2NRTA

Crystal structure of the c-terminal half of uvrc
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
GLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 79
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrtA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrtA01
4DQSA 4DS5A 3Q8PB 2PFNA 5KFFA 5CHGA 4FBTA 1ZQYA 2I1QA 5DDYA 1L5UA 2Y1JA 1COOA 4YXMA 4M47A 5J0UA 5KT3A 5KFSA 4O9MA 3RH5A 4UAZA 4FS2A 4Q43A 1S9FA 4RQ8A 1K1QA 5CA7A 4ECZA 9ICJA 3T5LA 3RH6A 1ZJNA 3UQ2A 4XQ8A 8ICLA 4DQIA 5DG9A 5DGBA 4UB1A 2BPCA 3KHHA 2BCSA 5KFMA 4DF8A 1NJXA 4EEYA 1U48A 1WCNA 3H8SA 4GXKA 2NRVA 1SL1A 4P4OA 4Z6DA 3C2KA 1HJPA 2FPLA 2XCAA 1JX4A 4RNMA 4I2IA 1T8EA 4DSEA 1XC9A 2H5XA 3HWTA 2BPGA 2C22A 8ICCA 4KLFA 4QZAA 2P6RA 1KFSA 4O3PA 1ZQPA 2ZTEA 4PPXA 3TFRA 1NK8A 9ICBA 2BR0A 7ICEA 4KN4A 1RXWA 7ICTA 2R8IA 3JPPA 2MAXA 1ZQHA 4YMMA 2W8KA 4J9MA 2BCRA 5DKWA 3MBYA 4QWBA 9ICIA 3ZDAA 2MUTA 2AQ4A 4IRCA 1NK4A 4X5VA 1BPEA 1H38A 4K4HA 3OHAA 2W9CB 1IM4A 1RYSA 3PW7A 1NJWA 1S97A 5C5JA 5J2CA 4EYHB 4R63A 3GV5B 1LB2B 4ECQA 3RAXA 4DSIA 4M2YA 3MR6A 8ICMA 1RXVA 4BXOB 5DG8A 1L3VA 3PVXA 4O3NA 2IMWP 1U4BA 2GWSA 3RRHA 4MEYA 3V7JA 4C8NA 4RNOA 4C8LA 4O5EA 4GLXA 4O3RA 3PW2A 2HHVA 2R8JA 2HHTA 4DO9A 4E0DA 8ICZA 4J9SA 2R8KA 4BWJA 5KFKA 4DSLA 4PGYA 1NKBA 1UT5A 4O3SA 1D9FA 2OWOA 2C28A 1A76A 4YVZA 4QZBA 1BPYA 4RQ5A 4QWEA 2JZBB 4KMUA 2C2DA 3PR5B 1BGXT 3KHRA 3UPQA 8ICRA 3ETLA 1RYRA 5DBCA 2XCPA 3MR2A 2HVHA 4M9NA 3AU6A 4P4MA 3FYHA 1KLNA 4DQQA 1QSYA 2XY6A 4I2EA 3M9OB 3SV3A 4EZ9A 1S0VA 3G6VA 2B21A 4QW8A 2VA8A 5D4BA 4F4XA 2JEFA 4M9GA 4Q8EA 8ICIA 4KN7A 1A77A 4NLKA 5J2IA 4QWDA 3PMNA 3T5JA 5L1JA 1DGSA 4M6WA 3GIIA 2UVRA 4QWCA 1XWLA 2PXIA 2JEJA 3ZDDA 2J6SA 4JWNA 5IIMA 9ICWA 4LVSA 1BPBA 4I2BA 2AGPA 5KFUA 5J2AA 4EYIB 4F8RA 1UT8A 2HHSA 8ICGA 4KLLA 1ZQGA 3PR4A 4DLGA 4RQ2A 1X2IA 4F50A 3OGUA 1TK8A 1ZQJA 2IA6A 8ICEA 3RBDA 4TUQA 2ZTDA 4ELVA 3SZ2A 1BVSA 7ICFA 7ICLA 3G6XA 4DL6A 4GC7A 7ICOA 2M9NA 3N4MB 4R8UA 3IM1A 1ZQEA 4PGXA 1MC8A 2ALZA 1X9WA 1SL0A 4DQRA 4KLJA 2ZUCA 4QZHA 4DFPA 4IQWA 3MR5A 2ISPA 4RPZA 2BCUA 1QSSA 1ZJMA 1SZPA 5KG2A 3RR8A 1ZQZA 4QZFA 3QZ7A 3GDXA 3LDAA 5BOMA 1L3TA 2FMSA 1KEJA 1ZQAA 3RJJA 3BQ2A 4TQSA 2BPFA 1UA0A 1MQ3A 4GXIA 4HYKA 2VA3A 3PX4A 8ICVA 3RH4A 1JMSA 1RPLA 7ICIA 7ICJA 5KFTA 1TAUA 4C8KA 1WCLA 4ED1A 4YD2A 1TVAA 3RB3A 2HHWA 4M9JA 3H40A 3JPTA 3TFSA 1Z00B 4YFKA 4F4WA 3MR3A 2UVWA 5KFAA 4XRHA 4M0AA 1TAQA 2ZJAA 4RU9A 9ICTA 8ICQA 4UB2A 4QZEA 5DQIA 3C2LA 3QEBZ 4YR2A 2ASLA 4DL4A 3RJIA 3PX6A 4ED0A 2JEIA 4KLHA 4MFCA 3V6HA 4DF4A 4RPXA 5KFVA 2A1JA 4QZIA 3ISBA 2IBKA 3M8SA 3LWMA 2AU0A 4RNNA 3ZD8A 7ICMA 3EYZA 3C5FA 2UVUA 4KLQA 9ICMA 4ZH4A 5L1IA 3Q8RB 2P6UA 3UXOA 3H4DA 1BPDA 2VANA 2ASJA 4GC6A 2BCQA 4G3IA 4RUAA 4DL3A 4LZDA 4KLUA 3GV8B 3JPRA 5DBBA 4EBCA 4M9LA 4RT3A 4EZ6A 4R65A 1ZQRA 4NY8A 2PFOA 2F1HA 4RQ1A 5KG3A 4XUSA 4I2CA 3ZD9A 3MDCA 4QZ9A 3C23A 1NOMA 5D46A 4YN4A 5J29A 4ED3A 5J0WA 4JV2A 3OSPA 2V4QA 2ZUBA 2IHMA 4DEZA 3C1YA 3NGDA 4ECRA 3GV7B 1S77D 3RB4A 5J0RA 3RBEA 4QZCA 2BQRA 9ICRA 1KFDA 3PW5A 4KLMA 5KT2A 3G6YA 8ICAA 3OSNA 9ICGA 8ICHA 4NLZA 2V4RA 4IQVA 4LZGA 4IR1A 5F9LA 5KT4A 5EWFA 1MSWD 7ICPA 4JWMA 4GXJA 3TARA 2FMQA 3RRGA 4UQGA 1LV5A 9ICXA 8ICFA 2BQ3A 1ZQBA 5L1KA 1BPXA 5KFDA 2RDIA 1U49A 3RJGA 2DFLA 8ICOA 1T7PA 5DQGA 5DB7A 4RT2A 4DFKA 3RR7A 5KG0A 1B22A 1ZETA 2KTQA 9ICUA 3KHGA 4J9RA 3EPGA 4IQUA 4I2GA 7ICGA 4B9TA 3BJYA 4ECTA 1B43A 1KSPA 2V9WA 4B9SA 9ICOA 4PGQA 3C21A 4PHPA 3C2MA 1DOQA 4KLDA 1QLNA 3C1ZA 5J0QA 2AQ0A 5HMLA 4EBDA 3IHQB 1D8LA 5J2JA 4R66A 2FLNA 9ICAA 4DFJA 5HNKA 4TUSA 3EPIA 5HHHA 1CEZA 4TURA 4DOAA 4JUZA 5J0TA 2BGWA 1XSPA 1NK5A 5KFOA 3Q8MA 4Q8FA 1SL2A 2NRRA 4IRKA 3LWLA 4I2AA 1NKCA 3OJUA 3T5KA 2AGOA 4UB3A 4P2HA 3B0YA 9ICFA 7ICHA 2NRTA 4F2SA 1SKSA 3Q8LA 1T3NA 4I2JA 5J2BA 4TUPA 5J0YA 5L1LA 1QSLA 3M8RA 4UAYA 1NK0A 4B9VA 4DQPA 3SV4A 4O5CA 1N48A 3GFKB 8ICYA 4QW9A 5CP2A 1U45A 4B9UA 3RJHA 4Z6CA 1HUOA 4YD1A 3QZ8A 4J9OA 3PW4A 9ICQA 4J9QA 4ECXA 3MABA 3LK9A 3UQ0A 3TQ1A 3RJFA 5L9XA 5CB1A 8ICKA 5CR0A 3Q8SB 2Q0ZX 5DB8A 4IQTA 4YCXA 4MEXA 4ECWA 4DL7A 4DWIA 2HW3A 1S76D 1TFRA 3NTUA 2MUTB 4UBCA 1CUKA 4ECYA 2PFQA 1QTMA 5KFQA 3RJKA 4I28A 3THVA 3GIKA 3RJEA 5KFLA 3EZ5A 1TK0A 1Y88A 2BQUA 2KN7A 4J9LA 1D8YA 2ZTCA 5KFZA 4F5QA 2Y1IA 3T5HA 4F2RA 4NLNA 5KG7A 4MF8A 5J2FA 4FS1A 1NKEA 1ZQMA 4O0IA 4F91B 5J0OA 8ICBA 4DSKA 2FMPA 3BQTA 4B9MA 4I2FA 1K1SA 3ISDA 4NLGA 4FO6A 2PI4A 5CJ7A 4EBEA 3GQCA 3TI0A 2W9CA 3V6KA 1V9PA 2W9BB 4CCHA 1L3UA 4DOCA 3BDPA 4PHDA 2R8HA 8ICXA 5IIOA 4QZGA 4RUCA 2RDJA 8ICJA 3AUOA 5CWRA 3E2EA 3UXNA 3PMLA 4RPYA 2FLPA 1SKRA 2ASDA 1NJZA 5KFGA 1ZQFA 5KFEA 4BXOA 4DFMA 2ISOA 4F92B 2IHNA 3MGIA 1N56A 1KTQA 5IIIA 4TQRA 3HT3A 4ECSA 4ELUA 5KTQA 5TZVA 5KG1A 3JPQA 2PI5A 4QWAA 1XU4A 3HP6A 2J6UA 1NK6A 4PHAA 2BHNA 5KFRA 4NM1A 1RZTA 4FBUA 4ED8A 2ZUDA 1JIHA 5KG5A 5KT6A 4ECUA 3ZDBA 1ZQVA 4F5PA 5EWGA 2JZBA 4QZ8A 5IINA 2R8GA 4F5NA 3OJSA 4B9NA 3UXPA 4M6WB 1NJYA 4KTQA 3B0XA 4I27A 2F1JA 2NRZA 4RQ3A 4C8MA 3PV8A 2F1IA 2WTFA 5BOLA 1U9LA 5DLGA 4KLEA 3BQ0A 4UB5A 1XO1A 5J0SA 4DL2A 1JN3A 1C7YA 4IR9A 8ICPA 4DS4A 1D9DA 5KFWA 