOA 3PR4A 9ICFA 5L1LA 2FLNA 9ICJA 3RB4A 4R66A 1MSWD 2AGPA 1XSLA 5KG0A 4F93B 4C8KA 9ICWA 4IRDA 1NJWA 2PFNA 3RJIA 4JUZA 2XGQA 5EOZA 4DOBA 1NK9A 1S76D 5HMMA 4NY8A 3IM1A 4J9SA 4MF8A 5J0QA 3PX4A 3H7IA 4IQTA 2UVUA 4I28A 3MGHA 3EPGA 3M8SA 4ECSA 4M9NA 1MC8A 3QEBZ 3PY8A 7ICHA 1ZQYA 2BCVA 4QZCA 1A77A 4TQRA 4UB3A 3ISCA 2NRTA 4R63A 3SYZA 4DSLA 4M2YA 8ICAA 9ICUA 4FS2A 3GIMA 5BOMA 2FPMA 5J0YA 3V7JA 1UA0A 2UVVA 4O3NA 4DSIA 4QZ9A 4FO6A 1ZQHA 9ICNA 2Y1JA 3RH6A 4I27A 5L1KA 4UB5A 2BQ3A 8ICFA 4KTQA 2FPLA 4RNMA 3QZ7A 4XA5A 4QWBA 2W9MA 5KTQA 4BDPA 4F2RA 4BWJA 4F3OA 3V6HA 4O5CA 5DG9A 5J0XA 4EBEA 2R8HA 2F1HA 3RJHA 2XY7A 4YMMA 3TANA 5J2AA 4ED1A 2JEGA 3TFSA 2VA3A 2ISPA 5KFZA 2J6SA 2ASDA 4B9NA 1V9PA 3TARA 1QTMA 4TUQA 1S0VA 2HHXA 1TK5A 4KMUA 5KFAA 4YP3A 5DQGA 1NKCA 1BPBA 3KHLA 4IQWA 2XCAA 4KLMA 4UAZA 5DGBA 3TAPA 3H4BA 1ZJNA 3PX0A 3B0XA 4UB1A 5KG2A 3UXPA 3SV3A 3RB6A 1QSLA 2PI5A 1JX4A 4YD1A 4X5VA 1L3TA 2UVRA 1TV9A 4I2CA 2PXIA 3ISDA 3FYHA 4YR3A 3GV8B 4DFPA 5KFRA 4MEXA 2C28A 4QZBA 1CUKA 2RDJA 2HVIA 4UB4A 1XU4A 5BOLA 5DB7A 3GIJA 1ZQPA 1K1SA 3UPQA 4RPZA 2C2RA 3H8JA 4M47A 4Q8FA 1RPLA 1ZQUA 8ICTA 3MR5A 2FLPA 4I2GA 1NJYA 4BXOB 5DB6A 1C7YA 4EBCA 1KFSA 3JPOA 4QZ8A 3OHAA 5IIIA 4JV0A 3ZDBA 3HX0A 4ED8A 4MEYA 5KFKA 8ICQA 1JMSA 3Q8SB 4YXMA 3LDAA 2V9WA 2P6RA 8ICRA 3UQ2A 4GLXA 2ATLA 2JEIA 8ICKA 5KG6A 2HHUA 1D9DA 1A76A 3N97B 1U48A 1KLNA 4I2IA 5KT2A 4F5OA 1ZQJA 1RXVA 1RZTA 2Q0ZX 1ZQLA 2W9BA 3Q8RB 7ICEA 3JPTA 4PGXA 1KTQA 4E0DA 8ICCA 3OGUA 3OSNA 3ZDDA 4I2BA 5IIKA 1D9FA 7ICMA 2FPKA 4DL6A 5CHGA 5IIOA 4GC7A 3RJJA 4DWIA 1B22A 1NK4A 1T7PA 5KFWA 2I9GA 2BCQA 2C22A 2OWOA 1X9SA 4B9VA 4XUSA 9ICGA 4NM2A 3C2KA 4P4MA 4EYIB 3GIKA 3NTUA 1Z00B 2ZTEA 3SV4A 2HHWA 4O0IA 2BCUA 5IIJA 5DB8A 3HW8A 4DQSA 2ZUCA 3MFHA 1KRPA 4NLKA 3C5GA 3RTVA 4J9LA 8ICEA 4FS1A 4JWMA 4PGYA 2ZJAA 1QSSA 4TUSA 4RQ0A 4F4XA 1ZQNA 5KT7A 5KG7A 3LK9A 3LWLA 2IMWP 4KLLA 3RJKA 3QZ8A 9ICSA 3PMNA 1WCLA 5J0WA 8ICBA 3GIIA 3T5KA 4RQ8A 1BPYA 3EWAA 4QZGA 4QZIA 4J9MA 2XGPA 4G3IA 3OHBA 1ZQAA 1S0NA 8ICMA 4F5PA 8ICNA 4PHEA 1SL1A 1ZQTA 4QW9A 2BCRA 4R65A 5CB1A 2PI4A 2AQ0A 1D8LA 4B9SA 4DQRA 4KLOA 5D4BA 9ICAA 9ICRA 3RR8A 3RB0A 1UT8A 4QWEA 5KFPA 1N48A 4ELVA 8ICWA 9ICTA 2PFPA 3JPRA 3C2MA 4PPXA 3MR6A 1N56A 3Q8MA 4FBTA 2ISOA 3PW0A 7ICGA 5KFUA 4YG2A 4R64A 5DG7A 4NM1A 3ZD9A 4UBCA 1D8YA 4KLFA 5CA7A 1TFRA 3MR3A 5HHIA 3ETLA 1ZQMA 3LWMA 4RPYA 2A1JB 4NLZA 2V4RA 9ICBA 4CCHA 4QWAA 4TQSA 4I2AA 4I2EA 2DPJA 2KTQA 4RQ6A 3RB3A 1XSPA 3ZDAA 4O3PA 4KLJA 2KZMA 8ICZA 4LZDA 1T4GA 8ICUA 4I2HA 8ICOA 5J2IA 4IQUA 2DPIA 4Q8EA 7ICFA 4Q44A 4DSFA 4B9TA 4JK1A 4KLHA 5KFOA 5KFIA 2XCPA 3KTQA 4DFMA 3PW7A 9ICOA 3IHQB 4YN4A 5J2HA 4DOAA 2P66A 1K1QA 1BPXA 4YMNA 3C5FA 1S97A 3GV5B 1U9LA 4YFKA 3RAQA 4GXIA 2ZJ5A 4BXOA 5EWEA 4DFKA 4QZDA 4MFAA 4XQ8A 3JPSA 1U49A 1TKDA 1ZQIA 1NOMA 5KFLA 1HUZA
chains in the Genus database with same CATH superfamily
1T6DA 4KX5A 4CHZA 2YMQA 2G08A 1KBUA 4DSJA 1HQEA 9ICXA 3FZMA 1KXPA 4PWDA 4W5RA 4ED7A 4CEZA 2X6NA 4C1NI 4BRGA 4WQ5A 2FMPA 4B8AB 4LF8K 1QHAA 3BQTA 4PZOA 1Z1BA 3NVKA 4DU4A 2O8FB 2VG5A 3AO2A 2IVOA 5HP4A 1ZYQA 3NRWA 3GE1A 3UXOA 3L2VA 2HOIA 2BR0A 3CXCM 4AF1A 2W7PA 2A41A 1KLMA 1Z3EB 2H3IA 1WOQA 2IDOA 4JI3K 1DK3A 2BE2A 3KHHA 1XMQK 3C7NA 2GWKA 2KIVA 2QB0A 3A5OC 2YCHA 3CM5A 5AQFA 1X9WA 3U3GA 4X64K 1JLFA 2ZJ8A 2F8TA 3THWA 4CBXA 2E8AA 3BS5B 4O3MA 3WK4A 5FRNA 5BR8K 3CP8A 3FDSA 4FLZA 3KZXA 3BZCA 5TISU 1YXQA 4FWOA 4Z4CA 1KD1O 3SENA 3CMEN 2QB0B 1XNQK 3P1GA 4KX3A 4EP5A 4H8KA 4DLEA 3TAQA 3VQAA 4C4SA 5FLXO 2W42A 1NGHA 5AIBA 4KO0A 2CN1A 5DLFA 4PKIA 3BQ7A 1M1KO 5TZVA 2D4WA 3ASMA 4RW4A 2NRRA 2OANA 3JXUA 5J2EA 5AQKA 1G99A 4FJHA 4BE2A 4CJ7A 4IQVA 3QU5A 4R8UA 2DBYA 4CIFA 4I9LA 3IV6A 2ZIXA 1V4TA 4B08A 4QWDA 3MCAB 5KG3A 3OYNA 1Z1VA 2ZD1A 2G07A 5BPNA 3DJCA 5E79U 3QDKA 1SL0A 4UBBA 3IN5A 4DOCA 1JL2A 1Y97A 3QXGA 4YXJA 5J0SA 4DSEA 3NF8A 4CEOA 1C1AA 3C1ZA 1RDDA 3SPYA 3OTQA 3NBPA 2XI9A 2JZBB 5KT6A 4IG3A 3T19A 4LFCK 3FZLA 2Q0UA 1JXEA 4C4TA 3LDLA 2VCPA 3CCRN 3WEEB 1QQ6A 4BRDA 2FC0A 2D8CA 1YJWN 1UHUA 5KPTA 4GMJB 2FF3B 4ECYA 4HUFA 4HWIA 2BDPA 2LKYA 4E7IA 1C0FA 2OZSA 2R7YA 4BG9A 5AKYA 4U7CA 4DV1K 3CF5L 5LY3A 4Y2YA 5KGWA 3CC2N 3CPWM 3JPNA 1Y88A 4F91B 5J2CA 5CR4A 7ICOA 2ZG6A 4RQ2A 1B43A 1L3SA 1LWCA 4UB6U 4BX9C 5B66U 1NOZA 2P9IA 4QW8A 2NRWA 3J7YP 4E7JA 2C2DA 4LSLA 3QU4A 1TAQA 1DT9A 3FFIA 8ICJA 1HNXK 2O8DB 3AVLA 3W3DA 2NRVA 2XY6A 2YMMA 2QLTA 2EDUA 1A5WA 4BRAA 1NZPA 4CF3A 1KEJA 1BPEA 3EYZA 3CM6A 3HT3A 2EZXA 1OH6A 3P5JA 5HRPA 3C6UA 2DGZA 2I6XA 1ZD2P 4DTNA 3SAHA 2J4RA 1Z19A 2H3ZA 2K8BB 2P6UA 4XRHA 3M6ZA 4KLGA 