2HVIA 9ICCA 5KFNA 5J2HA 5HHIA 3EWAA 7ICRA 2AJQA 1TK5A 1JXLA 4F4ZA 1PZNA 5J0XA 3PY8A 4JK1A 3JPNA 4ED7A 4Q44A 3RB6A 5JUMA 4C8OA 1XSNA 4M04A 4I2DA 4R8UB 4Q45A 4DLEA 1UA1A 1L3SA 4M9HA 4KLTA 4PHEA 4O5KA 2KFNA 1HUZA 1ZQLA 2FLLA 3ORYA 2JEGA 2XGPA 4I29A 3KHLA 1TKDA 4F4KA 5KFJA 2KZ3A 3GILA 1BPZA 3PO5A 3PO4A 2KZZA 9ICHA 5EWEA 1JXEA 4YQWA 4UAWA 3HPOA 1S10A 2BDPA 1ZQDA 4JV0A 1T4GA 5DQHA 5J2DA 3V7LA 1EXNA 4UB4A 2W9AA 1KFTA 4DOBA 2I9GA 4QZDA 4I2HA 5HMMA 4KLGA 4JV1A 3V6JA 4RQ7A 4RQ0A 2PFPA 1U47A 1ZYQA 1ZQSA 5J2EA 2ATLA 1AROP 3GIJA 4YMOA 3V7KA 1ZQXA 5IIKA 4O3OA 3BQ1A 5KFBA 7ICKA 3EW9A 3H4BA 2XY5A 2C2RA 3RB0A 5J2GA 2AGQA 2A1JB 4ECVA 5DG7A 1XSLA 4ELTA 2P66A 5DGAA 5KFYA 2XC9A 2HHXA 4KLIA 1Z00A 2NRWA 3PNCA 4MFAA 4R64A 4YR0A 9ICPA 3RTVA 5D49A 3H7IA 2W9BA 9ICSA 2ZJ5A 4DL5A 3M9MB 4J9KA 2LYHA 1NK9A 4BWMA 5KFIA 1ZQUA 4F93B 5EOZA 7ICVA 5KFPA 3JPOA 4NM2A 2UVVA 3PW0A 4F3OA 5DB6A 8ICUA 3KTQA 4B9LA 2HHUA 1ZQCA 2DPIA 1ZQKA 3N97B 7ICQA 3ZDEA 3T3FA 4NXZA 5DBAA 1ZQTA 8ICNA 5KG4A 5DDMA 5KFXA 4YXJA 5J0PA 2XGQA 3M9NB 2XY7A 1Z3EB 3AU2A 4KITB 3RAQA 2ZJ8A 4IRDA 9ICLA 3PX0A 4XA5A 3MFHA 4K4IA 1MQ2A 4MF2A 4ED6A 4Z6FA 3TAPA 3MDAA 4DSJA 5KFCA 4KLSA 5J2KA 5KT7A 3OHBA 3MGHA 4BDPA 1XS9D 1S0OA 4YP3A 4RZRA 3Q8QB 2BKEA 1ZQOA 4J9PA 8ICTA 4RQ4A 3SI8A 5KT5A 1ZQQA 1KRPA 3ZDCA 7ICSA 1IXRA 5IIJA 1X9SA 2NRXA 3H8WA 3JPSA 3QE9Y 4BGDA 2FPMA 3ISCA 3Q8KA 1X9MA 4O3QA 1ZQWA 5HP4A 5F9NA 5DB9A 3GIMA 8ICSA 4K4GA 3C5GA 9ICNA 4J9NA 4KLOA 4YMNA 3HX0A 9ICVA 4MFFA 1NK7A 5KFHA 7ICNA 4RQ6A 3V72A 2XO7A 4YR3A 4YG2A 4UBBA 7ICUA 2HHQA 4F4YA 2BCVA 2FPKA 3SYZA 5IILA 9ICKA 4Z6EA 1ZQNA 3K4GA 3C65A 2KZMA 2W8LA 2J6TA 8ICWA 3MFIA 1SKWA 2C2EA 3FDSA 4PH5A 3H8JA 1S0MA 4F5RA 3TANA 1ZQIA 2DPJA 9ICEA 1TV9A 2W9MA 1S0NA 3K75D 2VA2A 3HW8A 5BPCA 4F5OA 4ED2A 3TAQA 4P4PA 5KG6A 3QEAZ 1KDHA 4DSFA 5DLFA 2KFZA
chains in the Genus database with same CATH superfamily
4DQSA 3CNHA 3V9SA 3HPHA 2EWSA 2ZGYA 2PFNA 5KFFA 4CJRA 4CZIA 5DDYA 5AI0A 2Y1JA 3K5NA 2Z1IA 4M47A 4WFNL 2QWOA 4Z4FA 2DTUA 5AI6A 5EE3A 3B6OA 4H0YB 3J80O 3UMBA 3WEEB 1K1QA 4ECZA 3AVNA 4E19A 2A1RA 3LP1A 1TUUA 2P5GA 4E3SA 2P9NA 1ZJNA 2ZIWA 4KX5A 5DGBA 3KHHA 3DOKA 3JYTA 4DF8A 2O8BB 5BRHA 2HOQA 4P0PA 2YMQA 4GXKA 3H1VX 4C23A 1SL1A 4JS4A 1HNXK 4RG8A 3DXMB 3TAEA 1ZD4A 3O9SA 1KVAA 5B8HA 1EO1A 2H5XA 2D0PA 3HKZC 2C22A 1WAJA 1PK1A 3ETRA 3VQ6A 4O3PA 1REVA 1YIJN 1ZQPA 2G8FA 4KN4A 1EX4A 4CIEA 3SPZA 4M3YA 3VESA 4DG1A 2GLEA 2YNFA 2ZE2A 5EU7A 4OO1J 4XH1A 3VCBA 2BCRA 3FE1A 4F3TA 9ICIA 4RW7A 4YOVA 2JRZA 1QQCA 1RDBA 2GWJA 2MUTA 2IAJA 3SLCA 1NK4A 4BRGA 4K4HA 3L6QA 4I7FA 2H3ZA 4IO9L 2F76X 2VJ4A 3PW7A 3WXIA 5AM1A 2KKVA 2UU9K 5J2CA 1TGOA 3K1ZA 1X42A 3GV5B 4J2DA 2QWPA 3THXA 4UATA 4Y2XA 1EXQA 4GY2B 3AVAA 5AI9A 4O3NA 2IMWP 2A3VA 1ECWA 3RRHA 1TYQB 1RDWX 4C8LA 2O4GA 1K73O 3PW2A 4OGCA 2R8JA 3QETA 3DI6A 4DO9A 4J9SA 1QZ6A 3ZETA 3ICXA 4ZHRA 4M3WA 2VCPA 2ITMA 3PSPA 3L4PA 4YVZA 1BPYA 4FZNA 2JZBB 1BQNA 3QO9A 3S41A 5AQXA 1IG8A 2VWJA 3MR2A 2F96A 1O08A 4M9NA 5J2MA 3FYHA 2G8VA 4DQQA 2F8LA 1SUQA 2XY6A 4I2EA 4B6JA 4EZ9A 4DR3K 2HF3A 2E1FA 4EEKA 2W55A 3V9WA 4KRFA 2JEFA 8ICIA 4CESA 1NLVA 1A77A 1BU6O 3HZ6A 4MQ3A 2X78A 2JEJA 3OPXA 1P90A 4F72A 5CZ2A 1J97A 4I2BA 1CZ9A 2AGPA 5KFUA 3DLEA 1S5JA 2HOEA 5AKLA 3PR4A 4DLGA 2F7TA 4CJUA 1X2IA 1JLCA 3IG8A 3TACB 3RBDA 4CJSA 4GFJA 1BVSA 5AHXA 3KWIA 2O8CA 2M9NA 3N4MB 3L8BA 3THYB 4R8UA 4OKJA 2WF5A 5BREA 1SL0A 1L8LA 1B4FA 4DQRA 1RDFA 4QZHA 4DV2K 1Q18A 2ISPA 4CFDA 4R5PA 5ALRA 4UB8U 3KFUF 3QEXA 5GTIU 2LM4A 1ZQZA 3ZCMA 2XICA 3DV9A 3QUQA 3GDXA 3LDAA 2XRIA 5BOMA 1BO5O 1E3MA 2FMSA 3BQ2A 4TQSA 3VQDA 2A19A 1UA0A 3L2VA 4GXIA 4FW1A 3PX4A 2QKQA 3RH4A 8ICVA 1N2XA 2HB5A 5EX5A 5HRNA 4BX9C 3H6EA 7ICJA 1RBVA 1ZXOA 2RQ5A 2ZIXB 2HHWA 3H40A 3JPTA 1COKA 5HRSA 5GAHP 3OTQA 3TTCA 1Z00B 4YFKA 4DV1K 3P38A 2ZJAA 8ICQA 5AKKA 3Q7CA 5AKZA 3C2LA 3LM2A 4YR2A 2UUBK 4EAHD 2GOLA 3PX6A 5C0YA 1A6SA 1C0FA 2DFEA 4CJ3A 1GOCA 4O5FA 3TAMA 3FGUA 2YHWA 5FROA 4QZIA 4CGFA 5BRDA 2IBKA 3AO3A 2RKIA 2KE7A 3ZD8A 2D0OA 3MEDA 3O1BA 4ZH4A 5L1IA 1RCHA 4QJFB 3Q8RB 3UXOA 3H4DA 4E7IA 2OPSA 5AKEA 2ASJA 3HVTA 2BCQA 1KQSM 2H3VA 4LZDA 4KLUA 3LDNA 3M6KA 1VDVA 4NY8A 3VEOA 1IG9A 1GLEG 2KEYA 4JMUA 2RHKA 4RQ1A 5KG3A 4I2CA 1T3QA 2P9PA 1SV0C 4CFAA 3T79A 1XUPO 4DR2K 5D46A 5J2NA 3A5LC 3A2FA 2NYVA 1F21A 2FBVA 1BQMA 5J1EA 1WSFA 2KHOA 4ECRA 3NGDA 3OYEA 4LFAK 1KAZA 3KLGA 1S77D 5KNIA 3HM9A 4KHSA 2BQRA 1IG6A 3NH2A 4CE9A 5GTHU 5AQQA 4CHYA 4B8CA 1R59O 5FP0A 8ICAA 2B6GA 4CGGA 1YF5L 2KSOA 4IR1A 4FL9A 3QLHA 1MSWD 5AIAA 3U26A 4JWMA 3TARA 5LJWA 5TKYA 4UQGA 1LV5A 2FBYA 3WNHA 3AGKA 2LPEA 3RJGA 2E1YA 8ICOA 3IRUA 1RDDA 5KI6A 1PK3A 3A0IX 3F2DA 3TSUA 4QS7A 1M1KO 1S1XA 3G71N 5GAEP 3AVHA 4JK7A 4B9TA 4AF1A 4FZMA 1VSEA 3MMVA 2YN4A 1LKYA 4IG0A 4KH5A 3WNFA 4FCYA 4KHWA 3C21A 2XHBA 4N56A 1SS6A 3SUNA 3NF6A 3F5EA 2QM1A 4E1JA 1BWFO 5HMLA 4F71A 4EBDA 1ITGA 1V4TA 4DV7K 2JGAA 1Z1BA 4TURA 1Q86O 1NK5A 5HROA 1SL2A 1CRXA 4O8UA 4GKJK 2W40A 1Z25A 2X74A 4YOTA 2K89A 3VQEA 3CMAN 5AQHA 4BRNA 3B0YA 3KZXA 1QHAA 4Y2SA 3NUQA 1YAGA 2BZFA 4F2SA 3VGKA 1SKSA 2P9KB 3TSPA 5J0YA 3AVCA 