4JI2K 4K4HA 5DK5A 1FFVA 2E8OA 4O3QA 1YHQN 3MR2A 4UQGA 5FP0A 1QVFM 4YOXA 2AHOB 3L3UA 2G06A 1NMNA 3I1YA 3IG8A 4CGZA 4US8A 4OLAA 3GDQA 3NCIA 4HYKA 3G71N 2OPPA 5ALQA 4P0PA 9ICQA 4ZTFA 3ID8A 4JD2B 5LL6Z 4FO0A 3F73A 1YZ7A 1RGIA 4KN7A 1JXLA 3H3NO 1RBSA 1L7OA 3ATUA 5CYQA 1DGKN 3H8WA 1GOBA 5ALYA 3PNCA 3PW2A 1Z00A 1O08A 2ASLA 3HP6A 4PHAA 4CJUA 5J2MA 4KHNA 4I29A 2KZ3A 4M04A 3L3FX 4K41A 9ICEA 7ICSA 9ICCA 1J5EK 3QEWA 1ZQCA 2I7PA 5EXWA 4QZEA 5DDYA 1Q18A 3ONNA 3SQ1A 2ZJRL 5J2FA 2YNFA 4DFJA 2DFLA 2IOCA 3KLEA 3ZLJA 4CJEA 3QU9A 4KN4A 5AQYA 5KT5A 1DLOA 1NZBA 2OPRA 1ZBIA 2ZJQL 5HHHA 3RRHA 2QWMA 9ICVA 3V4IA 1NK5A 3V9WA 2H5XA 2F9TA 4MFBA 4NXZA 1KDHA 3V1RA 4C8MA 1TYQA 1NK0A 3CCUN 1XMOK 1B92A 3K0SA 2JEJA 3NVMA 1NJXA 5JVGL 1GLEG 2VANA 7ICNA 4BR5A 1RDBA 3AO5A 2F2AB 3AVFA 2A40A 1IIPA 8ICGA 1BL3A 3E0FA 1GLDG 5J0UA 4F8RA 2HB5A 1GLAG 1QS4A 5DBAA 4TUPA 1BDGA 4BVPA 3AVMA 1B9FA 3J7AP 4FXDA 3MEEA 3RMCA 3QEPA 3OSPA 2KJ8A 4KHWA 1SXEA 2E6MA 2P9UB 5ALJA 3A0IX 4WYBA 5LJVA 4RNOA 4HUEA 1XHXA 3VEOA 1Y64A 1HRHA 1WB9A 4FCYA 1RYSA 2WUSA 4CJPA 1RXWA 2UYTA 1ESVA 4X66K 1CZ9A 1W9HA 3I33A 4YOVA 4AP9A 5ELZA 8ICIA 3C21A 1L6NA 3DV9A 4NCBA 1ZQSA 2B5JA 4EHTA 4M9HA 4O3SA 3ZSQA 2K8AA 5G5GA 3KD1E 3Q8KA 3DEEA 1R59O 5KFSA 3UQ0A 1GOAA 5ADXA 2BHNA 8ICLA 3VN5A 9ICIA 3D2FB 3PUFA 4CJ5A 3E2EA 4KH5A 3JYTA 4OKEA 1O03A 3UKUB 5I3UA 1S6PA 2UUCK 1D8BA 9ICHA 4ECUA 1PVRA 1C20A 3KWIA 5AQIA 3L4IA 4NCAA 4FWPA 5AQJA 1COOA 3E9OA 5C25A 3SNNA 2RRDA 5KFXA 4WCEL 3KKAC 3RJGA 4WQ5C 4JI4K 4MHVA 3RRGA 2IVPA 2JR5A 1ZQKA 3PVXA 4Z4EA 4J9PA 4EZ6A 3E9PA 3H0MB 4RQ7A 4YD2A 3PO5A 1JI7A 1SKWA 3RJFA 1HKCA 4EHUA 3PIPL 3C1YA 3RJEA 2QWRA 3NGYA 4M6WB 1NBWA 2DFEA 4FOIA 2ZTDA 4MDBA 4A62A 2NZTA 3UMBA 3AGKA 4WFNL 5CYMA 2VIXA 1X3MA 4NYFA 5FDLA 3RBDA 3LALA 4JKAA 3SQ0A 4KLEA 5D46A 3ALRA 4QWCA 4KLTA 2EANA 3OPXA 4PJ0U 3C28A 1CZBA 4JKFA 2O8CA 4H5RA 3PR4A 9ICFA 2FLNA 1ATSA 4R66A 1MSWD 3EN9A 1LCUA 4FM0A 3OY9A 3BS7A 3MC1A 4C8KA 4CEAA 3S41A 4OO1J 4FJ8A 5KAIU 2PFNA 1NMDA 3ZX3A 4JUZA 2XGQA 1S76D 4DOBA 2PFUA 3VQ4A 1J6ZA 2JMGA 1VLBA 5J0QA 3OVNA 2E88A 4IJAA 3JSMA 4PKHA 3QUTA 4IQTA 5GAEP 3O5BA 4JYAK 3QEBZ 3PY8A 4QZCA 3OYGA 5TKWA 2NRTA 4R63A 4CESA 4JS4A 1ECWA 3QB0A 2V7YA 2FPMA 3V7JA 2UVVA 4K0KK 1RQNA 3RH6A 3VQBA 1VQMN 5AI5A 1JXBA 3RMBA 1RT3A 4BDPA 3I8DA 4BWJA 4F3OA 3V6HA 5AKJA 2R8HA 3RJHA 3NH0A 1ATRA 4CHNA 4MO5A 5AI6A 2J6SA 1V9PA 3VCBA 1RT1A 4KMUA 5DQGA 1NKCA 2XCAA 1RNHA 3W0LA 4UAZA 3H4BA 3C0BA 3NH1A 1EWQA 1VHXA 3MN6A 1J2MA 2H3FA 2HSTA 3K2PA 3WNEA 4X5VA 2HNDA 1HR0K 3M1FA 3HXMA 4FFDA 4M3WA 5HLFA 2W04A 3UMCA 4C80A 4B9QA 4A2AA 2CXYA 2G09A 2C28A 2WONA 4IXCA 2RDJA 2HVIA 4KH4A 4FWMA 4AM6A 3CERA 1ZQPA 1KAXA 1K1SA 3UPQA 3H8JA 5AQVA 1H1VA 3MR5A 2FLPA 1C6VA 1ZBLA 3VERA 1NJYA 5D3GA 1XNSA 1KQQA 1KFSA 4FJJA 1T94A 4EBCA 1D5AA 4RQNA 4CVNE 4B1ZA 2E8NA 5IIIA 4JV0A 4IFVA 1E4FT 1TKTA 3Q8SB 2F96A 3SQIA 3UQ2A 1RT2A 4GLXA 2ATLA 2JEIA 3ZSYA 4KTWA 2KHVA 2HHUA 2NUBA 2HI0A 4OPJA 3TTDA 5KT2A 1BA0A 1ZQLA 1RZTA 3DXKB 2PY5A 2W9BA 5AKKA 3T1HK 2WF8A 4WFAL 3LPUA 3DXKA 4CGDA 1V38A 4FLXA 2KQ2A 2JXJA 5AICA 4CK3A 4FJNA 5IIKA 3QEVA 1Q81O 3O9TA 4DL6A 4GC7A 4O8KA 3CMAN 1B22A 1TUUA 1NK4A 1T7PA 2NO4A 4N47A 3J7ZO 3QFPA 3HZ6A 2O6KA 5KFWA 2I9GA 2BCQA 2C22A 1X9SA 2VGMA 4MO4A 4P4MA 4E7LA 4EYIB 4LD0A 3V9UA 2FDRA 1Z00B 2ZTEA 3VGMA 3GBTA 4H4MA 3D2FA 1BI4A 1WYGA 4ISEA 3HW8A 5ALGA 3MFHA 4NLKA 3C5GA 1JLCA 1K6YA 4JI0K 5HOOA 3CD6N 3LM2A 2WF5A 1N32K 1ILYA 4F4XA 3WK7A 5KT7A 3F2CA 5AI4A 1KKXA 3LK9A 4H0PA 2QWPA 3RJKA 4KRFA 3K59A 3EE9A 5J0WA 4ZHRA 2KD1A 4AHVA 3TSPA 4FJKA 4CBWA 3MX5A 4JRPA 1ZQAA 2VGNA 2D0BA 3QMLA 3VQ5A 1IH7A 1K8KB 1K5OA 1ZQTA 4BR4A 4CZJA 1B9DA 4R65A 2PI4A 3AAPA 3HJEA 3VQCA 3EUB2 4DQRA 3L2RA 4KLOA 3WNGA 2FSJA 4JK8A 5KFPA 1NLVA 4OJ6A 2GELA 1N48A 2ASOA 3LANA 2PFPA 3C2MA 3K9JA 1L7PA 5AQXA 1N56A 4IFEA 1ZQ1C 5AM0A 3MK6A 2CPRA 4CBUA 5KFUA 1Z26A 3VQ7A 4CEEA 4R64A 5DG7A 4PHTX 3ZD9A 1S1TA 4GIBA 5GAHP 4CFCA 3ETLA 1ZQMA 3G10A 2A1JB 4BRPA 2WAQF 4BC5A 5AQWA 4FJ5A 3SBTA 3N4QA 3PLAA 4I2EA 1QQ7A 4Y2SA 5AQQA 4BR9A 3CNHA 3RB3A 1XSPA 1HPZA 4B1VA 1UCVA 4FSVA 5BRHA 8ICOA 5J2IA 1QE1A 4OKKA 4CEQA 4KHYA 2K4IA 2DPIA 4Q8EA 2FXUA 3TAMA 4Q44A 1NGCA 2YKNA 4FLWA 3LDQA 3A0HU 3CRXA 4KH6A 5KFOA 3OYAA 3IHQB 4P0QA 2VG7A 2PMZC 4YN4A 1TKZA 5KGXA 3O3GA 3LP3A 2P66A 3VEVA 4CE6A 4FVUA 3GV5B 3KLGA 3RAQA 4Y2XA 1C1BA 4BXOA 5C12A 2YN4A 1QQOA 2PBDA 1HUZA 3NFAA 1YI2N 1S0MA 4Y2QA 2GWSA 3MBYA 4YR0A 2E2NA 5EU7A 3RAXA 2AA4A 4EFHA 4YDUA 3F9KA 4BRNA 5J2QA 4DB3A 2P9LB 2W41A 4OGEA 3RF9A 2B21A 2DF4B 2B6GA 4O5KA 4OJOA 3WQUA 3V7LA 5KFQA 1F21A 1SV0C 1K8AO 3NGIA 3M8RA 5DBBA 2H3GX 3O9SA 4AHSA 3DLHA 4NV0A 3V7KA 3QEAZ 1BA1A 5GTHU 1L3UA 4FK0A 3F2DA 3TADA 1MQ3A 1KCFA 3I56N 3MX2A 3GG4A 3FZFA 4JWNA 4GFJA 4F4YA 4Y0WA 3WK5A 1N62A 4FZNA 2RHKA 9ICMA 3L2UA 4ECQA 1VSMA 3WKEA 2MUTB 1QQCA 1SGGA 4IR1A 4FJXA 4OJPA 1C0GA 5JS2A 3T1YK 4DTMA 1HQUA 4OVLA 2IOFA 4YCXA 2OYYA 4NYNA 2I1QA 4GKJK 4NWIA 4DS4A 3M9MB 1KAZA 4ZH4A 3BS5A 4AHUA 7ICRA 4KHQA 3HKZF 1JLBA 1LKYB 1SL2A 5KFJA 3HJFA 4RW9A 4YDUC 1BQNA 1RBUA 1NGJA 1K9MO 3L4PA 1DKGD 3TPQA 1TVAA 4U7BA 3CW2C 3M5RA 3KJVA 4EZ9A 3FC4A 2UXCK 3BJYA 2HOQA 1SZPA 1U45A 4PL8A 4B1XB 7ICJA 2F1JA 1KVCA 2O4GA 3MEDA 4CZEA 4I2DA 5ALWA 3M8QA 3WEEA 2ZXIA 1TK8A 4Q45A 3SPZA 4O9MA 1MWKA 5AQGA 5AQMA 3OYJA 3AGRA 3PSIA 5HR6A 4QCLA 1W7AA 5L9XA 2OPSA 4DTUA 4PL1A 1REVA 3QBWA 3M1YA 1X1PA 4US9A 4DF8A 1SQKA 2HF3A 5A2QO 1U47A 4B1WB 1YAGA 2DY4A 2LMRA 2JEFA 4K4GA 3Q7BA 3I8BA 1IKWA 4DUZK 4LJXA 3FM9A 4KV8A 2ETJA 4FWKA 4E1NA 2VWKA 2BPGA 3VQQA 1DOQA 4PQUA 2E2OA 2QKQA 2O8BA 4Q43A 2AQ4A 2YB1A 2D3DA 3ZSOA 3QNOA 1HEKA 2G8UA 1YVUA 4UW9A 2ASJA 3GZFA 3GOIA 5SZTA 3IG1A 3PZPA 2DKZA 4B9MA 3HPOA 3T79A 1NKBA 5HROA 2D6FC 3CIPA 1YVNA 3HBTA 3ATVA 5E84A 5HP1A 2A1RA 1FK9A 1NJIO 3O0FA 3AVNA 2KFNA 2E20A 3UKRB 4EAHD 5FPMA 2IHMA 2DL0A 3HTVA 5M1NA 4P0PB 4E1JA 3OJUA 4ICLA 4C0ZA 2F1IA 4CJFA 3O1WA 1X3NA 2OEHA 4JKDA 2GUPA 3VQ8A 2DFFA 4C7ZA 2K60A 1NK7A 3A5MC 1EP4A 4RNNA 1PK3A 2ES6A 5ALOA 3V6KA 4QIWC 1J97A 4KLIA 4FZLA 7ICKA 3O1BA 5B8HA 2VJ5A 2GX9A 1GLLO 3DLLL 1JALA 3UMGA 5AZIA 3MDAA 4H0YB 3SMPA 1CXUA 4Z6FA 1RFQA 5F9LA 4Z4FA 4Y1CA 2W9CA 4K42A 4BGAA 3SZ2A 2ATQA 5J2PA 3K4GA 3TABA 4F4ZA 4F92B 4LZGA 3D45A 1HIWA 2KKVA 5EVZA 2KG5A 3FLCO 5BPLA 3O9UA 2Y1IA 1BUPA 4BY9C 4CJ3A 2YJEA 4I2PA 2KVSA 4CFDA 3PMLA 2ZIVB 3EEQA 3T5JA 3EKSA 3T1AA 1Z05A 1YUWA 1L7MA 4DL3A 1ZQBA 1UWBA 4EX6A 3FE1A 3H6EA 3QNMA 1NI3A 3I76A 4DO9A 4NLCA 4LY7A 2WHEA 4OJRA 2BQRA 3M9OB 2E2PA 3P4IA 4CGJA 3BQ1A 2E6LA 1L5UA 1JKHA 1T03A 4UAUA 1WUAA 2AGOA 2W9AA 2Y0SF 1RDUA 3TACB 4ID5A 1VSDA 4Z6EA 5TKYA 1KN5A 4QZHA 4ELTA 5KFFA 1VAZA 3NE6A 4LF4K 4HCCA 4IO8A 5AM5A 3GV7B 2V7ZA 5JLFA 3U6FA 3RBEA 4FL9A 4QZAA 2QWQA 2CGLA 5GINA 3L2QA 3QUBA 3NVYA 2EH9A 1J54A 3E1YA 4J2AA 4GXKA 1VQPN 5J8YC 4ICAA 1QHTA 2QI2A 3FGUA 1OW5A 1MU2A 4JHDB 3DWLA 3KZBA 2KK0A 3C65A 2IHNA 3DI6A 2W9CB 5M1OA 3GQCA 7ICTA 3MDQA 3N4PA 5EWFA 3VEXA 4ED6A 1X6JA 2RQ5A 3NF6A 5GTIU 3SQ2A 3F2KA 3CCVN 1ZQXA 2EQYA 1YT3A 5EE0A 3LPTA 4PL2A 3F5TA 5M1QA 3OBYA 3CCJN 4CECA 1BPDA 3SUQA 3QE9Y 4FZXC 1RTDA 4IOXA 5IIMA 2P9SB 4RUAA 1WCNA 5C5JA 4KLQA 5KFVA 1EX4A 3OHRA 2W54A 3NUQA 3AVKA 1OVQA 2VG6A 4KBOA 4FLTA 5IINA 1MQ2A 4JRQA 3MXMA 1LWEA 2QK9A 4P4OA 4P4PA 1I94K 3MN9A 4C4RA 4FJ9A 1IBMK 4RQ3A 1FO4A 1RYRA 3KHRA 2R8GA 1N2XA 1ZQDA 3WKCA 1UOCA 1EXNA 3F5EA 3GL1A 5AQZA 4DQ8A 3Q8LA 2BANA 3M6GA 4HCBA 4N56A 3THXA 3HYFA 4CJSA 3E58A 5L1JA 4QS8A 1RBTA 3AA3A 3MXJA 1J5OA 4O8UA 4B9LA 1HJPA 3ZSZA 3GFKB 4PH5A 3ISBA 2QKKA 4J2DA 4CHYA 4ECTA 4QZFA 1IG9A 3I28A 5J0OA 4CZMA 2MRLA 2ZJPL 1GLCG 2WAQC 3PIOL 1FKPA 4ZTJA 1XSNA 3U3YA 1IM4A 4F2SA 5AM3A 4M9LA 4FVMA 4IC9A 3TADC 3M7DA 4DQIA 2ZIWA 1OKJA 3OYDA 4AILC 3EPIA 2DFHA 3CETA 4IO9L 1ZD3A 4TURA 4N76A 2J6TA 4CF5A 3TQ1A 1S72N 4E89A 2HBKA 1N6QA 3DMJA 3TI0A 2XHBA 3G6XA 2EHGA 5AZIB 4K25A 1KFTA 5AKGA 4RU9A 2V51B 3TAEA 9ICJA 1IKYA 2B6AA 1C0MA 2P9NB 1XSLA 3VQDA 4V19S 3UE5A 4IRDA 1NJWA 5JMVA 3HPGA 2K89A 5EOZA 4LF7K 1D4XA 3S3OA 4J9SA 3PSTA 1EXQA 2OTLN 3PX4A 4YFUA 4CK2A 3ZT4A 2CGJA 3EPGA 4BC4A 3M8SA 1VQ6N 1MC8A 2QARB 4EEKA 2GBZA 2BCVA 4XIUA 4K8ZA 4TQRA 2OH2A 3J8AA 1M6YA 1UPHA 8ICAA 2VWBA 3I0RA 1SWWA 2G8VA 1VQ8N 4BGBA 4FS2A 3GIMA 5BOMA 1UA0A 5J0YA 4A2BA 3KLHA 3VENA 9ICNA 4YOWA 1VQ5N 1HNZK 2CGKA 1BNPA 3QZ7A 1N61A 5A0LA 2W3SA 4XH1A 2E5SA 3WNHA 5C42A 4O5CA 2WB1F 4IEIA 1OXJA 2F1HA 4JKGA 1ZBUA 1ZRMA 2MA1A 3TANA 2JEGA 3S9HA 5FRMA 3QNNA 5KFZA 3TARA 3S3MA 1JCEA 3H3OB 4AHCA 1U04A 4KLMA 3QIOA 1BPBA 2HMXA 3KHLA 2P9NA 2QWOA 3ENHA 4DUYK 2HF4A 1QVGM 3VETA 4UB1A 3UXPA 3AO4A 1RBVA 2JWLA 1L3TA 2UVRA 1NNEA 4Y2VA 1TV9A 2PXIA 3AA2A 3VMFB 4CZLA 2EAOA 2Q1NA 3U4LA 3FYHA 4CD1A 2LBOA 4KI4A 1XNRK 4YR3A 1MWMA 1YIJN 1KW4A 5KFRA 5J2NA 1CLQA 3EL2A 1CUKA 3L3VA 2YNIA 5DB7A 1RPLA 1PUZA 3FR0A 4B1YB 2QM1A 2WF6A 2FBVA 3QESA 1WLJA 4BXOB 3AVHA 4HTLA 1C7YA 4W5OA 3JPOA 3EY1A 4QZ8A 3EZWA 1T3VA 2OCEA 4LH4A 1HNWK 4HTUA 4YXMA 5KRSA 2V9WA 1Q9YA 2Z1IA 1S1VA 1S1WA 4L3QA 2G8WA 4DMNA 1LKYA 8ICKA 3HL8A 1KLNA 3A5LC 1MA9B 4BC2A 3C29A 4F5OA 2D0OA 3MN5A 3OYCA 1RXVA 4JS5A 2Q0ZX 4W5QA 3Q8RB 2EZYA 3IDWA 1BIZA 4HVJA 1RDCA 3SEIA 4CGGA 2DQNB 3M8PA 8ICCA 1LW0A 1J9AA 4CJLA 3OSNA 4C7YA 4DV2K 2DUYA 2W55A 