3M8RA 3FAHA 3DLGA 4NJ8A 4UAYA 4O5CA 1RTHA 2XY8A 3UE5A 5KGXA 3F2KA 3GFKB 8ICYA 2ZIUB 5CP2A 3VENA 4C80A 1K8KA 4KX3A 2E8AA 1HUOA 1JROA 1NGHA 4M7XA 4YD1A 3O0FA 1ATNA 3QIPA 3U8XA 5ALOA 4WQ5A 4ECXA 2CXYA 1C0UA 3WK7A 2YX8A 4YCXA 4MEXA 3NGZA 4ECWA 2G8IA 3SI6A 4ID1A 1S76D 5AFUA 2QWQA 4NLCA 3RJKA 4IKFA 3GIKA 1JL2A 4CHNA 3L4IA 4KHNA 1TK0A 5C10A 1RBSA 1FFUA 2BQUA 1UAXA 3ALYA 1KC8O 5FPEA 1OW5A 1SV4A 3CETA 5KFZA 1NGFA 4F5QA 4H5NA 2EX3A 5J2FA 1NKEA 3OYGA 2E3TA 4O0IA 5J0OA 4KTWA 5C24A 3A0BU 2NO5A 2VG7A 2GX9A 4JD2B 5AK5A 1ILYA 4UB6U 2W9CA 3D2FB 3VETA 3BDPA 1N6QA 4PHDA 2R8HA 1YVUA 5IIOA 4RUCA 2RDJA 1S1WA 3VQ4A 4B3OA 3E2EA 3UXNA 3PMLA 1NJZA 5ALVA 1MN8A 4BXOA 4F92B 2FBTA 3QIOA 4TQRA 2WC9A 3HT3A 2LSNA 4A5BA 4PL2A 3WU2U 2EZZA 5KTQA 5TZVA 4CEFA 4BVPA 2WFBA 3JPQA 2Y9TA 5KG1A 4CVNE 1NGBA 5JTIA 2DFFA 2ZWHA 4DU1A 1XU4A 1WSJA 1YT3A 4C1NI 1JLGA 4FOIA 1LVHA 2DL0A 4NM1A 3LYSA 4FBUA 1BA1A 1W0HA 5JS2A 1DT9A 2FJ6A 3ZDBA 4M63C 4MDBA 4WF9L 5EWGA 4US9A 4PL7A 4F5NA 2O8DB 5EE1A 4B9NA 1X3NA 3A5MC 3KBBA 1ASUA 1BNOA 3D7EO 3AARA 5HLFA 1QCKA 5J0SA 3IKMA 4DS4A 3FC4A 3SQ4A 2EZXA 3PY8A 4JK1A 4G9BA 4DCCA 3RB6A 1Q9YA 3QESA 2EANA 1YJ9N 1WSEA 1IIPA 2WBNA 5AQUA 4M9HA 4Q45A 3QBWA 2ES6A 4L8RB 1FW6A 1VK0A 4PHEA 3F2BA 4CJKA 2KFNA 3HSTB 2FLLA 1TKTA 1X3MA 4I29A 1JLFA 4JKEA 4IO8A 3SMPA 2FXUA 5AK4A 3GILA 4OLAA 2KZZA 9ICHA 1JXEA 4YQWA 1JLEA 2Q3SA 3I76A 1QQ5A 4BR0A 4B08A 4CJEA 3B6PA 4NV0A 5J2DA 4Z4GA 3V7LA 1EXNA 3HRGA 4UB4A 4JLHA 1XI1A 3P83D 4IFVA 1T94A 5HL7L 2I9GA 5EVZA 3ZSRA 2A3ZA 3J81O 3V6JA 4RQ7A 4RQ0A 2PFPA 4AILC 3WK8A 3IV6A 2F44A 4FW2A 4KV8A 4X65K 1MDUB 3GIJA 2FI1A 1ZQXA 3BQ1A 5KRSA 1NM1A 1D5AA 4DTXA 3DLKA 2C2RA 3ZYYX 4O4GA 3QUBA 4ECVA 4ELTA 2P66A 5DGAA 4JB3A 2XC9A 1F5SA 1HQUA 1Z05A 3AV9A 2JH7A 1HJRA 2ZIVA 1OUQA 3PNCA 1Q3UA 4YR0A 4FZXC 2W9BA 9ICSA 5ALJA 1TKXA 5TKWA 2LYHA 4BWMA 5KFIA 4CJ7A 1XNRK 4CJQA 1TE2A 1S6QA 3OYCA 3QEIA 1NZPA 2QK9A 3KTQA 2KJ8A 4PJ0U 2RPIA 4FJ5A 3ZDEA 8ICNA 4GVEA 2AP1A 5DDMA 4BDZA 3M9NB 4A57A 3L2WA 3J81j 3D2NA 2KIWA 4Z6FA 3ZEUB 3CQYA 5AQJA 5KFCA 1DK2A 4CFBA 5C12A 5KT7A 1OH8A 3OHBA 3TPQA 5AQRA 1S0OA 3IP4B 1PUZA 4FWLA 5KAIU 1ZQOA 3QEWA 4J9PA 1DEJA 5KT5A 3ZDCA 2A1AA 1KRPA 4GV9A 2YI1A 1IXRA 2HMXA 3KKSA 3OYAA 5T14A 3G0ZA 2DFHA 3P5JA 3VA3A 2FPMA 1UPHA 2EH9A 5F9NA 3GIMA 3TADC 3C5GA 9ICNA 4KLOA 3L2RA 5C25A 4CJFA 1HNWK 3V72A 2KW4A 3W3DA 4CZFA 3DDHA 2UUCK 2Z1HA 4EELA 4UBBA 7ICUA 3AVKA 3RVCA 4FJJA 5GAGP 3K4GA 2J6TA 2VQEK 2NV3A 4E89A 4F5RA 3E58A 2BTFA 2DPJA 1T03A 3RSEB 3P31A 5AZIB 1TV9A 1GLFO 3H3NO 2W9MA 5G5GA 4JNEA 4H03B 5ALIA 2VA2A 1WUDA 5BPCA 4F5OA 2E5SA 4ISFA 2G8KA 3NE6A 5AQPA 4DSFA 5DLFA 4B1VA 3AY9A 5AQWA 4YOYA 4DS5A 1NNLA 1I39A 2Y0SF 4FWOA 3R9PA 2GUIA 1ZQYA 4FWNA 1Z4OA 2QWRA 1COOA 2QWNA 3I56N 4X62K 3U6FA 5KT3A 1HMVA 4Y1CA 3RH5A 2KKZA 4Q43A 4RQ8A 1S9GA 3D0PA 1URJA 3BZKA 2LBOA 5CA7A 3LM9A 2NLXA 3DJCA 2W6KA 3LL3A 1V4SA 2HMPA 8ICLA 1XQSC 2MRLA 4UB1A 2BPCA 2BCSA 5KFMA 1NJXA 4EEYA 3LVWA 4NL9C 1ZOLA 3CFPA 3EE9A 4I2PA 3KHYA 2P9UA 3H8SA 4HUFA 3KLIA 5DM7L 4LF4K 4P4OA 4KHYA 4Z6DA 1EETA 3LAKA 2AXTU 2YKMA 4FJ9A 2FPLA 4B8AB 1O1WA 2NRHA 1GLAG 1L7OA 4RNMA 5EXWA 1XC9A 3A0HU 2BPGA 3L3UA 1RYUA 2P6RA 1NU0A 1KQQA 5AQIA 2KHVA 4PPXA 4UY8O 3TFRA 1NK8A 4CJTA 4FZYA 4FLUA 3AQEA 4OJ5A 4O5BA 4BR9A 2IVPA 1SIJA 3UMCA 4JI6K 3K9KA 4EP4A 2I7PA 2E5LK 3T1YK 2HNZA 2W8KA 4J9MA 5DKWA 4GV3A 4QWBA 4NXNK 3ZDAA 4IRCA 4BRQA 4FVUA 2VGNA 3F53A 4X5VA 4EIAA 3GBTA 1JRPA 1Q8IA 4FWKA 1OH6A 3PIOL 2MSNA 3UKRA 1KKXA 1NJWA 3K5LA 4HUEA 3RFAA 2QARB 4NLBA 4R63A 8ICMA 1IBLK 3M5RA 2H3QA 1N36K 3VOVA 1L3VA 1RT5A 1K8AO 3AVIA 2NUBA 2HSTA 2Q0RA 2YV0X 3VEWA 2GWSA 4W5NA 3V9ZA 3LVVA 3VN5A 2OM6A 4C8NA 5I42A 1KAXA 3AAPA 2HHVA 1SGGA 4LH4A 2HHTA 3D2EB 4E0DA 2A42A 1FJGK 4DSLA 1NKBA 4KO0A 1UT5A 5JICA 3QNMA 3KK3A 1D9FA 9ICMA 3K1RB 1Q46A 2R18A 4FJ7A 1BGXT 3KHRA 3UPQA 4I9LA 1RYRA 4JKGA 4XIUA 3AVFA 2PZSA 2XCPA 2Q2RA 3OYFA 4P4MA 1QSYA 4CJWA 3TABA 3RMBA 3SV3A 3SCXA 3S3NA 4CF1A 2W04A 3NVKA 4J03A 1L7NA 1DTQA 5EOYA 5HRRA 4M42A 3LANA 2FF6A 5D4BA 5AR0A 4F4XA 4M9GA 4DTSA 5J2IA 4QWDA 3EUB2 5F2RA 3PMNA 3T5JA 4Y1DA 1DGSA 2ATQA 4NLNA 1VQ5N 4LJXA 3THWB 1W7AA 9ICWA 4F9OA 2Q36A 4JHDA 2O8EB 4Z4IA 4EYIB 3CJ1A 4KMOB 5H2FU 3WEEA 8ICGA 4USAA 3IN5A 2P9IB 3QEPA 4RQ2A 4F50A 5H1SQ 5EE9A 2ITGA 5ALEA 4TUQA 2ZTDA 2UXBK 1YHQN 2K4IA 4QIWF 2QEXN 2P9SA 4DL6A 4FXDA 1SWVA 3CCLN 2H3GX 1ZQEA 5KL8B 2ZQBA 3C94A 2I5JA 2ZUCA 4IQWA 3H08A 3MR5A 4Y2JA 4RPZA 3UMGA 1ZJMA 4UAVA 1SZPA 1QSSA 3RR8A 1XC3A 2P9LB 4QZFA 3QZ7A 3ULEA 2P5OA 4DR7K 3OS0A 1BDGA 1J53A 1VRUA 2PKEA 2ZXHA 3ZT1A 4QS9A 3NDKA 3M3ZA 2E8OA 1KEJA 1ZQAA 2BPFA 1MQ3A 3IG1A 2CN1A 2VA3A 4GKKK 5AZJB 3S3MA 2JR5A 1RG6A 2DKZA 3VEZA 4US8A 4C8KA 3WKCA 4ED1A 1TAUA 4GW6A 4C0ZA 2B6AA 3FLCO 4F4WA 1NMNA 2UVWA 2DUYA 4XRHA 1TAQA 4RU9A 4M0AA 3HXMA 4UB2A 3AQFA 4FJGA 4CJVA 3CD6N 1C0GA 1N33K 4DF4A 1KL9A 4RPXA 1BL3A 2IDOA 3ZSVA 2A1JA 2KMDA 2IC3A 3CC7N 5AICA 3LWMA 2AU0A 4RNNA 1WNSA 4RW9A 1XHXA 2KJ9A 3EYZA 3C5FA 2UVUA 4KLQA 3ZT2A 3T1AA 1ZRMA 2YB1A 2VANA 4LF7K 4DL3A 1KLMA 4WQ5C 2XI9A 3GV8B 2QW9A 4RT3A 4EZ6A 1BA0A 1V97A 1U6ZA 5FPDA 2HMIA 