2X6SA 2Q97A 4CW7B 4DWIA 5AHXA 4GKKK 2GO7A 4BDYA 3AMZA 3RSEA 4KAZA 3C2KA 3KLIA 4NJ8A 4YORA 4CHOA 3SV4A 4G1QA 1OVYA 1ZXOA 2BCUA 4KHUA 1YJNN 1JLAA 3DM2A 5DB8A 5AFUH 2YB4A 5ALIA 5I9EB 3QIPA 2RP5A 4TUSA 5AQLA 3WXIA 3DRRA 1ZQNA 3THYA 5KG7A 2IMWP 5AQNA 4DU1A 3H0RB 1JLEA 9ICSA 3ZCMA 2A3ZA 5KI6A 1WCLA 8ICBA 1RT7A 2P9IB 3G25A 5AM4A 3EWAA 4QZGA 1DRGA 4G3IA 1S0NA 4NL9A 3ENBA 1SL1A 4N41A 4QW9A 2BCRA 2WFBA 5CB1A 1Q86O 2AQ0A 3DRSA 4B9SA 2F8SA 1BIUA 1F5SA 4W5TA 3S6JA 1HYZA 1UT8A 1FEZA 4UARA 4ILHA 3CQ8A 3VTIA 1ZC6A 2G0AA 3VC8A 2D1KA 2WF9A 3ETRA 8ICWA 4FWRA 4M63C 5LJWA 1B0XA 3JPRA 4KTZA 2GOLA 2XRIA 2GH1A 4EELA 3TSQA 2ISOA 3PW0A 2RKIA 4JI8K 2F9WA 4NM1A 2ZXHA 4ZOHC 4UBCA 3H45C 3RFAA 1RCHA 5KQ8A 4KLFA 3THYB 5CA7A 3MR3A 3Q7CA 4B8CA 3LWMA 5CZ1A 3V6DA 2WF7A 4I2AA 1P90A 3O9QA 2KW4A 4B3SK 4M3UA 1N5XA 1BU6O 4O3PA 2KZMA 3QBXA 2BGGA 2P1JA 2FSNA 5AQOA 1T4GA 4DR1K 7ICFA 2CH6A 1WBBA 2O4IA 3D6JA 1QH9A 2HCFA 1LWFA 5AQHA 1ATNA 3O3HA 3KTQA 3PW7A 3IUCA 1L8LA 5AIAA 4K8XA 4DOAA 4CIEA 4FLVA 1K1QA 1VQKN 4YMNA 1Z4OA 3N7PD 2A42A 1TVRA 4BJQA 4GXIA 4IR9A 1VSHA 1X9XA 4DFKA 4MFAA 1SXDA 1TKDA 1XUPO 1S0VA 4CF2A 3WT0A 4F3TA 1NOMA 3THWB 3G6YA 1DTQA 5ALTA 4DV6K 2ZTCA 3ULEA 4HUGA 1NKEA 2HBLA 3OA9A 2ZIUB 5AK4A 2BUPA 3DOKA 4J9OA 5FROA 4CJ4A 1L7NA 1SKSA 4DCCA 4KLSA 4UAYA 3L0QA 2D0PA 3VGLA 4CERA 3SI8A 1S5LU 5EY4A 2MAXA 4J9RA 1TUYA 1JJ2M 2Q0RA 3ZEUA 3ITHA 1TK0A 4IWVA 5JICA 2W8LA 3TR8A 5BRFA 1AQ6A 4DR7K 2BDUA 3R3LA 3WKAA 3QUQA 5H1SQ 4FW1A 2NO5A 4GVMA 2GLEA 4CD3A 3EO3A 3SMVA 2C2EA 2O8BB 3MGIA 4YVZA 3AL0B 7ICIA 3G0ZA 5KFMA 5F9NA 4Q0BA 4H0VB 3ZX2A 5AM1A 1L8OA 4DHYA 4WF9L 1VSKA 4O0JA 5ALLA 4DQQA 2P51A 5EX5A 3VA3A 4YOTA 4ED0A 1WG8A 4DL4A 2FJ6A 3ISNC 4FPAA 5J2DA 1ZRNA 4DL7A 1IV0A 4GVEA 3ZD8A 2RDIA 5KFDA 2Q4TA 2ESEA 4KKOA 2G8HA 3B0YA 4DTSA 4RT2A 5M1KA 2WFAA 3O4WA 3WUHA 1M90O 1A5VA 2B4JA 1WWVA 2E1EA 2A6AA 2BQUA 5GIPA 4MFCA 1S22A 2A1SA 2YX6A 3LL3A 3LZIA 4RQ1A 4KREA 4H0XB 1U4BA 3BQ2A 3ENOA 3KK2A 5IT9O 4BDZA 5J2GA 1JUDA 2XVTA 3L5KA 1GLBG 3VQEA 2G8IA 2XO7A 4YR2A 1T6CA 4JAXA 4Y2RA 2R8JA 2FMSA 4BG8A 4UASA 1QSYA 5DG8A 7ICUA 4JD2A 4OJLA 3D0PA 4CGIA 4FJ7A 1S1UA 4HHTA 3ULEB 2PYJA 3OYIA 1NM1A 4JKCA 3T3FA 5EE9A 5AI0A 3IFRA 4O5EA 5D49A 5HNKA 4J9KA 1WSFA 3KBBA 5C0YA 3H46O 5G5HA 4H4OA 3T5LA 3AU2A 5ALFA 5DQIA 2QW9A 3SK3A 3L4QA 4DQPA 3K75D 2E4LA 4CZKA 3KD5E 1JLGA 5KL1B 3I0SA 3VEZA 5DKWA 4ECWA 2KFZA 3O9RA 2ZF5O 2YHWA 4JI6K 3IRUA 3AUOA 1CZAN 2E1ZA 3ULDA 4C8OA 5BPCA 3IRXA 5KG5A 1SUQA 4FJLA 5ADXH 2VQEK 1OH8A 1FJGK 3ALYA 4F5NA 5L1IA 9ICPA 2F8LA 4DEZA 3NF9A 2O8DA 1W97L 3SAFA 4K4IA 3J81O 1WBDA 4BGDA 4GC6A 1RT5A 2P9LA 4FZZA 9ICLA 5DBCA 2VA2A 1P7DA 5J29A 3QICA 1DXSA 4C1NK 1BGXT 2ZGYA 3C23A 2NNWA 2LYBA 4UAWA 3PV8A 3AO1A 2MU2A 4G9ZA 1HLUA 5J0PA 3IP4B 1XC9A 5ALEA 3AVAA 3HO1A 1Q8KA 3HWTA 1QZ5A 4FLUA 2Y9TA 3IMXA 3V9SA 2BH1A 1ZD4A 4EEYA 2HNZA 4OD0A 4GV3A 3WKDA 5ALKA 1I3AA 4CGHA 1WAFA 3NS1A 2FMQA 1DK2A 1RT6A 2JWKA 4M7XA 2UUAK 1HJRA 2G8KA 3F9MA 5CEHA 3DAWA 1KL9A 5K4LA 3VF6A 3CQXA 1VSFA 3OYEA 4DTOA 4RG8A 1LB2B 4FW2A 1EWRA 4OX9K 1N33K 2BPFA 2KEYA 1DGJA 4Z6DA 1VSIA 4Z0UA 4W5NA 4EBDA 4DL2A 3WXJA 3CCLN 4I2FA 4NLNA 5BN8A 4I9QA 3MFIA 4F4KA 3C95A 3PW5A 1HPMA 3NAEA 1Z4NA 3WXLA 1RG6A 5DQHA 5KT4A 3F53A 4U6PA 4ED2A 1WSJA 2A5XA 2PFQA 3BDPA 4DR6K 3O6WA 4HAIA 1TV6A 4U67L 2RHFA 1NK6A 3WK6A 2P5GA 3QX7A 4ECVA 4NB4A 3DDHA 1NGFA 4YOUA 7ICQA 5JUMA 3Q8QB 3RWUA 1X9MA 1WAJA 2D0AA 1CI4A 1HKBA 4H0TB 4IJNA 4M3RA 3PO4A 5JS1A 1HNIA 1LAVA 2XY5A 4J2BA 2N1RA 4I6MA 7ICPA 4UB8U 3UXNA 4B9UA 1BNOA 2OM6A 1UAXA 3AVCA 3B6PA 3H40A 3ZDCA 2WTFA 1WSEA 2DPNA 3OYBA 1I39A 4A61A 3OBWA 4M0AA 4LH5A 1X2IA 3TTFA 4FZYA 1SWVA 1DGSA 3PR5B 3AU6A 3NVVA 5FPDA 1OH5A 1BPZA 1TAUA 1ZD5A 5DLGA 3ZSWA 2VWJA 3A8YA 2KHQA 5KFYA 3G6VA 4QAGA 3KK3A 1LW2A 3WK8A 3J80O 1BVSA 4RT3A 5H2FU 1NGBA 2QA4N 1VQON 4M7YA 2QTDA 4AYBF 5AM2A 2VKQA 1X6IA 1LAWA 4CEBA 5BN9A 2FE9A 5CJ7A 3SAGA 2KZZA 1KC8O 2QXFA 3VTHA 2GEMA 5DB9A 4PHDA 2LHTA 4Y2PA 3JPPA 3H08A 3HSTB 2W40A 3FZHA 3LP2A 2IA6A 4BACA 4TSXA 1YTAA 2LSNA 5EWGA 2IC3A 3M9NB 4CZHA 3NVZA 5ALNA 2W9BB 1BCOA 3WQTA 3MABA 2O8EB 4RPXA 2A3VA 2OYQA 4GV6A 4R8UB 3VEYA 2ZUBA 4B3OA 4DR3K 2DTUA 1ASWA 3P31A 1LV5A 1SKRA 4B6JA 4M9JA 4ELUA 5SWMA 4F9OA 4DTRA 3CJAA 4GXJA 3U26A 1NWKA 3HKZC 2EAPA 1VSEA 2E2QA 2I5JA 2YHAA 3BQ0A 3ID6A 3GDXA 2LYHA 1Z6RA 5F2RA 4DR2K 3VA0A 2WC9A 2NYVA 1Z25A 1W0HA 4CJKA 3RR7A 8ICNA 1COKA 2AJQA 4E7KA 3WK9A 2YKMA 5IILA 2RF2A 1NGEA 4DTPA 3QYPA 4I6MB 3CCEN 5AKEA 5HRSA 4JI1K 4KB1A 3DOLA 4ISFA 5KL8B 3C7NB 5E26A 3ORYA 4A57A 1VSLA 2E5LK 1BO5O 5JTIA 3TFRA 5FPNA 2G8FA 5DGAA 4DU3A 3NGDA 2P9SA 4MFFA 4KITB 1NGIA 5AZJB 3T69A 4KLDA 1TGOA 1W2BM 5L1LA 3QU7A 2FF6A 1KAYA 5KG0A 5EE3A 4F93B 5DMRA 3G6EN 3LYSA 3ZI4A 3WNFA 2HOEA 3CHWA 4I2QA 1NK9A 3HP9A 3ZT2A 4NY8A 5GADP 3IM1A 2BTFA 4MF8A 2WB1C 3MMVA 3ZETB 3CFRA 1J2NA 4I28A 2R18A 3MGHA 4ISGA 4R79A 3LM9A 1ZQYA 3JS6A 2KSOA 3SLCA 3ISCA 3SYZA 4M2YA 4DSLA 9ICUA 1GOCA 4JKHA 3O4NA 4DSIA 4FJGA 1LVHA 2MSNA 4FO6A 1MDUB 3K5LA 2Y1JA 3N7SC 4I27A 1S3XA 5L1KA 4UB5A 4ID1A 8ICFA 5AJ3K 4KTQA 3HRDD 5J8YA 2ZE2A 4RNMA 4F72A 4PZNA 4XA5A 4QWBA 2W43A 2W9MA 5KTQA 4DCHA 2VYPA 2XY7A 4YMMA 2PZSA 5J2AA 4AM7A 2VA3A 2ISPA 3THXB 2ASDA 1ASVA 4AYBC 2YTUA 1TK5A 1VRTA 4M41A 5KFAA 4YP3A 1A0PA 3MN7A 2Z1GA 2KV2A 5DGBA 2K4PA 3TAPA 2GV9A 5CZ2A 3RB6A 3KHYA 1QSLA 3S3NA 1N5YA 2PI5A 2O8EA 3O08A 4A8EA 1JX4A 3PSFA 4FWQA 3CI5A 4Q5VA 2UU9K 3BF1A 3UIQA 2PYLA 3ISDA 2GUIA 5JVHL 3MWPA 3GV8B 3R9PA 2FI1A 1PVQA 4MEXA 5KRTA 3D7EO 5AK5A 4BR2A 4MDAA 5KNIA 5BOLA 3GIJA 4Q8FA 2C2RA 4FWLA 4RPZA 4M47A 3VQ6A 1RYUA 1ZQUA 2A19A 3TAFA 1E4GT 4I2GA 1ZBFA 3AQFA 4J03A 4LF5K 4Z4GA 1EO1A 5DB6A 2D5RA 4QIWF 5CHIA 1N34K 2HSZA 3OHAA 2F8KA 4QNLA 1URJA 3ZDBA 3HX0A 4ED8A 4MEYA 4B3MK 4NXNK 2JRZA 2UXDK 3M6KA 5KFKA 3MGVA 3OYKA 2P6RA 2QWLA 4OKJA 3HM9A 3B6OA 1N5WA 4O44A 4KPYA 1Q46A 5KG6A 4BUGA 2W11A 1D9DA 3NF7A 4J2EA 1FIQA 5AFUA 5KAFU 1U48A 1ZQJA 4DG1A 4M3XA 3AVBA 2F76X 3JPTA 4PGXA 3LDNA 4IBNA 1KTQA 3NMUA 4CHQA 1FXXA 1RILA 3K1ZA 1EQYA 5F1XA 5HL7L 1N8RO 4YY3K 3ZDDA 2QWNA 3VF2A 4I2BA 1D9FA 2QXLA 5ALXA 1T3QA 5CHGA 3RJJA 1VSJA 4MLEA 4CJWA 4YOYA 5JRTA 4PY5A 1DEJA 5FPEA 4XUSA 5MLCQ 4NM2A 1S6QA 2KKZA 3GIKA 3DLKA 2HHWA 5C2FA 2LM1A 4O0IA 3SJHA 5IIJA 3A0BU 1GLFO 1MA7A 4IDHA 5AKHA 1N36K 8ICEA 3OYMA 4FJMA 4J9LA 3F5AA 2JH7A 4Z94A 3NGZA 1V85A 4PGYA 2ZJAA 1QSSA 2P9PA 2Q36A 2KIWA 3KKSA 4H5VA 4FPBA 1VK0A 1IKVA 3TU5A 4CZFA 3AO3A 4K43A 3ZYYX 4IS7A 5C10A 3GIIA 1BPYA 4RQ8A 1RDWX 2VJ4A 2G5IB 3OHBA 8ICMA 4DV7K 4F5PA 4PHEA 2YHXA 4JI5K 5LMUK 4OLBA 4DV3K 2YQEA 4FM1A 1SV0A 2ASMA 2PAVA 1N63A 1TAMA 2CH5A 4BRMA 3ZEUB 4BREA 5D4BA 1XHZA 3CCQN 3RR8A 4OPHA 3AV9A 4QWEA 4H5WA 5EE1A 1RTJA 2BZFA 2KLAA 2KKPA 5ALHA 3V1OA 1X66A 5F3XB 4ELVA 2KICA 1IKXA 4PPXA 2D0CA 2ZM6K 3Q8MA 4FBTA 2XY8A 5KQDA 7ICGA 3ZT0A 2NRHA 4YG2A 1C0UA 3D2NA 3NHGA 1D8YA 5BR9A 1TFRA 1JCGA 3H8MA 4NCGA 2JV3A 4NLZA 4RPYA 1IG6A 3O4QA 4XEIA 5AQRA 1TL3A 4CCHA 4QWAA 4TQSA 3ZT3A 1P8ZA 3KK7A 3VF4A 3ZDAA 8ICZA 4KLJA 2B0CA 4RW8A 1V97A 4PA1A 4WFBL 8ICUA 4H03B 1VQ7N 4DSFA 4B9TA 4JK1A 5AQTA 2WTUA 3MWTA 5KFIA 4DFMA 1VQNN 5J2HA 3FFKB 4JK9A 3SUOA 4H0OA 4O5BA 1S9EA 3NVWA 1JLQA 1JROA 4YFKA 1X40A 2Q31A 5EWEA 1RDAA 3LDPA 1U49A 4XQ8A 3JPSA 1ZQIA 1QQNA 1IBLK 4O5FA 3KVGA 3LAKA 4GNIA 4A5BA 5AK3A 3CYMA 4F5QA 2G5HB 3IG5A 4RQ5A 4DS5A 4RQMA 2Y9UA 3R1XA 2CRXA 4MF2A 3D6RA 4NLBA 3KOOA 4IOAL 3NASA 3RH5A 3E66A 3I55N 3AVGA 1GLJO 1BQMA 4CF4A 2W8KA 3GU3A 4MQ3A 3AARA 4FK2A 1ZQRA 1IXRA 1RQLA 5CR0A 3C94A 3EE8A 2IBKA 3AEVA 2OTJN 1NJZA 4DF4A 1XWLA 4BWMA 1YJ9N 3ZSXA 2HHSA 5J1EA 2F4VK 1GO3F 4P0QB 4JN4A 2O8CB 4RW7A 4USAA 4C8LA 4ECZA 3QLHA 4RZRA 1WSIA 5AKLA 5KG4A 1YF5L 5AI8A 5CWRA 4F50A 5ALRA 2YNHA 3O80A 2HHQA 1AROP 2AXTU 2IOHA 3KKRA 4P2HA 1BCMA 1TL1A 3AA5X 2ZWHA 3L6QA 4M6WA 1T05A 3OYLA 1HJOA 4J8FA 4X65K 3U9DA 8ICXA 3ZSVA 4CF9A 1QZ6A 3OS2A 2A1JA 3PX6A 4O3OA 2KSOB 4RUCA 4ED3A 4BC3A 2MUTA 1ZOLA 2A1AA 2YY6A 4C8NA 3JPQA 8ICHA 1ZQQA 2YHYA 4FK4A 1NGAA 3ZDEA 2BKEA 4A59A 2ZGZA 3BZKA 5KFCA 3V81A 4JV1A 2H3QA 3CCMN 2OHFA 3EW9A 3H1QA 4AHRA 2E3TA 2JGAA 3MECA 1X9JA 4F4WA 3T5HA 4IL6U 1EKEA 2JH1A 3BF3A 3AAQA 4IDKA 1S77D 4DR4K 3P38A 4KLUA 3MEGA 5AZJA 2I7NA 5ALPA 3GILA 2BCSA 1K8KA 3C6HA 3DLRA 4DSKA 3KWGA 5HRRA 4BQLA 4E7HA 3HRGA 3K5NA 4JK7A 2Y0SC 3NDKA 5KG1A 1KSPA 1NU0A 3BY5A 3DLBA 2YX8A 3DXMB 4O4GA 5KFTA 2E8MA 2FSKA 3E01A 2F7TA 3VESA 4CZGA 4KFBA 2AU0A 2P9UA 4EIAA 3H8SA 5I42A 4X62K 3N7RC 4CK1A 1SB3C 1S5JA 3CQYA 4R5PA 2AGQA 4DFDA 2QKBA 4CF1A 1BI4B 1YITN 2K8CB 5JU5A 4WJ3B 4GW6A 4KHPK 3H4DA 5C2DA 2LM4A 1SIJA 8ICSA 4C23A 2NRXA 3MAQA 5AK6A 1ZQVA 4UATA 4LFAK 3KLFA 4OJ5A 4RQ4A 3NRZA 4H5TA 2KJ9A 2HMIA 5ALVA 2BGWA 1ZQZA 1Q82O 4J9NA 5J2JA 1Q7YO 4M3TA 5T14A 5DM6L 1A6SA 4L8RB 2O8FA 3QU2A 2LPEA 4FE3A 3HVTA 1T8EA 2OXOA 5AQPA 3RVCA 5GAGP 1JN3A 3KFUF 3R6MA 5KFBA 3C2LA 1WUDA 4DLGA 4JV2A 3CJ1A 1ED1A 2W6KA 3H1VX 3N4MB 5HMLA 2HDOA 3KZIU 2YV0X 3ED5A 5CP2A 2ITMA 2P9KA 5AI9A 3AVJA 3VGKA 4UB2A 7ICVA 3K1RB 2EAMA 4IRCA 5E41A 1ZQFA 3ZSRA 2XC9A 4PHPA 1ZETA 1ZQGA 2RE2A 4IEEA 2YJFA 4IRKA 4QJFB 1NK8A 8ICVA 5KFHA 1Q9XA 4ECRA 3MCPA 3K5MA 5KFGA 2PFOA 4Z6CA 1CEZA 3HPHA 1UT5A 3P39A 3DXMA 1T44A 4PGQA 2YNGA 4MLHA 1O13A 4FBUA 1YTUA 