1QVFM 2P1JA 3L0QA 4CD3A 2NZTA 3QNNA 3F73A 2HI0A 2WFAA 4I6MB 3DXKA 4YN4A 4ED3A 4JV2A 3VMFB 3OSPA 3H3OB 3LZJA 4OJPA 3R9KA 3NRZA 2YNIA 4OCZA 2IHMA 3JAMO 4DEZA 3C1YA 5BPMA 5SWMA 1KFDA 3PW5A 4KLMA 2QKKA 4XH4A 3WUHA 3KLHA 9ICGA 2E8PA 8ICHA 2B4JA 3TADA 4NLZA 2V4RA 4IQVA 2PFUA 1GLDG 5AQNA 5KT4A 5EWFA 4GXJA 3R3LA 3RRGA 1MA9B 2CGKA 4B1YB 2CGJA 1TV6A 5KFDA 1U49A 2O6KA 2DFLA 2PY5A 5DQGA 4CF2A 4BE1A 2KTQA 3EPGA 3V1OA 4B3TK 7ICGA 1HJOA 1BI4B 2DBYA 3BJYA 1VJ5A 1BCMA 1B43A 1KSPA 3EEQA 9ICOA 1G99A 3CI5A 2YCHA 1DOQA 4DV0K 1X6IA 1QLNA 2AQ0A 9ICAA 2N1RA 4R66A 2FLNA 1FEZA 2G5HB 4DFJA 4IOCL 4UW9A 1S1VA 3LZIA 3SUPA 5KPTA 4IXCA 4DOAA 2BGWA 1XSPA 1RDAA 2V7ZA 3Q8MA 1SQKA 3CG7A 2NRRA 2YNHA 1I94K 3LWLA 4L3QA 2P9NB 3OYBA 4FWMA 4H0XB 5C2FA 1R0AA 3KZIU 2ZIWB 4P2HA 4FM2A 4FSVA 1QHTA 4ILGB 9ICFA 2NRTA 4P0PB 1T3NA 3BP8A 2HBJA 4FVMA 1S8OA 1LW0A 2GELA 4Z4EA 3QBXA 1N48A 3LDOA 4DTUA 4NL9A 3MEEA 1PK1B 1HIWA 2YKNA 3QZ8A 4M7YA 2DWQA 3UKUB 3PW4A 4A2BA 4J9QA 2D6FC 1BISA 4RW8A 3LK9A 3UQ0A 3TQ1A 4BRFA 5CB1A 1NJIO 1Q81O 4CIFA 4QS8A 1S1TA 2FF3B 3O9RA 4ACOA 1TFRA 3NTUA 4CK3A 2MUTB 1ZD3A 1GLBG 1NGCA 2FDRA 3NVZA 4I28A 3AO4A 4LC9B 5KFQA 4G1QA 4H5TA 3THVA 5DK5A 5ALUA 1Y88A 4J9LA 5TISU 2VGMA 5ALHA 5M1NA 3THXB 4F2RA 4H5VA 5ALFA 5BR8K 4FS1A 4CEDA 3I55N 1ZQMA 8ICBA 4F91B 2FMPA 4I2FA 4FWRA 3CCMN 4DV3K 4NLGA 5AFUH 4DQ8A 2DQNB 3TKAA 2PI4A 4EBEA 3TI0A 2JGUA 3V6KA 4DOCA 3ZETB 4O0JA 1UOCA 3ENBA 3B8AX 8ICJA 3AUOA 5CWRA 3N4PA 3N4QA 4RPYA 1SKRA 3K9JA 3EKUA 2KG5A 5KFEA 4DFMA 2IHNA 3MGIA 1N56A 2EAOA 4RW6A 5C2DA 1KCFA 4GIBA 3KK1A 2JH1A 4M41A 3WKDA 2PI5A 2YMPA 4EX7A 1WAFA 2KKPA 3CMEN 2J6UA 1YTUA 3QUTA 4FWSA 2BHNA 3LP2A 1W9HA 2DPNA 3LP0A 3AMZA 3N28A 4C7YA 1C6VA 3SEIA 4AYBF 2ZUDA 1JIHA 2EAMA 5KG5A 3WKAA 3KVGA 4BREA 2D5RA 3C7NB 5AQTA 1I3AA 5HR6A 2YHYA 3OJSA 1XNQK 4C4SA 3UXPA 2WF9A 4CEZA 4NYFA 3VEYA 3B0XA 2EZYA 1N61A 2RP5A 2NRZA 5AM3A 2WAQC 1LWEA 4KREA 2WTFA 5T7BA 4X66K 1HNZK 5DLGA 4M3XA 5CZ1A 3ONNA 1RBRA 4IR9A 1XO1A 3VQCA 1BCOA 4BDYA 1YXQA 3WXLA 3V6DA 5KFWA 9ICCA 1BIZA 1CZBA 2CH6A 1N8RO 3EWAA 1JXLA 1PZNA 3AM9A 3O1WA 4ED7A 4Q44A 2O8CB 3CC4N 4I2DA 4R8UB 1UA1A 4DLEA 1L3SA 1RTDA 2OYYA 1QQNA 5ALTA 2X6SA 3U3GA 1D4XA 3ORYA 2JEGA 2XGPA 3FZMA 2QXLA 1TKDA 4RTFD 2PYLA 5KFJA 3PO5A 1DLOA 3PO4A 2GBZA 3RWUA 3OY9A 1FO4A 5AQGA 4NYNA 3HPOA 1S10A 2V51B 1HLUA 4PKIA 1WWUA 3UM9A 1ZQDA 4BC4A 2A1SA 1NWKA 5KAFU 3I8DA 2XVTA 4JV0A 4KHPK 3LDPA 3CCRN 2OCEA 3CP8A 3OYKA 5AM0A 2WB1C 2W9AA 1KFTA 3N7SC 4DOBA 1ASWA 2YTUA 2AHOB 4QZDA 5I9EB 1YI2N 3K5MA 5HMMA 3WKEA 4KLGA 4B1ZA 4OD0A 1C1AA 5J2EA 2ATLA 1RTIA 2QWLA 2LM1A 5A2QO 4YMOA 3V7KA 2GH1A 4Y0WA 4O3OA 4KHQA 4IOAL 7ICKA 3EW9A 2XY5A 3AVLA 1WSHA 3RB0A 5J2GA 2AGQA 2R7YA 4CI6A 1XSLA 4DR1K 2QB0A 5KFYA 4JS5A 3RMAA 3AO5A 4MFAA 2MA1A 5D49A 2GV9A 2ZJ5A 3M9MB 1NK9A 2QI2A 1ZQUA 2KLAA 3R1XA 4JI3K 3U9ZA 4NM2A 2UVVA 4ILHA 3PW0A 3E9LA 5E26A 4DTPA 4N41A 2KNJA 2PMZC 3VQ9A 1C1CA 2VG5A 4CFCA 1BUPA 2HHUA 3BEXA 3KZBA 4CEOA 3F5TA 3S3OA 2W3SA 1VQ6N 4M45A 3HYFA 1KVCA 3ENOA 4G9ZA 1VSLA 4DR5K 5KFXA 2XY7A 3AU2A 2P9PB 3IFRA 3K58A 1B9FA 3TU5A 9ICLA 3P39A 5EE0A 1RFQA 1MQ2A 3FR0A 3VQ8A 1MWKA 2YHAA 4A2AA 3TAPA 1XO0A 3MDAA 3NVMA 3SBGA 3LPUA 3WXKA 5J2KA 1RILA 5LY3A 3R6MA 3GDQA 3O3GA 4ICLA 1ZD2P 4BDPA 3O9TA 3C95A 4CD1A 1ZXIA 1C1BA 2F8TA 4FFDA 4K8ZA 1YITN 4YP3A 4RZRA 3HRDD 2BKEA 1HPZA 4RQ4A 3SI8A 3C6AA 3CJCA 4BQLA 2O8FA 2NRXA 5JVGL 3QE9Y 1A5XA 2E2PA 3Q8KA 1X9MA 3LDSA 3ZT0A 2LMRA 4IZ9A 3SUOA 2OPPA 3T7ZA 2ZGZA 2BDUA 5EY4A 3M8PA 4J9NA 3OBYA 4MFFA 5KFHA 7ICNA 2GWKA 2XO7A 5AQKA 4CEEA 4I2QA 4YG2A 4QNLA 2HHQA 1B0XA 2G08A 2BCVA 3SYZA 9ICKA 1D8BA 4Z6EA 3VGLA 1OXJA 3BS7A 1LKYB 3H0RB 3IS9A 3FZHA 2ESEA 3FFIA 4BACA 3FDSA 4PH5A 4YDUC 1S0MA 3TANA 1EP4A 2ZM6K 1UCVA 1PVQA 4YHHK 4DTNA 3KK2A 3K75D 5I3UA 3CC2N 4CGIA 3QEAZ 1LAWA 1V38A 3TAGA 4Y2QA 5ALSA 4KBOA 4CZKA 5CHGA 4HCBA 2I1QA 3NF7A 4FLXA 4YXMA 1JLAA 5J0UA 3CCUN 2W7OA 4O9MA 5FRMA 4BRDA 2NO4A 2Y9UA 3OYHA 1J2NA 2RHFA 4FS2A 2QTDA 1S9FA 3FZLA 2HOIA 3CCVN 9ICJA 4JEPA 4DTRA 5ALWA 4WQ4A 1K8KB 1DKGD 2WOMA 3UQ2A 4DQIA 3I0SA 1VSMA 1YTAA 4CF0A 4FJIA 4Y2PA 3NAEA 1IKYA 1JI7A 2W03A 4LH5A 1WCNA 5HOOA 4HHTA 4OX9K 2EAPA 2YJFA 4DV6K 2VIXA 1W97L 3VF6A 2UUAK 1HJPA 4FJ8A 1XHZA 1JX4A 1T8EA 1ZBFA 3CERA 5AK3A 3OHRA 3HWTA 3TAFA 4QZAA 1KFSA 2ASOA 4FPAA 4EHTA 3CCQN 9ICBA 4EENA 7ICEA 1K5OA 4IFEA 3C29A 7ICTA 4E7JA 3IRXA 3QU7A 2MAXA 3OA9A 1WB9A 4CDGA 4YFUA 1ZQHA 4H5RA 4FZLA 2W11A 4QAGA 3WT0A 3BF3A 3MBYA 4NCAA 3K2PA 2AQ4A 4AHCA 4JRPA 4IC9A 4H0TB 2E2QA 1GLCG 3OHAA 2W9CB 2YMLA 3BY5A 4LF9K 1IM4A 1RYSA 1KAYA 1S3XA 1PVPA 3DLBA 1RDUA 4EYHB 1LB2B 4DSIA 3CQXA 4M2YA 4ZOHC 2VWKA 3J8AA 1RXVA 3O5BA 3NHGA 4BXOB 5DG8A 2KIVA 3HJEA 3PVXA 3G25A 1U4BA 3IUCA 4EFHA 1VQ9N 2G8UA 4OKKA 1IJJA 4RNOA 1P7DA 4O5EA 4O3RA 3ZX3A 1C0TA 1NGAA 3BGRA 2G8HA 4KI4A 1YJWN 8ICZA 2R8KA 2FLOA 4BWJA 5KFKA 4O3SA 2FC0A 2E6MA 3K5OA 4RQ5A 3NF9A 4KMUA 3PR5B 1IO2A 8ICRA 3SPYA 4OPJA 3ETLA 2J4RA 3DRPA 2HVHA 4IWVA 3G6EN 3AU6A 1KLNA 2W3RA 3G6VA 3AEVA 1G15A 2B21A 4QW8A 2E1ZA 2UXCK 3L2QA 1N60A 1O03A 2OA8A 1XNSA 3C6UA 3SK3A 3HJFA 2K8BB 2Q0UA 3WKBA 3HI0A 