5ALUA 4CJTA 3AVIA 2IGIA 4JKEA 2UVWA 3A5NC 2I5HA 4M42A 3E9LA 2KHOA 2DKXA 2W7OA 3LVWA 3O8MA 3P83D 2AH5A 1ZQEA 4LVSA 1HMVA 3CJCA 3QUCA 3UM9A 3LVVA 2IAJA 1IBKK 3CJ7A 3RH4A 3AY9A 4B3TK 2NRZA 3AN1A 3FAHA 4J9QA 1O1WA 4BROA 2RPIA 4UAVA 1F0MA 3CC4N 4OCZA 2KE7A 3MDCA 5JLHA 4N5SA 5AKXA 3PSPA 4WQ4A 3L2WA 5ALZA 4CJQA 4EYHB 4CZIA 5ALDA 5J2BA 4O3RA 2RLTA 4YMOA 1OUQA 2R8IA 2Z1HA 5DM7L 4LF9K 2KP7A 3OS0A 4BE0A 3ICXA 4DTXA 3CCSN 1RM6C 1ZJMA 4DL5A 1UA1A 1HKGA 3SCXA 4QOZB 1XQSC 3SMSA 3Q8PB 2V4QA 3HM8A 1HUOA 2E1FA 5KT3A 2F3NA 1T3NA 4OPAA 4Y2UA 3LP0A 1QCKA 1U2VB 1UQVA 3QEIA 3SUNA 2F77X 3RMAA 1HX1A 2HBJA 3AA4A 3DRPA 2IIRA 2K4HA 1RTIA 3CFOA 3VQ9A 4A5AA 1R0AA 1S9FA 3V6JA 4QS9A 1K73O 2ITGA 5C15A 1XO0A 4CI6A 1G15A 2HHVA 4CFAA 1HUXA 2IVNA 2IOFK 2LI6A 1MN8A 1Q3VA 1BISA 2HNYA 4ILJA 4Y1DA 4F5RA 4CF0A 8ICYA 4CHPA 1WWUA 2YHBA 5CY4A 7ICLA 1JIHA 1B4FA 3BEXA 4FOEA 5DDMA 3B9JA 4FJIA 3THVA 3HSCA 3VPZA 3K9KA 1L3VA 1WNSA 1S0OA 2P9KB 3U9ZA 2JZBA 5J0TA 4JMUA 2J6UA 2GWJA 3D2EA 3SR6A 4E3SA 5M1PA 3ZETA 2BPCA 2QB1A 2R8KA 1RT4A 2HW3A 1U2VA 4OPKA 1PVPA 1NG9A 1E3MA 1IJJA 4NLGA 4F71A 1PK1B 3MXIA 3K58A 2WOMA 2VA8A 1NNLA 3KK1A 3V72A 1ZQWA 5KFEA 4Y2TA 4BVOA 4CNQA 2HVHA 2NLXA 2ZIXB 1XS9D 8ICPA 2HHHK 2X74A 4BR7A 4JLHA 4BRCA 4JKBA 1SV4A 2FLLA 4PL7A 4BRFA 3HILA 4ECXA 1TE2A 3LZJA 5J2KA 5J0RA 4B1UB 3HI0A 3CPEA 3HOSA 2YMLA 2M9NA 1SS6A 4JKGB 1S10A 4CEDA 4CJVA 1PZNA 3R8EA 3KHGA 2ALZA 1BG3A 1IV8A 2AP1A 1BHLA 3M3ZA 4IFYA 1WN7A 4YQWA 4FYDA 2OA8A 1F44A 2ASPA 1XO1A 1QLNA 4YHHK 3PW4A 1KFDA 2ZUDA 3V9ZA 1H38A 1WSHA 2PKEA 2ZIUA 3OYHA 2KN7A 4KI6A 2KOBA 5KFNA 2PMZF 5GIOA 3TTCA 1XI1A 3OJSA 3FZKA 1C1CA 2FBYA 2HBMA 2FBTA 3EZ5A 1KQSM 1RTHA 4JV5K 2F44A 9ICKA 3VOVA 4M9GA 3EKUA 1A5XA 2HHTA 3F2BA 1TKXA 1HYSA 4YNQA 4I2JA 1ZQOA 3DLGA 3K5OA 1VDVA 4PKGA 5BRDA 3RB4A 3SJJA 2W03A 2AGPA 4AH9A 9ICWA 3WXKA 3LDOA 4EENA 3TSUA 3H0LB 5HR7A 2ZIVA 3RJIA 1QQMA 4DKWA 5HMMA 3IAYA 1QQ5A 3OS1A 3OW2M 5CRXA 3H7IA 1ASUA 1BWFO 3IS9A 2UVUA 4LFBK 1TYQB 4XH5A 5BPMA 4ECSA 4M9NA 4OGCA 3SQ4A 7ICHA 1C0TA 4BQZA 4CRXA 1A77A 4UB3A 2K4EA 4G9BA 4QS7A 2P9PB 1SV5A 4RTFD 3CC7N 4O3NA 4QZ9A 3VQPA 4IOCL 1ZQHA 3SUPA 2BQ3A 3G4SN 2FPLA 1WSGA 4EX7A 3L8BA 4F2RA 4WE1A 4CJRA 4DV0K 5IWAK 5DG9A 3CG7A 5J0XA 4EBEA 1VQLN 3CJBA 1EETA 4ED1A 2EZZA 3TFSA 4BRKA 4B9NA 4O55A 4XH4A 1QTMA 2HHXA 1S9GA 4TUQA 2RN2A 4IQWA 4DR5K 3HVRA 1V4SA 1NGDA 3HOTA 1ZJNA 4BE1A 3PX0A 1VQ4N 3B0XA 4FZMA 5KG2A 3SV3A 4PUOA 4RW6A 4I2CA 4YD1A 4BR0A 4M45A 1FW6A 3QETA 2OPQA 2UXBK 1IO2A 2Z7JA 1RDFA 4DFPA 2QARA 5ALMA 3R9KA 2E1YA 2ODGA 1Q3UA 4QZBA 2P35A 3LP1A 4CF8A 5KPRA 3TWHA 4UB4A 2IS3A 5AR0A 3RMDA 1XU4A 4JI7K 4B3RK 2JLEA 4NL9C 5B5EU 4NO7A 8ICTA 2Q3SA 2Q2RA 4FM2A 4CEFA 2L5YA 2EX3A 3CJ9A 4Z4IA 3KD3A 3QEXA 2KJ5A 1YZ6A 1U6ZA 3ZX0A 1SZ2A 1HNVA 2HMPA 3SBGA 5M1FA 3V1QA 4IZ9A 3TAGA 8ICQA 1JMSA 3LDAA 1ITGA 8ICRA 5KPZA 4JNEA 4NXMK 4FLYA 3TKAA 3J81j 3O3FA 4AHTA 3LDSA 5EOYA 1S1XA 4CDGA 4I7FA 1CRXA 4JHDA 1A76A 3N97B 2W6LA 2ZIWB 1X42A 3N28A 4I2IA 2FBXA 3KIOA 3K57A 1KVAA 2EWSA 3OYFA 1PK1A 2M0NA 7ICEA 4H5NA 2XICA 4GV9A 4E0DA 1FFUA 3OGUA 5F0XA 2KVCA 4M3ZA 5HBMA 4LF6K 4CIGA 3D2EB 1VQ9N 3WKBA 3T7ZA 3HK2A 5L1MA 7ICMA 2FPKA 5IIOA 3C6AA 3LAMA 2ZQBA 4M3YA 3C6TA 3QO9A 3AM9A 9ICGA 3SI6A 2OWOA 4B9VA 3BGRA 5AQUA 4CE9A 4E19A 2VQFK 4BRIA 3NTUA 3AQEA 4KB0A 4FWNA 3WU2U 3B8AX 4DQSA 2ZUCA 1KRPA 1Q8IA 3SD7A 3UB5A 3RTVA 4BRQA 4FS1A 1VJ5A 4JWMA 3D2SA 2XIDA 4E1MA 4RWTA 1RBRA 4RQ0A 2WBNA 3BP8A 3LWLA 2NV3A 4KLLA 1OH7A 1HYVA 3QZ8A 3PMNA 4WQ4C 4LSNA 2LYAA 4IKFA 3T5KA 3KKAA 3BUZB 4QZIA 4J9MA 2XGPA 4CFBA 1JRPA 4BRHA 3OTOK 1BOTO 4JB3A 2FLOA 2KNJA 1JCFA 2YI1A 4DV4K 1ZBHA 1NGGA 2UUBK 1D8LA 3DYAA 3A2FA 5HRNA 9ICAA 4DTJA 9ICRA 4RCHA 3RB0A 2P5OA 1J53A 4DV5K 2QEXN 3RSEB 9ICTA 5BREA 4UY8O 1ZBSA 1JL1A 3MR6A 2V52B 3QERA 5AKIA 4EP4A 4KMOB 3UKUA 3DLEA 5ALSA 4Z4HA 5HHIA 9ICBA 2V4RA 2W3RA 4IG0A 5K14A 1CXQA 3UKRA 2DPJA 4ILGB 2KTQA 4RQ6A 1KVBA 5CE3A 3NH2A 4GY2B 4KHSA 2E8PA 2YMPA 4JEPA 4LZDA 3VEWA 4I2HA 5AQSA 5AKZA 2H3VA 4IQUA 1SZHA 1LOTB 5T7BA 5LMNK 2OZMA 2JHDA 3D2QA 3QINA 4LC9B 4KLHA 1SAZA 3QFUA 4AQYK 2HOFA 3IDHA 2DWQA 2XCPA 9ICOA 1NOYA 1IG8A 4ACOA 2X78A 3IKMA 1DTTA 3U8XA 4CGFA 3V9XA 3JAMO 4Y2JA 2KMDA 3ZT1A 1VRUA 1N60A 1BPXA 3C5FA 5C24A 3WXMB 1S97A 1U9LA 4FWSA 4BRLA 2GTDA 2ZJ5A 4QZDA 3CFPA 2JGUA 1ZXIA 1XC3A 1FKOA 1S8OA 2Z1JA 5KFLA
chains in the Genus database with same CATH topology