2ZXIA 4RQMA 2YB4A 1BNPA 3D2SA 4M6WA 3GIIA 4JWNA 3ZDDA 4QWCA 1XWLA 2PXIA 4PKGA 4DCHA 2J6SA 5JMVA 5IIMA 3LPTA 4AHTA 1BPBA 2KICA 4HAIA 3M6ZA 5J2AA 2D0AA 3SQ0A 4FLVA 1UT8A 2HHSA 2PAVA 4B3RK 1X40A 4KLLA 1ZQGA 3HPGA 4MLHA 4R79A 4CK2A 4JKCA 1ZQJA 5J8YA 3OGUA 1TK8A 1ESVA 3V81A 4YOUA 4ELVA 1HKCA 4B1UB 4CJPA 7ICLA 7ICFA 1RQLA 2E4LA 3G6XA 3M8QA 1J5OA 1JLQA 3M1YA 4KLJA 2JLEA 4PGXA 1MC8A 3H45C 1X9WA 3HP9A 2FSJA 4TSXA 5KQDA 2YQEA 4CEAA 3KIOA 4YY3K 2BCUA 5KG2A 2DF4B 3O9UA 5CE3A 1IV8A 2CGLA 1DGJA 4JK9A 1K9MO 2YX6A 4P0QA 1L3TA 3RJJA 5AQVA 1Z4NA 5CEHA 4YOXA 1C0MA 1J2MA 2VG6A 2KVSA 4HYKA 3ISNC 2KJ5A 3QEVA 4AM7A 3WQTA 7ICIA 5KFTA 4KAZA 1WCLA 1TVAA 4YD2A 3QB0A 3RB3A 2YHBA 4MO4A 4DR6K 4LY7A 3TFSA 2ZIVB 3MEGA 3ZX2A 3MR3A 3PUFA 1F44A 4FLYA 9ICTA 4I9QA 2Z7JA 3S6JA 1HEKA 4OJLA 4CGHA 3TWHA 4FLZA 5DQIA 3QEBZ 4DR4K 3SAFA 4ED0A 3ZSQA 1T3VA 4FWQA 1IV0A 4KLHA 4MFCA 3V6HA 1ATSA 3MX2A 4BG8A 1JJ2M 5M1PA 1VQ8N 5ALZA 1U2VA 5FPMA 1WSGA 1KXPA 3SAGA 5M1FA 5G5HA 1E4GT 3M6GA 4FJHA 4FO0A 3KKAA 3BQ7A 3MN7A 1BPDA 1SXDA 4GC6A 4G3IA 4CGDA 3M7DA 4KTZA 2ASPA 1E4FT 1TKZA 1SXEA 2F3NA 2OEHA 5HR7A 1ZQRA 1MWMA 2PFOA 3HSCA 3LP3A 3EE8A 3OBWA 2F1HA 2OHFA 4XUSA 1IBMK 4N5SA 1WYGA 4DV4K 3C23A 3O9QA 1EKEA 2G8WA 3GE1A 4DTOA 3HO1A 2I5HA 3F5AA 2V4QA 2ZUBA 4HWIA 4KFBA 4BRKA 5AK6A 2IIRA 3I33A 3GV7B 3RB4A 3HM8A 4IFYA 3RBEA 3RMDA 4QZCA 4K42A 4FJXA 5GINA 9ICRA 1N63A 1YVNA 4B3SK 3KD5E 1SWWA 4CHZA 3NH0A 2ODGA 2Y0SC 5KT2A 3G6YA 3OSNA 2AH5A 4PL8A 5CHIA 4LZGA 1QQ7A 3BS5A 4MFBA 7ICPA 3T19A 3NRWA 2QA4N 4FZZA 3S9HA 1CLQA 1VAZA 1X1PA 1ZQBA 1HKGA 1LOTB 4WYBA 5L1KA 3QFUA 1BPXA 5AQFA 3P1GA 4RT2A 1N62A 4DFKA 3RR7A 5KG0A 1B22A 4CZHA 1ZETA 9ICUA 4J9RA 2ETJA 1ASVA 4UAUA 4KH6A 1VQPN 4BR2A 1TL3A 3TTDA 2LKYA 4IQUA 2Z1JA 4YDUA 4HVJA 5JS1A 1J5EK 3OYMA 1V85A 2P9LA 5LL6Z 3H46O 1KBUA 3VQBA 5AJ3K 4PGQA 4XEIA 2ZF5O 4PHPA 1SAZA 2E8NA 3C2MA 3DRSA 5M1KA 2RLTA 3OYDA 3CFRA 4KLDA 4PZOA 1D8LA 4WFBL 5CR4A 3EY1A 2A41A 3CJBA 3TR8A 4OLBA 3H1QA 3EO3A 5KQ8A 3J7AP 1XMQK 4IJNA 5KFOA 1L8OA 3PZPA 1QVGM 5ALGA 4BJQA 4IRKA 4I2AA 5BN9A 4PWDA 1IKWA 2AGOA 3MWTA 3O3HA 2HNDA 4BRAA 3H8MA 3Q8LA 2P9UB 4I2JA 3HOSA 2D0CA 1ATRA 2K8AA 4UARA 4JI2K 1HR0K 1NK0A 4C4TA 1RT3A 3L5KA 1Q9XA 5ALMA 3BUZB 4QW9A 4B9UA 1SZHA 1ZC6A 4DUZK 3OVNA 4YOWA 3QDKA 2F8SA 2D0BA 3SUQA 1HNIA 9ICQA 3MABA 4KH4A 2O8BA 3IDWA 2KV2A 1EQYA 4W5OA 2VKQA 5CR0A 3Q8SB 3HBTA 5DB8A 3DXMA 4IQTA 4DWIA 1A5VA 3ATVA 5SZTA 4KI6A 1VSFA 5BPNA 4W5TA 3K0SA 1CUKA 4ECYA 3ATUA 3Q7BA 3DEEA 2WONA 3RJEA 3OS2A 4OPHA 1JCEA 5E41A 3EZ5A 3UKRB 4CHPA 3KLFA 3RMCA 4RWTA 4V19S 4RQNA 4JAXA 1ZBHA 4M3TA 3O4NA 2ZTCA 1NMDA 3CM5A 2Y1IA 4MO5A 3SMSA 2W43A 1OKJA 2VWBA 5IT9O 3MGVA 1JCGA 4ZTJA 3BQTA 1K1SA 4JV5K 3ISDA 1O13A 5GIPA 3U9DA 2G07A 3GG4A 4ISGA 5CJ7A 5JVHL 2ZJQL 3QX7A 4AHVA 4B9QA 4CCHA 4U7CA 1HRHA 2IOHA 4IDKA 3QXGA 4QZGA 4X64K 1WN7A 3OS1A 3C0BA 4OKEA 3QFPA 3HKZF 2ASDA 4BRCA 3WXJA 2A40A 2RF2A 1KTQA 4ECSA 3AO2A 1TYQA 4JKHA 1X9XA 3SBTA 3HP6A 1NK6A 1S9EA 4PHAA 4ZTFA 3SR6A 4QIWC 1RZTA 4A59A 5J2PA 4Y2YA 4H8KA 5KT6A 4ECUA 4CGZA 1ZQVA 5HP1A 3SJJA 2JZBA 4QZ8A 5IINA 4B1WB 5JU5A 1VSJA 4CF8A 2HHHK 5FRNA 4H5WA 3P4IA 4KTQA 1RBTA 2EQYA 2F1JA 4WE1A 2IVOA 4RQ3A 2RN2A 2P35A 4JHDB 4GNIA 5MLCQ 5JLFA 1LAVA 1YZ6A 1UHUA 4Q5VA 4BRIA 4Y2TA 4JKBA 3L4QA 3SQ2A 4DL2A 8ICPA 2KP7A 2E6LA 1JN3A 1C7YA 4Y2UA 2Q97A 4JI5K 2ZJPL 5HHIA 2E1EA 2V7YA 3SAHA 2UXDK 3JPNA 5F0XA 5JUMA 1RT2A 2P9SB 4C8OA 1XSNA 3CCJN 2NNWA 4CF9A 2OPQA 1T44A 3CHWA 1HUZA 3LDQA 4M3UA 4FM1A 1ZQLA 4K0KK 3ULEB 4O3MA 3KHLA 1VHXA 3EZWA 4A5AA 3E9PA 4F4KA 4DU4A 2KZ3A 3UKUA 5AM2A 1BPZA 3CF5L 4UAWA 3DRRA 5BPLA 2BDPA 4BC2A 2HNYA 1L7PA 1HPMA 1RNHA 3THYA 1T4GA 2ZG6A 3JSMA 4CE6A 4Z94A 3AVJA 1ZD5A 4BRHA 2G5IB 3V4IA 3SMVA 3CPEA 2VQFK 2JXJA 2IGIA 4NXMK 4E1NA 1NGEA 3NGIA 3SNNA 5KFBA 3CJAA 4E7LA 3QNOA 3A5NC 3QMLA 3H4BA 4J8FA 5M1OA 5KPRA 2A1JB 4DHYA 2ZIXA 3MK6A 1Z00A 4R64A 9ICPA 1JCFA 3RTVA 1IKVA 3IG5A 3H7IA 3AA2A 1HQEA 5EOZA 1T05A 5KFPA 3ED5A 2EDUA 1TUYA 4BRMA 4WQ4C 2Z1GA 4H0OA 1OH5A 4F3OA 2JWLA 1EWQA 3C28A 3SQIA 3CJ7A 3AAQA 5BN8A 3CPWM 4B9LA 5KRTA 2GTDA 1ZQCA 2DPIA 3N97B 7ICQA 3MAQA 5DBAA 2DGZA 1Z1VA 1ZQTA 4YXJA 3LAMA 4KITB 3RAQA 2ZJ8A 4IRDA 3DXKB 5AQOA 4XA5A 3MFHA 4K4IA 4MF2A 4ED6A 3I8BA 3G4SN 1NGIA 3BF1A 3C7NA 4E1MA 2VJ5A 4C4RA 4KLSA 2PYJA 1LCUA 1ED1A 2OZMA 1B9DA 5AKXA 2WTUA 4LF8K 4B1XB 2W6LA 1SZ2A 4FJMA 3ZX0A 4CF3A 5F3XB 3CIPA 3O3FA 1ZQQA 1NG9A 3ZT3A 3H8WA 2CPRA 4IBNA 4BGDA 2HBKA 3MWPA 4O3QA 4JI1K 1BIUA 5HP4A 1J9AA 5DB9A 1GO3F 8ICSA 3O4WA 4K4GA 4WFAL 3LALA 3HOTA 3HX0A 1JL1A 3DM2A 4FM0A 2W54A 4CJ4A 4DU3A 4LFBK 5JRTA 5AQSA 2FPKA 5IILA 3PLAA 1YUWA 3C65A 2W8LA 4CNQA 8ICWA 2X6NA 3F2CA 3OYLA 2LYAA 2WAQF 4NWIA 3MFIA 1SKWA 2C2EA 3VEXA 1U04A 3PIPL 4BY9C 1FKOA 1RT7A 3SENA 3ZLJA 3ALRA 2YHXA 3AA4A 4BC3A 2K4HA 1RBUA 2A6AA 5AQLA 3T1HK 5ALNA 1S0NA 1GOBA 1HKBA 3VPZA 1N5YA 3MN9A 3QUCA 2BH1A 3UIQA 3L3VA 3FFKB 1EWRA 1KDHA 3V9XA 2KFZA 1QQOA 1A5WA 3CRXA 2RRDA 4LF6K 1KW4A 5CRXA 3Q8PB 3VA0A 4FBTA 4KKOA 2G0AA 1M6YA 1L5UA 1OH7A 5KFSA 2W41A 1S1UA 4UAZA 5E84A 1WG8A 1QQ6A 4FK4A 5AKJA 4AHRA 4HTLA 2OPRA 3T5LA 3OYJA 3HTVA 3VGMA 3RH6A 2Q4TA 1DGKN 5HBMA 3E1YA 4QCLA 4CGJA 4XQ8A 5DG9A 3ITHA 1ZBIA 1S5LU 2WF8A 2WB1F 2K8CB 1U48A 4IS7A 1N5XA 3AL0B 1RDCA 2P9KA 2NRVA 5J8YC 3C2KA 4FJKA 4MDAA 1VQ4N 3J7ZO 4N76A 2XCAA 1VSIA 4RCHA 4I2IA 2ZIUA 2D8CA 4DSEA 5LJVA 4E7KA 2I7NA 4CF5A 8ICCA 4KLFA 4CBWA 3VERA 2ZTEA 4CW7B 1RT6A 4NCBA 2BR0A 2HOFA 3DMJA 4ID5A 3HILA 2KD1A 1RXWA 2R8IA 3O80A 1K6YA 3JPPA 3KWGA 4BRLA 1CI4A 4YMMA 4FPBA 3NFAA 5ALKA 3QICA 2WF6A 4AYBC 5ADXH 2KQ2A 4JKFA 2L5YA 3WK5A 4ILJA 4CK1A 2OYQA 1BPEA 1H38A 4OVLA 2PMZF 4CF4A 3LDLA 2RE2A 4DTJA 1S97A 1NI3A 5C5JA 4O8KA 5AM4A 3NH1A 4ECQA 3RAXA 3MR6A 1T6DA 2WHEA 3OYNA 2UYTA 2V52B 4K25A 1RT4A 2FSKA 1WUAA 4MEYA 4NCGA 2YMMA 4U67L 2F8KA 3V7JA 1Z26A 3O4QA 3AN1A 2CH5A 4GLXA 4JD2A 3D2FA 5K4LA 3E01A 4CBXA 1TAMA 4LSLA 4HCCA 1Z19A 3GOIA 5AKGA 4PGYA 3U3YA 5GADP 4ICAA 2OWOA 4A61A 2C28A 1A76A 4QZBA 3MN6A 3T69A 4QWEA 2C2DA 4Q0BA 4JI4K 4DV5K 3WNGA 1NGJA 4CERA 1LWFA 4IEIA 5DBCA 2OTLN 3H0MB 3PSIA 2OANA 3TTFA 2O4IA 3KKAC 3O6WA 1HUXA 3M9OB 1S0VA 4DMNA 1VQNN 4FK2A 1W2BM 4KB0A 2VA8A 2LI6A 4AHUA 3MXIA 2M0NA 3H0LB 4Z4CA 2QB1A 4Q8EA 4FYDA 3VF4A 4KN7A 4NLKA 2IVNA 1VQLN 3NCIA 3ULDA 3NGYA 2O8DA 2UVRA 5L1JA 1IH7A 1NZBA 4LVSA 4OJOA 4F8RA 3DLLL 4IJAA 1CZAN 4ISEA 3ZSYA 3D2QA 4CRXA 2KSOB 4U7BA 3WK4A 3NS1A 2JMGA 2W7PA 4BC5A 3SD7A 1NBWA 1TL1A 4BQZA 1MA7A 4CJ5A 2IA6A 8ICEA 2E8MA 2H3FA 2OTJN 2EHGA 2DY4A 3SZ2A 5JLHA 5GIOA 4Z4HA 4GC7A 4IEEA 7ICOA 3PSTA 2OZSA 1KN5A 3IM1A 4PUOA 2ALZA 2HCFA 3AGRA 2BGGA 4M3ZA 4DFPA 1RTJA 2F77X 4O44A 2LHTA 3I28A 4IDHA 1A0PA 1Z6RA 2E2OA 3QINA 4GV6A 1RGIA 1JMSA 1RPLA 4BE2A 4E7HA 2QB0B 4M9JA 1KVBA 3F9MA 3FZFA 4CECA 1VQ7N 1Q82O 1HYVA 2E88A 1N34K 5KFAA 4AH9A 4QZEA 3D45A 1QH9A 2BANA 2ASLA 2OH2A 4DL4A 3RJIA 2JEIA 3C6TA 3VQAA 3HVRA 1NGDA 5C15A 4WCEL 4LFCK 5KFVA 3ISBA 4MHVA 1X6JA 3NVWA 5ALLA 3AVMA 3M8SA 4KPYA 1WSIA 2QLTA 2JV3A 2KK0A 7ICMA 1LW2A 5FDLA 3E0FA 4JKAA 4DTMA 1HNVA 3AO1A 3K59A 4Z0UA 2P6UA 3PSFA 2QKBA 4JN4A 4CHOA 4W5QA 2E20A 3U4LA 1JUDA 5ADXA 4RUAA 4QOZB 3ENHA 3FZKA 3JPRA 5DBBA 4EBCA 4M9LA 1ZBUA 3IDHA 4R65A 3ZT4A 3ZSXA 2IOFA 1H1VA 3ZD9A 1QS4A 3OTOK 4J2EA 3MDCA 2O8FB 4QZ9A 1NOMA 4Y2RA 5J29A 3WQUA 5J0WA 1GOAA 4FOEA 3ZEUA 2MU2A 3BZCA 2B5JA 3AA3A 3VF2A 2YJEA 3NBPA 3G10A 4KHUA 5J0RA 5K14A 4DFDA 4BVOA 4CEBA 3I1YA 1DXSA 2VYPA 3SJHA 2QWMA 1MU2A 4LD0A 5F9LA 2FMQA 4RW4A 1SB3C 9ICXA 8ICFA 2A5XA 1Y97A 2BQ3A 3O8MA 1VRTA 2RDIA 1T7PA 4GMJB 5DB7A 1NGGA 3V1QA 3KHGA 3V1RA 3KD3A 1KD1O 4IOXA 1J54A 4H4OA 1S72N 2I6XA 4I2GA 5F1XA 3WXMB 4ECTA 1SV5A 2BE2A 2LYBA 3IMXA 2V9WA 4B9SA 3MX5A 4BUGA 1FKPA 5ALQA 4BR4A 4BROA 4CZGA 2ASMA 1FFVA 4PY5A 3VEVA 3QU4A 4AHSA 1X66A 3C1ZA 5J0QA 1UWBA 1ZBSA 2H3IA 3IHQB 1L7MA 5J2JA 5AZIA 1S6PA 3RSEA 3UB5A 5HNKA 4U6PA 1ZRNA 4TUSA 1NNEA 3EPIA 5HHHA 5FLXO 1CEZA 2KVCA 3DLHA 4JUZA 5J0TA 4Q8FA 5CY4A 4JK8A 4YNQA 1NKCA 3OJUA 3T5KA 5AKIA 4N47A 3OYIA 4CZMA 4UB3A 1DRGA 4J2BA 2WUSA 3KOOA 3HK2A 3NF8A 3AA5X 4K41A 7ICHA 3MXMA 5J2BA 4TUPA 5L1LA 2KOBA 1QSLA 4DQPA 4B9VA 3SV4A 4GVMA 4J2AA 1F0MA 1U45A 1WBDA 3ID6A 5A0LA 4AM6A 3RJHA 2WF7A 4Z6CA 3GL1A 5C42A 1P8ZA 4BRPA 1NOYA 3NASA 4J9OA 2HF4A 3RJFA 5L9XA 3ID8A 8ICKA 5ALPA 4PA1A 1CXUA 1HX1A 1X9JA 3DOLA 5AQZA 3J7YP 2Q0ZX 2K4PA 4DL7A 2Q1NA 1SV0A 3N7PD 2HW3A 1Q7YO 2FBXA 2G06A 3WK9A 1J6ZA 4DB3A 4JI7K 5B5EU 5KL1B 4UBCA 3MDQA 3VQQA 2PFQA 4JI0K 1QTMA 1FK9A 1S22A 4OJRA 4C1NK 5KFLA 5IWAK 3I0RA 4AP9A 5BRFA 2GUPA 1OVYA 2KN7A 1D8YA 3WNEA 1XMOK 5AQMA 1JKHA 3T5HA 5KG7A 4FLTA 1WWVA 4MF8A 2FE9A 1JALA 1PVRA 4DSKA 3L3FX 2QXFA 4B9MA 1YJNN 4KB1A 4FO6A 1DTTA 2HDOA 3GQCA 1N5WA 3QU9A 1VQON 3CW2C 1V9PA 3QYPA 2W9BB 1L3UA 1HYZA 2D4WA 3KK7A 4AQYK 8ICXA 1Y64A 2QARA 5AI5A 3MECA 5D3GA 3ZI4A 3KKRA 2D3DA 2FLPA 5M1QA 5KFGA 1ZQFA 1T6CA 1Q8KA 2ISOA 4DKWA 5IIIA 4ELUA 4PQUA 1FXXA 5LMUK 2K60A 4QWAA 3OW2M 1JXBA 4BG9A 4FJLA 3QU2A 5KFRA 3EL2A 3D2EA 4ED8A 1VSHA 1FIQA 5AI4A 3ASMA 2JHDA 4CZJA 4PZNA 3ZSZA 4PKHA 4F5PA 3K57A 2FSNA 2IOCA 1M90O 2R8GA 3CM6A 2F9TA 3CFOA 4OGEA 4M6WB 1NJYA 5AKYA 4A8EA 4BR7A 3DYAA 4I27A 3W0LA 1BG3A 1IKXA 4EX6A 4C8MA 3PV8A 2F1IA 4JYAK 4IG3A 5BOLA 1U9LA 3ZSOA 5ALDA 4KLEA 3BQ0A 1JLBA 4UB5A 4YORA 4EP5A 5KPZA 1D9DA 2B0CA 2HVIA 5KFNA 5J2HA 2D1KA 2PBDA 1VQKN 7ICRA 2AJQA 1TK5A 1QQMA 4F4ZA 3CJ9A 5J0XA 2DKXA 3AVGA 4H4MA 2IS3A 3DAWA 3NVYA 2CRXA 3THWA 3KD1E 5ELZA 3V9UA 4M04A 4KLTA 1VSDA 2O8EA 4CHQA 2HSZA 3JXUA 4O5KA 3EKSA 5AKHA 4CZLA 1BOTO 1QE1A 2P51A 1AQ6A 2P9IA 3QERA 1L6NA 2F2AB 1LWCA 1RQNA 4FK0A 4P0QB 4M3RA 4IL6U 5EWEA 2Q31A 4LSNA 1B92A 1Q3VA 4H0PA 1GLJO 2YNGA 4OJ6A 3CXCM 4PL1A 5DQHA 5FPNA 2AA4A 1WLJA 4WJ3B 3WK6A 3MXJA 3CYMA 4I2HA 1HYSA 1WBBA 5L1MA 1YZ7A 4JV1A 5ALYA 1U47A 1ZYQA 1ZQSA 4FE3A 1AROP 3VC8A 4K43A 2KHQA 5IIKA 1QZ5A 1IBKK 1VQMN 1GLLO 5AZJA 3HL8A 5DG7A 3GU3A 2HHXA 3C6HA 2HBMA 1U2VB 4KLIA 3MC1A 2NRWA 4EHUA 4OPKA 3L2UA 3DWLA 3EN9A 4FLWA 1ZQ1C 5DMRA 4DL5A 3R8EA 4J9KA 1NOZA 1VSKA 3VTIA 2OXOA 7ICVA 1DK3A 4F93B 4NO7A 3JPOA 3MN5A 4CIGA 4DUYK 3N7RC 2GEMA 2F9WA 4HUGA 3E9OA 4A62A 5J2QA 5DB6A 1CXQA 3VQ7A 8ICUA 3SQ1A 3D6JA 4FWPA 2F4VK 3VQPA 4JKDA 1ZQKA 5AIBA 4NXZA 3T3FA 2G09A 5CYMA 3RF9A 4W5RA 3IAYA 5KG4A 5J0PA 