1T6DA 4DSJA 9ICXA 3FZMA 1KXPA 4ED7A 4C1NI 4BRGA 4WQ5A 2FMPA 1QHAA 3BQTA 3NVKA 2IVOA 5HP4A 1ZYQA 3GE1A 3UXOA 2BR0A 3CXCM 4AF1A 2A41A 1Z3EB 1WOQA 3KHHA 3C7NA 2GWKA 3A5OC 5AQFA 2YCHA 1X9WA 2ZJ8A 4CBXA 2E8AA 3FDSA 1YXQA 4FWOA 1KD1O 3CMEN 4DLEA 3TAQA 1NGHA 5DLFA 4PKIA 1M1KO 5TZVA 2D4WA 2NRRA 2OANA 3JXUA 5J2EA 5AQKA 1G99A 4CJ7A 4IQVA 4R8UA 1V4TA 4QWDA 3MCAB 5KG3A 5BPNA 3DJCA 3QDKA 1SL0A 4UBBA 4DOCA 4YXJA 5J0SA 4DSEA 3C1ZA 2JZBB 5KT6A 3FZLA 2Q0UA 1JXEA 3LDLA 2VCPA 3CCRN 3WEEB 4BRDA 1YJWN 5KPTA 2FF3B 4ECYA 4HWIA 2BDPA 1C0FA 4BG9A 3CF5L 5LY3A 3CC2N 3CPWM 3JPNA 1Y88A 4F91B 5J2CA 5CR4A 7ICOA 4RQ2A 1B43A 1L3SA 2P9IA 4QW8A 2NRWA 2C2DA 1TAQA 1DT9A 8ICJA 3W3DA 2NRVA 2XY6A 4BRAA 1KEJA 1BPEA 3EYZA 3HT3A 3SAHA 2J4RA 2P6UA 4XRHA 4KLGA 4K4HA 4O3QA 1YHQN 3MR2A 4UQGA 1QVFM 4YOXA 3GDQA 4HYKA 3G71N 9ICQA 3ID8A 4JD2B 4FO0A 1RGIA 4KN7A 1JXLA 3H3NO 3ATUA 1DGKN 3H8WA 3PNCA 3PW2A 1Z00A 2ASLA 3HP6A 4PHAA 4I29A 2KZ3A 4M04A 4K41A 9ICEA 7ICSA 9ICCA 1ZQCA 2I7PA 5EXWA 4QZEA 5DDYA 1Q18A 2ZJRL 5J2FA 4DFJA 2DFLA 4KN4A 5AQYA 5KT5A 2ZJQL 5HHHA 3RRHA 2QWMA 9ICVA 1NK5A 2H5XA 2F9TA 4NXZA 1KDHA 4C8MA 1TYQA 1NK0A 3CCUN 2JEJA 3NVMA 1NJXA 5JVGL 1GLEG 2VANA 7ICNA 4BR5A 2A40A 8ICGA 1GLDG 5J0UA 4F8RA 3CCEN 1GLAG 5DBAA 4TUPA 1BDGA 4BVPA 3OSPA 2P9UB 3A0IX 4WYBA 5LJVA 4RNOA 3VEOA 1Y64A 1RYSA 2WUSA 1RXWA 2UYTA 1ESVA 3I33A 4YOVA 5ELZA 8ICIA 3C21A 1ZQSA 4EHTA 4M9HA 4O3SA 3Q8KA 1R59O 5KFSA 3UQ0A 5ADXA 2BHNA 8ICLA 9ICIA 3D2FB 3E2EA 4KH5A 3UKUB 9ICHA 4ECUA 3KWIA 5AQIA 3L4IA 4FWPA 5AQJA 1COOA 3E9OA 5KFXA 4WCEL 3RJGA 4WQ5C 3RRGA 2IVPA 1ZQKA 3PVXA 4J9PA 4EZ6A 3E9PA 4RQ7A 4YD2A 3PO5A 1SKWA 3RJFA 1HKCA 4EHUA 3PIPL 3C1YA 3RJEA 2QWRA 4M6WB 1NBWA 4FOIA 2ZTDA 4MDBA 4A62A 2NZTA 3AGKA 4WFNL 1X3MA 3RBDA 4JKAA 4KLEA 5D46A 4QWCA 4KLTA 4JKFA 4H5RA 3PR4A 9ICFA 2FLNA 1ATSA 4R66A 1MSWD 3EN9A 1LCUA 4C8KA 3S41A 4OO1J 2PFNA 1NMDA 3ZX3A 4JUZA 2XGQA 1S76D 4DOBA 2PFUA 1J6ZA 5J0QA 4IJAA 2E88A 4PKHA 4IQTA 5GAEP 3O5BA 3QEBZ 3PY8A 4QZCA 5TKWA 2NRTA 4R63A 3QB0A 2V7YA 2FPMA 3V7JA 2UVVA 3RH6A 1VQMN 4BDPA 4BWJA 4F3OA 3V6HA 2R8HA 3RJHA 1ATRA 4MO5A 2J6SA 1V9PA 4KMUA 5DQGA 1NKCA 2XCAA 3W0LA 4UAZA 3H4BA 3C0BA 3MN6A 2HSTA 4X5VA 3M1FA 4B9QA 4A2AA 2C28A 4IXCA 2RDJA 2HVIA 4KH4A 4FWMA 4AM6A 3CERA 1KAXA 1ZQPA 1K1SA 3UPQA 3H8JA 5AQVA 1H1VA 3MR5A 2FLPA 3VERA 1NJYA 1KFSA 4EBCA 4B1ZA 5IIIA 4JV0A 1E4FT 3Q8SB 3UQ2A 4GLXA 2ATLA 2JEIA 2HHUA 3TTDA 5KT2A 1BA0A 1ZQLA 1RZTA 3DXKB 2W9BA 4WFAL 3DXKA 5IIKA 1Q81O 3O9TA 4DL6A 4GC7A 4O8KA 3CMAN 1B22A 1TUUA 1NK4A 1T7PA 3J7ZO 3QFPA 3HZ6A 5KFWA 2I9GA 2BCQA 2C22A 1X9SA 2VGMA 4MO4A 4P4MA 4EYIB 1Z00B 2ZTEA 3VGMA 3GBTA 3D2FA 4ISEA 3HW8A 3MFHA 4NLKA 3C5GA 5HOOA 3CD6N 3LM2A 1ILYA 4F4XA 5KT7A 3LK9A 4H0PA 2QWPA 3RJKA 3EE9A 5J0WA 3TSPA 4CBWA 3MX5A 1ZQAA 2VGNA 3QMLA 1K8KB 1ZQTA 4BR4A 4CZJA 4R65A 2PI4A 3AAPA 4DQRA 4KLOA 2FSJA 4JK8A 5KFPA 1NLVA 2GELA 1N48A 2ASOA 2PFPA 3C2MA 3K9JA 5AQXA 1N56A 4IFEA 3MK6A 4CBUA 5KFUA 4R64A 5DG7A 4PHTX 3ZD9A 5GAHP 3ETLA 1ZQMA 2A1JB 4BRPA 4BC5A 5AQWA 3SBTA 3N4QA 3PLAA 4I2EA 5AQQA 4BR9A 3RB3A 1XSPA 4B1VA 4FSVA 5BRHA 8ICOA 5J2IA 2DPIA 4Q8EA 2FXUA 4Q44A 1NGCA 3LDQA 4KH6A 5KFOA 3IHQB 4YN4A 2P66A 3VEVA 4FVUA 3GV5B 3RAQA 4BXOA 5C12A 1QQOA 2PBDA 1HUZA 1YI2N 1S0MA 2GWSA 3MBYA 4YR0A 2E2NA 3RAXA 2AA4A 4EFHA 4YDUA 4BRNA 4DB3A 2P9LB 2W41A 2B21A 4O5KA 3WQUA 3V7LA 5KFQA 1K8AO 3M8RA 5DBBA 2H3GX 3O9SA 3QEAZ 3V7KA 1BA1A 1L3UA 1MQ3A 3I56N 3MX2A 3GG4A 3FZFA 4JWNA 4Y0WA 4F4YA 2RHKA 9ICMA 4ECQA 2MUTB 4IR1A 1C0GA 4YCXA 2I1QA 3M9MB 4DS4A 1KAZA 4ZH4A 7ICRA 1SL2A 5KFJA 4YDUC 1NGJA 1K9MO 1DKGD 3TPQA 1TVAA 4U7BA 3M5RA 4EZ9A 3BJYA 1U45A 1SZPA 4PL8A 4B1XB 7ICJA 2F1JA 4CZEA 4I2DA 3WEEA 1TK8A 4Q45A 4O9MA 1MWKA 5AQGA 5AQMA 3AGRA 5L9XA 3QBWA 4DF8A 1SQKA 2HF3A 1U47A 4B1WB 1YAGA 2JEFA 4K4GA 3Q7BA 3I8BA 4FWKA 2BPGA 1DOQA 2E2OA 4Q43A 2AQ4A 2ASJA 3GOIA 4B9MA 3HPOA 1NKBA 3CIPA 1YVNA 3HBTA 3ATVA 5E84A 1NJIO 2KFNA 2E20A 3UKRB 4EAHD 5FPMA 2IHMA 3HTVA 5M1NA 4E1JA 3OJUA 2F1IA 3O1WA 1X3NA 4JKDA 2GUPA 3A5MC 1NK7A 4RNNA 3V6KA 4KLIA 7ICKA 3O1BA 5B8HA 2GX9A 1GLLO 3DLLL 5AZIA 3MDAA 4H0YB 3SMPA 1RFQA 4Z6FA 5F9LA 2W9CA 4K42A 4BGAA 3SZ2A 3K4GA 4F4ZA 4F92B 4LZGA 5EVZA 5BPLA 3FLCO 3O9UA 2Y1IA 1BUPA 4BY9C 2YJEA 3PMLA 3EKSA 3T5JA 1Z05A 1YUWA 4DL3A 1ZQBA 3FE1A 3H6EA 4DO9A 4NLCA 2BQRA 3M9OB 2E2PA 3P4IA 3BQ1A 1L5UA 1WUAA 2AGOA 2W9AA 1RDUA 4Z6EA 5TKYA 4QZHA 4ELTA 1VAZA 5KFFA 4IO8A 2V7ZA 3GV7B 5JLFA 3RBEA 4FL9A 4QZAA 2QWQA 2CGLA 5GINA 3E1YA 4GXKA 1VQPN 2QI2A 3FGUA 4JHDB 3DWLA 3KZBA 3C65A 2IHNA 5M1OA 2W9CB 3GQCA 7ICTA 3MDQA 3N4PA 5EWFA 3VEXA 4ED6A 3F2KA 3CCVN 1ZQXA 3F5TA 5M1QA 3OBYA 3CCJN 1BPDA 3QE9Y 4IOXA 5IIMA 2P9SB 4RUAA 1WCNA 5C5JA 4KLQA 5KFVA 3OHRA 4KBOA 5IINA 1MQ2A 4P4OA 4P4PA 3MN9A 4RQ3A 1RYRA 3KHRA 2R8GA 1ZQDA 1EXNA 3GL1A 