2XGQA 1C20A 2XIDA 1RT1A 1Z3EB 3A5OC 3CCSN 3MCAB 2E2NA 2YY6A 2JWKA 5AI8A 3PX0A 3KLEA 3F9KA 3O08A 4O55A 4JRQA 3DLRA 5KGWA 4JI8K 4DSJA 4UASA 4XH5A 4LF5K 3VQ5A 2ZD1A 4Y2VA 3A8YA 3MGHA 3MCPA 3KJVA 3NMUA 3JS6A 4CEQA 5HRPA 1XS9D 2W42A 3QU5A 1OVQA 3M1FA 3TSQA 3Q8QB 3ZSWA 2ZJRL 8ICTA 7ICSA 3CCEN 2K4EA 3CQ8A 5IIJA 4I6MA 4HTUA 1X9SA 3E66A 4H0VB 3VTHA 3BS5B 3JPSA 3FM9A 2HBLA 5BR9A 5DM6L 3ISCA 2BUPA 1ZQWA 3D6RA 5CYQA 3GZFA 1VLBA 4BGAA 5LMNK 3NVVA 4YMNA 5E79U 9ICVA 1WOQA 4PHTX 4FJNA 1NK7A 5ALXA 5AM5A 5AQYA 4RQ6A 5B66U 4CBUA 4YR3A 4F4YA 4NB4A 1ZQNA 2KZMA 4C7ZA 4OPAA 1N32K 4B3MK 4BGBA 4MLEA 4K8XA 4JKGB 3H8JA 4BR5A 1BHLA 3B9JA 1ZQIA 1TVRA 1ZBLA 3AVBA 9ICEA 4CZEA 4CJLA 2GO7A 3HW8A 1RM6C 4ED2A 1UQVA 3TAQA 4BE0A 4P4PA 5KG6A 1BI4A 2IOFK
chains in the Genus database with same CATH topology
4DQSA 2EWSA 2ZGYA 2PFNA 5KFFA 4CZIA 5DDYA 2Y1JA 4WFNL 4M47A 2QWOA 4H0YB 3WEEB 1K1QA 4ECZA 1TUUA 2P9NA 1ZJNA 5DGBA 3KHHA 4DF8A 5BRHA 3H1VX 4GXKA 4C23A 1SL1A 3DXMB 3O9SA 1EO1A 5B8HA 2H5XA 2D0PA 2C22A 4O3PA 1YIJN 1ZQPA 4KN4A 3VESA 4XH1A 4OO1J 2BCRA 3FE1A 9ICIA 4YOVA 2GWJA 2MUTA 3SLCA 1NK4A 4BRGA 4K4HA 3L6QA 4IO9L 3WXIA 3PW7A 5J2CA 3GV5B 2QWPA 4GY2B 4O3NA 2IMWP 3RRHA 1TYQB 1RDWX 4C8LA 1K73O 3PW2A 2R8JA 4DO9A 4J9SA 1QZ6A 3ZETA 2VCPA 2ITMA 4YVZA 1BPYA 2JZBB 3S41A 5AQXA 1IG8A 3MR2A 4M9NA 3FYHA 4DQQA 2XY6A 4I2EA 4EZ9A 2HF3A 2JEFA 8ICIA 1NLVA 1A77A 1BU6O 3HZ6A 2JEJA 1P90A 4I2BA 2AGPA 5KFUA 2HOEA 3PR4A 2F7TA 4DLGA 1X2IA 3RBDA 1BVSA 3KWIA 2M9NA 3N4MB 4R8UA 5BREA 1SL0A 4DQRA 4QZHA 1Q18A 2ISPA 1ZQZA 3GDXA 3LDAA 5BOMA 1BO5O 2FMSA 3BQ2A 4TQSA 1UA0A 4GXIA 3PX4A 8ICVA 3RH4A 5EX5A 3H6EA 7ICJA 1ZXOA 2HHWA 3H40A 3JPTA 5GAHP 3TTCA 1Z00B 4YFKA 3P38A 2ZJAA 8ICQA 3Q7CA 3C2LA 3LM2A 4YR2A 4EAHD 3PX6A 5C0YA 1C0FA 4O5FA 3FGUA 2YHWA 4QZIA 5BRDA 2IBKA 3ZD8A 2D0OA 3O1BA 4ZH4A 5L1IA 3Q8RB 3UXOA 3H4DA 2ASJA 2BCQA 1KQSM 4LZDA 4KLUA 3LDNA 4NY8A 3VEOA 1GLEG 2RHKA 4RQ1A 5KG3A 4I2CA 2P9PA 1XUPO 5D46A 3A5LC 2KHOA 4ECRA 3NGDA 1KAZA 1S77D 2BQRA 5AQQA 1R59O 8ICAA 1YF5L 4IR1A 4FL9A 1MSWD 4JWMA 3TARA 5LJWA 5TKYA 4UQGA 1LV5A 3AGKA 3RJGA 2E1YA 8ICOA 3A0IX 3TSUA 4QS7A 1M1KO 3G71N 5GAEP 4JK7A 4B9TA 4AF1A 3MMVA 4KH5A 3C21A 1SS6A 2QM1A 4E1JA 1BWFO 5HMLA 4EBDA 1V4TA 4TURA 1Q86O 1NK5A 1SL2A 4O8UA 2W40A 3CMAN 4YOTA 5AQHA 4BRNA 3B0YA 1QHAA 1YAGA 4F2SA 3VGKA 1SKSA 2P9KB 3TSPA 5J0YA 3M8RA 4UAYA 4O5CA 3UE5A 3F2KA 3GFKB 8ICYA 5CP2A 3VENA 1K8KA 2E8AA 1HUOA 1NGHA 4M7XA 3U8XA 4YD1A 1ATNA 4WQ5A 4ECXA 4YCXA 4MEXA 4ECWA 1S76D 5AFUA 2QWQA 4NLCA 3RJKA 3GIKA 3L4IA 1TK0A 5C10A 2BQUA 1KC8O 5FPEA 3CETA 5KFZA 1NGFA 4F5QA 4H5NA 5J2FA 1NKEA 4O0IA 5J0OA 2GX9A 4JD2B 1ILYA 2W9CA 3VETA 3D2FB 3BDPA 4PHDA 2R8HA 5IIOA 4RUCA 2RDJA 3E2EA 3UXNA 3PMLA 1NJZA 4BXOA 4F92B 4A5BA 4TQRA 2WC9A 3HT3A 5KTQA 5TZVA 4BVPA 2WFBA 5KG1A 3JPQA 1NGBA 2ZWHA 1XU4A 4C1NI 4FOIA 4NM1A 1BA1A 4FBUA 1DT9A 3ZDBA 4M63C 4MDBA 4WF9L 5EWGA 4PL7A 4F5NA 4B9NA 1X3NA 3A5MC 3D7EO 3AARA 5J0SA 3IKMA 4DS4A 3PY8A 4JK1A 3RB6A 1YJ9N 2WBNA 5AQUA 4M9HA 4Q45A 3QBWA 4PHEA 2KFNA 2FLLA 1X3MA 4I29A 4JKEA 4IO8A 3SMPA 2FXUA 3GILA 2KZZA 9ICHA 1JXEA 4YQWA 4BR0A 5J2DA 3V7LA 1EXNA 3HRGA 4UB4A 5HL7L 2I9GA 5EVZA 2A3ZA 3V6JA 4RQ7A 4RQ0A 2PFPA 1MDUB 3GIJA 1ZQXA 3BQ1A 1NM1A 2C2RA 3ZYYX 4ECVA 4ELTA 2P66A 5DGAA 2XC9A 1Z05A 3PNCA 4YR0A 2W9BA 9ICSA 5TKWA 2LYHA 4BWMA 5KFIA 4CJ7A 3KTQA 3ZDEA 8ICNA 4GVEA 2AP1A 5DDMA 3M9NB 4A57A 4Z6FA 3ZEUB 3CQYA 5AQJA 5KFCA 5C12A 5KT7A 3OHBA 3TPQA 5AQRA 1S0OA 4FWLA 1ZQOA 4J9PA 1DEJA 5KT5A 3ZDCA 1KRPA 4GV9A 2YI1A 1IXRA 2FPMA 5F9NA 3GIMA 3C5GA 9ICNA 4KLOA 3V72A 3W3DA 4CZFA 4UBBA 7ICUA 3RVCA 5GAGP 3K4GA 2J6TA 4F5RA 2BTFA 2DPJA 3RSEB 3P31A 5AZIB 1TV9A 1GLFO 3H3NO 2W9MA 4JNEA 4H03B 2VA2A 5BPCA 4F5OA 4ISFA 5AQPA 4DSFA 5DLFA 4B1VA 3AY9A 5AQWA 4YOYA 4DS5A 4FWOA 3R9PA 1ZQYA 4FWNA 2QWRA 1COOA 2QWNA 3I56N 5KT3A 3RH5A 2KKZA 4Q43A 4RQ8A 5CA7A 3LM9A 2NLXA 3DJCA 3LL3A 1V4SA 2HMPA 8ICLA 1XQSC 4UB1A 2BPCA 2BCSA 5KFMA 1NJXA 4EEYA 3EE9A 3KHYA 2P9UA 3H8SA 5DM7L 4P4OA 4Z6DA 2FPLA 2NRHA 1GLAG 4RNMA 5EXWA 1XC9A 2BPGA 2P6RA 5AQIA 4PPXA 4UY8O 3TFRA 1NK8A 4BR9A 2IVPA 3K9KA 2I7PA 2W8KA 4J9MA 5DKWA 4GV3A 4QWBA 3ZDAA 4IRCA 4BRQA 4FVUA 2VGNA 4X5VA 3GBTA 4FWKA 3PIOL 3UKRA 1NJWA 4R63A 4NLBA 8ICMA 3M5RA 3VOVA 1L3VA 1K8AO 2Q0RA 2HSTA 3VEWA 2GWSA 4C8NA 1KAXA 3AAPA 2HHVA 2HHTA 3D2EB 4E0DA 2A42A 4DSLA 1NKBA 1UT5A 5JICA 1D9FA 9ICMA 1BGXT 3KHRA 3UPQA 1RYRA 4JKGA 2XCPA 2Q2RA 4P4MA 1QSYA 3SV3A 3NVKA 5EOYA 2FF6A 5D4BA 5AR0A 4F4XA 4M9GA 5J2IA 4QWDA 5F2RA 3PMNA 3T5JA 1DGSA 4NLNA 1VQ5N 9ICWA 4F9OA 2Q36A 4JHDA 4EYIB 3CJ1A 3WEEA 8ICGA 2P9IB 4RQ2A 4F50A 5H1SQ 4TUQA 2ZTDA 1YHQN 2QEXN 2P9SA 4DL6A 3CCLN 2H3GX 1ZQEA 2ZUCA 4IQWA 3MR5A 4RPZA 1QSSA 1ZJMA 1XC3A 1SZPA 3RR8A 2P9LB 3ULEA 4QZFA 3QZ7A 1BDGA 4QS9A 3M3ZA 1KEJA 1ZQAA 2BPFA 1MQ3A 2VA3A 5AZJB 3VEZA 1TAUA 4C8KA 4ED1A 3FLCO 4F4WA 2UVWA 4XRHA 4M0AA 1TAQA 4RU9A 4UB2A 3CD6N 1C0GA 4DF4A 4RPXA 2A1JA 3CC7N 3LWMA 2AU0A 4RNNA 3EYZA 3C5FA 2UVUA 4KLQA 2VANA 4DL3A 4WQ5C 3GV8B 2QW9A 4RT3A 4EZ6A 1BA0A 1U6ZA 5FPDA 1QVFM 3L0QA 4CD3A 2NZTA 4I6MB 3DXKA 4YN4A 4ED3A 4JV2A 3VMFB 3OSPA 3H3OB 2IHMA 4DEZA 3C1YA 5BPMA 1KFDA 3PW5A 4KLMA 4XH4A 3WUHA 9ICGA 8ICHA 2PFUA 4NLZA 2V4RA 4IQVA 1GLDG 5AQNA 5KT4A 5EWFA 4GXJA 3R3LA 3RRGA 1MA9B 2CGKA 4B1YB 2CGJA 5KFDA 1U49A 2DFLA 5DQGA 2KTQA 3EPGA 7ICGA 1HJOA 3BJYA 1B43A 1KSPA 9ICOA 1G99A 3CI5A 2YCHA 1DOQA 1QLNA 2AQ0A 9ICAA 4R66A 2FLNA 4DFJA 4IOCL 5KPTA 4IXCA 4DOAA 2BGWA 1XSPA 2V7ZA 3Q8MA 1SQKA 2NRRA 3LWLA 4L3QA 2P9NB 4FWMA 4H0XB 5C2FA 4P2HA 4FSVA 4ILGB 9ICFA 2NRTA 1T3NA 3BP8A 2HBJA 2GELA 3QBXA 1N48A 3LDOA 3QZ8A 4M7YA 3UKUB 3PW4A 4A2BA 4J9QA 3LK9A 3UQ0A 3TQ1A 4BRFA 5CB1A 1NJIO 1Q81O 4QS8A 2FF3B 3O9RA 1TFRA 3NTUA 2MUTB 1GLBG 1NGCA 4I28A 4LC9B 5KFQA 4H5TA 3THVA 1Y88A 4J9LA 2VGMA 5M1NA 4F2RA 4H5VA 4FS1A 3I55N 1ZQMA 8ICBA 4F91B 2FMPA 4I2FA 4FWRA 3CCMN 4NLGA 5AFUH 4DQ8A 2PI4A 4EBEA 3TI0A 3V6KA 4DOCA 3ZETB 3ENBA 3B8AX 8ICJA 3AUOA 5CWRA 3N4PA 3N4QA 4RPYA 1SKRA 3K9JA 3EKUA 5KFEA 4DFMA 2IHNA 3MGIA 1N56A 5C2DA 2PI5A 3CMEN 2J6UA 4FWSA 2BHNA 2DPNA 2ZUDA 1JIHA 5KG5A 3KVGA 4BREA 3C7NB 5AQTA 2YHYA 3OJSA 3UXPA 3VEYA 3B0XA 2NRZA 2WTFA 5DLGA 4IR9A 1XO1A 1YXQA 3WXLA 5KFWA 9ICCA 2CH6A 1N8RO 3EWAA 1JXLA 1PZNA 3O1WA 4ED7A 4Q44A 3CC4N 4I2DA 4R8UB 1UA1A 4DLEA 1L3SA 1QQNA 1D4XA 3ORYA 2JEGA 2XGPA 3FZMA 2QXLA 1TKDA 4RTFD 5KFJA 3PO5A 3PO4A 5AQGA 3HPOA 1S10A 2V51B 1HLUA 4PKIA 1ZQDA 4BC4A 1NWKA 4JV0A 3LDPA 3CCRN 2W9AA 1KFTA 4DOBA 4QZDA 5I9EB 5HMMA 4KLGA 4B1ZA 5J2EA 2ATLA 2QWLA 4YMOA 3V7KA 4Y0WA 4IOAL 4O3OA 7ICKA 3EW9A 2XY5A 3RB0A 5J2GA 2AGQA 4CI6A 1XSLA 5KFYA 4MFAA 5D49A 2ZJ5A 3M9MB 1NK9A 2QI2A 1ZQUA 2KLAA 3R1XA 3U9ZA 4NM2A 2UVVA 4ILHA 3PW0A 3E9LA 5E26A 1BUPA 2HHUA 3BEXA 3KZBA 3F5TA 1VQ6N 3ENOA 4G9ZA 5KFXA 2XY7A 3AU2A 2P9PB 3IFRA 3TU5A 9ICLA 3P39A 1RFQA 1MQ2A 3FR0A 4EIAA 1MWKA 4A2AA 3TAPA 3NVMA 3MDAA 3SBGA 3WXKA 5J2KA 5LY3A 3R6MA 3GDQA 4BDPA 3O9TA 4CD1A 1YITN 4YP3A 4RZRA 2BKEA 4RQ4A 3SI8A 3C6AA 3CJCA 4BQLA 2NRXA 5JVGL 3QE9Y 2E2PA 3Q8KA 1X9MA 4IZ9A 3T7ZA 2ZGZA 5EY4A 4J9NA 3OBYA 4MFFA 5KFHA 7ICNA 2GWKA 2XO7A 5AQKA 4YG2A 2HHQA 2BCVA 3SYZA 9ICKA 4Z6EA 3VGLA 3FZHA 3FDSA 4PH5A 4YDUC 1S0MA 3TANA 3K75D 3CC2N 3QEAZ 4KBOA 4CZKA 5CHGA 2I1QA 4YXMA 5J0UA 3CCUN 4O9MA 4BRDA 4FS2A 2QTDA 1S9FA 3FZLA 3CCVN 9ICJA 4JEPA 4WQ4A 1K8KB 1DKGD 3UQ2A 4DQIA 5HOOA 1WCNA 2YJFA 1W97L 3VF6A 1HJPA 1JX4A 1T8EA 3CERA 3OHRA 3HWTA 4QZAA 1KFSA 2ASOA 4FPAA 4EHTA 3CCQN 9ICBA 7ICEA 4IFEA 7ICTA 2MAXA 3OA9A 1ZQHA 4H5RA 3WT0A 3BF3A 3MBYA 2AQ4A 4H0TB 2E2QA 1GLCG 3OHAA 2W9CB 1IM4A 1RYSA 1KAYA 1S3XA 1RDUA 4EYHB 1LB2B 4DSIA 3CQXA 4M2YA 3J8AA 1RXVA 3O5BA 4BXOB 5DG8A 3PVXA 3G25A 1U4BA 3IUCA 4EFHA 1VQ9N 1IJJA 4RNOA 4O5EA 4O3RA 3ZX3A 1NGAA 1YJWN 8ICZA 2R8KA 2FLOA 4BWJA 5KFKA 4O3SA 4RQ5A 4KMUA 3PR5B 8ICRA 3ETLA 2J4RA 2HVHA 4IWVA 3G6EN 3AU6A 1KLNA 3G6VA 2B21A 4QW8A 2E1ZA 3SK3A 2Q0UA 3HI0A 4M6WA 3GIIA 4JWNA 3ZDDA 4QWCA 1XWLA 2PXIA 4PKGA 4DCHA 2J6SA 5JMVA 5IIMA 1BPBA 5J2AA 1UT8A 2HHSA 2PAVA 4KLLA 1ZQGA 4MLHA 4R79A 4JKCA 1ZQJA 3OGUA 1TK8A 1ESVA 4YOUA 4ELVA 1HKCA 4B1UB 7ICLA 7ICFA 3G6XA 4KLJA 3H45C 4PGXA 1MC8A 5KQDA 1X9WA 2FSJA 2BCUA 5KG2A 3O9UA 5CE3A 2CGLA 4JK9A 1K9MO 2YX6A 1L3TA 3RJJA 5AQVA 4YOXA 4HYKA 4AM7A 3WQTA 7ICIA 5KFTA 1WCLA 1TVAA 4YD2A 3QB0A 3RB3A 4MO4A 3TFSA 3ZX2A 3MR3A 9ICTA 5DQIA 3QEBZ 3SAFA 4ED0A 1T3VA 4FWQA 4KLHA 4MFCA 3V6HA 1ATSA 3MX2A 4BG8A 1JJ2M 5M1PA 1VQ8N 1U2VA 5FPMA 1KXPA 5M1FA 3SAGA 1E4GT 3M6GA 4FO0A 3MN7A 1BPDA 4GC6A 4G3IA 2ASPA 1E4FT 3HSCA 1MWMA 1ZQRA 2PFOA 3EE8A 3OBWA 2F1HA 4XUSA 3C23A 3O9QA 3GE1A 2V4QA 2ZUBA 4HWIA 4BRKA 2IIRA 3I33A 3GV7B 3RB4A 3HM8A 3RBEA 4QZCA 4K42A 5GINA 9ICRA 1YVNA 5KT2A 3G6YA 3OSNA 5CHIA 4PL8A 4LZGA 7ICPA 2QA4N 1VAZA 1ZQBA 1HKGA 1LOTB 4WYBA 5L1KA 3QFUA 1BPXA 5AQFA 4RT2A 4DFKA 3RR7A 5KG0A 1B22A 4CZHA 1ZETA 9ICUA 4J9RA 4KH6A 1VQPN 4BR2A 3TTDA 4IQUA 4YDUA 2P9LA 3H46O 4PGQA 4XEIA 2ZF5O 4PHPA 1SAZA 3C2MA 5M1KA 4KLDA 1D8LA 4WFBL 5CR4A 2A41A 3CJBA 3H1QA 3EO3A 5KQ8A 4IJNA 5KFOA 1QVGM 4IRKA 4I2AA 5BN9A 2AGOA 3MWTA 4BRAA 3Q8LA 2P9UB 4I2JA 3HOSA 1ATRA 1NK0A 3BUZB 4QW9A 4B9UA 1ZC6A 4YOWA 3QDKA 9ICQA 3MABA 4KH4A 1EQYA 5CR0A 3Q8SB 3HBTA 5DB8A 3DXMA 4IQTA 4DWIA 3ATVA 5BPNA 1CUKA 4ECYA 3ATUA 3Q7BA 3RJEA 4OPHA 1JCEA 3EZ5A 3UKRB 4RWTA 4JAXA 2ZTCA 1NMDA 2Y1IA 4MO5A 3SMSA 1OKJA 2VWBA 1JCGA 3BQTA 1K1SA 3ISDA 1O13A 5GIPA 3U9DA 3GG4A 4ISGA 5CJ7A 5JVHL 2ZJQL 4B9QA 4CCHA 4QZGA 3C0BA 3QFPA 2ASDA 4BRCA 3WXJA 2A40A 1KTQA 4ECSA 1TYQA 4JKHA 3SBTA 3HP6A 1NK6A 4PHAA 4A59A 1RZTA 5KT6A 4ECUA 1ZQVA 2JZBA 4QZ8A 5IINA 4B1WB 4H5WA 3P4IA 4KTQA 2F1JA 2IVOA 4RQ3A 4JHDB 5MLCQ 4GNIA 5JLFA 4BRIA 4JKBA 3L4QA 4DL2A 8ICPA 1JN3A 1C7YA 2Q97A 2ZJPL 5HHIA 2V7YA 3SAHA 3JPNA 5F0XA 5JUMA 2P9SB 4C8OA 1XSNA 3CCJN 2NNWA 1T44A 3CHWA 1HUZA 3LDQA 1ZQLA 3ULEB 3KHLA 3EZWA 4A5AA 3E9PA 4F4KA 2KZ3A 3UKUA 1BPZA 3CF5L 4UAWA 5BPLA 2BDPA 4BC2A 1HPMA 1T4GA 4Z94A 4BRHA 3CPEA 1NGEA 5KFBA 3CJAA 3A5NC 3QMLA 3H4BA 4J8FA 5M1OA 5KPRA 2A1JB 4DHYA 3MK6A 1Z00A 4R64A 9ICPA 1JCFA 3RTVA 3H7IA 5EOZA 5KFPA 1TUYA 4BRMA 4WQ4C 4H0OA 4F3OA 2JWLA 3CPWM 3CJ7A 3AAQA 5BN8A 4B9LA 2GTDA 1ZQCA 2DPIA 3N97B 7ICQA 5DBAA 1ZQTA 4YXJA 4KITB 3RAQA 2ZJ8A 4IRDA 3DXKB 5AQOA 4XA5A 3MFHA 4K4IA 4MF2A