5AQZA 4DQ8A 3Q8LA 3M6GA 5L1JA 4QS8A 4O8UA 4B9LA 1HJPA 3GFKB 4PH5A 3ISBA 4ECTA 4QZFA 5J0OA 4CZMA 2ZJPL 1GLCG 3PIOL 1XSNA 1IM4A 4F2SA 4M9LA 4DQIA 1OKJA 3EPIA 3CETA 4IO9L 4TURA 2J6TA 3TQ1A 1S72N 2HBKA 3TI0A 3G6XA 5AZIB 4K25A 1KFTA 4RU9A 2V51B 9ICJA 2P9NB 1XSLA 3UE5A 4IRDA 1NJWA 5JMVA 5EOZA 1D4XA 4J9SA 2OTLN 3PX4A 2CGJA 3EPGA 4BC4A 3M8SA 1VQ6N 1MC8A 2BCVA 4TQRA 3J8AA 8ICAA 2VWBA 1VQ8N 4BGBA 4FS2A 3GIMA 5BOMA 1UA0A 5J0YA 4A2BA 3VENA 9ICNA 4YOWA 1VQ5N 2CGKA 3QZ7A 4XH1A 4O5CA 4IEIA 2F1HA 4JKGA 3TANA 2JEGA 5KFZA 3TARA 1JCEA 3H3OB 4KLMA 1BPBA 3KHLA 2P9NA 2QWOA 3ENHA 2HF4A 1QVGM 3VETA 4UB1A 3UXPA 2JWLA 1L3TA 2UVRA 1TV9A 2PXIA 3VMFB 4CZLA 2Q1NA 3U4LA 3FYHA 4CD1A 4YR3A 1MWMA 1YIJN 5KFRA 3EL2A 1CUKA 5DB7A 1RPLA 3FR0A 4B1YB 2QM1A 4BXOB 4HTLA 1C7YA 3JPOA 4QZ8A 3EZWA 1T3VA 4YXMA 2V9WA 4L3QA 8ICKA 1KLNA 3A5LC 1MA9B 4BC2A 4F5OA 2D0OA 3MN5A 1RXVA 2Q0ZX 3Q8RB 8ICCA 3OSNA 2Q97A 4DWIA 3RSEA 3C2KA 4YORA 3SV4A 1OVYA 1ZXOA 2BCUA 1YJNN 5DB8A 5AFUH 5I9EB 4TUSA 5AQLA 3WXIA 1ZQNA 5KG7A 2IMWP 5AQNA 9ICSA 2A3ZA 1WCLA 8ICBA 2P9IB 3G25A 3EWAA 4QZGA 4G3IA 1S0NA 3ENBA 1SL1A 4QW9A 2BCRA 2WFBA 5CB1A 1Q86O 2AQ0A 4B9SA 1UT8A 4ILHA 3VTIA 1ZC6A 2D1KA 8ICWA 4FWRA 4M63C 5LJWA 3JPRA 3TSQA 2ISOA 3PW0A 2F9WA 4NM1A 4UBCA 3H45C 5KQ8A 4KLFA 5CA7A 3MR3A 3Q7CA 3LWMA 4I2AA 1P90A 3O9QA 1BU6O 4O3PA 2KZMA 3QBXA 2FSNA 5AQOA 1T4GA 7ICFA 2CH6A 5AQHA 1ATNA 3KTQA 3PW7A 3IUCA 4DOAA 1K1QA 1VQKN 4YMNA 2A42A 4GXIA 4IR9A 4DFKA 4MFAA 1TKDA 1XUPO 1S0VA 3WT0A 1NOMA 3G6YA 2ZTCA 3ULEA 1NKEA 2HBLA 3OA9A 2BUPA 4J9OA 1SKSA 4KLSA 4UAYA 3L0QA 2D0PA 3VGLA 3SI8A 5EY4A 2MAXA 4J9RA 1TUYA 1JJ2M 2Q0RA 3ZEUA 1TK0A 4IWVA 5JICA 2W8LA 5BRFA 3R3LA 5H1SQ 4CD3A 3EO3A 2C2EA 3MGIA 4YVZA 7ICIA 5KFMA 5F9NA 4H0VB 3ZX2A 4DHYA 4WF9L 4DQQA 5EX5A 4YOTA 4ED0A 4DL4A 4FPAA 5J2DA 4DL7A 4GVEA 3ZD8A 2RDIA 5KFDA 3B0YA 4RT2A 5M1KA 1M90O 3O4WA 3WUHA 2A6AA 2BQUA 5GIPA 4MFCA 1S22A 2YX6A 3LL3A 4RQ1A 4H0XB 1U4BA 3BQ2A 3ENOA 5J2GA 1GLBG 2XO7A 4YR2A 1T6CA 4JAXA 2R8JA 2FMSA 4BG8A 1QSYA 5DG8A 7ICUA 4JD2A 3ULEB 1NM1A 4JKCA 3T3FA 3IFRA 4O5EA 5D49A 5HNKA 4J9KA 5C0YA 3H46O 3T5LA 3AU2A 2QW9A 5DQIA 3SK3A 3L4QA 4DQPA 3K75D 4CZKA 3VEZA 5DKWA 4ECWA 2KFZA 3O9RA 2ZF5O 2YHWA 3AUOA 1CZAN 2E1ZA 4C8OA 5BPCA 5KG5A 5ADXH 4F5NA 5L1IA 9ICPA 4DEZA 1W97L 4K4IA 3SAFA 4BGDA 4GC6A 2P9LA 9ICLA 5DBCA 2VA2A 5J29A 3QICA 4C1NK 1BGXT 2ZGYA 3C23A 2NNWA 4UAWA 3PV8A 4G9ZA 1HLUA 5J0PA 1XC9A 3HWTA 1QZ5A 3IMXA 2BH1A 4EEYA 4GV3A 2JWKA 2FMQA 4M7XA 3F9MA 3DAWA 3VF6A 3CQXA 1LB2B 2BPFA 4Z6DA 4EBDA 4DL2A 3WXJA 3CCLN 4I2FA 4NLNA 5BN8A 3MFIA 4F4KA 3PW5A 1HPMA 3WXLA 5KT4A 5DQHA 4ED2A 2A5XA 2PFQA 3BDPA 3O6WA 4U67L 1NK6A 4ECVA 4NB4A 1NGFA 4YOUA 7ICQA 5JUMA 3Q8QB 1X9MA 1HKBA 4H0TB 4IJNA 3PO4A 2XY5A 4I6MA 7ICPA 3UXNA 4B9UA 3H40A 3ZDCA 2WTFA 2DPNA 4A61A 3OBWA 4M0AA 3TTFA 1X2IA 1DGSA 3PR5B 3AU6A 5FPDA 1BPZA 1TAUA 5DLGA 3A8YA 5KFYA 3G6VA 1BVSA 4RT3A 1NGBA 2QA4N 1VQON 4M7YA 2QTDA 5BN9A 5CJ7A 2KZZA 3SAGA 1KC8O 3VTHA 2GEMA 5DB9A 4PHDA 3JPPA 2W40A 3FZHA 2IA6A 5EWGA 3M9NB 4CZHA 2W9BB 3WQTA 3MABA 4RPXA 4GV6A 4R8UB 3VEYA 2ZUBA 3P31A 1LV5A 1SKRA 4M9JA 4ELUA 4F9OA 3CJAA 4GXJA 1NWKA 2E2QA 3BQ0A 3ID6A 3GDXA 2LYHA 1Z6RA 5F2RA 2WC9A 3RR7A 8ICNA 2AJQA 5IILA 1NGEA 4I6MB 4ISFA 5E26A 3C7NB 4A57A 3ORYA 1BO5O 3TFRA 5FPNA 5DGAA 2P9SA 3NGDA 4MFFA 4KITB 1NGIA 5AZJB 3T69A 4KLDA 1W2BM 5L1LA 2FF6A 1KAYA 5KG0A 4F93B 3G6EN 2HOEA 3CHWA 1NK9A 4NY8A 5GADP 3IM1A 2BTFA 4MF8A 3MMVA 3ZETB 4I28A 3MGHA 4ISGA 4R79A 3LM9A 1ZQYA 3JS6A 3SLCA 3ISCA 3SYZA 4M2YA 4DSLA 9ICUA 4JKHA 4DSIA 4FO6A 1MDUB 2Y1JA 4I27A 1S3XA 5L1KA 4UB5A 8ICFA 4KTQA 4RNMA 4XA5A 4QWBA 2W9MA 5KTQA 4DCHA 2VYPA 2XY7A 4YMMA 5J2AA 4AM7A 2VA3A 2ISPA 2ASDA 1TK5A 5KFAA 4YP3A 3MN7A 5DGBA 3TAPA 3RB6A 3KHYA 1QSLA 2PI5A 3O08A 1JX4A 4FWQA 3CI5A 3BF1A 3ISDA 5JVHL 3MWPA 3GV8B 3R9PA 4MEXA 3D7EO 4BR2A 4MDAA 5BOLA 3GIJA 4Q8FA 2C2RA 4FWLA 4RPZA 4M47A 1ZQUA 1E4GT 4I2GA 1EO1A 5DB6A 5CHIA 3OHAA 3ZDBA 3HX0A 4ED8A 4MEYA 5KFKA 2P6RA 2QWLA 5KG6A 1D9DA 5AFUA 1U48A 1ZQJA 3JPTA 3LDNA 4PGXA 3NMUA 1KTQA 1EQYA 5HL7L 5F1XA 1N8RO 3ZDDA 2QWNA 3VF2A 4I2BA 1D9FA 2QXLA 5CHGA 3RJJA 4MLEA 4YOYA 1DEJA 5FPEA 4XUSA 5MLCQ 4NM2A 2KKZA 3GIKA 2HHWA 5C2FA 4O0IA 3SJHA 5IIJA 1GLFO 4IDHA 8ICEA 4J9LA 4Z94A 4PGYA 2ZJAA 1QSSA 2P9PA 2Q36A 4H5VA 4FPBA 3TU5A 4CZFA 4K43A 3ZYYX 5C10A 3GIIA 1BPYA 4RQ8A 1RDWX 3OHBA 8ICMA 4F5PA 4PHEA 2YHXA 2ASMA 2PAVA 2CH5A 4BRMA 3ZEUB 4BREA 5D4BA 3CCQN 3RR8A 4OPHA 4QWEA 4H5WA 2KLAA 4ELVA 4PPXA 3Q8MA 4FBTA 5KQDA 7ICGA 2NRHA 4YG2A 1D8YA 5BR9A 1JCGA 1TFRA 4XEIA 4NLZA 4RPYA 5AQRA 4CCHA 4QWAA 4TQSA 1P8ZA